F489464

General Info

Members Datasets Scaffolds Average Seq Length
1070 375 2140 241

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100011762|Ga0070707_1000117625
Length 275
Sequence MPASKLMTGDRGKAGLNDMASDDGAGGDAVLELNGLSVGYDRAMVVRDLNLTVGHGEVVALLGANGAGKTTTLRAISGLLKHPPGTIRFGGTDLAGVAPTARARLGIAHVPFDRGIFFGLTVAEHFRLDGLSSPAQMDTAFDHFPALRDLRDRKAGLLSGGEQQMLALARALSRTPKLLMLDEMSLGLAPVIVGRLLPVVRDYATSTGTGVLLVEQHVHMALKIADRGYILAHGDLTASGTAESLSKDSALLAASYLGSAAQSSAAESDGRAAAG

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
193 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
194 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
227 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.37
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100011762 3300005468 Bacteria 8167
2 JGI24743J22301_10016999 3300001991 Bacteria 1362
3 Ga0070658_10031578 3300005327 Bacteria 4253
4 Ga0070676_10008579 3300005328 Bacteria 5511
5 Ga0070683_100024182 3300005329 Bacteria 5438
6 Ga0070683_100035573 3300005329 Bacteria 4552
7 Ga0070683_100184669 3300005329 Bacteria 1979
8 Ga0070683_100572869 3300005329 Bacteria 1080
9 Ga0070690_100033637 3300005330 Bacteria 3210
10 Ga0070677_10036674 3300005333 Bacteria 1909
11 Ga0070677_10116912 3300005333 Bacteria 1199
12 Ga0068869_100077105 3300005334 Bacteria 2478
13 Ga0070666_10238638 3300005335 Bacteria 1285
14 Ga0070680_100012784 3300005336 Bacteria 6529
15 Ga0070680_100035628 3300005336 Bacteria 4018
16 Ga0070680_100058113 3300005336 Bacteria 3163
17 Ga0070680_100367038 3300005336 Bacteria 1225
18 Ga0070682_100001115 3300005337 Bacteria 15366
19 Ga0070682_100020568 3300005337 Bacteria 3885
20 Ga0070682_100022722 3300005337 Bacteria 3718
21 Ga0070682_100028402 3300005337 Bacteria 3364
22 Ga0070682_100047731 3300005337 Bacteria 2663
23 Ga0068868_100037538 3300005338 Bacteria 3756
24 Ga0068868_100060994 3300005338 Bacteria 2987
25 Ga0068868_100127828 3300005338 Bacteria 2077
26 Ga0068868_100141468 3300005338 Bacteria 1975
27 Ga0070660_100027045 3300005339 Bacteria 4278
28 Ga0070660_100075574 3300005339 Bacteria 2638
29 Ga0070660_100325809 3300005339 Bacteria 1262
30 Ga0070689_100015483 3300005340 Bacteria 5562
31 Ga0070689_100090077 3300005340 Bacteria 2416
32 Ga0070691_10020124 3300005341 Bacteria 3081
33 Ga0070691_10085721 3300005341 Bacteria 1547
34 Ga0070687_100037843 3300005343 Bacteria 2414
35 Ga0070687_100060290 3300005343 Bacteria 2001
36 Ga0070687_100105148 3300005343 Bacteria 1588
37 Ga0070661_100034847 3300005344 Bacteria 3652
38 Ga0070661_100205317 3300005344 Bacteria 1507
39 Ga0070661_100303886 3300005344 Bacteria 1243
40 Ga0070692_10000680 3300005345 Bacteria 10889
41 Ga0070668_100023742 3300005347 Bacteria 4641
42 Ga0070668_100110219 3300005347 Bacteria 2190
43 Ga0070669_100049735 3300005353 Bacteria 3061
44 Ga0070671_100077520 3300005355 Bacteria 2777
45 Ga0070671_100108597 3300005355 Bacteria 2330
46 Ga0070671_100166425 3300005355 Bacteria 1864
47 Ga0070671_100339114 3300005355 Bacteria 1282
48 Ga0070671_100630215 3300005355 Bacteria 928
49 Ga0070674_100019942 3300005356 Bacteria 4271
50 Ga0070673_100001554 3300005364 Bacteria 13519
51 Ga0070673_100030569 3300005364 Bacteria 4033
52 Ga0070673_100205072 3300005364 Bacteria 1700
53 Ga0070688_100004156 3300005365 Bacteria 7511
54 Ga0070688_100153333 3300005365 Bacteria 1577
55 Ga0070659_100065518 3300005366 Bacteria 2877
56 Ga0070659_100127468 3300005366 Bacteria 2065
57 Ga0070659_100406559 3300005366 Bacteria 1150
58 Ga0070667_100185328 3300005367 Bacteria 1842
59 Ga0070709_10229597 3300005434 Bacteria 1327
60 Ga0070709_10256198 3300005434 Bacteria 1262
61 Ga0070709_10328457 3300005434 Bacteria 1124
62 Ga0070714_100005004 3300005435 Bacteria 10075
63 Ga0070714_100022763 3300005435 Bacteria 5141
64 Ga0070714_100025927 3300005435 Bacteria 4841
65 Ga0070714_100057117 3300005435 Bacteria 3339
66 Ga0070714_100094541 3300005435 Bacteria 2623
67 Ga0070714_100094776 3300005435 Bacteria 2620
68 Ga0070714_100350997 3300005435 Bacteria 1385
69 Ga0070714_100387008 3300005435 Bacteria 1319
70 Ga0070713_100026994 3300005436 Bacteria 4516
71 Ga0070713_100039538 3300005436 Bacteria 3829
72 Ga0070713_100039539 3300005436 Bacteria 3829
73 Ga0070713_100051557 3300005436 Bacteria 3403
74 Ga0070713_100051620 3300005436 Bacteria 3401
75 Ga0070713_100153435 3300005436 Bacteria 2051
76 Ga0070713_100157429 3300005436 Bacteria 2026
77 Ga0070713_100270683 3300005436 Bacteria 1555
78 Ga0070713_100292501 3300005436 Bacteria 1497
79 Ga0070713_100343374 3300005436 Bacteria 1384
80 Ga0070713_100498029 3300005436 Bacteria 1149
81 Ga0070710_10148799 3300005437 Bacteria 1442
82 Ga0070710_10154861 3300005437 Bacteria 1416
83 Ga0070710_10374976 3300005437 Bacteria 948
84 Ga0070701_10001431 3300005438 Bacteria 8831
85 Ga0070701_10015879 3300005438 Bacteria 3488
86 Ga0070701_10030589 3300005438 Bacteria 2665
87 Ga0070701_10106211 3300005438 Bacteria 1562
88 Ga0070711_100078667 3300005439 Bacteria 2344
89 Ga0070711_100108594 3300005439 Bacteria 2033
90 Ga0070711_100211749 3300005439 Bacteria 1501
91 Ga0070700_100006064 3300005441 Bacteria 6436
92 Ga0070694_100019267 3300005444 Bacteria 4338
93 Ga0070694_100260119 3300005444 Bacteria 1316
94 Ga0070694_100297064 3300005444 Bacteria 1236
95 Ga0070708_100032029 3300005445 Bacteria 4556
96 Ga0070663_100010363 3300005455 Bacteria 5808
97 Ga0070663_100017685 3300005455 Bacteria 4657
98 Ga0070663_100029866 3300005455 Bacteria 3729
99 Ga0070663_100374628 3300005455 Bacteria 1158
100 Ga0070678_100001369 3300005456 Bacteria 12966
101 Ga0070678_100016846 3300005456 Bacteria 4686
102 Ga0070678_100172324 3300005456 Bacteria 1764
103 Ga0070662_100116871 3300005457 Bacteria 2039
104 Ga0070662_100125211 3300005457 Bacteria 1975
105 Ga0070681_10018491 3300005458 Bacteria 6965
106 Ga0070681_10041048 3300005458 Bacteria 4637
107 Ga0070681_10073782 3300005458 Bacteria 3374
108 Ga0070681_10092314 3300005458 Bacteria 2977
109 Ga0070681_10110043 3300005458 Bacteria 2695
110 Ga0068867_100110155 3300005459 Bacteria 2115
111 Ga0068867_100452683 3300005459 Bacteria 1094
112 Ga0070685_10002395 3300005466 Bacteria 9653
113 Ga0070706_100009548 3300005467 Bacteria 9020
114 Ga0070706_100619061 3300005467 Bacteria 1005
115 Ga0070707_100336942 3300005468 Bacteria 1465
116 Ga0070698_100001275 3300005471 Bacteria 28146
117 Ga0070698_100176229 3300005471 Bacteria 2077
118 Ga0070699_100012479 3300005518 Bacteria 7333
119 Ga0070699_100053961 3300005518 Bacteria 3479
120 Ga0070699_100057204 3300005518 Bacteria 3378
121 Ga0070679_100023595 3300005530 Bacteria 6024
122 Ga0070679_100030247 3300005530 Bacteria 5346
123 Ga0070679_100047803 3300005530 Bacteria 4264
124 Ga0070679_100061319 3300005530 Bacteria 3748
125 Ga0070679_100124243 3300005530 Bacteria 2563
126 Ga0070684_100000984 3300005535 Bacteria 20350
127 Ga0070684_100009376 3300005535 Bacteria 7707
128 Ga0070684_100038452 3300005535 Bacteria 4110
129 Ga0070684_100038871 3300005535 Bacteria 4090
130 Ga0070684_100071619 3300005535 Bacteria 3050
131 Ga0070684_100094680 3300005535 Bacteria 2660
132 Ga0070684_100183198 3300005535 Bacteria 1904
133 Ga0070684_100240561 3300005535 Bacteria 1654
134 Ga0070684_100542580 3300005535 Bacteria 1079
135 Ga0070684_100727333 3300005535 Bacteria 926
136 Ga0070697_100037905 3300005536 Bacteria 3893
137 Ga0068853_100087029 3300005539 Bacteria 2741
138 Ga0068853_100087337 3300005539 Bacteria 2736
139 Ga0070672_100063501 3300005543 Bacteria 2916
140 Ga0070672_100068531 3300005543 Bacteria 2814
141 Ga0070672_100110123 3300005543 Bacteria 2243
142 Ga0070686_100015215 3300005544 Bacteria 4449
143 Ga0070695_100020800 3300005545 Bacteria 4009
144 Ga0070695_100349009 3300005545 Bacteria 1108
145 Ga0070696_100053705 3300005546 Bacteria 2805
146 Ga0070696_100053925 3300005546 Bacteria 2800
147 Ga0070693_100024538 3300005547 Bacteria 3234
148 Ga0070693_100091457 3300005547 Bacteria 1835
149 Ga0070665_100000229 3300005548 Bacteria 93160
150 Ga0070704_100012165 3300005549 Bacteria 5310
151 Ga0070704_100044570 3300005549 Bacteria 3083
152 Ga0070704_100228210 3300005549 Bacteria 1517
153 Ga0070704_100768533 3300005549 Bacteria 859
154 Ga0068855_100060592 3300005563 Bacteria 4425
155 Ga0068855_100221308 3300005563 Bacteria 2122
156 Ga0070664_100078501 3300005564 Bacteria 2840
157 Ga0070664_100154334 3300005564 Bacteria 2028
158 Ga0070664_100382570 3300005564 Bacteria 1285
159 Ga0070664_100409649 3300005564 Bacteria 1240
160 Ga0070664_100434506 3300005564 Bacteria 1203
161 Ga0068857_100058441 3300005577 Bacteria 3424
162 Ga0068857_100070329 3300005577 Bacteria 3117
163 Ga0068857_100100905 3300005577 Bacteria 2589
164 Ga0068857_100605308 3300005577 Bacteria 1036
165 Ga0068857_100747016 3300005577 Bacteria 932
166 Ga0068857_100952259 3300005577 Bacteria 825
167 Ga0068854_100039289 3300005578 Bacteria 3333
168 Ga0068854_100203701 3300005578 Bacteria 1557
169 Ga0068856_100004569 3300005614 Bacteria 13754
170 Ga0068856_100022506 3300005614 Bacteria 6128
171 Ga0068856_100029150 3300005614 Bacteria 5391
172 Ga0068856_100110195 3300005614 Bacteria 2750
173 Ga0068856_100142010 3300005614 Bacteria 2408
174 Ga0068856_100303864 3300005614 Bacteria 1613
175 Ga0068856_100383617 3300005614 Bacteria 1424
176 Ga0068856_100415210 3300005614 Bacteria 1366
177 Ga0070702_100010375 3300005615 Bacteria 4586
178 Ga0070702_100032844 3300005615 Bacteria 2850
179 Ga0070702_100418455 3300005615 Bacteria 963
180 Ga0068852_100039903 3300005616 Bacteria 3956
181 Ga0068852_100392579 3300005616 Bacteria 1363
182 Ga0068859_100027634 3300005617 Bacteria 5690
183 Ga0068859_100074258 3300005617 Bacteria 3439
184 Ga0068859_100114632 3300005617 Bacteria 2759
185 Ga0068864_100009949 3300005618 Bacteria 7845
186 Ga0068864_100061923 3300005618 Bacteria 3241
187 Ga0068866_10042518 3300005718 Bacteria 2262
188 Ga0068861_100024174 3300005719 Bacteria 4391
189 Ga0068861_100139915 3300005719 Bacteria 1974
190 Ga0068861_100408658 3300005719 Bacteria 1207
191 Ga0068851_10069990 3300005834 Bacteria 1813
192 Ga0068870_10023183 3300005840 Bacteria 3059
193 Ga0068870_10101084 3300005840 Bacteria 1629
194 Ga0068863_100134075 3300005841 Bacteria 2366
195 Ga0068858_100025876 3300005842 Bacteria 5457
196 Ga0068858_100212244 3300005842 Bacteria 1832
197 Ga0068858_100399964 3300005842 Bacteria 1320
198 Ga0068858_100415415 3300005842 Bacteria 1293
199 Ga0068860_100086887 3300005843 Bacteria 2976
200 Ga0068862_100091412 3300005844 Bacteria 2651
201 Ga0068862_100208837 3300005844 Bacteria 1764
202 Ga0081455_10010765 3300005937 Bacteria 9242
203 Ga0081455_10049660 3300005937 Bacteria 3615
204 Ga0081455_10220883 3300005937 Bacteria 1404
205 Ga0081538_10002360 3300005981 Bacteria 18572
206 Ga0081540_1000469 3300005983 Bacteria 39957
207 Ga0081540_1000812 3300005983 Bacteria 28585
208 Ga0081539_10001611 3300005985 Bacteria 37114
209 Ga0081539_10020745 3300005985 Bacteria 4424
210 Ga0070717_10048480 3300006028 Bacteria 3484
211 Ga0070717_10141101 3300006028 Bacteria 2078
212 Ga0070717_10170334 3300006028 Bacteria 1893
213 Ga0070717_10472630 3300006028 Bacteria 1131
214 Ga0075432_10036537 3300006058 Bacteria 1708
215 Ga0070715_10012008 3300006163 Bacteria 3136
216 Ga0070715_10016284 3300006163 Bacteria 2791
217 Ga0070716_100152699 3300006173 Bacteria 1487
218 Ga0070716_100510662 3300006173 Bacteria 888
219 Ga0070712_100034813 3300006175 Bacteria 3414
220 Ga0070712_100050549 3300006175 Bacteria 2892
221 Ga0070712_100182249 3300006175 Bacteria 1637
222 Ga0070712_100211567 3300006175 Bacteria 1529
223 Ga0070712_100329074 3300006175 Bacteria 1244
224 Ga0097621_100061326 3300006237 Bacteria 3084
225 Ga0097621_100104322 3300006237 Bacteria 2389
226 Ga0097621_100132424 3300006237 Bacteria 2123
227 Ga0068871_100011741 3300006358 Bacteria 6434
228 Ga0068871_100149106 3300006358 Bacteria 1993
229 Ga0075430_100048618 3300006846 Bacteria 3581
230 Ga0075430_100049684 3300006846 Bacteria 3539
231 Ga0075431_100035661 3300006847 Bacteria 5121
232 Ga0075429_100023734 3300006880 Bacteria 5322
233 Ga0068865_100030003 3300006881 Bacteria 3613
234 Ga0068865_100117910 3300006881 Bacteria 1969
235 Ga0068865_100196425 3300006881 Bacteria 1564
236 Ga0068865_100221316 3300006881 Bacteria 1480
237 Ga0075436_100050805 3300006914 Bacteria 2861
238 Ga0075436_100073444 3300006914 Bacteria 2367
239 Ga0075436_100493713 3300006914 Bacteria 895
240 Ga0097620_100027634 3300006931 Bacteria 5690
241 Ga0097620_100074256 3300006931 Bacteria 3439
242 Ga0097620_100114626 3300006931 Bacteria 2759
243 Ga0105251_10032807 3300009011 Bacteria 2584
244 Ga0105240_10378177 3300009093 Bacteria 1600
245 Ga0111539_10242722 3300009094 Bacteria 2097
246 Ga0111539_10745746 3300009094 Bacteria 1140
247 Ga0111539_11063826 3300009094 Bacteria 940
248 Ga0111539_11168891 3300009094 Bacteria 894
249 Ga0105245_10012593 3300009098 Bacteria 7362
250 Ga0105245_10047590 3300009098 Bacteria 3834
251 Ga0105245_10428957 3300009098 Bacteria 1326
252 Ga0105247_10002030 3300009101 Bacteria 14021
253 Ga0105247_10008171 3300009101 Bacteria 6390
254 Ga0105247_10081893 3300009101 Bacteria 2036
255 Ga0105247_10195441 3300009101 Bacteria 1356
256 Ga0114129_10104431 3300009147 Bacteria 3916
257 Ga0114129_10184702 3300009147 Bacteria 2835
258 Ga0105243_10005206 3300009148 Bacteria 10174
259 Ga0105243_10015264 3300009148 Bacteria 5812
260 Ga0105243_10024764 3300009148 Bacteria 4581
261 Ga0105241_10063879 3300009174 Bacteria 2841
262 Ga0105241_10087154 3300009174 Bacteria 2457
263 Ga0105241_10404025 3300009174 Bacteria 1199
264 Ga0105242_10005941 3300009176 Bacteria 9415
265 Ga0105242_10022342 3300009176 Bacteria 4973
266 Ga0105242_10063862 3300009176 Bacteria 3033
267 Ga0105248_10017616 3300009177 Bacteria 7880
268 Ga0105248_10225789 3300009177 Bacteria 2108
269 Ga0105248_10244377 3300009177 Bacteria 2020
270 Ga0105237_10374267 3300009545 Bacteria 1429
271 Ga0105237_10861161 3300009545 Bacteria 913
272 Ga0105238_10454333 3300009551 Bacteria 1278
273 Ga0105249_10044630 3300009553 Bacteria 4030
274 Ga0105249_10046893 3300009553 Bacteria 3935
275 Ga0105249_10339298 3300009553 Bacteria 1519
276 Ga0105249_10395801 3300009553 Bacteria 1411
277 Ga0105249_10729413 3300009553 Bacteria 1052
278 Ga0105239_10180973 3300010375 Bacteria 2359
279 Ga0105239_10550633 3300010375 Bacteria 1314
280 Ga0105239_11309907 3300010375 Bacteria 836
281 Ga0105246_10012761 3300011119 Bacteria 5250
282 Ga0157338_1000598 3300012515 Bacteria 2215
283 Ga0157373_10069495 3300013100 Bacteria 2490
284 Ga0157373_10075509 3300013100 Bacteria 2378
285 Ga0157373_10083384 3300013100 Bacteria 2253
286 Ga0157370_10110439 3300013104 Bacteria 2570
287 Ga0157370_10111214 3300013104 Bacteria 2561
288 Ga0157370_10571624 3300013104 Bacteria 1036
289 Ga0157369_10054340 3300013105 Bacteria 4325
290 Ga0157369_10077101 3300013105 Bacteria 3572
291 Ga0157369_10094244 3300013105 Bacteria 3196
292 Ga0157374_10039166 3300013296 Bacteria 4362
293 Ga0157374_10410258 3300013296 Bacteria 1352
294 Ga0157374_10547990 3300013296 Bacteria 1164
295 Ga0157378_10003662 3300013297 Bacteria 13617
296 Ga0157378_10464488 3300013297 Bacteria 1258
297 Ga0163162_10026748 3300013306 Bacteria 5704
298 Ga0163162_10056403 3300013306 Bacteria 3956
299 Ga0163162_10354346 3300013306 Bacteria 1600
300 Ga0157372_10259460 3300013307 Bacteria 2018
301 Ga0157372_10370018 3300013307 Bacteria 1670
302 Ga0157372_10549287 3300013307 Bacteria 1346
303 Ga0157372_10584689 3300013307 Bacteria 1301
304 Ga0157375_10010929 3300013308 Bacteria 8007
305 Ga0157375_10026169 3300013308 Bacteria 5433
306 Ga0157375_10148515 3300013308 Bacteria 2477
307 Ga0157375_10363253 3300013308 Bacteria 1614
308 Ga0163163_10009970 3300014325 Bacteria 8518
309 Ga0163163_10054030 3300014325 Bacteria 3966
310 Ga0163163_10254305 3300014325 Bacteria 1807
311 Ga0163163_10680464 3300014325 Bacteria 1092
312 Ga0157380_10054718 3300014326 Bacteria 3167
313 Ga0157380_10066621 3300014326 Bacteria 2897
314 Ga0157380_10663072 3300014326 Bacteria 1043
315 Ga0182008_10221690 3300014497 Bacteria 968
316 Ga0157377_10044800 3300014745 Bacteria 2468
317 Ga0157377_10054184 3300014745 Bacteria 2270
318 Ga0157379_10000752 3300014968 Bacteria 26221
319 Ga0157379_10018107 3300014968 Bacteria 6207
320 Ga0157379_10178207 3300014968 Bacteria 1920
321 Ga0157379_10742799 3300014968 Bacteria 923
322 Ga0206356_11776078 3300020070 Bacteria 1534
323 Ga0206350_10369510 3300020080 Bacteria 2172
324 Ga0206354_10648326 3300020081 Bacteria 2693
325 Ga0206353_11975746 3300020082 Bacteria 2222
326 Ga0213873_10066712 3300021358 Bacteria 984
327 Ga0213874_10024128 3300021377 Bacteria 1702
328 Ga0213876_10004367 3300021384 Bacteria 7918
329 Ga0213875_10044787 3300021388 Bacteria 2077
330 Ga0213875_10058979 3300021388 Bacteria 1797
331 Ga0213875_10153172 3300021388 Bacteria 1081
332 Ga0224712_10014237 3300022467 Bacteria 2555
333 Ga0224712_10181362 3300022467 Bacteria 949
334 Ga0224712_10240029 3300022467 Bacteria 834
335 Ga0228598_1018640 3300024227 Bacteria 1370
336 Ga0207656_10047327 3300025321 Bacteria 1848
337 Ga0207653_10017181 3300025885 Bacteria 2275
338 Ga0207682_10012745 3300025893 Bacteria 3280
339 Ga0207692_10107792 3300025898 Bacteria 1540
340 Ga0207692_10209091 3300025898 Bacteria 1151
341 Ga0207642_10211688 3300025899 Bacteria 1077
342 Ga0207710_10012716 3300025900 Bacteria 3543
343 Ga0207710_10013223 3300025900 Bacteria 3478
344 Ga0207710_10178948 3300025900 Bacteria 1040
345 Ga0207688_10007413 3300025901 Bacteria 5974
346 Ga0207680_10131229 3300025903 Bacteria 1652
347 Ga0207647_10062932 3300025904 Bacteria 2258
348 Ga0207647_10164347 3300025904 Bacteria 1294
349 Ga0207699_10010248 3300025906 Bacteria 4695
350 Ga0207699_10018608 3300025906 Bacteria 3684
351 Ga0207699_10022468 3300025906 Bacteria 3418
352 Ga0207699_10161454 3300025906 Bacteria 1492
353 Ga0207699_10178569 3300025906 Bacteria 1425
354 Ga0207645_10165547 3300025907 Bacteria 1448
355 Ga0207643_10001157 3300025908 Bacteria 15664
356 Ga0207643_10022072 3300025908 Bacteria 3502
357 Ga0207705_10034857 3300025909 Bacteria 3599
358 Ga0207705_10089308 3300025909 Bacteria 2255
359 Ga0207705_10122297 3300025909 Bacteria 1932
360 Ga0207684_10011968 3300025910 Bacteria 7557
361 Ga0207684_10618645 3300025910 Bacteria 924
362 Ga0207654_10089087 3300025911 Bacteria 1876
363 Ga0207654_10120824 3300025911 Bacteria 1644
364 Ga0207654_10161561 3300025911 Bacteria 1448
365 Ga0207707_10031202 3300025912 Bacteria 4662
366 Ga0207707_10073020 3300025912 Bacteria 2991
367 Ga0207707_10204816 3300025912 Bacteria 1719
368 Ga0207707_10423314 3300025912 Bacteria 1141
369 Ga0207695_10095283 3300025913 Bacteria 2981
370 Ga0207695_10295412 3300025913 Bacteria 1512
371 Ga0207671_10130171 3300025914 Bacteria 1931
372 Ga0207693_10003910 3300025915 Bacteria 12684
373 Ga0207693_10044334 3300025915 Bacteria 3496
374 Ga0207693_10144949 3300025915 Bacteria 1868
375 Ga0207693_10168853 3300025915 Bacteria 1723
376 Ga0207693_10300741 3300025915 Bacteria 1257
377 Ga0207663_10275184 3300025916 Bacteria 1249
378 Ga0207663_10306382 3300025916 Bacteria 1189
379 Ga0207663_10317760 3300025916 Bacteria 1169
380 Ga0207660_10007118 3300025917 Bacteria 7246
381 Ga0207662_10003814 3300025918 Bacteria 7827
382 Ga0207662_10020825 3300025918 Bacteria 3743
383 Ga0207662_10074091 3300025918 Bacteria 2066
384 Ga0207662_10185373 3300025918 Bacteria 1341
385 Ga0207657_10011229 3300025919 Bacteria 8901
386 Ga0207657_10018249 3300025919 Bacteria 6709
387 Ga0207657_10028393 3300025919 Bacteria 5104
388 Ga0207657_10126865 3300025919 Bacteria 2095
389 Ga0207657_10175356 3300025919 Bacteria 1735
390 Ga0207652_10008008 3300025921 Bacteria 8481
391 Ga0207652_10011450 3300025921 Bacteria 7150
392 Ga0207652_10018135 3300025921 Bacteria 5769
393 Ga0207652_10051214 3300025921 Bacteria 3539
394 Ga0207646_10025845 3300025922 Bacteria 5368
395 Ga0207646_10451319 3300025922 Bacteria 1160
396 Ga0207694_10426383 3300025924 Bacteria 1105
397 Ga0207687_10002244 3300025927 Bacteria 13162
398 Ga0207687_10010596 3300025927 Bacteria 6026
399 Ga0207687_10174584 3300025927 Bacteria 1660
400 Ga0207687_10325924 3300025927 Bacteria 1245
401 Ga0207687_10442461 3300025927 Bacteria 1077
402 Ga0207700_10017698 3300025928 Bacteria 4766
403 Ga0207700_10059904 3300025928 Bacteria 2881
404 Ga0207700_10076050 3300025928 Bacteria 2604
405 Ga0207700_10140372 3300025928 Bacteria 1985
406 Ga0207700_10156089 3300025928 Bacteria 1891
407 Ga0207700_10238388 3300025928 Bacteria 1549
408 Ga0207700_10296916 3300025928 Bacteria 1394
409 Ga0207700_10832675 3300025928 Bacteria 825
410 Ga0207664_10009299 3300025929 Bacteria 6891
411 Ga0207664_10039978 3300025929 Bacteria 3643
412 Ga0207664_10074329 3300025929 Bacteria 2745
413 Ga0207664_10111497 3300025929 Bacteria 2276
414 Ga0207664_10156300 3300025929 Bacteria 1942
415 Ga0207664_10282318 3300025929 Bacteria 1457
416 Ga0207664_10373641 3300025929 Bacteria 1265
417 Ga0207644_10715561 3300025931 Bacteria 835
418 Ga0207690_10046198 3300025932 Bacteria 2883
419 Ga0207690_10365221 3300025932 Bacteria 1144
420 Ga0207706_10004493 3300025933 Bacteria 13096
421 Ga0207706_10011072 3300025933 Bacteria 8221
422 Ga0207706_10168597 3300025933 Bacteria 1924
423 Ga0207706_10435728 3300025933 Bacteria 1135
424 Ga0207686_10030176 3300025934 Bacteria 3207
425 Ga0207686_10139505 3300025934 Bacteria 1673
426 Ga0207709_10061991 3300025935 Bacteria 2339
427 Ga0207709_10120750 3300025935 Bacteria 1769
428 Ga0207709_10195992 3300025935 Bacteria 1439
429 Ga0207709_10220045 3300025935 Bacteria 1369
430 Ga0207670_10120498 3300025936 Bacteria 1906
431 Ga0207670_10278271 3300025936 Bacteria 1303
432 Ga0207669_10013094 3300025937 Bacteria 4106
433 Ga0207704_10019367 3300025938 Bacteria 3572
434 Ga0207704_10175373 3300025938 Bacteria 1543
435 Ga0207665_10006692 3300025939 Bacteria 7649
436 Ga0207665_10035589 3300025939 Bacteria 3306
437 Ga0207665_10060505 3300025939 Bacteria 2565
438 Ga0207691_10005186 3300025940 Bacteria 12580
439 Ga0207691_10011648 3300025940 Bacteria 8443
440 Ga0207691_10075507 3300025940 Bacteria 3039
441 Ga0207691_10088284 3300025940 Bacteria 2781
442 Ga0207711_10046170 3300025941 Bacteria 3722
443 Ga0207711_10714960 3300025941 Bacteria 934
444 Ga0207689_10005938 3300025942 Bacteria 10810
445 Ga0207689_10056182 3300025942 Bacteria 3239
446 Ga0207661_10006689 3300025944 Bacteria 8155
447 Ga0207661_10008139 3300025944 Bacteria 7483
448 Ga0207661_10011085 3300025944 Bacteria 6515
449 Ga0207661_10048471 3300025944 Bacteria 3376
450 Ga0207661_10140041 3300025944 Bacteria 2081
451 Ga0207661_10181786 3300025944 Bacteria 1837
452 Ga0207661_10263189 3300025944 Bacteria 1537
453 Ga0207661_10680109 3300025944 Bacteria 946
454 Ga0207661_10790796 3300025944 Bacteria 873
455 Ga0207679_10063765 3300025945 Bacteria 2752
456 Ga0207679_10070065 3300025945 Bacteria 2641
457 Ga0207679_10280931 3300025945 Bacteria 1428
458 Ga0207651_10278414 3300025960 Bacteria 1381
459 Ga0207651_10335663 3300025960 Bacteria 1268
460 Ga0207712_10028737 3300025961 Bacteria 3722
461 Ga0207712_10029993 3300025961 Bacteria 3654
462 Ga0207712_10236286 3300025961 Bacteria 1470
463 Ga0207640_10222441 3300025981 Bacteria 1446
464 Ga0207677_10018844 3300026023 Bacteria 4153
465 Ga0207677_10034224 3300026023 Bacteria 3288
466 Ga0207677_10048307 3300026023 Bacteria 2865
467 Ga0207703_10212277 3300026035 Bacteria 1726
468 Ga0207703_10246482 3300026035 Bacteria 1608
469 Ga0207703_10601427 3300026035 Bacteria 1040
470 Ga0207639_10051429 3300026041 Bacteria 3133
471 Ga0207639_10180438 3300026041 Bacteria 1795
472 Ga0207678_10012261 3300026067 Bacteria 7527
473 Ga0207678_10020413 3300026067 Bacteria 5811
474 Ga0207678_10053919 3300026067 Bacteria 3464
475 Ga0207678_10119930 3300026067 Bacteria 2245
476 Ga0207708_10004717 3300026075 Bacteria 10026
477 Ga0207708_10015717 3300026075 Bacteria 5679
478 Ga0207702_10027114 3300026078 Bacteria 4757
479 Ga0207702_10052244 3300026078 Bacteria 3457
480 Ga0207702_10170316 3300026078 Bacteria 1996
481 Ga0207702_10264670 3300026078 Bacteria 1620
482 Ga0207702_10379475 3300026078 Bacteria 1359
483 Ga0207641_10105064 3300026088 Bacteria 2494
484 Ga0207641_10135214 3300026088 Bacteria 2218
485 Ga0207648_10006493 3300026089 Bacteria 11612
486 Ga0207648_10070622 3300026089 Bacteria 3044
487 Ga0207648_10080988 3300026089 Bacteria 2832
488 Ga0207648_10304609 3300026089 Bacteria 1429
489 Ga0207676_10015899 3300026095 Bacteria 5442
490 Ga0207674_10015365 3300026116 Bacteria 8412
491 Ga0207674_10033304 3300026116 Bacteria 5395
492 Ga0207674_10041037 3300026116 Bacteria 4788
493 Ga0207674_10060000 3300026116 Bacteria 3848
494 Ga0207674_10098775 3300026116 Bacteria 2902
495 Ga0207674_10300387 3300026116 Bacteria 1554
496 Ga0207674_10411416 3300026116 Bacteria 1307
497 Ga0207675_100005731 3300026118 Bacteria 11885
498 Ga0207675_100018410 3300026118 Bacteria 6513
499 Ga0207675_100069644 3300026118 Bacteria 3288
500 Ga0207675_100616277 3300026118 Bacteria 1089
501 Ga0207675_100767649 3300026118 Bacteria 976
502 Ga0207683_10000149 3300026121 Bacteria 57867
503 Ga0207683_10020233 3300026121 Bacteria 5690
504 Ga0207683_10021451 3300026121 Bacteria 5530
505 Ga0207683_10023650 3300026121 Bacteria 5286
506 Ga0207683_10037161 3300026121 Bacteria 4241
507 Ga0207683_10151618 3300026121 Bacteria 2092
508 Ga0207683_10404871 3300026121 Bacteria 1255
509 Ga0207698_10023386 3300026142 Bacteria 4316
510 Ga0207428_10309785 3300027907 Bacteria 1167
511 Ga0268266_10010760 3300028379 Bacteria 7971
512 Ga0268266_10221568 3300028379 Bacteria 1739
513 Ga0268265_10121865 3300028380 Bacteria 2150
514 Ga0268265_10193869 3300028380 Bacteria 1757
515 Ga0268265_10773261 3300028380 Bacteria 934
516 Ga0268264_10059288 3300028381 Bacteria 3207
517 Ga0268264_10827504 3300028381 Bacteria 926
518 Ga0265337_1000276 3300028556 Bacteria 28064
519 Ga0265326_10002480 3300028558 Bacteria 6217
520 Ga0265319_1005034 3300028563 Bacteria 6428
521 Ga0265334_10000924 3300028573 Bacteria 14626
522 Ga0265318_10007416 3300028577 Bacteria 4958
523 Ga0265323_10007197 3300028653 Bacteria 4639
524 Ga0265336_10010553 3300028666 Bacteria 3163
525 Ga0265338_10002647 3300028800 Bacteria 26361
526 Ga0265324_10001566 3300029957 Bacteria 12763
527 Ga0265332_10015019 3300031238 Bacteria 3422
528 Ga0265320_10004570 3300031240 Bacteria 9052
529 Ga0265325_10113760 3300031241 Bacteria 1312
530 Ga0265340_10002012 3300031247 Bacteria 11633
531 Ga0265316_10016656 3300031344 Bacteria 6371
532 Ga0265313_10037779 3300031595 Bacteria 2411
533 Ga0265314_10007805 3300031711 Bacteria 9247
534 Ga0265342_10001356 3300031712 Bacteria 22912
535 Ga0307410_10009428 3300031852 Bacteria 5474
536 Ga0307406_10013868 3300031901 Bacteria 4626
537 Ga0307406_10015209 3300031901 Bacteria 4448
538 Ga0307406_10497204 3300031901 Bacteria 988
539 Ga0307407_10130883 3300031903 Bacteria 1605
540 Ga0307412_10086380 3300031911 Bacteria 2183
541 Ga0307409_100006151 3300031995 Bacteria 7019
542 Ga0307416_100000255 3300032002 Bacteria 28483
543 Ga0307416_100104350 3300032002 Bacteria 2478
544 Ga0307411_10271050 3300032005 Bacteria 1346
545 Ga0307415_100036731 3300032126 Bacteria 3213
546 Ga0307415_100218476 3300032126 Bacteria 1526
547 Ga0373950_0033451 3300034818 Bacteria 960
548 Ga0373959_0035232 3300034820 Bacteria 1028
549 Ga0373938_0029736 3300034957 Bacteria 1162
550 Ga0373926_0002013 3300035083 Bacteria 6386
551 Ga0373926_0024005 3300035083 Bacteria 2120
552 Ga0373928_0016047 3300035084 Bacteria 1529
553 Ga0373928_0016437 3300035084 Bacteria 1515
554 Ga0373929_0003342 3300035085 Bacteria 2897
555 Ga0373934_0013897 3300035086 Bacteria 3046
556 Ga0373934_0022778 3300035086 Bacteria 2417
557 Ga0373934_0097921 3300035086 Bacteria 1185
558 Ga0373940_0005434 3300035088 Bacteria 2761
559 Ga0373944_0000389 3300035089 Bacteria 9976
560 Ga0373944_0058347 3300035089 Bacteria 1232
561 Ga0373951_0003925 3300035091 Bacteria 3574
562 Ga0373951_0057217 3300035091 Bacteria 970
563 Ga0373952_0036385 3300035092 Bacteria 1118
564 Ga0373923_0030923 3300035111 Bacteria 2155
565 Ga0373932_0010739 3300035112 Bacteria 2223
566 Ga0373936_0000112 3300035113 Bacteria 28228
567 Ga0373936_0003805 3300035113 Bacteria 5683
568 Ga0373936_0049321 3300035113 Bacteria 1700
569 Ga0373939_0035228 3300035114 Bacteria 1473
570 Ga0373939_0038491 3300035114 Bacteria 1427
571 Ga0373941_0018484 3300035115 Bacteria 1927
572 Ga0373945_0000180 3300035116 Bacteria 16902
573 Ga0373945_0000291 3300035116 Bacteria 14209
574 Ga0373953_0006891 3300035117 Bacteria 3773
575 Ga0373953_0022773 3300035117 Bacteria 2365
576 Ga0373953_0047343 3300035117 Bacteria 1729
577 Ga0373953_0094796 3300035117 Bacteria 1251
578 Ga0373954_0002644 3300035118 Bacteria 7541
579 Ga0373954_0043591 3300035118 Bacteria 2092
580 Ga0373954_0123113 3300035118 Bacteria 1260
581 Ga0373956_0006193 3300035119 Bacteria 4786
582 Ga0373956_0023950 3300035119 Bacteria 2625
583 Ga0373956_0039319 3300035119 Bacteria 2096
584 Ga0373957_0007283 3300035120 Bacteria 3536
585 Ga0373957_0024728 3300035120 Bacteria 2159
586 Ga0373957_0045928 3300035120 Bacteria 1656
587 Ga0373960_0007606 3300035121 Bacteria 2573
588 Ga0373960_0014262 3300035121 Bacteria 2010
589 Ga0373943_0000414 3300035170 Bacteria 18003
590 Ga0373943_0102659 3300035170 Bacteria 1498
591 Ga0373946_0001584 3300035171 Bacteria 7925
592 Ga0373946_0012759 3300035171 Bacteria 3149
593 Ga0373955_0007888 3300035172 Bacteria 4914
594 Ga0373955_0009588 3300035172 Bacteria 4543
595 Ga0373955_0023895 3300035172 Bacteria 3119
596 Ga0373955_0031220 3300035172 Bacteria 2789
597 Ga0373955_0043271 3300035172 Bacteria 2422
598 Ga0373961_0096510 3300035241 Bacteria 951
599 Ga0373962_0013383 3300035242 Bacteria 2077
600 Ga0373962_0052454 3300035242 Bacteria 1178
601 Ga0373924_0011007 3300035410 Bacteria 3351
602 Ga0373924_0050274 3300035410 Bacteria 1726
603 Ga0373931_0069160 3300035691 Bacteria 1923
604 Ga0373935_0000268 3300035692 Bacteria 25733
605 Ga0373935_0025301 3300035692 Bacteria 3658
606 Ga0373927_0005354 3300035695 Bacteria 8866
607 Ga0373927_0006642 3300035695 Bacteria 7872
608 Ga0373933_0070781 3300035724 Bacteria 2122
609 Ga0373933_0089801 3300035724 Bacteria 1894
610 Ga0373933_0249670 3300035724 Bacteria 1142
611 Ga0373947_0000374 3300035725 Bacteria 25329
612 Ga0373947_0001684 3300035725 Bacteria 13542
613 Ga0373937_0005834 3300036401 Bacteria 10587
614 Ga0373937_0080506 3300036401 Bacteria 3012
615 Ga0373937_0218168 3300036401 Bacteria 1795
616 Ga0373937_0558360 3300036401 Bacteria 1087
617 Ga0373925_0000366 3300037068 Bacteria 47068
618 Ga0373925_0004028 3300037068 Bacteria 11169
619 Ga0373925_0032104 3300037068 Bacteria 3863
620 Ga0395898_0219790 3300037466 Bacteria 1812
621 Ga0395898_0753429 3300037466 Bacteria 915
622 Ga0395905_0239273 3300037471 Bacteria 1697
623 Ga0395905_0613392 3300037471 Bacteria 990
624 Ga0436364_0099500 3300037853 Bacteria 7864
625 Ga0436364_0274704 3300037853 Bacteria 15930
626 Ga0436364_1049383 3300037853 Bacteria 1991
627 Ga0436364_1304558 3300037853 Bacteria 2248
628 Ga0436364_1394580 3300037853 Bacteria 9566
629 Ga0395901_0262301 3300038443 Bacteria 1798
630 Ga0436365_0080097 3300039437 Bacteria 4156
631 Ga0436365_0226989 3300039437 Bacteria 10155
632 Ga0436365_0445234 3300039437 Bacteria 18009
633 Ga0436365_1235428 3300039437 Bacteria 2976
634 Ga0436363_0230425 3300039450 Bacteria 32869
635 Ga0436362_1304003 3300039453 Bacteria 1408
636 Ga0439461_0026884 3300041410 Bacteria 1177
637 Ga0466963_0149897 3300044694 Bacteria 1619
638 Ga0466963_0190038 3300044694 Bacteria 1434
639 Ga0466960_0122728 3300044901 Bacteria 1362
640 Ga0466958_0063911 3300045836 Bacteria 2245
641 Ga0466967_0006871 3300045976 Bacteria 8124
642 Ga0466967_0016490 3300045976 Bacteria 5829
643 Ga0466967_0027220 3300045976 Bacteria 4753
644 Ga0466967_0598337 3300045976 Bacteria 1088
645 Ga0495592_0014225 3300046454 Bacteria 6045
646 Ga0495592_0065139 3300046454 Bacteria 2669
647 Ga0495592_0168597 3300046454 Bacteria 1501
648 Ga0495592_0261188 3300046454 Bacteria 1140
649 Ga0495592_0344915 3300046454 Bacteria 956
650 Ga0495603_0000607 3300046455 Bacteria 20137
651 Ga0495603_0087045 3300046455 Bacteria 1828
652 Ga0495629_0020484 3300046459 Bacteria 4721
653 Ga0495641_0018052 3300046461 Bacteria 3653
654 Ga0495641_0039112 3300046461 Bacteria 2213
655 Ga0495641_0112430 3300046461 Bacteria 1215
656 Ga0495651_0002244 3300046462 Bacteria 14923
657 Ga0495651_0009366 3300046462 Bacteria 7518
658 Ga0495651_0099224 3300046462 Bacteria 2172
659 Ga0495651_0168098 3300046462 Bacteria 1564
660 Ga0495653_0000846 3300046463 Bacteria 23582
661 Ga0495653_0002582 3300046463 Bacteria 14424
662 Ga0495653_0016716 3300046463 Bacteria 5971
663 Ga0495653_0018503 3300046463 Bacteria 5655
664 Ga0495653_0029432 3300046463 Bacteria 4383
665 Ga0495653_0034410 3300046463 Bacteria 4008
666 Ga0495653_0192096 3300046463 Bacteria 1392
667 Ga0495653_0286324 3300046463 Bacteria 1079
668 Ga0495580_0035801 3300046472 Bacteria 3568
669 Ga0495582_0004531 3300046473 Bacteria 7803
670 Ga0495582_0069819 3300046473 Bacteria 1943
671 Ga0495582_0131003 3300046473 Bacteria 1417
672 Ga0495639_0002111 3300046475 Bacteria 8774
673 Ga0495639_0042209 3300046475 Bacteria 2056
674 Ga0495639_0141503 3300046475 Bacteria 1157
675 Ga0495662_0006080 3300046476 Bacteria 6031
676 Ga0495662_0009989 3300046476 Bacteria 4660
677 Ga0495664_0006875 3300046477 Bacteria 6296
678 Ga0495664_0318906 3300046477 Bacteria 937
679 Ga0495584_0038168 3300046491 Bacteria 2428
680 Ga0495594_0001729 3300046499 Bacteria 11329
681 Ga0495596_0077150 3300046500 Bacteria 1294
682 Ga0495608_0001741 3300046511 Bacteria 15558
683 Ga0495608_0011846 3300046511 Bacteria 6068
684 Ga0495608_0034267 3300046511 Bacteria 3428
685 Ga0495608_0036852 3300046511 Bacteria 3290
686 Ga0495618_0011652 3300046514 Bacteria 5335
687 Ga0495618_0018660 3300046514 Bacteria 4260
688 Ga0495618_0025614 3300046514 Bacteria 3661
689 Ga0495628_0214967 3300046516 Bacteria 1445
690 Ga0495628_0266116 3300046516 Bacteria 1276
691 Ga0495630_0015268 3300046517 Bacteria 5605
692 Ga0495630_0374521 3300046517 Bacteria 1090
693 Ga0495630_0441323 3300046517 Bacteria 997
694 Ga0495666_0000796 3300046526 Bacteria 14627
695 Ga0495652_0038052 3300046529 Bacteria 4170
696 Ga0495652_0045318 3300046529 Bacteria 3782
697 Ga0495652_0070018 3300046529 Bacteria 2934
698 Ga0495652_0080197 3300046529 Bacteria 2696
699 Ga0495652_0099154 3300046529 Bacteria 2366
700 Ga0495652_0442522 3300046529 Bacteria 911
701 Ga0495665_0001759 3300046531 Bacteria 11661
702 Ga0495665_0049482 3300046531 Bacteria 2228
703 Ga0495665_0183715 3300046531 Bacteria 1086
704 Ga0495640_0011158 3300046533 Bacteria 6917
705 Ga0495640_0035037 3300046533 Bacteria 3555
706 Ga0495640_0069145 3300046533 Bacteria 2375
707 Ga0495640_0087838 3300046533 Bacteria 2056
708 Ga0495640_0340410 3300046533 Bacteria 927
709 Ga0495586_0001514 3300046535 Bacteria 12851
710 Ga0495586_0053846 3300046535 Bacteria 2180
711 Ga0495587_0020492 3300046536 Bacteria 4082
712 Ga0495587_0090191 3300046536 Bacteria 1771
713 Ga0495645_0183278 3300046543 Bacteria 1432
714 Ga0495622_0038112 3300046557 Bacteria 2238
715 Ga0495667_0008762 3300046559 Bacteria 6875
716 Ga0495667_0031077 3300046559 Bacteria 3585
717 Ga0495667_0141005 3300046559 Bacteria 1553
718 Ga0495667_0167594 3300046559 Bacteria 1412
719 Ga0495667_0307726 3300046559 Bacteria 1003
720 Ga0495656_0077626 3300046615 Bacteria 1491
721 Ga0495634_0005096 3300046642 Bacteria 10148
722 Ga0495634_0012615 3300046642 Bacteria 6117
723 Ga0495634_0022040 3300046642 Bacteria 4492
724 Ga0495634_0112028 3300046642 Bacteria 1754
725 Ga0495635_0003934 3300046663 Bacteria 10331
726 Ga0495635_0033619 3300046663 Bacteria 3556
727 Ga0495635_0110738 3300046663 Bacteria 1875
728 Ga0495588_0099124 3300046674 Bacteria 1530
729 Ga0495657_0002535 3300046675 Bacteria 15314
730 Ga0495657_0014321 3300046675 Bacteria 5821
731 Ga0495657_0018097 3300046675 Bacteria 5106
732 Ga0495657_0022976 3300046675 Bacteria 4461
733 Ga0495657_0024842 3300046675 Bacteria 4261
734 Ga0495657_0098083 3300046675 Bacteria 1870
735 Ga0495599_0020196 3300046678 Bacteria 4150
736 Ga0495599_0046427 3300046678 Bacteria 2724
737 Ga0495599_0075159 3300046678 Bacteria 2110
738 Ga0495623_0017512 3300046679 Bacteria 4629
739 Ga0495623_0078914 3300046679 Bacteria 2040
740 Ga0495623_0087429 3300046679 Bacteria 1920
741 Ga0495623_0149329 3300046679 Bacteria 1383
742 Ga0495646_0009623 3300046680 Bacteria 6134
743 Ga0495646_0030180 3300046680 Bacteria 3386
744 Ga0495646_0032235 3300046680 Bacteria 3262
745 Ga0495646_0096960 3300046680 Bacteria 1695
746 Ga0495646_0137222 3300046680 Bacteria 1371
747 Ga0495646_0176159 3300046680 Bacteria 1176
748 Ga0495647_0016956 3300046681 Bacteria 2572
749 Ga0495647_0037907 3300046681 Bacteria 1821
750 Ga0495658_0022413 3300046683 Bacteria 3339
751 Ga0495613_0011338 3300046689 Bacteria 6623
752 Ga0495613_0033171 3300046689 Bacteria 3837
753 Ga0495613_0038008 3300046689 Bacteria 3568
754 Ga0495613_0041387 3300046689 Bacteria 3412
755 Ga0495624_0005144 3300046690 Bacteria 9447
756 Ga0495600_0007628 3300046809 Bacteria 6628
757 Ga0495600_0074040 3300046809 Bacteria 2223
758 Ga0495600_0080505 3300046809 Bacteria 2126
759 Ga0495600_0093876 3300046809 Bacteria 1956
760 Ga0495581_0010675 3300047315 Bacteria 5309
761 Ga0495581_0062102 3300047315 Bacteria 2158
762 Ga0495581_0134371 3300047315 Bacteria 1442
763 Ga0495604_0002573 3300047317 Bacteria 14521
764 Ga0495604_0082400 3300047317 Bacteria 2406
765 Ga0495604_0180634 3300047317 Bacteria 1476
766 Ga0495674_0000257 3300047319 Bacteria 45119
767 Ga0495674_0031264 3300047319 Bacteria 4837
768 Ga0495674_0235212 3300047319 Bacteria 1511
769 Ga0495676_0005541 3300047321 Bacteria 11580
770 Ga0495676_0008224 3300047321 Bacteria 9567
771 Ga0495676_0038979 3300047321 Bacteria 3941
772 Ga0495680_0003922 3300047322 Bacteria 14390
773 Ga0495680_0005834 3300047322 Bacteria 11522
774 Ga0495680_0015599 3300047322 Bacteria 6551
775 Ga0495680_0026095 3300047322 Bacteria 4823
776 Ga0495680_0036051 3300047322 Bacteria 3976
777 Ga0495680_0104034 3300047322 Bacteria 2112
778 Ga0495680_0123201 3300047322 Bacteria 1912
779 Ga0495675_0008400 3300047444 Bacteria 6393
780 Ga0495675_0081995 3300047444 Bacteria 2031
781 Ga0495675_0141542 3300047444 Bacteria 1491
782 Ga0495684_0000981 3300047471 Bacteria 23174
783 Ga0495684_0005341 3300047471 Bacteria 10001
784 Ga0495684_0046663 3300047471 Bacteria 3313
785 Ga0495684_0058671 3300047471 Bacteria 2931
786 Ga0495684_0322092 3300047471 Bacteria 1105
787 Ga0495602_0010703 3300048088 Bacteria 9512
788 Ga0495602_0036428 3300048088 Bacteria 4579
789 Ga0495602_0091288 3300048088 Bacteria 2527
790 Ga0495602_0288950 3300048088 Bacteria 1204
791 Ga0495602_0341206 3300048088 Bacteria 1083
792 Ga0495614_0012996 3300048089 Bacteria 3650
793 Ga0496100_0008167 3300048903 Bacteria 5829
794 Ga0496100_0010081 3300048903 Bacteria 5338
795 Ga0496100_0055141 3300048903 Bacteria 2596
796 Ga0496101_0004103 3300048904 Bacteria 9113
797 Ga0496101_0030252 3300048904 Bacteria 3795
798 Ga0496101_0040032 3300048904 Bacteria 3337
799 Ga0496101_0126672 3300048904 Bacteria 1936
800 Ga0496102_0001623 3300048905 Bacteria 19807
801 Ga0496102_0005668 3300048905 Bacteria 10601
802 Ga0496102_0104765 3300048905 Bacteria 2631
803 Ga0496102_0112017 3300048905 Bacteria 2544
804 Ga0496103_0006938 3300048906 Bacteria 6762
805 Ga0496103_0053378 3300048906 Bacteria 2505
806 Ga0496103_0080597 3300048906 Bacteria 2047
807 Ga0496103_0205476 3300048906 Bacteria 1267
808 Ga0496103_0212647 3300048906 Bacteria 1243
809 Ga0496104_0000254 3300048907 Bacteria 47479
810 Ga0496104_0008860 3300048907 Bacteria 8943
811 Ga0496104_0014694 3300048907 Bacteria 7073
812 Ga0496104_0015680 3300048907 Bacteria 6872
813 Ga0496104_0031489 3300048907 Bacteria 4933
814 Ga0496104_0036667 3300048907 Bacteria 4584
815 Ga0496104_0047252 3300048907 Bacteria 4057
816 Ga0496104_0065886 3300048907 Bacteria 3438
817 Ga0496104_0229033 3300048907 Bacteria 1770
818 Ga0496104_0347742 3300048907 Bacteria 1395
819 Ga0496104_0386762 3300048907 Bacteria 1311
820 Ga0496104_0418885 3300048907 Bacteria 1251
821 Ga0496105_0000055 3300048908 Bacteria 88389
822 Ga0496105_0003044 3300048908 Bacteria 12325
823 Ga0496105_0010670 3300048908 Bacteria 7227
824 Ga0496105_0014256 3300048908 Bacteria 6325
825 Ga0496105_0032850 3300048908 Bacteria 4258
826 Ga0496105_0042293 3300048908 Bacteria 3755
827 Ga0496105_0042707 3300048908 Bacteria 3739
828 Ga0496105_0052598 3300048908 Bacteria 3364
829 Ga0496105_0231037 3300048908 Bacteria 1503
830 Ga0496106_0011270 3300048909 Bacteria 6617
831 Ga0496106_0033323 3300048909 Bacteria 3843
832 Ga0496106_0040300 3300048909 Bacteria 3497
833 Ga0496106_0101550 3300048909 Bacteria 2231
834 Ga0496106_0121000 3300048909 Bacteria 2046
835 Ga0496107_0009801 3300048910 Bacteria 6643
836 Ga0496107_0023308 3300048910 Bacteria 4377
837 Ga0496107_0033007 3300048910 Bacteria 3702
838 Ga0496107_0081402 3300048910 Bacteria 2361
839 Ga0496108_0005384 3300048911 Bacteria 10344
840 Ga0496108_0005962 3300048911 Bacteria 9871
841 Ga0496108_0009422 3300048911 Bacteria 7907
842 Ga0496108_0032706 3300048911 Bacteria 4320
843 Ga0496108_0038778 3300048911 Bacteria 3970
844 Ga0496108_0107817 3300048911 Bacteria 2379
845 Ga0496108_0146048 3300048911 Bacteria 2039
846 Ga0496108_0162522 3300048911 Bacteria 1930
847 Ga0496108_0219488 3300048911 Bacteria 1652
848 Ga0496108_0326619 3300048911 Bacteria 1337
849 Ga0496108_0522629 3300048911 Bacteria 1036
850 Ga0496109_0001140 3300048912 Bacteria 22090
851 Ga0496109_0005718 3300048912 Bacteria 10407
852 Ga0496109_0012060 3300048912 Bacteria 7445
853 Ga0496109_0076080 3300048912 Bacteria 3087
854 Ga0496109_0080461 3300048912 Bacteria 3001
855 Ga0496109_0160880 3300048912 Bacteria 2104
856 Ga0496109_0165713 3300048912 Bacteria 2071
857 Ga0496109_0231858 3300048912 Bacteria 1737
858 Ga0496109_0303254 3300048912 Bacteria 1506
859 Ga0496109_0307428 3300048912 Bacteria 1495
860 Ga0496110_0000306 3300048913 Bacteria 32370
861 Ga0496110_0002326 3300048913 Bacteria 14207
862 Ga0496110_0014402 3300048913 Bacteria 6564
863 Ga0496110_0029828 3300048913 Bacteria 4699
864 Ga0496110_0034589 3300048913 Bacteria 4378
865 Ga0496110_0049253 3300048913 Bacteria 3695
866 Ga0496110_0053846 3300048913 Bacteria 3538
867 Ga0496110_0118572 3300048913 Bacteria 2383
868 Ga0496110_0201054 3300048913 Bacteria 1810
869 Ga0496110_0209365 3300048913 Bacteria 1772
870 Ga0496110_0281699 3300048913 Bacteria 1514
871 Ga0496111_0000166 3300048914 Bacteria 29882
872 Ga0496111_0001388 3300048914 Bacteria 13743
873 Ga0496111_0019761 3300048914 Bacteria 4684
874 Ga0496111_0055766 3300048914 Bacteria 2858
875 Ga0496111_0072893 3300048914 Bacteria 2500
876 Ga0496111_0104494 3300048914 Bacteria 2083
877 Ga0496111_0165732 3300048914 Bacteria 1641
878 Ga0496111_0326644 3300048914 Bacteria 1136
879 Ga0496112_0008060 3300048915 Bacteria 9402
880 Ga0496112_0157257 3300048915 Bacteria 2240
881 Ga0496112_0216107 3300048915 Bacteria 1873
882 Ga0496112_0526192 3300048915 Bacteria 1117
883 Ga0496113_0002213 3300048916 Bacteria 11219
884 Ga0496113_0025416 3300048916 Bacteria 4221
885 Ga0496113_0037152 3300048916 Bacteria 3572
886 Ga0496113_0099307 3300048916 Bacteria 2254
887 Ga0496113_0147625 3300048916 Bacteria 1853
888 Ga0496113_0292434 3300048916 Bacteria 1303
889 Ga0496113_0351406 3300048916 Bacteria 1183
890 Ga0496113_0580610 3300048916 Bacteria 898
891 Ga0496114_0000202 3300048917 Bacteria 43512
892 Ga0496114_0000256 3300048917 Bacteria 38442
893 Ga0496114_0004795 3300048917 Bacteria 10531
894 Ga0496114_0005333 3300048917 Bacteria 10049
895 Ga0496114_0015003 3300048917 Bacteria 6229
896 Ga0496114_0261163 3300048917 Bacteria 1525
897 Ga0496114_0281122 3300048917 Bacteria 1467
898 Ga0496115_0011279 3300048918 Bacteria 6696
899 Ga0496115_0028781 3300048918 Bacteria 4357
900 Ga0496115_0037402 3300048918 Bacteria 3846
901 Ga0496115_0039681 3300048918 Bacteria 3740
902 Ga0496115_0071198 3300048918 Bacteria 2820
903 Ga0496115_0132465 3300048918 Bacteria 2055
904 Ga0496126_0168384 3300048929 Bacteria 1868
905 Ga0501031_0009747 3300049568 Bacteria 6253
906 Ga0501031_0034162 3300049568 Bacteria 3319
907 Ga0501031_0102885 3300049568 Bacteria 1864
908 Ga0501031_0117264 3300049568 Bacteria 1739
909 Ga0501032_0067996 3300049569 Bacteria 2379
910 Ga0501032_0138997 3300049569 Bacteria 1600
911 Ga0501033_0001904 3300049570 Bacteria 18165
912 Ga0501033_0006376 3300049570 Bacteria 9243
913 Ga0501034_0024537 3300049571 Bacteria 6133
914 Ga0501034_0103079 3300049571 Bacteria 2846
915 Ga0501036_0012610 3300049572 Bacteria 7010
916 Ga0501036_0083701 3300049572 Bacteria 2697
917 Ga0501036_0604462 3300049572 Bacteria 909
918 Ga0501037_0028422 3300049573 Bacteria 4130
919 Ga0501037_0098518 3300049573 Bacteria 2112
920 Ga0501037_0159680 3300049573 Bacteria 1607
921 Ga0501038_0011586 3300049574 Bacteria 8044
922 Ga0501038_0128197 3300049574 Bacteria 2086
923 Ga0501038_0152100 3300049574 Bacteria 1886
924 Ga0501038_0287351 3300049574 Bacteria 1293
925 Ga0501039_0001500 3300049575 Bacteria 17173
926 Ga0501039_0184855 3300049575 Bacteria 1639
927 Ga0501039_0226981 3300049575 Bacteria 1468
928 Ga0501039_0285534 3300049575 Bacteria 1297
929 Ga0501040_0004386 3300049576 Bacteria 9173
930 Ga0501040_0007052 3300049576 Bacteria 7282
931 Ga0501040_0021853 3300049576 Bacteria 4278
932 Ga0501040_0066861 3300049576 Bacteria 2476
933 Ga0501041_0071764 3300049577 Bacteria 2126
934 Ga0501041_0363211 3300049577 Bacteria 915
935 Ga0501042_0092048 3300049578 Bacteria 2177
936 Ga0501042_0131689 3300049578 Bacteria 1802
937 Ga0501042_0142565 3300049578 Bacteria 1727
938 Ga0501042_0479335 3300049578 Bacteria 903
939 Ga0501043_0008340 3300049579 Bacteria 8157
940 Ga0501043_0138894 3300049579 Bacteria 1903
941 Ga0501043_0138990 3300049579 Bacteria 1903
942 Ga0501043_0208922 3300049579 Bacteria 1513
943 Ga0501043_0498193 3300049579 Bacteria 910
944 Ga0501046_0043834 3300049580 Bacteria 3560
945 Ga0501046_0056098 3300049580 Bacteria 3094
946 Ga0501046_0241658 3300049580 Bacteria 1332
947 Ga0501046_0475414 3300049580 Bacteria 897
948 Ga0501047_0041964 3300049581 Bacteria 4421
949 Ga0501047_0399393 3300049581 Bacteria 1207
950 Ga0501048_0051621 3300049582 Bacteria 2927
951 Ga0501048_0054446 3300049582 Bacteria 2842
952 Ga0501048_0131295 3300049582 Bacteria 1770
953 Ga0501067_0088735 3300049583 Bacteria 1716
954 Ga0501067_0101054 3300049583 Bacteria 1602
955 Ga0501067_0107324 3300049583 Bacteria 1552
956 Ga0501068_0007821 3300049584 Bacteria 5921
957 Ga0501068_0014213 3300049584 Bacteria 4547
958 Ga0501068_0119082 3300049584 Bacteria 1645
959 Ga0501068_0155979 3300049584 Bacteria 1437
960 Ga0501069_0056429 3300049585 Bacteria 2188
961 Ga0501070_0008311 3300049586 Bacteria 8769
962 Ga0501070_0042762 3300049586 Bacteria 3773
963 Ga0501070_0046448 3300049586 Bacteria 3611
964 Ga0501070_0056883 3300049586 Bacteria 3242
965 Ga0501070_0220248 3300049586 Bacteria 1556
966 Ga0501070_0444296 3300049586 Bacteria 1046
967 Ga0501071_0044122 3300049587 Bacteria 3198
968 Ga0501071_0053022 3300049587 Bacteria 2924
969 Ga0501071_0103323 3300049587 Bacteria 2102
970 Ga0501071_0268722 3300049587 Bacteria 1289
971 Ga0501071_0318678 3300049587 Bacteria 1180
972 Ga0501072_0006286 3300049588 Bacteria 9042
973 Ga0501072_0038369 3300049588 Bacteria 3759
974 Ga0501072_0140543 3300049588 Bacteria 1925
975 Ga0501072_0308336 3300049588 Bacteria 1258
976 Ga0501072_0329461 3300049588 Bacteria 1213
977 Ga0501072_0343604 3300049588 Bacteria 1185
978 Ga0501073_0027805 3300049589 Bacteria 4042
979 Ga0501073_0104938 3300049589 Bacteria 1961
980 Ga0501073_0137950 3300049589 Bacteria 1690
981 Ga0501073_0140357 3300049589 Bacteria 1674
982 Ga0501073_0207375 3300049589 Bacteria 1354
983 Ga0501074_0003457 3300049590 Bacteria 11205
984 Ga0501074_0022511 3300049590 Bacteria 4578
985 Ga0501074_0038175 3300049590 Bacteria 3481
986 Ga0501074_0073800 3300049590 Bacteria 2450
987 Ga0501074_0146247 3300049590 Bacteria 1690
988 Ga0501074_0205490 3300049590 Bacteria 1403
989 Ga0501075_0001147 3300049591 Bacteria 17101
990 Ga0501075_0006209 3300049591 Bacteria 8212
991 Ga0501075_0084598 3300049591 Bacteria 2403
992 Ga0501075_0184033 3300049591 Bacteria 1593
993 Ga0501075_0245045 3300049591 Bacteria 1366
994 Ga0501075_0440695 3300049591 Bacteria 993
995 Ga0501076_0002038 3300049592 Bacteria 13830
996 Ga0501076_0023268 3300049592 Bacteria 4774
997 Ga0501076_0102633 3300049592 Bacteria 2306
998 Ga0501076_0113067 3300049592 Bacteria 2196
999 Ga0501076_0165298 3300049592 Bacteria 1803
1000 Ga0501077_0000293 3300049593 Bacteria 29649
1001 Ga0501077_0088749 3300049593 Bacteria 1960
1002 Ga0501077_0256495 3300049593 Bacteria 1112
1003 Ga0501077_0302027 3300049593 Bacteria 1020
1004 Ga0501079_0001626 3300049741 Bacteria 16009
1005 Ga0501079_0003249 3300049741 Bacteria 11909
1006 Ga0501079_0044178 3300049741 Bacteria 3439
1007 Ga0501079_0140983 3300049741 Bacteria 1878
1008 Ga0501079_0163986 3300049741 Bacteria 1733
1009 Ga0501079_0171054 3300049741 Bacteria 1694
1010 Ga0501080_0169127 3300049742 Bacteria 2016
1011 Ga0501080_0319801 3300049742 Bacteria 1405
1012 Ga0501080_0421610 3300049742 Bacteria 1199
1013 Ga0501081_0005676 3300049743 Bacteria 8075
1014 Ga0501081_0007144 3300049743 Bacteria 7259
1015 Ga0501081_0015412 3300049743 Bacteria 5044
1016 Ga0501083_0024804 3300049744 Bacteria 4154
1017 Ga0501083_0054197 3300049744 Bacteria 2691
1018 Ga0501083_0226907 3300049744 Bacteria 1216
1019 Ga0501035_0003489 3300049822 Bacteria 15039
1020 Ga0501035_0042761 3300049822 Bacteria 4086
1021 Ga0501035_0255617 3300049822 Bacteria 1486
1022 Ga0501035_0357676 3300049822 Bacteria 1221
1023 Ga0501044_0399376 3300049823 Bacteria 1287
1024 Ga0501045_0000645 3300049824 Bacteria 22078
1025 Ga0501045_0009173 3300049824 Bacteria 6913
1026 Ga0501045_0010473 3300049824 Bacteria 6494
1027 Ga0501045_0027422 3300049824 Bacteria 4104
1028 Ga0501045_0059058 3300049824 Bacteria 2809
1029 Ga0501045_0063464 3300049824 Bacteria 2711
1030 nmdc:mga05p37_5114_c1 3300050507 Bacteria 15383
1031 nmdc:mga05p37_71538_c1 3300050507 Bacteria 4267
1032 nmdc:mga09592_15116_c1 3300050508 Bacteria 6307
1033 nmdc:mga09592_661185_c1 3300050508 Bacteria 892
1034 nmdc:mga0qj67_22953_c1 3300050509 Bacteria 4794
1035 nmdc:mga0qj67_419_c1 3300050509 Bacteria 4577
1036 nmdc:mga06r32_43563_c1 3300050510 Bacteria 4270
1037 nmdc:mga06r32_481_c1 3300050510 Bacteria 30864
1038 nmdc:mga06r32_63463_c1 3300050510 Bacteria 3561
1039 nmdc:mga06r32_69551_c1 3300050510 Bacteria 3402
1040 nmdc:mga08y16_37460_c1 3300050511 Bacteria 5093
1041 nmdc:mga08x19_324206_c1 3300050514 Bacteria 1072
1042 nmdc:mga0a205_237419_c1 3300050515 Bacteria 1704
1043 Ga0495601_0227358 3300053077 Bacteria 1219
1044 Ga0495601_0263014 3300053077 Bacteria 1126
1045 Ga0495601_0503704 3300053077 Bacteria 781
1046 Ga0495595_0054679 3300053084 Bacteria 1857
1047 Ga0495595_0102418 3300053084 Bacteria 1383
1048 Ga0495619_0000657 3300053085 Bacteria 22715
1049 Ga0495619_0002299 3300053085 Bacteria 12587
1050 Ga0495619_0039046 3300053085 Bacteria 3098
1051 Ga0495619_0161072 3300053085 Bacteria 1550
1052 Ga0501084_0019206 3300054114 Bacteria 5692
1053 Ga0501084_0022285 3300054114 Bacteria 5286
1054 Ga0501084_0035743 3300054114 Bacteria 4153
1055 Ga0501084_0058566 3300054114 Bacteria 3223
1056 Ga0501084_0114451 3300054114 Bacteria 2268
1057 Ga0501084_0132389 3300054114 Bacteria 2099
1058 Ga0501082_0003497 3300060353 Bacteria 13703
1059 Ga0501082_0007361 3300060353 Bacteria 9498
1060 Ga0501082_0020391 3300060353 Bacteria 5714
1061 Ga0501082_0024039 3300060353 Bacteria 5255
1062 Ga0501082_0034967 3300060353 Bacteria 4331
1063 Ga0501082_0175674 3300060353 Bacteria 1862
1064 Ga0501082_0223850 3300060353 Bacteria 1637
1065 Ga0501082_0604034 3300060353 Bacteria 960
1066 Ga0501082_0737920 3300060353 Bacteria 862
1067 Ga0530510_0000475 3300061734 Bacteria 25733
1068 Ga0530510_0009115 3300061734 Bacteria 6954
1069 Ga0530510_0305998 3300061734 Bacteria 1190
1070 Ga0530510_0561438 3300061734 Bacteria 867
1071 Ga0070707_100011762
1072 JGI24743J22301_10016999
1073 Ga0070658_10031578
1074 Ga0070676_10008579
1075 Ga0070683_100024182
1076 Ga0070683_100035573
1077 Ga0070683_100184669
1078 Ga0070683_100572869
1079 Ga0070690_100033637
1080 Ga0070677_10036674
1081 Ga0070677_10116912
1082 Ga0068869_100077105
1083 Ga0070666_10238638
1084 Ga0070680_100012784
1085 Ga0070680_100035628
1086 Ga0070680_100058113
1087 Ga0070680_100367038
1088 Ga0070682_100001115
1089 Ga0070682_100020568
1090 Ga0070682_100022722
1091 Ga0070682_100028402
1092 Ga0070682_100047731
1093 Ga0068868_100037538
1094 Ga0068868_100060994
1095 Ga0068868_100127828
1096 Ga0068868_100141468
1097 Ga0070660_100027045
1098 Ga0070660_100075574
1099 Ga0070660_100325809
1100 Ga0070689_100015483
1101 Ga0070689_100090077
1102 Ga0070691_10020124
1103 Ga0070691_10085721
1104 Ga0070687_100037843
1105 Ga0070687_100060290
1106 Ga0070687_100105148
1107 Ga0070661_100034847
1108 Ga0070661_100205317
1109 Ga0070661_100303886
1110 Ga0070692_10000680
1111 Ga0070668_100023742
1112 Ga0070668_100110219
1113 Ga0070669_100049735
1114 Ga0070671_100077520
1115 Ga0070671_100108597
1116 Ga0070671_100166425
1117 Ga0070671_100339114
1118 Ga0070671_100630215
1119 Ga0070674_100019942
1120 Ga0070673_100001554
1121 Ga0070673_100030569
1122 Ga0070673_100205072
1123 Ga0070688_100004156
1124 Ga0070688_100153333
1125 Ga0070659_100065518
1126 Ga0070659_100127468
1127 Ga0070659_100406559
1128 Ga0070667_100185328
1129 Ga0070709_10229597
1130 Ga0070709_10256198
1131 Ga0070709_10328457
1132 Ga0070714_100005004
1133 Ga0070714_100022763
1134 Ga0070714_100025927
1135 Ga0070714_100057117
1136 Ga0070714_100094541
1137 Ga0070714_100094776
1138 Ga0070714_100350997
1139 Ga0070714_100387008
1140 Ga0070713_100026994
1141 Ga0070713_100039538
1142 Ga0070713_100039539
1143 Ga0070713_100051557
1144 Ga0070713_100051620
1145 Ga0070713_100153435
1146 Ga0070713_100157429
1147 Ga0070713_100270683
1148 Ga0070713_100292501
1149 Ga0070713_100343374
1150 Ga0070713_100498029
1151 Ga0070710_10148799
1152 Ga0070710_10154861
1153 Ga0070710_10374976
1154 Ga0070701_10001431
1155 Ga0070701_10015879
1156 Ga0070701_10030589
1157 Ga0070701_10106211
1158 Ga0070711_100078667
1159 Ga0070711_100108594
1160 Ga0070711_100211749
1161 Ga0070700_100006064
1162 Ga0070694_100019267
1163 Ga0070694_100260119
1164 Ga0070694_100297064
1165 Ga0070708_100032029
1166 Ga0070663_100010363
1167 Ga0070663_100017685
1168 Ga0070663_100029866
1169 Ga0070663_100374628
1170 Ga0070678_100001369
1171 Ga0070678_100016846
1172 Ga0070678_100172324
1173 Ga0070662_100116871
1174 Ga0070662_100125211
1175 Ga0070681_10018491
1176 Ga0070681_10041048
1177 Ga0070681_10073782
1178 Ga0070681_10092314
1179 Ga0070681_10110043
1180 Ga0068867_100110155
1181 Ga0068867_100452683
1182 Ga0070685_10002395
1183 Ga0070706_100009548
1184 Ga0070706_100619061
1185 Ga0070707_100336942
1186 Ga0070698_100001275
1187 Ga0070698_100176229
1188 Ga0070699_100012479
1189 Ga0070699_100053961
1190 Ga0070699_100057204
1191 Ga0070679_100023595
1192 Ga0070679_100030247
1193 Ga0070679_100047803
1194 Ga0070679_100061319
1195 Ga0070679_100124243
1196 Ga0070684_100000984
1197 Ga0070684_100009376
1198 Ga0070684_100038452
1199 Ga0070684_100038871
1200 Ga0070684_100071619
1201 Ga0070684_100094680
1202 Ga0070684_100183198
1203 Ga0070684_100240561
1204 Ga0070684_100542580
1205 Ga0070684_100727333
1206 Ga0070697_100037905
1207 Ga0068853_100087029
1208 Ga0068853_100087337
1209 Ga0070672_100063501
1210 Ga0070672_100068531
1211 Ga0070672_100110123
1212 Ga0070686_100015215
1213 Ga0070695_100020800
1214 Ga0070695_100349009
1215 Ga0070696_100053705
1216 Ga0070696_100053925
1217 Ga0070693_100024538
1218 Ga0070693_100091457
1219 Ga0070665_100000229
1220 Ga0070704_100012165
1221 Ga0070704_100044570
1222 Ga0070704_100228210
1223 Ga0070704_100768533
1224 Ga0068855_100060592
1225 Ga0068855_100221308
1226 Ga0070664_100078501
1227 Ga0070664_100154334
1228 Ga0070664_100382570
1229 Ga0070664_100409649
1230 Ga0070664_100434506
1231 Ga0068857_100058441
1232 Ga0068857_100070329
1233 Ga0068857_100100905
1234 Ga0068857_100605308
1235 Ga0068857_100747016
1236 Ga0068857_100952259
1237 Ga0068854_100039289
1238 Ga0068854_100203701
1239 Ga0068856_100004569
1240 Ga0068856_100022506
1241 Ga0068856_100029150
1242 Ga0068856_100110195
1243 Ga0068856_100142010
1244 Ga0068856_100303864
1245 Ga0068856_100383617
1246 Ga0068856_100415210
1247 Ga0070702_100010375
1248 Ga0070702_100032844
1249 Ga0070702_100418455
1250 Ga0068852_100039903
1251 Ga0068852_100392579
1252 Ga0068859_100027634
1253 Ga0068859_100074258
1254 Ga0068859_100114632
1255 Ga0068864_100009949
1256 Ga0068864_100061923
1257 Ga0068866_10042518
1258 Ga0068861_100024174
1259 Ga0068861_100139915
1260 Ga0068861_100408658
1261 Ga0068851_10069990
1262 Ga0068870_10023183
1263 Ga0068870_10101084
1264 Ga0068863_100134075
1265 Ga0068858_100025876
1266 Ga0068858_100212244
1267 Ga0068858_100399964
1268 Ga0068858_100415415
1269 Ga0068860_100086887
1270 Ga0068862_100091412
1271 Ga0068862_100208837
1272 Ga0081455_10010765
1273 Ga0081455_10049660
1274 Ga0081455_10220883
1275 Ga0081538_10002360
1276 Ga0081540_1000469
1277 Ga0081540_1000812
1278 Ga0081539_10001611
1279 Ga0081539_10020745
1280 Ga0070717_10048480
1281 Ga0070717_10141101
1282 Ga0070717_10170334
1283 Ga0070717_10472630
1284 Ga0075432_10036537
1285 Ga0070715_10012008
1286 Ga0070715_10016284
1287 Ga0070716_100152699
1288 Ga0070716_100510662
1289 Ga0070712_100034813
1290 Ga0070712_100050549
1291 Ga0070712_100182249
1292 Ga0070712_100211567
1293 Ga0070712_100329074
1294 Ga0097621_100061326
1295 Ga0097621_100104322
1296 Ga0097621_100132424
1297 Ga0068871_100011741
1298 Ga0068871_100149106
1299 Ga0075430_100048618
1300 Ga0075430_100049684
1301 Ga0075431_100035661
1302 Ga0075429_100023734
1303 Ga0068865_100030003
1304 Ga0068865_100117910
1305 Ga0068865_100196425
1306 Ga0068865_100221316
1307 Ga0075436_100050805
1308 Ga0075436_100073444
1309 Ga0075436_100493713
1310 Ga0097620_100027634
1311 Ga0097620_100074256
1312 Ga0097620_100114626
1313 Ga0105251_10032807
1314 Ga0105240_10378177
1315 Ga0111539_10242722
1316 Ga0111539_10745746
1317 Ga0111539_11063826
1318 Ga0111539_11168891
1319 Ga0105245_10012593
1320 Ga0105245_10047590
1321 Ga0105245_10428957
1322 Ga0105247_10002030
1323 Ga0105247_10008171
1324 Ga0105247_10081893
1325 Ga0105247_10195441
1326 Ga0114129_10104431
1327 Ga0114129_10184702
1328 Ga0105243_10005206
1329 Ga0105243_10015264
1330 Ga0105243_10024764
1331 Ga0105241_10063879
1332 Ga0105241_10087154
1333 Ga0105241_10404025
1334 Ga0105242_10005941
1335 Ga0105242_10022342
1336 Ga0105242_10063862
1337 Ga0105248_10017616
1338 Ga0105248_10225789
1339 Ga0105248_10244377
1340 Ga0105237_10374267
1341 Ga0105237_10861161
1342 Ga0105238_10454333
1343 Ga0105249_10044630
1344 Ga0105249_10046893
1345 Ga0105249_10339298
1346 Ga0105249_10395801
1347 Ga0105249_10729413
1348 Ga0105239_10180973
1349 Ga0105239_10550633
1350 Ga0105239_11309907
1351 Ga0105246_10012761
1352 Ga0157338_1000598
1353 Ga0157373_10069495
1354 Ga0157373_10075509
1355 Ga0157373_10083384
1356 Ga0157370_10110439
1357 Ga0157370_10111214
1358 Ga0157370_10571624
1359 Ga0157369_10054340
1360 Ga0157369_10077101
1361 Ga0157369_10094244
1362 Ga0157374_10039166
1363 Ga0157374_10410258
1364 Ga0157374_10547990
1365 Ga0157378_10003662
1366 Ga0157378_10464488
1367 Ga0163162_10026748
1368 Ga0163162_10056403
1369 Ga0163162_10354346
1370 Ga0157372_10259460
1371 Ga0157372_10370018
1372 Ga0157372_10549287
1373 Ga0157372_10584689
1374 Ga0157375_10010929
1375 Ga0157375_10026169
1376 Ga0157375_10148515
1377 Ga0157375_10363253
1378 Ga0163163_10009970
1379 Ga0163163_10054030
1380 Ga0163163_10254305
1381 Ga0163163_10680464
1382 Ga0157380_10054718
1383 Ga0157380_10066621
1384 Ga0157380_10663072
1385 Ga0182008_10221690
1386 Ga0157377_10044800
1387 Ga0157377_10054184
1388 Ga0157379_10000752
1389 Ga0157379_10018107
1390 Ga0157379_10178207
1391 Ga0157379_10742799
1392 Ga0206356_11776078
1393 Ga0206350_10369510
1394 Ga0206354_10648326
1395 Ga0206353_11975746
1396 Ga0213873_10066712
1397 Ga0213874_10024128
1398 Ga0213876_10004367
1399 Ga0213875_10044787
1400 Ga0213875_10058979
1401 Ga0213875_10153172
1402 Ga0224712_10014237
1403 Ga0224712_10181362
1404 Ga0224712_10240029
1405 Ga0228598_1018640
1406 Ga0207656_10047327
1407 Ga0207653_10017181
1408 Ga0207682_10012745
1409 Ga0207692_10107792
1410 Ga0207692_10209091
1411 Ga0207642_10211688
1412 Ga0207710_10012716
1413 Ga0207710_10013223
1414 Ga0207710_10178948
1415 Ga0207688_10007413
1416 Ga0207680_10131229
1417 Ga0207647_10062932
1418 Ga0207647_10164347
1419 Ga0207699_10010248
1420 Ga0207699_10018608
1421 Ga0207699_10022468
1422 Ga0207699_10161454
1423 Ga0207699_10178569
1424 Ga0207645_10165547
1425 Ga0207643_10001157
1426 Ga0207643_10022072
1427 Ga0207705_10034857
1428 Ga0207705_10089308
1429 Ga0207705_10122297
1430 Ga0207684_10011968
1431 Ga0207684_10618645
1432 Ga0207654_10089087
1433 Ga0207654_10120824
1434 Ga0207654_10161561
1435 Ga0207707_10031202
1436 Ga0207707_10073020
1437 Ga0207707_10204816
1438 Ga0207707_10423314
1439 Ga0207695_10095283
1440 Ga0207695_10295412
1441 Ga0207671_10130171
1442 Ga0207693_10003910
1443 Ga0207693_10044334
1444 Ga0207693_10144949
1445 Ga0207693_10168853
1446 Ga0207693_10300741
1447 Ga0207663_10275184
1448 Ga0207663_10306382
1449 Ga0207663_10317760
1450 Ga0207660_10007118
1451 Ga0207662_10003814
1452 Ga0207662_10020825
1453 Ga0207662_10074091
1454 Ga0207662_10185373
1455 Ga0207657_10011229
1456 Ga0207657_10018249
1457 Ga0207657_10028393
1458 Ga0207657_10126865
1459 Ga0207657_10175356
1460 Ga0207652_10008008
1461 Ga0207652_10011450
1462 Ga0207652_10018135
1463 Ga0207652_10051214
1464 Ga0207646_10025845
1465 Ga0207646_10451319
1466 Ga0207694_10426383
1467 Ga0207687_10002244
1468 Ga0207687_10010596
1469 Ga0207687_10174584
1470 Ga0207687_10325924
1471 Ga0207687_10442461
1472 Ga0207700_10017698
1473 Ga0207700_10059904
1474 Ga0207700_10076050
1475 Ga0207700_10140372
1476 Ga0207700_10156089
1477 Ga0207700_10238388
1478 Ga0207700_10296916
1479 Ga0207700_10832675
1480 Ga0207664_10009299
1481 Ga0207664_10039978
1482 Ga0207664_10074329
1483 Ga0207664_10111497
1484 Ga0207664_10156300
1485 Ga0207664_10282318
1486 Ga0207664_10373641
1487 Ga0207644_10715561
1488 Ga0207690_10046198
1489 Ga0207690_10365221
1490 Ga0207706_10004493
1491 Ga0207706_10011072
1492 Ga0207706_10168597
1493 Ga0207706_10435728
1494 Ga0207686_10030176
1495 Ga0207686_10139505
1496 Ga0207709_10061991
1497 Ga0207709_10120750
1498 Ga0207709_10195992
1499 Ga0207709_10220045
1500 Ga0207670_10120498
1501 Ga0207670_10278271
1502 Ga0207669_10013094
1503 Ga0207704_10019367
1504 Ga0207704_10175373
1505 Ga0207665_10006692
1506 Ga0207665_10035589
1507 Ga0207665_10060505
1508 Ga0207691_10005186
1509 Ga0207691_10011648
1510 Ga0207691_10075507
1511 Ga0207691_10088284
1512 Ga0207711_10046170
1513 Ga0207711_10714960
1514 Ga0207689_10005938
1515 Ga0207689_10056182
1516 Ga0207661_10006689
1517 Ga0207661_10008139
1518 Ga0207661_10011085
1519 Ga0207661_10048471
1520 Ga0207661_10140041
1521 Ga0207661_10181786
1522 Ga0207661_10263189
1523 Ga0207661_10680109
1524 Ga0207661_10790796
1525 Ga0207679_10063765
1526 Ga0207679_10070065
1527 Ga0207679_10280931
1528 Ga0207651_10278414
1529 Ga0207651_10335663
1530 Ga0207712_10028737
1531 Ga0207712_10029993
1532 Ga0207712_10236286
1533 Ga0207640_10222441
1534 Ga0207677_10018844
1535 Ga0207677_10034224
1536 Ga0207677_10048307
1537 Ga0207703_10212277
1538 Ga0207703_10246482
1539 Ga0207703_10601427
1540 Ga0207639_10051429
1541 Ga0207639_10180438
1542 Ga0207678_10012261
1543 Ga0207678_10020413
1544 Ga0207678_10053919
1545 Ga0207678_10119930
1546 Ga0207708_10004717
1547 Ga0207708_10015717
1548 Ga0207702_10027114
1549 Ga0207702_10052244
1550 Ga0207702_10170316
1551 Ga0207702_10264670
1552 Ga0207702_10379475
1553 Ga0207641_10105064
1554 Ga0207641_10135214
1555 Ga0207648_10006493
1556 Ga0207648_10070622
1557 Ga0207648_10080988
1558 Ga0207648_10304609
1559 Ga0207676_10015899
1560 Ga0207674_10015365
1561 Ga0207674_10033304
1562 Ga0207674_10041037
1563 Ga0207674_10060000
1564 Ga0207674_10098775
1565 Ga0207674_10300387
1566 Ga0207674_10411416
1567 Ga0207675_100005731
1568 Ga0207675_100018410
1569 Ga0207675_100069644
1570 Ga0207675_100616277
1571 Ga0207675_100767649
1572 Ga0207683_10000149
1573 Ga0207683_10020233
1574 Ga0207683_10021451
1575 Ga0207683_10023650
1576 Ga0207683_10037161
1577 Ga0207683_10151618
1578 Ga0207683_10404871
1579 Ga0207698_10023386
1580 Ga0207428_10309785
1581 Ga0268266_10010760
1582 Ga0268266_10221568
1583 Ga0268265_10121865
1584 Ga0268265_10193869
1585 Ga0268265_10773261
1586 Ga0268264_10059288
1587 Ga0268264_10827504
1588 Ga0265337_1000276
1589 Ga0265326_10002480
1590 Ga0265319_1005034
1591 Ga0265334_10000924
1592 Ga0265318_10007416
1593 Ga0265323_10007197
1594 Ga0265336_10010553
1595 Ga0265338_10002647
1596 Ga0265324_10001566
1597 Ga0265332_10015019
1598 Ga0265320_10004570
1599 Ga0265325_10113760
1600 Ga0265340_10002012
1601 Ga0265316_10016656
1602 Ga0265313_10037779
1603 Ga0265314_10007805
1604 Ga0265342_10001356
1605 Ga0307410_10009428
1606 Ga0307406_10013868
1607 Ga0307406_10015209
1608 Ga0307406_10497204
1609 Ga0307407_10130883
1610 Ga0307412_10086380
1611 Ga0307409_100006151
1612 Ga0307416_100000255
1613 Ga0307416_100104350
1614 Ga0307411_10271050
1615 Ga0307415_100036731
1616 Ga0307415_100218476
1617 Ga0373950_0033451
1618 Ga0373959_0035232
1619 Ga0373938_0029736
1620 Ga0373926_0002013
1621 Ga0373926_0024005
1622 Ga0373928_0016047
1623 Ga0373928_0016437
1624 Ga0373929_0003342
1625 Ga0373934_0013897
1626 Ga0373934_0022778
1627 Ga0373934_0097921
1628 Ga0373940_0005434
1629 Ga0373944_0000389
1630 Ga0373944_0058347
1631 Ga0373951_0003925
1632 Ga0373951_0057217
1633 Ga0373952_0036385
1634 Ga0373923_0030923
1635 Ga0373932_0010739
1636 Ga0373936_0000112
1637 Ga0373936_0003805
1638 Ga0373936_0049321
1639 Ga0373939_0035228
1640 Ga0373939_0038491
1641 Ga0373941_0018484
1642 Ga0373945_0000180
1643 Ga0373945_0000291
1644 Ga0373953_0006891
1645 Ga0373953_0022773
1646 Ga0373953_0047343
1647 Ga0373953_0094796
1648 Ga0373954_0002644
1649 Ga0373954_0043591
1650 Ga0373954_0123113
1651 Ga0373956_0006193
1652 Ga0373956_0023950
1653 Ga0373956_0039319
1654 Ga0373957_0007283
1655 Ga0373957_0024728
1656 Ga0373957_0045928
1657 Ga0373960_0007606
1658 Ga0373960_0014262
1659 Ga0373943_0000414
1660 Ga0373943_0102659
1661 Ga0373946_0001584
1662 Ga0373946_0012759
1663 Ga0373955_0007888
1664 Ga0373955_0009588
1665 Ga0373955_0023895
1666 Ga0373955_0031220
1667 Ga0373955_0043271
1668 Ga0373961_0096510
1669 Ga0373962_0013383
1670 Ga0373962_0052454
1671 Ga0373924_0011007
1672 Ga0373924_0050274
1673 Ga0373931_0069160
1674 Ga0373935_0000268
1675 Ga0373935_0025301
1676 Ga0373927_0005354
1677 Ga0373927_0006642
1678 Ga0373933_0070781
1679 Ga0373933_0089801
1680 Ga0373933_0249670
1681 Ga0373947_0000374
1682 Ga0373947_0001684
1683 Ga0373937_0005834
1684 Ga0373937_0080506
1685 Ga0373937_0218168
1686 Ga0373937_0558360
1687 Ga0373925_0000366
1688 Ga0373925_0004028
1689 Ga0373925_0032104
1690 Ga0395898_0219790
1691 Ga0395898_0753429
1692 Ga0395905_0239273
1693 Ga0395905_0613392
1694 Ga0436364_0099500
1695 Ga0436364_0274704
1696 Ga0436364_1049383
1697 Ga0436364_1304558
1698 Ga0436364_1394580
1699 Ga0395901_0262301
1700 Ga0436365_0080097
1701 Ga0436365_0226989
1702 Ga0436365_0445234
1703 Ga0436365_1235428
1704 Ga0436363_0230425
1705 Ga0436362_1304003
1706 Ga0439461_0026884
1707 Ga0466963_0149897
1708 Ga0466963_0190038
1709 Ga0466960_0122728
1710 Ga0466958_0063911
1711 Ga0466967_0006871
1712 Ga0466967_0016490
1713 Ga0466967_0027220
1714 Ga0466967_0598337
1715 Ga0495592_0014225
1716 Ga0495592_0065139
1717 Ga0495592_0168597
1718 Ga0495592_0261188
1719 Ga0495592_0344915
1720 Ga0495603_0000607
1721 Ga0495603_0087045
1722 Ga0495629_0020484
1723 Ga0495641_0018052
1724 Ga0495641_0039112
1725 Ga0495641_0112430
1726 Ga0495651_0002244
1727 Ga0495651_0009366
1728 Ga0495651_0099224
1729 Ga0495651_0168098
1730 Ga0495653_0000846
1731 Ga0495653_0002582
1732 Ga0495653_0016716
1733 Ga0495653_0018503
1734 Ga0495653_0029432
1735 Ga0495653_0034410
1736 Ga0495653_0192096
1737 Ga0495653_0286324
1738 Ga0495580_0035801
1739 Ga0495582_0004531
1740 Ga0495582_0069819
1741 Ga0495582_0131003
1742 Ga0495639_0002111
1743 Ga0495639_0042209
1744 Ga0495639_0141503
1745 Ga0495662_0006080
1746 Ga0495662_0009989
1747 Ga0495664_0006875
1748 Ga0495664_0318906
1749 Ga0495584_0038168
1750 Ga0495594_0001729
1751 Ga0495596_0077150
1752 Ga0495608_0001741
1753 Ga0495608_0011846
1754 Ga0495608_0034267
1755 Ga0495608_0036852
1756 Ga0495618_0011652
1757 Ga0495618_0018660
1758 Ga0495618_0025614
1759 Ga0495628_0214967
1760 Ga0495628_0266116
1761 Ga0495630_0015268
1762 Ga0495630_0374521
1763 Ga0495630_0441323
1764 Ga0495666_0000796
1765 Ga0495652_0038052
1766 Ga0495652_0045318
1767 Ga0495652_0070018
1768 Ga0495652_0080197
1769 Ga0495652_0099154
1770 Ga0495652_0442522
1771 Ga0495665_0001759
1772 Ga0495665_0049482
1773 Ga0495665_0183715
1774 Ga0495640_0011158
1775 Ga0495640_0035037
1776 Ga0495640_0069145
1777 Ga0495640_0087838
1778 Ga0495640_0340410
1779 Ga0495586_0001514
1780 Ga0495586_0053846
1781 Ga0495587_0020492
1782 Ga0495587_0090191
1783 Ga0495645_0183278
1784 Ga0495622_0038112
1785 Ga0495667_0008762
1786 Ga0495667_0031077
1787 Ga0495667_0141005
1788 Ga0495667_0167594
1789 Ga0495667_0307726
1790 Ga0495656_0077626
1791 Ga0495634_0005096
1792 Ga0495634_0012615
1793 Ga0495634_0022040
1794 Ga0495634_0112028
1795 Ga0495635_0003934
1796 Ga0495635_0033619
1797 Ga0495635_0110738
1798 Ga0495588_0099124
1799 Ga0495657_0002535
1800 Ga0495657_0014321
1801 Ga0495657_0018097
1802 Ga0495657_0022976
1803 Ga0495657_0024842
1804 Ga0495657_0098083
1805 Ga0495599_0020196
1806 Ga0495599_0046427
1807 Ga0495599_0075159
1808 Ga0495623_0017512
1809 Ga0495623_0078914
1810 Ga0495623_0087429
1811 Ga0495623_0149329
1812 Ga0495646_0009623
1813 Ga0495646_0030180
1814 Ga0495646_0032235
1815 Ga0495646_0096960
1816 Ga0495646_0137222
1817 Ga0495646_0176159
1818 Ga0495647_0016956
1819 Ga0495647_0037907
1820 Ga0495658_0022413
1821 Ga0495613_0011338
1822 Ga0495613_0033171
1823 Ga0495613_0038008
1824 Ga0495613_0041387
1825 Ga0495624_0005144
1826 Ga0495600_0007628
1827 Ga0495600_0074040
1828 Ga0495600_0080505
1829 Ga0495600_0093876
1830 Ga0495581_0010675
1831 Ga0495581_0062102
1832 Ga0495581_0134371
1833 Ga0495604_0002573
1834 Ga0495604_0082400
1835 Ga0495604_0180634
1836 Ga0495674_0000257
1837 Ga0495674_0031264
1838 Ga0495674_0235212
1839 Ga0495676_0005541
1840 Ga0495676_0008224
1841 Ga0495676_0038979
1842 Ga0495680_0003922
1843 Ga0495680_0005834
1844 Ga0495680_0015599
1845 Ga0495680_0026095
1846 Ga0495680_0036051
1847 Ga0495680_0104034
1848 Ga0495680_0123201
1849 Ga0495675_0008400
1850 Ga0495675_0081995
1851 Ga0495675_0141542
1852 Ga0495684_0000981
1853 Ga0495684_0005341
1854 Ga0495684_0046663
1855 Ga0495684_0058671
1856 Ga0495684_0322092
1857 Ga0495602_0010703
1858 Ga0495602_0036428
1859 Ga0495602_0091288
1860 Ga0495602_0288950
1861 Ga0495602_0341206
1862 Ga0495614_0012996
1863 Ga0496100_0008167
1864 Ga0496100_0010081
1865 Ga0496100_0055141
1866 Ga0496101_0004103
1867 Ga0496101_0030252
1868 Ga0496101_0040032
1869 Ga0496101_0126672
1870 Ga0496102_0001623
1871 Ga0496102_0005668
1872 Ga0496102_0104765
1873 Ga0496102_0112017
1874 Ga0496103_0006938
1875 Ga0496103_0053378
1876 Ga0496103_0080597
1877 Ga0496103_0205476
1878 Ga0496103_0212647
1879 Ga0496104_0000254
1880 Ga0496104_0008860
1881 Ga0496104_0014694
1882 Ga0496104_0015680
1883 Ga0496104_0031489
1884 Ga0496104_0036667
1885 Ga0496104_0047252
1886 Ga0496104_0065886
1887 Ga0496104_0229033
1888 Ga0496104_0347742
1889 Ga0496104_0386762
1890 Ga0496104_0418885
1891 Ga0496105_0000055
1892 Ga0496105_0003044
1893 Ga0496105_0010670
1894 Ga0496105_0014256
1895 Ga0496105_0032850
1896 Ga0496105_0042293
1897 Ga0496105_0042707
1898 Ga0496105_0052598
1899 Ga0496105_0231037
1900 Ga0496106_0011270
1901 Ga0496106_0033323
1902 Ga0496106_0040300
1903 Ga0496106_0101550
1904 Ga0496106_0121000
1905 Ga0496107_0009801
1906 Ga0496107_0023308
1907 Ga0496107_0033007
1908 Ga0496107_0081402
1909 Ga0496108_0005384
1910 Ga0496108_0005962
1911 Ga0496108_0009422
1912 Ga0496108_0032706
1913 Ga0496108_0038778
1914 Ga0496108_0107817
1915 Ga0496108_0146048
1916 Ga0496108_0162522
1917 Ga0496108_0219488
1918 Ga0496108_0326619
1919 Ga0496108_0522629
1920 Ga0496109_0001140
1921 Ga0496109_0005718
1922 Ga0496109_0012060
1923 Ga0496109_0076080
1924 Ga0496109_0080461
1925 Ga0496109_0160880
1926 Ga0496109_0165713
1927 Ga0496109_0231858
1928 Ga0496109_0303254
1929 Ga0496109_0307428
1930 Ga0496110_0000306
1931 Ga0496110_0002326
1932 Ga0496110_0014402
1933 Ga0496110_0029828
1934 Ga0496110_0034589
1935 Ga0496110_0049253
1936 Ga0496110_0053846
1937 Ga0496110_0118572
1938 Ga0496110_0201054
1939 Ga0496110_0209365
1940 Ga0496110_0281699
1941 Ga0496111_0000166
1942 Ga0496111_0001388
1943 Ga0496111_0019761
1944 Ga0496111_0055766
1945 Ga0496111_0072893
1946 Ga0496111_0104494
1947 Ga0496111_0165732
1948 Ga0496111_0326644
1949 Ga0496112_0008060
1950 Ga0496112_0157257
1951 Ga0496112_0216107
1952 Ga0496112_0526192
1953 Ga0496113_0002213
1954 Ga0496113_0025416
1955 Ga0496113_0037152
1956 Ga0496113_0099307
1957 Ga0496113_0147625
1958 Ga0496113_0292434
1959 Ga0496113_0351406
1960 Ga0496113_0580610
1961 Ga0496114_0000202
1962 Ga0496114_0000256
1963 Ga0496114_0004795
1964 Ga0496114_0005333
1965 Ga0496114_0015003
1966 Ga0496114_0261163
1967 Ga0496114_0281122
1968 Ga0496115_0011279
1969 Ga0496115_0028781
1970 Ga0496115_0037402
1971 Ga0496115_0039681
1972 Ga0496115_0071198
1973 Ga0496115_0132465
1974 Ga0496126_0168384
1975 Ga0501031_0009747
1976 Ga0501031_0034162
1977 Ga0501031_0102885
1978 Ga0501031_0117264
1979 Ga0501032_0067996
1980 Ga0501032_0138997
1981 Ga0501033_0001904
1982 Ga0501033_0006376
1983 Ga0501034_0024537
1984 Ga0501034_0103079
1985 Ga0501036_0012610
1986 Ga0501036_0083701
1987 Ga0501036_0604462
1988 Ga0501037_0028422
1989 Ga0501037_0098518
1990 Ga0501037_0159680
1991 Ga0501038_0011586
1992 Ga0501038_0128197
1993 Ga0501038_0152100
1994 Ga0501038_0287351
1995 Ga0501039_0001500
1996 Ga0501039_0184855
1997 Ga0501039_0226981
1998 Ga0501039_0285534
1999 Ga0501040_0004386
2000 Ga0501040_0007052
2001 Ga0501040_0021853
2002 Ga0501040_0066861
2003 Ga0501041_0071764
2004 Ga0501041_0363211
2005 Ga0501042_0092048
2006 Ga0501042_0131689
2007 Ga0501042_0142565
2008 Ga0501042_0479335
2009 Ga0501043_0008340
2010 Ga0501043_0138894
2011 Ga0501043_0138990
2012 Ga0501043_0208922
2013 Ga0501043_0498193
2014 Ga0501046_0043834
2015 Ga0501046_0056098
2016 Ga0501046_0241658
2017 Ga0501046_0475414
2018 Ga0501047_0041964
2019 Ga0501047_0399393
2020 Ga0501048_0051621
2021 Ga0501048_0054446
2022 Ga0501048_0131295
2023 Ga0501067_0088735
2024 Ga0501067_0101054
2025 Ga0501067_0107324
2026 Ga0501068_0007821
2027 Ga0501068_0014213
2028 Ga0501068_0119082
2029 Ga0501068_0155979
2030 Ga0501069_0056429
2031 Ga0501070_0008311
2032 Ga0501070_0042762
2033 Ga0501070_0046448
2034 Ga0501070_0056883
2035 Ga0501070_0220248
2036 Ga0501070_0444296
2037 Ga0501071_0044122
2038 Ga0501071_0053022
2039 Ga0501071_0103323
2040 Ga0501071_0268722
2041 Ga0501071_0318678
2042 Ga0501072_0006286
2043 Ga0501072_0038369
2044 Ga0501072_0140543
2045 Ga0501072_0308336
2046 Ga0501072_0329461
2047 Ga0501072_0343604
2048 Ga0501073_0027805
2049 Ga0501073_0104938
2050 Ga0501073_0137950
2051 Ga0501073_0140357
2052 Ga0501073_0207375
2053 Ga0501074_0003457
2054 Ga0501074_0022511
2055 Ga0501074_0038175
2056 Ga0501074_0073800
2057 Ga0501074_0146247
2058 Ga0501074_0205490
2059 Ga0501075_0001147
2060 Ga0501075_0006209
2061 Ga0501075_0084598
2062 Ga0501075_0184033
2063 Ga0501075_0245045
2064 Ga0501075_0440695
2065 Ga0501076_0002038
2066 Ga0501076_0023268
2067 Ga0501076_0102633
2068 Ga0501076_0113067
2069 Ga0501076_0165298
2070 Ga0501077_0000293
2071 Ga0501077_0088749
2072 Ga0501077_0256495
2073 Ga0501077_0302027
2074 Ga0501079_0001626
2075 Ga0501079_0003249
2076 Ga0501079_0044178
2077 Ga0501079_0140983
2078 Ga0501079_0163986
2079 Ga0501079_0171054
2080 Ga0501080_0169127
2081 Ga0501080_0319801
2082 Ga0501080_0421610
2083 Ga0501081_0005676
2084 Ga0501081_0007144
2085 Ga0501081_0015412
2086 Ga0501083_0024804
2087 Ga0501083_0054197
2088 Ga0501083_0226907
2089 Ga0501035_0003489
2090 Ga0501035_0042761
2091 Ga0501035_0255617
2092 Ga0501035_0357676
2093 Ga0501044_0399376
2094 Ga0501045_0000645
2095 Ga0501045_0009173
2096 Ga0501045_0010473
2097 Ga0501045_0027422
2098 Ga0501045_0059058
2099 Ga0501045_0063464
2100 nmdc:mga05p37_5114_c1
2101 nmdc:mga05p37_71538_c1
2102 nmdc:mga09592_15116_c1
2103 nmdc:mga09592_661185_c1
2104 nmdc:mga0qj67_22953_c1
2105 nmdc:mga0qj67_419_c1
2106 nmdc:mga06r32_43563_c1
2107 nmdc:mga06r32_481_c1
2108 nmdc:mga06r32_63463_c1
2109 nmdc:mga06r32_69551_c1
2110 nmdc:mga08y16_37460_c1
2111 nmdc:mga08x19_324206_c1
2112 nmdc:mga0a205_237419_c1
2113 Ga0495601_0227358
2114 Ga0495601_0263014
2115 Ga0495601_0503704
2116 Ga0495595_0054679
2117 Ga0495595_0102418
2118 Ga0495619_0000657
2119 Ga0495619_0002299
2120 Ga0495619_0039046
2121 Ga0495619_0161072
2122 Ga0501084_0019206
2123 Ga0501084_0022285
2124 Ga0501084_0035743
2125 Ga0501084_0058566
2126 Ga0501084_0114451
2127 Ga0501084_0132389
2128 Ga0501082_0003497
2129 Ga0501082_0007361
2130 Ga0501082_0020391
2131 Ga0501082_0024039
2132 Ga0501082_0034967
2133 Ga0501082_0175674
2134 Ga0501082_0223850
2135 Ga0501082_0604034
2136 Ga0501082_0737920
2137 Ga0530510_0000475
2138 Ga0530510_0009115
2139 Ga0530510_0305998
2140 Ga0530510_0561438

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

185

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9202 6 220
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9111 6 220
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9099 1 233
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.906 6 220
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9026 6 220
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 1 233 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.928 6 233 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9206 6 215 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9147 6 211 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9133 26 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N7IFK1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9917 4 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2V2SQV4-F1-model_v4 deleted 0.9816 4 238
AF-A0A2A3EW38-F1-model_v4 deleted 0.9674 1 231
AF-A0A7K3WDW6-F1-model_v4 ABC transporter ATP-binding protein 0.967 11 237 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2E7NN84-F1-model_v4 deleted 0.9661 1 233

Map