F489464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1070 | 375 | 2140 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100011762|Ga0070707_1000117625 |
| Length | 275 |
| Sequence | MPASKLMTGDRGKAGLNDMASDDGAGGDAVLELNGLSVGYDRAMVVRDLNLTVGHGEVVALLGANGAGKTTTLRAISGLLKHPPGTIRFGGTDLAGVAPTARARLGIAHVPFDRGIFFGLTVAEHFRLDGLSSPAQMDTAFDHFPALRDLRDRKAGLLSGGEQQMLALARALSRTPKLLMLDEMSLGLAPVIVGRLLPVVRDYATSTGTGVLLVEQHVHMALKIADRGYILAHGDLTASGTAESLSKDSALLAASYLGSAAQSSAAESDGRAAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.37 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100011762 | 3300005468 | Bacteria | 8167 |
| 2 | JGI24743J22301_10016999 | 3300001991 | Bacteria | 1362 |
| 3 | Ga0070658_10031578 | 3300005327 | Bacteria | 4253 |
| 4 | Ga0070676_10008579 | 3300005328 | Bacteria | 5511 |
| 5 | Ga0070683_100024182 | 3300005329 | Bacteria | 5438 |
| 6 | Ga0070683_100035573 | 3300005329 | Bacteria | 4552 |
| 7 | Ga0070683_100184669 | 3300005329 | Bacteria | 1979 |
| 8 | Ga0070683_100572869 | 3300005329 | Bacteria | 1080 |
| 9 | Ga0070690_100033637 | 3300005330 | Bacteria | 3210 |
| 10 | Ga0070677_10036674 | 3300005333 | Bacteria | 1909 |
| 11 | Ga0070677_10116912 | 3300005333 | Bacteria | 1199 |
| 12 | Ga0068869_100077105 | 3300005334 | Bacteria | 2478 |
| 13 | Ga0070666_10238638 | 3300005335 | Bacteria | 1285 |
| 14 | Ga0070680_100012784 | 3300005336 | Bacteria | 6529 |
| 15 | Ga0070680_100035628 | 3300005336 | Bacteria | 4018 |
| 16 | Ga0070680_100058113 | 3300005336 | Bacteria | 3163 |
| 17 | Ga0070680_100367038 | 3300005336 | Bacteria | 1225 |
| 18 | Ga0070682_100001115 | 3300005337 | Bacteria | 15366 |
| 19 | Ga0070682_100020568 | 3300005337 | Bacteria | 3885 |
| 20 | Ga0070682_100022722 | 3300005337 | Bacteria | 3718 |
| 21 | Ga0070682_100028402 | 3300005337 | Bacteria | 3364 |
| 22 | Ga0070682_100047731 | 3300005337 | Bacteria | 2663 |
| 23 | Ga0068868_100037538 | 3300005338 | Bacteria | 3756 |
| 24 | Ga0068868_100060994 | 3300005338 | Bacteria | 2987 |
| 25 | Ga0068868_100127828 | 3300005338 | Bacteria | 2077 |
| 26 | Ga0068868_100141468 | 3300005338 | Bacteria | 1975 |
| 27 | Ga0070660_100027045 | 3300005339 | Bacteria | 4278 |
| 28 | Ga0070660_100075574 | 3300005339 | Bacteria | 2638 |
| 29 | Ga0070660_100325809 | 3300005339 | Bacteria | 1262 |
| 30 | Ga0070689_100015483 | 3300005340 | Bacteria | 5562 |
| 31 | Ga0070689_100090077 | 3300005340 | Bacteria | 2416 |
| 32 | Ga0070691_10020124 | 3300005341 | Bacteria | 3081 |
| 33 | Ga0070691_10085721 | 3300005341 | Bacteria | 1547 |
| 34 | Ga0070687_100037843 | 3300005343 | Bacteria | 2414 |
| 35 | Ga0070687_100060290 | 3300005343 | Bacteria | 2001 |
| 36 | Ga0070687_100105148 | 3300005343 | Bacteria | 1588 |
| 37 | Ga0070661_100034847 | 3300005344 | Bacteria | 3652 |
| 38 | Ga0070661_100205317 | 3300005344 | Bacteria | 1507 |
| 39 | Ga0070661_100303886 | 3300005344 | Bacteria | 1243 |
| 40 | Ga0070692_10000680 | 3300005345 | Bacteria | 10889 |
| 41 | Ga0070668_100023742 | 3300005347 | Bacteria | 4641 |
| 42 | Ga0070668_100110219 | 3300005347 | Bacteria | 2190 |
| 43 | Ga0070669_100049735 | 3300005353 | Bacteria | 3061 |
| 44 | Ga0070671_100077520 | 3300005355 | Bacteria | 2777 |
| 45 | Ga0070671_100108597 | 3300005355 | Bacteria | 2330 |
| 46 | Ga0070671_100166425 | 3300005355 | Bacteria | 1864 |
| 47 | Ga0070671_100339114 | 3300005355 | Bacteria | 1282 |
| 48 | Ga0070671_100630215 | 3300005355 | Bacteria | 928 |
| 49 | Ga0070674_100019942 | 3300005356 | Bacteria | 4271 |
| 50 | Ga0070673_100001554 | 3300005364 | Bacteria | 13519 |
| 51 | Ga0070673_100030569 | 3300005364 | Bacteria | 4033 |
| 52 | Ga0070673_100205072 | 3300005364 | Bacteria | 1700 |
| 53 | Ga0070688_100004156 | 3300005365 | Bacteria | 7511 |
| 54 | Ga0070688_100153333 | 3300005365 | Bacteria | 1577 |
| 55 | Ga0070659_100065518 | 3300005366 | Bacteria | 2877 |
| 56 | Ga0070659_100127468 | 3300005366 | Bacteria | 2065 |
| 57 | Ga0070659_100406559 | 3300005366 | Bacteria | 1150 |
| 58 | Ga0070667_100185328 | 3300005367 | Bacteria | 1842 |
| 59 | Ga0070709_10229597 | 3300005434 | Bacteria | 1327 |
| 60 | Ga0070709_10256198 | 3300005434 | Bacteria | 1262 |
| 61 | Ga0070709_10328457 | 3300005434 | Bacteria | 1124 |
| 62 | Ga0070714_100005004 | 3300005435 | Bacteria | 10075 |
| 63 | Ga0070714_100022763 | 3300005435 | Bacteria | 5141 |
| 64 | Ga0070714_100025927 | 3300005435 | Bacteria | 4841 |
| 65 | Ga0070714_100057117 | 3300005435 | Bacteria | 3339 |
| 66 | Ga0070714_100094541 | 3300005435 | Bacteria | 2623 |
| 67 | Ga0070714_100094776 | 3300005435 | Bacteria | 2620 |
| 68 | Ga0070714_100350997 | 3300005435 | Bacteria | 1385 |
| 69 | Ga0070714_100387008 | 3300005435 | Bacteria | 1319 |
| 70 | Ga0070713_100026994 | 3300005436 | Bacteria | 4516 |
| 71 | Ga0070713_100039538 | 3300005436 | Bacteria | 3829 |
| 72 | Ga0070713_100039539 | 3300005436 | Bacteria | 3829 |
| 73 | Ga0070713_100051557 | 3300005436 | Bacteria | 3403 |
| 74 | Ga0070713_100051620 | 3300005436 | Bacteria | 3401 |
| 75 | Ga0070713_100153435 | 3300005436 | Bacteria | 2051 |
| 76 | Ga0070713_100157429 | 3300005436 | Bacteria | 2026 |
| 77 | Ga0070713_100270683 | 3300005436 | Bacteria | 1555 |
| 78 | Ga0070713_100292501 | 3300005436 | Bacteria | 1497 |
| 79 | Ga0070713_100343374 | 3300005436 | Bacteria | 1384 |
| 80 | Ga0070713_100498029 | 3300005436 | Bacteria | 1149 |
| 81 | Ga0070710_10148799 | 3300005437 | Bacteria | 1442 |
| 82 | Ga0070710_10154861 | 3300005437 | Bacteria | 1416 |
| 83 | Ga0070710_10374976 | 3300005437 | Bacteria | 948 |
| 84 | Ga0070701_10001431 | 3300005438 | Bacteria | 8831 |
| 85 | Ga0070701_10015879 | 3300005438 | Bacteria | 3488 |
| 86 | Ga0070701_10030589 | 3300005438 | Bacteria | 2665 |
| 87 | Ga0070701_10106211 | 3300005438 | Bacteria | 1562 |
| 88 | Ga0070711_100078667 | 3300005439 | Bacteria | 2344 |
| 89 | Ga0070711_100108594 | 3300005439 | Bacteria | 2033 |
| 90 | Ga0070711_100211749 | 3300005439 | Bacteria | 1501 |
| 91 | Ga0070700_100006064 | 3300005441 | Bacteria | 6436 |
| 92 | Ga0070694_100019267 | 3300005444 | Bacteria | 4338 |
| 93 | Ga0070694_100260119 | 3300005444 | Bacteria | 1316 |
| 94 | Ga0070694_100297064 | 3300005444 | Bacteria | 1236 |
| 95 | Ga0070708_100032029 | 3300005445 | Bacteria | 4556 |
| 96 | Ga0070663_100010363 | 3300005455 | Bacteria | 5808 |
| 97 | Ga0070663_100017685 | 3300005455 | Bacteria | 4657 |
| 98 | Ga0070663_100029866 | 3300005455 | Bacteria | 3729 |
| 99 | Ga0070663_100374628 | 3300005455 | Bacteria | 1158 |
| 100 | Ga0070678_100001369 | 3300005456 | Bacteria | 12966 |
| 101 | Ga0070678_100016846 | 3300005456 | Bacteria | 4686 |
| 102 | Ga0070678_100172324 | 3300005456 | Bacteria | 1764 |
| 103 | Ga0070662_100116871 | 3300005457 | Bacteria | 2039 |
| 104 | Ga0070662_100125211 | 3300005457 | Bacteria | 1975 |
| 105 | Ga0070681_10018491 | 3300005458 | Bacteria | 6965 |
| 106 | Ga0070681_10041048 | 3300005458 | Bacteria | 4637 |
| 107 | Ga0070681_10073782 | 3300005458 | Bacteria | 3374 |
| 108 | Ga0070681_10092314 | 3300005458 | Bacteria | 2977 |
| 109 | Ga0070681_10110043 | 3300005458 | Bacteria | 2695 |
| 110 | Ga0068867_100110155 | 3300005459 | Bacteria | 2115 |
| 111 | Ga0068867_100452683 | 3300005459 | Bacteria | 1094 |
| 112 | Ga0070685_10002395 | 3300005466 | Bacteria | 9653 |
| 113 | Ga0070706_100009548 | 3300005467 | Bacteria | 9020 |
| 114 | Ga0070706_100619061 | 3300005467 | Bacteria | 1005 |
| 115 | Ga0070707_100336942 | 3300005468 | Bacteria | 1465 |
| 116 | Ga0070698_100001275 | 3300005471 | Bacteria | 28146 |
| 117 | Ga0070698_100176229 | 3300005471 | Bacteria | 2077 |
| 118 | Ga0070699_100012479 | 3300005518 | Bacteria | 7333 |
| 119 | Ga0070699_100053961 | 3300005518 | Bacteria | 3479 |
| 120 | Ga0070699_100057204 | 3300005518 | Bacteria | 3378 |
| 121 | Ga0070679_100023595 | 3300005530 | Bacteria | 6024 |
| 122 | Ga0070679_100030247 | 3300005530 | Bacteria | 5346 |
| 123 | Ga0070679_100047803 | 3300005530 | Bacteria | 4264 |
| 124 | Ga0070679_100061319 | 3300005530 | Bacteria | 3748 |
| 125 | Ga0070679_100124243 | 3300005530 | Bacteria | 2563 |
| 126 | Ga0070684_100000984 | 3300005535 | Bacteria | 20350 |
| 127 | Ga0070684_100009376 | 3300005535 | Bacteria | 7707 |
| 128 | Ga0070684_100038452 | 3300005535 | Bacteria | 4110 |
| 129 | Ga0070684_100038871 | 3300005535 | Bacteria | 4090 |
| 130 | Ga0070684_100071619 | 3300005535 | Bacteria | 3050 |
| 131 | Ga0070684_100094680 | 3300005535 | Bacteria | 2660 |
| 132 | Ga0070684_100183198 | 3300005535 | Bacteria | 1904 |
| 133 | Ga0070684_100240561 | 3300005535 | Bacteria | 1654 |
| 134 | Ga0070684_100542580 | 3300005535 | Bacteria | 1079 |
| 135 | Ga0070684_100727333 | 3300005535 | Bacteria | 926 |
| 136 | Ga0070697_100037905 | 3300005536 | Bacteria | 3893 |
| 137 | Ga0068853_100087029 | 3300005539 | Bacteria | 2741 |
| 138 | Ga0068853_100087337 | 3300005539 | Bacteria | 2736 |
| 139 | Ga0070672_100063501 | 3300005543 | Bacteria | 2916 |
| 140 | Ga0070672_100068531 | 3300005543 | Bacteria | 2814 |
| 141 | Ga0070672_100110123 | 3300005543 | Bacteria | 2243 |
| 142 | Ga0070686_100015215 | 3300005544 | Bacteria | 4449 |
| 143 | Ga0070695_100020800 | 3300005545 | Bacteria | 4009 |
| 144 | Ga0070695_100349009 | 3300005545 | Bacteria | 1108 |
| 145 | Ga0070696_100053705 | 3300005546 | Bacteria | 2805 |
| 146 | Ga0070696_100053925 | 3300005546 | Bacteria | 2800 |
| 147 | Ga0070693_100024538 | 3300005547 | Bacteria | 3234 |
| 148 | Ga0070693_100091457 | 3300005547 | Bacteria | 1835 |
| 149 | Ga0070665_100000229 | 3300005548 | Bacteria | 93160 |
| 150 | Ga0070704_100012165 | 3300005549 | Bacteria | 5310 |
| 151 | Ga0070704_100044570 | 3300005549 | Bacteria | 3083 |
| 152 | Ga0070704_100228210 | 3300005549 | Bacteria | 1517 |
| 153 | Ga0070704_100768533 | 3300005549 | Bacteria | 859 |
| 154 | Ga0068855_100060592 | 3300005563 | Bacteria | 4425 |
| 155 | Ga0068855_100221308 | 3300005563 | Bacteria | 2122 |
| 156 | Ga0070664_100078501 | 3300005564 | Bacteria | 2840 |
| 157 | Ga0070664_100154334 | 3300005564 | Bacteria | 2028 |
| 158 | Ga0070664_100382570 | 3300005564 | Bacteria | 1285 |
| 159 | Ga0070664_100409649 | 3300005564 | Bacteria | 1240 |
| 160 | Ga0070664_100434506 | 3300005564 | Bacteria | 1203 |
| 161 | Ga0068857_100058441 | 3300005577 | Bacteria | 3424 |
| 162 | Ga0068857_100070329 | 3300005577 | Bacteria | 3117 |
| 163 | Ga0068857_100100905 | 3300005577 | Bacteria | 2589 |
| 164 | Ga0068857_100605308 | 3300005577 | Bacteria | 1036 |
| 165 | Ga0068857_100747016 | 3300005577 | Bacteria | 932 |
| 166 | Ga0068857_100952259 | 3300005577 | Bacteria | 825 |
| 167 | Ga0068854_100039289 | 3300005578 | Bacteria | 3333 |
| 168 | Ga0068854_100203701 | 3300005578 | Bacteria | 1557 |
| 169 | Ga0068856_100004569 | 3300005614 | Bacteria | 13754 |
| 170 | Ga0068856_100022506 | 3300005614 | Bacteria | 6128 |
| 171 | Ga0068856_100029150 | 3300005614 | Bacteria | 5391 |
| 172 | Ga0068856_100110195 | 3300005614 | Bacteria | 2750 |
| 173 | Ga0068856_100142010 | 3300005614 | Bacteria | 2408 |
| 174 | Ga0068856_100303864 | 3300005614 | Bacteria | 1613 |
| 175 | Ga0068856_100383617 | 3300005614 | Bacteria | 1424 |
| 176 | Ga0068856_100415210 | 3300005614 | Bacteria | 1366 |
| 177 | Ga0070702_100010375 | 3300005615 | Bacteria | 4586 |
| 178 | Ga0070702_100032844 | 3300005615 | Bacteria | 2850 |
| 179 | Ga0070702_100418455 | 3300005615 | Bacteria | 963 |
| 180 | Ga0068852_100039903 | 3300005616 | Bacteria | 3956 |
| 181 | Ga0068852_100392579 | 3300005616 | Bacteria | 1363 |
| 182 | Ga0068859_100027634 | 3300005617 | Bacteria | 5690 |
| 183 | Ga0068859_100074258 | 3300005617 | Bacteria | 3439 |
| 184 | Ga0068859_100114632 | 3300005617 | Bacteria | 2759 |
| 185 | Ga0068864_100009949 | 3300005618 | Bacteria | 7845 |
| 186 | Ga0068864_100061923 | 3300005618 | Bacteria | 3241 |
| 187 | Ga0068866_10042518 | 3300005718 | Bacteria | 2262 |
| 188 | Ga0068861_100024174 | 3300005719 | Bacteria | 4391 |
| 189 | Ga0068861_100139915 | 3300005719 | Bacteria | 1974 |
| 190 | Ga0068861_100408658 | 3300005719 | Bacteria | 1207 |
| 191 | Ga0068851_10069990 | 3300005834 | Bacteria | 1813 |
| 192 | Ga0068870_10023183 | 3300005840 | Bacteria | 3059 |
| 193 | Ga0068870_10101084 | 3300005840 | Bacteria | 1629 |
| 194 | Ga0068863_100134075 | 3300005841 | Bacteria | 2366 |
| 195 | Ga0068858_100025876 | 3300005842 | Bacteria | 5457 |
| 196 | Ga0068858_100212244 | 3300005842 | Bacteria | 1832 |
| 197 | Ga0068858_100399964 | 3300005842 | Bacteria | 1320 |
| 198 | Ga0068858_100415415 | 3300005842 | Bacteria | 1293 |
| 199 | Ga0068860_100086887 | 3300005843 | Bacteria | 2976 |
| 200 | Ga0068862_100091412 | 3300005844 | Bacteria | 2651 |
| 201 | Ga0068862_100208837 | 3300005844 | Bacteria | 1764 |
| 202 | Ga0081455_10010765 | 3300005937 | Bacteria | 9242 |
| 203 | Ga0081455_10049660 | 3300005937 | Bacteria | 3615 |
| 204 | Ga0081455_10220883 | 3300005937 | Bacteria | 1404 |
| 205 | Ga0081538_10002360 | 3300005981 | Bacteria | 18572 |
| 206 | Ga0081540_1000469 | 3300005983 | Bacteria | 39957 |
| 207 | Ga0081540_1000812 | 3300005983 | Bacteria | 28585 |
| 208 | Ga0081539_10001611 | 3300005985 | Bacteria | 37114 |
| 209 | Ga0081539_10020745 | 3300005985 | Bacteria | 4424 |
| 210 | Ga0070717_10048480 | 3300006028 | Bacteria | 3484 |
| 211 | Ga0070717_10141101 | 3300006028 | Bacteria | 2078 |
| 212 | Ga0070717_10170334 | 3300006028 | Bacteria | 1893 |
| 213 | Ga0070717_10472630 | 3300006028 | Bacteria | 1131 |
| 214 | Ga0075432_10036537 | 3300006058 | Bacteria | 1708 |
| 215 | Ga0070715_10012008 | 3300006163 | Bacteria | 3136 |
| 216 | Ga0070715_10016284 | 3300006163 | Bacteria | 2791 |
| 217 | Ga0070716_100152699 | 3300006173 | Bacteria | 1487 |
| 218 | Ga0070716_100510662 | 3300006173 | Bacteria | 888 |
| 219 | Ga0070712_100034813 | 3300006175 | Bacteria | 3414 |
| 220 | Ga0070712_100050549 | 3300006175 | Bacteria | 2892 |
| 221 | Ga0070712_100182249 | 3300006175 | Bacteria | 1637 |
| 222 | Ga0070712_100211567 | 3300006175 | Bacteria | 1529 |
| 223 | Ga0070712_100329074 | 3300006175 | Bacteria | 1244 |
| 224 | Ga0097621_100061326 | 3300006237 | Bacteria | 3084 |
| 225 | Ga0097621_100104322 | 3300006237 | Bacteria | 2389 |
| 226 | Ga0097621_100132424 | 3300006237 | Bacteria | 2123 |
| 227 | Ga0068871_100011741 | 3300006358 | Bacteria | 6434 |
| 228 | Ga0068871_100149106 | 3300006358 | Bacteria | 1993 |
| 229 | Ga0075430_100048618 | 3300006846 | Bacteria | 3581 |
| 230 | Ga0075430_100049684 | 3300006846 | Bacteria | 3539 |
| 231 | Ga0075431_100035661 | 3300006847 | Bacteria | 5121 |
| 232 | Ga0075429_100023734 | 3300006880 | Bacteria | 5322 |
| 233 | Ga0068865_100030003 | 3300006881 | Bacteria | 3613 |
| 234 | Ga0068865_100117910 | 3300006881 | Bacteria | 1969 |
| 235 | Ga0068865_100196425 | 3300006881 | Bacteria | 1564 |
| 236 | Ga0068865_100221316 | 3300006881 | Bacteria | 1480 |
| 237 | Ga0075436_100050805 | 3300006914 | Bacteria | 2861 |
| 238 | Ga0075436_100073444 | 3300006914 | Bacteria | 2367 |
| 239 | Ga0075436_100493713 | 3300006914 | Bacteria | 895 |
| 240 | Ga0097620_100027634 | 3300006931 | Bacteria | 5690 |
| 241 | Ga0097620_100074256 | 3300006931 | Bacteria | 3439 |
| 242 | Ga0097620_100114626 | 3300006931 | Bacteria | 2759 |
| 243 | Ga0105251_10032807 | 3300009011 | Bacteria | 2584 |
| 244 | Ga0105240_10378177 | 3300009093 | Bacteria | 1600 |
| 245 | Ga0111539_10242722 | 3300009094 | Bacteria | 2097 |
| 246 | Ga0111539_10745746 | 3300009094 | Bacteria | 1140 |
| 247 | Ga0111539_11063826 | 3300009094 | Bacteria | 940 |
| 248 | Ga0111539_11168891 | 3300009094 | Bacteria | 894 |
| 249 | Ga0105245_10012593 | 3300009098 | Bacteria | 7362 |
| 250 | Ga0105245_10047590 | 3300009098 | Bacteria | 3834 |
| 251 | Ga0105245_10428957 | 3300009098 | Bacteria | 1326 |
| 252 | Ga0105247_10002030 | 3300009101 | Bacteria | 14021 |
| 253 | Ga0105247_10008171 | 3300009101 | Bacteria | 6390 |
| 254 | Ga0105247_10081893 | 3300009101 | Bacteria | 2036 |
| 255 | Ga0105247_10195441 | 3300009101 | Bacteria | 1356 |
| 256 | Ga0114129_10104431 | 3300009147 | Bacteria | 3916 |
| 257 | Ga0114129_10184702 | 3300009147 | Bacteria | 2835 |
| 258 | Ga0105243_10005206 | 3300009148 | Bacteria | 10174 |
| 259 | Ga0105243_10015264 | 3300009148 | Bacteria | 5812 |
| 260 | Ga0105243_10024764 | 3300009148 | Bacteria | 4581 |
| 261 | Ga0105241_10063879 | 3300009174 | Bacteria | 2841 |
| 262 | Ga0105241_10087154 | 3300009174 | Bacteria | 2457 |
| 263 | Ga0105241_10404025 | 3300009174 | Bacteria | 1199 |
| 264 | Ga0105242_10005941 | 3300009176 | Bacteria | 9415 |
| 265 | Ga0105242_10022342 | 3300009176 | Bacteria | 4973 |
| 266 | Ga0105242_10063862 | 3300009176 | Bacteria | 3033 |
| 267 | Ga0105248_10017616 | 3300009177 | Bacteria | 7880 |
| 268 | Ga0105248_10225789 | 3300009177 | Bacteria | 2108 |
| 269 | Ga0105248_10244377 | 3300009177 | Bacteria | 2020 |
| 270 | Ga0105237_10374267 | 3300009545 | Bacteria | 1429 |
| 271 | Ga0105237_10861161 | 3300009545 | Bacteria | 913 |
| 272 | Ga0105238_10454333 | 3300009551 | Bacteria | 1278 |
| 273 | Ga0105249_10044630 | 3300009553 | Bacteria | 4030 |
| 274 | Ga0105249_10046893 | 3300009553 | Bacteria | 3935 |
| 275 | Ga0105249_10339298 | 3300009553 | Bacteria | 1519 |
| 276 | Ga0105249_10395801 | 3300009553 | Bacteria | 1411 |
| 277 | Ga0105249_10729413 | 3300009553 | Bacteria | 1052 |
| 278 | Ga0105239_10180973 | 3300010375 | Bacteria | 2359 |
| 279 | Ga0105239_10550633 | 3300010375 | Bacteria | 1314 |
| 280 | Ga0105239_11309907 | 3300010375 | Bacteria | 836 |
| 281 | Ga0105246_10012761 | 3300011119 | Bacteria | 5250 |
| 282 | Ga0157338_1000598 | 3300012515 | Bacteria | 2215 |
| 283 | Ga0157373_10069495 | 3300013100 | Bacteria | 2490 |
| 284 | Ga0157373_10075509 | 3300013100 | Bacteria | 2378 |
| 285 | Ga0157373_10083384 | 3300013100 | Bacteria | 2253 |
| 286 | Ga0157370_10110439 | 3300013104 | Bacteria | 2570 |
| 287 | Ga0157370_10111214 | 3300013104 | Bacteria | 2561 |
| 288 | Ga0157370_10571624 | 3300013104 | Bacteria | 1036 |
| 289 | Ga0157369_10054340 | 3300013105 | Bacteria | 4325 |
| 290 | Ga0157369_10077101 | 3300013105 | Bacteria | 3572 |
| 291 | Ga0157369_10094244 | 3300013105 | Bacteria | 3196 |
| 292 | Ga0157374_10039166 | 3300013296 | Bacteria | 4362 |
| 293 | Ga0157374_10410258 | 3300013296 | Bacteria | 1352 |
| 294 | Ga0157374_10547990 | 3300013296 | Bacteria | 1164 |
| 295 | Ga0157378_10003662 | 3300013297 | Bacteria | 13617 |
| 296 | Ga0157378_10464488 | 3300013297 | Bacteria | 1258 |
| 297 | Ga0163162_10026748 | 3300013306 | Bacteria | 5704 |
| 298 | Ga0163162_10056403 | 3300013306 | Bacteria | 3956 |
| 299 | Ga0163162_10354346 | 3300013306 | Bacteria | 1600 |
| 300 | Ga0157372_10259460 | 3300013307 | Bacteria | 2018 |
| 301 | Ga0157372_10370018 | 3300013307 | Bacteria | 1670 |
| 302 | Ga0157372_10549287 | 3300013307 | Bacteria | 1346 |
| 303 | Ga0157372_10584689 | 3300013307 | Bacteria | 1301 |
| 304 | Ga0157375_10010929 | 3300013308 | Bacteria | 8007 |
| 305 | Ga0157375_10026169 | 3300013308 | Bacteria | 5433 |
| 306 | Ga0157375_10148515 | 3300013308 | Bacteria | 2477 |
| 307 | Ga0157375_10363253 | 3300013308 | Bacteria | 1614 |
| 308 | Ga0163163_10009970 | 3300014325 | Bacteria | 8518 |
| 309 | Ga0163163_10054030 | 3300014325 | Bacteria | 3966 |
| 310 | Ga0163163_10254305 | 3300014325 | Bacteria | 1807 |
| 311 | Ga0163163_10680464 | 3300014325 | Bacteria | 1092 |
| 312 | Ga0157380_10054718 | 3300014326 | Bacteria | 3167 |
| 313 | Ga0157380_10066621 | 3300014326 | Bacteria | 2897 |
| 314 | Ga0157380_10663072 | 3300014326 | Bacteria | 1043 |
| 315 | Ga0182008_10221690 | 3300014497 | Bacteria | 968 |
| 316 | Ga0157377_10044800 | 3300014745 | Bacteria | 2468 |
| 317 | Ga0157377_10054184 | 3300014745 | Bacteria | 2270 |
| 318 | Ga0157379_10000752 | 3300014968 | Bacteria | 26221 |
| 319 | Ga0157379_10018107 | 3300014968 | Bacteria | 6207 |
| 320 | Ga0157379_10178207 | 3300014968 | Bacteria | 1920 |
| 321 | Ga0157379_10742799 | 3300014968 | Bacteria | 923 |
| 322 | Ga0206356_11776078 | 3300020070 | Bacteria | 1534 |
| 323 | Ga0206350_10369510 | 3300020080 | Bacteria | 2172 |
| 324 | Ga0206354_10648326 | 3300020081 | Bacteria | 2693 |
| 325 | Ga0206353_11975746 | 3300020082 | Bacteria | 2222 |
| 326 | Ga0213873_10066712 | 3300021358 | Bacteria | 984 |
| 327 | Ga0213874_10024128 | 3300021377 | Bacteria | 1702 |
| 328 | Ga0213876_10004367 | 3300021384 | Bacteria | 7918 |
| 329 | Ga0213875_10044787 | 3300021388 | Bacteria | 2077 |
| 330 | Ga0213875_10058979 | 3300021388 | Bacteria | 1797 |
| 331 | Ga0213875_10153172 | 3300021388 | Bacteria | 1081 |
| 332 | Ga0224712_10014237 | 3300022467 | Bacteria | 2555 |
| 333 | Ga0224712_10181362 | 3300022467 | Bacteria | 949 |
| 334 | Ga0224712_10240029 | 3300022467 | Bacteria | 834 |
| 335 | Ga0228598_1018640 | 3300024227 | Bacteria | 1370 |
| 336 | Ga0207656_10047327 | 3300025321 | Bacteria | 1848 |
| 337 | Ga0207653_10017181 | 3300025885 | Bacteria | 2275 |
| 338 | Ga0207682_10012745 | 3300025893 | Bacteria | 3280 |
| 339 | Ga0207692_10107792 | 3300025898 | Bacteria | 1540 |
| 340 | Ga0207692_10209091 | 3300025898 | Bacteria | 1151 |
| 341 | Ga0207642_10211688 | 3300025899 | Bacteria | 1077 |
| 342 | Ga0207710_10012716 | 3300025900 | Bacteria | 3543 |
| 343 | Ga0207710_10013223 | 3300025900 | Bacteria | 3478 |
| 344 | Ga0207710_10178948 | 3300025900 | Bacteria | 1040 |
| 345 | Ga0207688_10007413 | 3300025901 | Bacteria | 5974 |
| 346 | Ga0207680_10131229 | 3300025903 | Bacteria | 1652 |
| 347 | Ga0207647_10062932 | 3300025904 | Bacteria | 2258 |
| 348 | Ga0207647_10164347 | 3300025904 | Bacteria | 1294 |
| 349 | Ga0207699_10010248 | 3300025906 | Bacteria | 4695 |
| 350 | Ga0207699_10018608 | 3300025906 | Bacteria | 3684 |
| 351 | Ga0207699_10022468 | 3300025906 | Bacteria | 3418 |
| 352 | Ga0207699_10161454 | 3300025906 | Bacteria | 1492 |
| 353 | Ga0207699_10178569 | 3300025906 | Bacteria | 1425 |
| 354 | Ga0207645_10165547 | 3300025907 | Bacteria | 1448 |
| 355 | Ga0207643_10001157 | 3300025908 | Bacteria | 15664 |
| 356 | Ga0207643_10022072 | 3300025908 | Bacteria | 3502 |
| 357 | Ga0207705_10034857 | 3300025909 | Bacteria | 3599 |
| 358 | Ga0207705_10089308 | 3300025909 | Bacteria | 2255 |
| 359 | Ga0207705_10122297 | 3300025909 | Bacteria | 1932 |
| 360 | Ga0207684_10011968 | 3300025910 | Bacteria | 7557 |
| 361 | Ga0207684_10618645 | 3300025910 | Bacteria | 924 |
| 362 | Ga0207654_10089087 | 3300025911 | Bacteria | 1876 |
| 363 | Ga0207654_10120824 | 3300025911 | Bacteria | 1644 |
| 364 | Ga0207654_10161561 | 3300025911 | Bacteria | 1448 |
| 365 | Ga0207707_10031202 | 3300025912 | Bacteria | 4662 |
| 366 | Ga0207707_10073020 | 3300025912 | Bacteria | 2991 |
| 367 | Ga0207707_10204816 | 3300025912 | Bacteria | 1719 |
| 368 | Ga0207707_10423314 | 3300025912 | Bacteria | 1141 |
| 369 | Ga0207695_10095283 | 3300025913 | Bacteria | 2981 |
| 370 | Ga0207695_10295412 | 3300025913 | Bacteria | 1512 |
| 371 | Ga0207671_10130171 | 3300025914 | Bacteria | 1931 |
| 372 | Ga0207693_10003910 | 3300025915 | Bacteria | 12684 |
| 373 | Ga0207693_10044334 | 3300025915 | Bacteria | 3496 |
| 374 | Ga0207693_10144949 | 3300025915 | Bacteria | 1868 |
| 375 | Ga0207693_10168853 | 3300025915 | Bacteria | 1723 |
| 376 | Ga0207693_10300741 | 3300025915 | Bacteria | 1257 |
| 377 | Ga0207663_10275184 | 3300025916 | Bacteria | 1249 |
| 378 | Ga0207663_10306382 | 3300025916 | Bacteria | 1189 |
| 379 | Ga0207663_10317760 | 3300025916 | Bacteria | 1169 |
| 380 | Ga0207660_10007118 | 3300025917 | Bacteria | 7246 |
| 381 | Ga0207662_10003814 | 3300025918 | Bacteria | 7827 |
| 382 | Ga0207662_10020825 | 3300025918 | Bacteria | 3743 |
| 383 | Ga0207662_10074091 | 3300025918 | Bacteria | 2066 |
| 384 | Ga0207662_10185373 | 3300025918 | Bacteria | 1341 |
| 385 | Ga0207657_10011229 | 3300025919 | Bacteria | 8901 |
| 386 | Ga0207657_10018249 | 3300025919 | Bacteria | 6709 |
| 387 | Ga0207657_10028393 | 3300025919 | Bacteria | 5104 |
| 388 | Ga0207657_10126865 | 3300025919 | Bacteria | 2095 |
| 389 | Ga0207657_10175356 | 3300025919 | Bacteria | 1735 |
| 390 | Ga0207652_10008008 | 3300025921 | Bacteria | 8481 |
| 391 | Ga0207652_10011450 | 3300025921 | Bacteria | 7150 |
| 392 | Ga0207652_10018135 | 3300025921 | Bacteria | 5769 |
| 393 | Ga0207652_10051214 | 3300025921 | Bacteria | 3539 |
| 394 | Ga0207646_10025845 | 3300025922 | Bacteria | 5368 |
| 395 | Ga0207646_10451319 | 3300025922 | Bacteria | 1160 |
| 396 | Ga0207694_10426383 | 3300025924 | Bacteria | 1105 |
| 397 | Ga0207687_10002244 | 3300025927 | Bacteria | 13162 |
| 398 | Ga0207687_10010596 | 3300025927 | Bacteria | 6026 |
| 399 | Ga0207687_10174584 | 3300025927 | Bacteria | 1660 |
| 400 | Ga0207687_10325924 | 3300025927 | Bacteria | 1245 |
| 401 | Ga0207687_10442461 | 3300025927 | Bacteria | 1077 |
| 402 | Ga0207700_10017698 | 3300025928 | Bacteria | 4766 |
| 403 | Ga0207700_10059904 | 3300025928 | Bacteria | 2881 |
| 404 | Ga0207700_10076050 | 3300025928 | Bacteria | 2604 |
| 405 | Ga0207700_10140372 | 3300025928 | Bacteria | 1985 |
| 406 | Ga0207700_10156089 | 3300025928 | Bacteria | 1891 |
| 407 | Ga0207700_10238388 | 3300025928 | Bacteria | 1549 |
| 408 | Ga0207700_10296916 | 3300025928 | Bacteria | 1394 |
| 409 | Ga0207700_10832675 | 3300025928 | Bacteria | 825 |
| 410 | Ga0207664_10009299 | 3300025929 | Bacteria | 6891 |
| 411 | Ga0207664_10039978 | 3300025929 | Bacteria | 3643 |
| 412 | Ga0207664_10074329 | 3300025929 | Bacteria | 2745 |
| 413 | Ga0207664_10111497 | 3300025929 | Bacteria | 2276 |
| 414 | Ga0207664_10156300 | 3300025929 | Bacteria | 1942 |
| 415 | Ga0207664_10282318 | 3300025929 | Bacteria | 1457 |
| 416 | Ga0207664_10373641 | 3300025929 | Bacteria | 1265 |
| 417 | Ga0207644_10715561 | 3300025931 | Bacteria | 835 |
| 418 | Ga0207690_10046198 | 3300025932 | Bacteria | 2883 |
| 419 | Ga0207690_10365221 | 3300025932 | Bacteria | 1144 |
| 420 | Ga0207706_10004493 | 3300025933 | Bacteria | 13096 |
| 421 | Ga0207706_10011072 | 3300025933 | Bacteria | 8221 |
| 422 | Ga0207706_10168597 | 3300025933 | Bacteria | 1924 |
| 423 | Ga0207706_10435728 | 3300025933 | Bacteria | 1135 |
| 424 | Ga0207686_10030176 | 3300025934 | Bacteria | 3207 |
| 425 | Ga0207686_10139505 | 3300025934 | Bacteria | 1673 |
| 426 | Ga0207709_10061991 | 3300025935 | Bacteria | 2339 |
| 427 | Ga0207709_10120750 | 3300025935 | Bacteria | 1769 |
| 428 | Ga0207709_10195992 | 3300025935 | Bacteria | 1439 |
| 429 | Ga0207709_10220045 | 3300025935 | Bacteria | 1369 |
| 430 | Ga0207670_10120498 | 3300025936 | Bacteria | 1906 |
| 431 | Ga0207670_10278271 | 3300025936 | Bacteria | 1303 |
| 432 | Ga0207669_10013094 | 3300025937 | Bacteria | 4106 |
| 433 | Ga0207704_10019367 | 3300025938 | Bacteria | 3572 |
| 434 | Ga0207704_10175373 | 3300025938 | Bacteria | 1543 |
| 435 | Ga0207665_10006692 | 3300025939 | Bacteria | 7649 |
| 436 | Ga0207665_10035589 | 3300025939 | Bacteria | 3306 |
| 437 | Ga0207665_10060505 | 3300025939 | Bacteria | 2565 |
| 438 | Ga0207691_10005186 | 3300025940 | Bacteria | 12580 |
| 439 | Ga0207691_10011648 | 3300025940 | Bacteria | 8443 |
| 440 | Ga0207691_10075507 | 3300025940 | Bacteria | 3039 |
| 441 | Ga0207691_10088284 | 3300025940 | Bacteria | 2781 |
| 442 | Ga0207711_10046170 | 3300025941 | Bacteria | 3722 |
| 443 | Ga0207711_10714960 | 3300025941 | Bacteria | 934 |
| 444 | Ga0207689_10005938 | 3300025942 | Bacteria | 10810 |
| 445 | Ga0207689_10056182 | 3300025942 | Bacteria | 3239 |
| 446 | Ga0207661_10006689 | 3300025944 | Bacteria | 8155 |
| 447 | Ga0207661_10008139 | 3300025944 | Bacteria | 7483 |
| 448 | Ga0207661_10011085 | 3300025944 | Bacteria | 6515 |
| 449 | Ga0207661_10048471 | 3300025944 | Bacteria | 3376 |
| 450 | Ga0207661_10140041 | 3300025944 | Bacteria | 2081 |
| 451 | Ga0207661_10181786 | 3300025944 | Bacteria | 1837 |
| 452 | Ga0207661_10263189 | 3300025944 | Bacteria | 1537 |
| 453 | Ga0207661_10680109 | 3300025944 | Bacteria | 946 |
| 454 | Ga0207661_10790796 | 3300025944 | Bacteria | 873 |
| 455 | Ga0207679_10063765 | 3300025945 | Bacteria | 2752 |
| 456 | Ga0207679_10070065 | 3300025945 | Bacteria | 2641 |
| 457 | Ga0207679_10280931 | 3300025945 | Bacteria | 1428 |
| 458 | Ga0207651_10278414 | 3300025960 | Bacteria | 1381 |
| 459 | Ga0207651_10335663 | 3300025960 | Bacteria | 1268 |
| 460 | Ga0207712_10028737 | 3300025961 | Bacteria | 3722 |
| 461 | Ga0207712_10029993 | 3300025961 | Bacteria | 3654 |
| 462 | Ga0207712_10236286 | 3300025961 | Bacteria | 1470 |
| 463 | Ga0207640_10222441 | 3300025981 | Bacteria | 1446 |
| 464 | Ga0207677_10018844 | 3300026023 | Bacteria | 4153 |
| 465 | Ga0207677_10034224 | 3300026023 | Bacteria | 3288 |
| 466 | Ga0207677_10048307 | 3300026023 | Bacteria | 2865 |
| 467 | Ga0207703_10212277 | 3300026035 | Bacteria | 1726 |
| 468 | Ga0207703_10246482 | 3300026035 | Bacteria | 1608 |
| 469 | Ga0207703_10601427 | 3300026035 | Bacteria | 1040 |
| 470 | Ga0207639_10051429 | 3300026041 | Bacteria | 3133 |
| 471 | Ga0207639_10180438 | 3300026041 | Bacteria | 1795 |
| 472 | Ga0207678_10012261 | 3300026067 | Bacteria | 7527 |
| 473 | Ga0207678_10020413 | 3300026067 | Bacteria | 5811 |
| 474 | Ga0207678_10053919 | 3300026067 | Bacteria | 3464 |
| 475 | Ga0207678_10119930 | 3300026067 | Bacteria | 2245 |
| 476 | Ga0207708_10004717 | 3300026075 | Bacteria | 10026 |
| 477 | Ga0207708_10015717 | 3300026075 | Bacteria | 5679 |
| 478 | Ga0207702_10027114 | 3300026078 | Bacteria | 4757 |
| 479 | Ga0207702_10052244 | 3300026078 | Bacteria | 3457 |
| 480 | Ga0207702_10170316 | 3300026078 | Bacteria | 1996 |
| 481 | Ga0207702_10264670 | 3300026078 | Bacteria | 1620 |
| 482 | Ga0207702_10379475 | 3300026078 | Bacteria | 1359 |
| 483 | Ga0207641_10105064 | 3300026088 | Bacteria | 2494 |
| 484 | Ga0207641_10135214 | 3300026088 | Bacteria | 2218 |
| 485 | Ga0207648_10006493 | 3300026089 | Bacteria | 11612 |
| 486 | Ga0207648_10070622 | 3300026089 | Bacteria | 3044 |
| 487 | Ga0207648_10080988 | 3300026089 | Bacteria | 2832 |
| 488 | Ga0207648_10304609 | 3300026089 | Bacteria | 1429 |
| 489 | Ga0207676_10015899 | 3300026095 | Bacteria | 5442 |
| 490 | Ga0207674_10015365 | 3300026116 | Bacteria | 8412 |
| 491 | Ga0207674_10033304 | 3300026116 | Bacteria | 5395 |
| 492 | Ga0207674_10041037 | 3300026116 | Bacteria | 4788 |
| 493 | Ga0207674_10060000 | 3300026116 | Bacteria | 3848 |
| 494 | Ga0207674_10098775 | 3300026116 | Bacteria | 2902 |
| 495 | Ga0207674_10300387 | 3300026116 | Bacteria | 1554 |
| 496 | Ga0207674_10411416 | 3300026116 | Bacteria | 1307 |
| 497 | Ga0207675_100005731 | 3300026118 | Bacteria | 11885 |
| 498 | Ga0207675_100018410 | 3300026118 | Bacteria | 6513 |
| 499 | Ga0207675_100069644 | 3300026118 | Bacteria | 3288 |
| 500 | Ga0207675_100616277 | 3300026118 | Bacteria | 1089 |
| 501 | Ga0207675_100767649 | 3300026118 | Bacteria | 976 |
| 502 | Ga0207683_10000149 | 3300026121 | Bacteria | 57867 |
| 503 | Ga0207683_10020233 | 3300026121 | Bacteria | 5690 |
| 504 | Ga0207683_10021451 | 3300026121 | Bacteria | 5530 |
| 505 | Ga0207683_10023650 | 3300026121 | Bacteria | 5286 |
| 506 | Ga0207683_10037161 | 3300026121 | Bacteria | 4241 |
| 507 | Ga0207683_10151618 | 3300026121 | Bacteria | 2092 |
| 508 | Ga0207683_10404871 | 3300026121 | Bacteria | 1255 |
| 509 | Ga0207698_10023386 | 3300026142 | Bacteria | 4316 |
| 510 | Ga0207428_10309785 | 3300027907 | Bacteria | 1167 |
| 511 | Ga0268266_10010760 | 3300028379 | Bacteria | 7971 |
| 512 | Ga0268266_10221568 | 3300028379 | Bacteria | 1739 |
| 513 | Ga0268265_10121865 | 3300028380 | Bacteria | 2150 |
| 514 | Ga0268265_10193869 | 3300028380 | Bacteria | 1757 |
| 515 | Ga0268265_10773261 | 3300028380 | Bacteria | 934 |
| 516 | Ga0268264_10059288 | 3300028381 | Bacteria | 3207 |
| 517 | Ga0268264_10827504 | 3300028381 | Bacteria | 926 |
| 518 | Ga0265337_1000276 | 3300028556 | Bacteria | 28064 |
| 519 | Ga0265326_10002480 | 3300028558 | Bacteria | 6217 |
| 520 | Ga0265319_1005034 | 3300028563 | Bacteria | 6428 |
| 521 | Ga0265334_10000924 | 3300028573 | Bacteria | 14626 |
| 522 | Ga0265318_10007416 | 3300028577 | Bacteria | 4958 |
| 523 | Ga0265323_10007197 | 3300028653 | Bacteria | 4639 |
| 524 | Ga0265336_10010553 | 3300028666 | Bacteria | 3163 |
| 525 | Ga0265338_10002647 | 3300028800 | Bacteria | 26361 |
| 526 | Ga0265324_10001566 | 3300029957 | Bacteria | 12763 |
| 527 | Ga0265332_10015019 | 3300031238 | Bacteria | 3422 |
| 528 | Ga0265320_10004570 | 3300031240 | Bacteria | 9052 |
| 529 | Ga0265325_10113760 | 3300031241 | Bacteria | 1312 |
| 530 | Ga0265340_10002012 | 3300031247 | Bacteria | 11633 |
| 531 | Ga0265316_10016656 | 3300031344 | Bacteria | 6371 |
| 532 | Ga0265313_10037779 | 3300031595 | Bacteria | 2411 |
| 533 | Ga0265314_10007805 | 3300031711 | Bacteria | 9247 |
| 534 | Ga0265342_10001356 | 3300031712 | Bacteria | 22912 |
| 535 | Ga0307410_10009428 | 3300031852 | Bacteria | 5474 |
| 536 | Ga0307406_10013868 | 3300031901 | Bacteria | 4626 |
| 537 | Ga0307406_10015209 | 3300031901 | Bacteria | 4448 |
| 538 | Ga0307406_10497204 | 3300031901 | Bacteria | 988 |
| 539 | Ga0307407_10130883 | 3300031903 | Bacteria | 1605 |
| 540 | Ga0307412_10086380 | 3300031911 | Bacteria | 2183 |
| 541 | Ga0307409_100006151 | 3300031995 | Bacteria | 7019 |
| 542 | Ga0307416_100000255 | 3300032002 | Bacteria | 28483 |
| 543 | Ga0307416_100104350 | 3300032002 | Bacteria | 2478 |
| 544 | Ga0307411_10271050 | 3300032005 | Bacteria | 1346 |
| 545 | Ga0307415_100036731 | 3300032126 | Bacteria | 3213 |
| 546 | Ga0307415_100218476 | 3300032126 | Bacteria | 1526 |
| 547 | Ga0373950_0033451 | 3300034818 | Bacteria | 960 |
| 548 | Ga0373959_0035232 | 3300034820 | Bacteria | 1028 |
| 549 | Ga0373938_0029736 | 3300034957 | Bacteria | 1162 |
| 550 | Ga0373926_0002013 | 3300035083 | Bacteria | 6386 |
| 551 | Ga0373926_0024005 | 3300035083 | Bacteria | 2120 |
| 552 | Ga0373928_0016047 | 3300035084 | Bacteria | 1529 |
| 553 | Ga0373928_0016437 | 3300035084 | Bacteria | 1515 |
| 554 | Ga0373929_0003342 | 3300035085 | Bacteria | 2897 |
| 555 | Ga0373934_0013897 | 3300035086 | Bacteria | 3046 |
| 556 | Ga0373934_0022778 | 3300035086 | Bacteria | 2417 |
| 557 | Ga0373934_0097921 | 3300035086 | Bacteria | 1185 |
| 558 | Ga0373940_0005434 | 3300035088 | Bacteria | 2761 |
| 559 | Ga0373944_0000389 | 3300035089 | Bacteria | 9976 |
| 560 | Ga0373944_0058347 | 3300035089 | Bacteria | 1232 |
| 561 | Ga0373951_0003925 | 3300035091 | Bacteria | 3574 |
| 562 | Ga0373951_0057217 | 3300035091 | Bacteria | 970 |
| 563 | Ga0373952_0036385 | 3300035092 | Bacteria | 1118 |
| 564 | Ga0373923_0030923 | 3300035111 | Bacteria | 2155 |
| 565 | Ga0373932_0010739 | 3300035112 | Bacteria | 2223 |
| 566 | Ga0373936_0000112 | 3300035113 | Bacteria | 28228 |
| 567 | Ga0373936_0003805 | 3300035113 | Bacteria | 5683 |
| 568 | Ga0373936_0049321 | 3300035113 | Bacteria | 1700 |
| 569 | Ga0373939_0035228 | 3300035114 | Bacteria | 1473 |
| 570 | Ga0373939_0038491 | 3300035114 | Bacteria | 1427 |
| 571 | Ga0373941_0018484 | 3300035115 | Bacteria | 1927 |
| 572 | Ga0373945_0000180 | 3300035116 | Bacteria | 16902 |
| 573 | Ga0373945_0000291 | 3300035116 | Bacteria | 14209 |
| 574 | Ga0373953_0006891 | 3300035117 | Bacteria | 3773 |
| 575 | Ga0373953_0022773 | 3300035117 | Bacteria | 2365 |
| 576 | Ga0373953_0047343 | 3300035117 | Bacteria | 1729 |
| 577 | Ga0373953_0094796 | 3300035117 | Bacteria | 1251 |
| 578 | Ga0373954_0002644 | 3300035118 | Bacteria | 7541 |
| 579 | Ga0373954_0043591 | 3300035118 | Bacteria | 2092 |
| 580 | Ga0373954_0123113 | 3300035118 | Bacteria | 1260 |
| 581 | Ga0373956_0006193 | 3300035119 | Bacteria | 4786 |
| 582 | Ga0373956_0023950 | 3300035119 | Bacteria | 2625 |
| 583 | Ga0373956_0039319 | 3300035119 | Bacteria | 2096 |
| 584 | Ga0373957_0007283 | 3300035120 | Bacteria | 3536 |
| 585 | Ga0373957_0024728 | 3300035120 | Bacteria | 2159 |
| 586 | Ga0373957_0045928 | 3300035120 | Bacteria | 1656 |
| 587 | Ga0373960_0007606 | 3300035121 | Bacteria | 2573 |
| 588 | Ga0373960_0014262 | 3300035121 | Bacteria | 2010 |
| 589 | Ga0373943_0000414 | 3300035170 | Bacteria | 18003 |
| 590 | Ga0373943_0102659 | 3300035170 | Bacteria | 1498 |
| 591 | Ga0373946_0001584 | 3300035171 | Bacteria | 7925 |
| 592 | Ga0373946_0012759 | 3300035171 | Bacteria | 3149 |
| 593 | Ga0373955_0007888 | 3300035172 | Bacteria | 4914 |
| 594 | Ga0373955_0009588 | 3300035172 | Bacteria | 4543 |
| 595 | Ga0373955_0023895 | 3300035172 | Bacteria | 3119 |
| 596 | Ga0373955_0031220 | 3300035172 | Bacteria | 2789 |
| 597 | Ga0373955_0043271 | 3300035172 | Bacteria | 2422 |
| 598 | Ga0373961_0096510 | 3300035241 | Bacteria | 951 |
| 599 | Ga0373962_0013383 | 3300035242 | Bacteria | 2077 |
| 600 | Ga0373962_0052454 | 3300035242 | Bacteria | 1178 |
| 601 | Ga0373924_0011007 | 3300035410 | Bacteria | 3351 |
| 602 | Ga0373924_0050274 | 3300035410 | Bacteria | 1726 |
| 603 | Ga0373931_0069160 | 3300035691 | Bacteria | 1923 |
| 604 | Ga0373935_0000268 | 3300035692 | Bacteria | 25733 |
| 605 | Ga0373935_0025301 | 3300035692 | Bacteria | 3658 |
| 606 | Ga0373927_0005354 | 3300035695 | Bacteria | 8866 |
| 607 | Ga0373927_0006642 | 3300035695 | Bacteria | 7872 |
| 608 | Ga0373933_0070781 | 3300035724 | Bacteria | 2122 |
| 609 | Ga0373933_0089801 | 3300035724 | Bacteria | 1894 |
| 610 | Ga0373933_0249670 | 3300035724 | Bacteria | 1142 |
| 611 | Ga0373947_0000374 | 3300035725 | Bacteria | 25329 |
| 612 | Ga0373947_0001684 | 3300035725 | Bacteria | 13542 |
| 613 | Ga0373937_0005834 | 3300036401 | Bacteria | 10587 |
| 614 | Ga0373937_0080506 | 3300036401 | Bacteria | 3012 |
| 615 | Ga0373937_0218168 | 3300036401 | Bacteria | 1795 |
| 616 | Ga0373937_0558360 | 3300036401 | Bacteria | 1087 |
| 617 | Ga0373925_0000366 | 3300037068 | Bacteria | 47068 |
| 618 | Ga0373925_0004028 | 3300037068 | Bacteria | 11169 |
| 619 | Ga0373925_0032104 | 3300037068 | Bacteria | 3863 |
| 620 | Ga0395898_0219790 | 3300037466 | Bacteria | 1812 |
| 621 | Ga0395898_0753429 | 3300037466 | Bacteria | 915 |
| 622 | Ga0395905_0239273 | 3300037471 | Bacteria | 1697 |
| 623 | Ga0395905_0613392 | 3300037471 | Bacteria | 990 |
| 624 | Ga0436364_0099500 | 3300037853 | Bacteria | 7864 |
| 625 | Ga0436364_0274704 | 3300037853 | Bacteria | 15930 |
| 626 | Ga0436364_1049383 | 3300037853 | Bacteria | 1991 |
| 627 | Ga0436364_1304558 | 3300037853 | Bacteria | 2248 |
| 628 | Ga0436364_1394580 | 3300037853 | Bacteria | 9566 |
| 629 | Ga0395901_0262301 | 3300038443 | Bacteria | 1798 |
| 630 | Ga0436365_0080097 | 3300039437 | Bacteria | 4156 |
| 631 | Ga0436365_0226989 | 3300039437 | Bacteria | 10155 |
| 632 | Ga0436365_0445234 | 3300039437 | Bacteria | 18009 |
| 633 | Ga0436365_1235428 | 3300039437 | Bacteria | 2976 |
| 634 | Ga0436363_0230425 | 3300039450 | Bacteria | 32869 |
| 635 | Ga0436362_1304003 | 3300039453 | Bacteria | 1408 |
| 636 | Ga0439461_0026884 | 3300041410 | Bacteria | 1177 |
| 637 | Ga0466963_0149897 | 3300044694 | Bacteria | 1619 |
| 638 | Ga0466963_0190038 | 3300044694 | Bacteria | 1434 |
| 639 | Ga0466960_0122728 | 3300044901 | Bacteria | 1362 |
| 640 | Ga0466958_0063911 | 3300045836 | Bacteria | 2245 |
| 641 | Ga0466967_0006871 | 3300045976 | Bacteria | 8124 |
| 642 | Ga0466967_0016490 | 3300045976 | Bacteria | 5829 |
| 643 | Ga0466967_0027220 | 3300045976 | Bacteria | 4753 |
| 644 | Ga0466967_0598337 | 3300045976 | Bacteria | 1088 |
| 645 | Ga0495592_0014225 | 3300046454 | Bacteria | 6045 |
| 646 | Ga0495592_0065139 | 3300046454 | Bacteria | 2669 |
| 647 | Ga0495592_0168597 | 3300046454 | Bacteria | 1501 |
| 648 | Ga0495592_0261188 | 3300046454 | Bacteria | 1140 |
| 649 | Ga0495592_0344915 | 3300046454 | Bacteria | 956 |
| 650 | Ga0495603_0000607 | 3300046455 | Bacteria | 20137 |
| 651 | Ga0495603_0087045 | 3300046455 | Bacteria | 1828 |
| 652 | Ga0495629_0020484 | 3300046459 | Bacteria | 4721 |
| 653 | Ga0495641_0018052 | 3300046461 | Bacteria | 3653 |
| 654 | Ga0495641_0039112 | 3300046461 | Bacteria | 2213 |
| 655 | Ga0495641_0112430 | 3300046461 | Bacteria | 1215 |
| 656 | Ga0495651_0002244 | 3300046462 | Bacteria | 14923 |
| 657 | Ga0495651_0009366 | 3300046462 | Bacteria | 7518 |
| 658 | Ga0495651_0099224 | 3300046462 | Bacteria | 2172 |
| 659 | Ga0495651_0168098 | 3300046462 | Bacteria | 1564 |
| 660 | Ga0495653_0000846 | 3300046463 | Bacteria | 23582 |
| 661 | Ga0495653_0002582 | 3300046463 | Bacteria | 14424 |
| 662 | Ga0495653_0016716 | 3300046463 | Bacteria | 5971 |
| 663 | Ga0495653_0018503 | 3300046463 | Bacteria | 5655 |
| 664 | Ga0495653_0029432 | 3300046463 | Bacteria | 4383 |
| 665 | Ga0495653_0034410 | 3300046463 | Bacteria | 4008 |
| 666 | Ga0495653_0192096 | 3300046463 | Bacteria | 1392 |
| 667 | Ga0495653_0286324 | 3300046463 | Bacteria | 1079 |
| 668 | Ga0495580_0035801 | 3300046472 | Bacteria | 3568 |
| 669 | Ga0495582_0004531 | 3300046473 | Bacteria | 7803 |
| 670 | Ga0495582_0069819 | 3300046473 | Bacteria | 1943 |
| 671 | Ga0495582_0131003 | 3300046473 | Bacteria | 1417 |
| 672 | Ga0495639_0002111 | 3300046475 | Bacteria | 8774 |
| 673 | Ga0495639_0042209 | 3300046475 | Bacteria | 2056 |
| 674 | Ga0495639_0141503 | 3300046475 | Bacteria | 1157 |
| 675 | Ga0495662_0006080 | 3300046476 | Bacteria | 6031 |
| 676 | Ga0495662_0009989 | 3300046476 | Bacteria | 4660 |
| 677 | Ga0495664_0006875 | 3300046477 | Bacteria | 6296 |
| 678 | Ga0495664_0318906 | 3300046477 | Bacteria | 937 |
| 679 | Ga0495584_0038168 | 3300046491 | Bacteria | 2428 |
| 680 | Ga0495594_0001729 | 3300046499 | Bacteria | 11329 |
| 681 | Ga0495596_0077150 | 3300046500 | Bacteria | 1294 |
| 682 | Ga0495608_0001741 | 3300046511 | Bacteria | 15558 |
| 683 | Ga0495608_0011846 | 3300046511 | Bacteria | 6068 |
| 684 | Ga0495608_0034267 | 3300046511 | Bacteria | 3428 |
| 685 | Ga0495608_0036852 | 3300046511 | Bacteria | 3290 |
| 686 | Ga0495618_0011652 | 3300046514 | Bacteria | 5335 |
| 687 | Ga0495618_0018660 | 3300046514 | Bacteria | 4260 |
| 688 | Ga0495618_0025614 | 3300046514 | Bacteria | 3661 |
| 689 | Ga0495628_0214967 | 3300046516 | Bacteria | 1445 |
| 690 | Ga0495628_0266116 | 3300046516 | Bacteria | 1276 |
| 691 | Ga0495630_0015268 | 3300046517 | Bacteria | 5605 |
| 692 | Ga0495630_0374521 | 3300046517 | Bacteria | 1090 |
| 693 | Ga0495630_0441323 | 3300046517 | Bacteria | 997 |
| 694 | Ga0495666_0000796 | 3300046526 | Bacteria | 14627 |
| 695 | Ga0495652_0038052 | 3300046529 | Bacteria | 4170 |
| 696 | Ga0495652_0045318 | 3300046529 | Bacteria | 3782 |
| 697 | Ga0495652_0070018 | 3300046529 | Bacteria | 2934 |
| 698 | Ga0495652_0080197 | 3300046529 | Bacteria | 2696 |
| 699 | Ga0495652_0099154 | 3300046529 | Bacteria | 2366 |
| 700 | Ga0495652_0442522 | 3300046529 | Bacteria | 911 |
| 701 | Ga0495665_0001759 | 3300046531 | Bacteria | 11661 |
| 702 | Ga0495665_0049482 | 3300046531 | Bacteria | 2228 |
| 703 | Ga0495665_0183715 | 3300046531 | Bacteria | 1086 |
| 704 | Ga0495640_0011158 | 3300046533 | Bacteria | 6917 |
| 705 | Ga0495640_0035037 | 3300046533 | Bacteria | 3555 |
| 706 | Ga0495640_0069145 | 3300046533 | Bacteria | 2375 |
| 707 | Ga0495640_0087838 | 3300046533 | Bacteria | 2056 |
| 708 | Ga0495640_0340410 | 3300046533 | Bacteria | 927 |
| 709 | Ga0495586_0001514 | 3300046535 | Bacteria | 12851 |
| 710 | Ga0495586_0053846 | 3300046535 | Bacteria | 2180 |
| 711 | Ga0495587_0020492 | 3300046536 | Bacteria | 4082 |
| 712 | Ga0495587_0090191 | 3300046536 | Bacteria | 1771 |
| 713 | Ga0495645_0183278 | 3300046543 | Bacteria | 1432 |
| 714 | Ga0495622_0038112 | 3300046557 | Bacteria | 2238 |
| 715 | Ga0495667_0008762 | 3300046559 | Bacteria | 6875 |
| 716 | Ga0495667_0031077 | 3300046559 | Bacteria | 3585 |
| 717 | Ga0495667_0141005 | 3300046559 | Bacteria | 1553 |
| 718 | Ga0495667_0167594 | 3300046559 | Bacteria | 1412 |
| 719 | Ga0495667_0307726 | 3300046559 | Bacteria | 1003 |
| 720 | Ga0495656_0077626 | 3300046615 | Bacteria | 1491 |
| 721 | Ga0495634_0005096 | 3300046642 | Bacteria | 10148 |
| 722 | Ga0495634_0012615 | 3300046642 | Bacteria | 6117 |
| 723 | Ga0495634_0022040 | 3300046642 | Bacteria | 4492 |
| 724 | Ga0495634_0112028 | 3300046642 | Bacteria | 1754 |
| 725 | Ga0495635_0003934 | 3300046663 | Bacteria | 10331 |
| 726 | Ga0495635_0033619 | 3300046663 | Bacteria | 3556 |
| 727 | Ga0495635_0110738 | 3300046663 | Bacteria | 1875 |
| 728 | Ga0495588_0099124 | 3300046674 | Bacteria | 1530 |
| 729 | Ga0495657_0002535 | 3300046675 | Bacteria | 15314 |
| 730 | Ga0495657_0014321 | 3300046675 | Bacteria | 5821 |
| 731 | Ga0495657_0018097 | 3300046675 | Bacteria | 5106 |
| 732 | Ga0495657_0022976 | 3300046675 | Bacteria | 4461 |
| 733 | Ga0495657_0024842 | 3300046675 | Bacteria | 4261 |
| 734 | Ga0495657_0098083 | 3300046675 | Bacteria | 1870 |
| 735 | Ga0495599_0020196 | 3300046678 | Bacteria | 4150 |
| 736 | Ga0495599_0046427 | 3300046678 | Bacteria | 2724 |
| 737 | Ga0495599_0075159 | 3300046678 | Bacteria | 2110 |
| 738 | Ga0495623_0017512 | 3300046679 | Bacteria | 4629 |
| 739 | Ga0495623_0078914 | 3300046679 | Bacteria | 2040 |
| 740 | Ga0495623_0087429 | 3300046679 | Bacteria | 1920 |
| 741 | Ga0495623_0149329 | 3300046679 | Bacteria | 1383 |
| 742 | Ga0495646_0009623 | 3300046680 | Bacteria | 6134 |
| 743 | Ga0495646_0030180 | 3300046680 | Bacteria | 3386 |
| 744 | Ga0495646_0032235 | 3300046680 | Bacteria | 3262 |
| 745 | Ga0495646_0096960 | 3300046680 | Bacteria | 1695 |
| 746 | Ga0495646_0137222 | 3300046680 | Bacteria | 1371 |
| 747 | Ga0495646_0176159 | 3300046680 | Bacteria | 1176 |
| 748 | Ga0495647_0016956 | 3300046681 | Bacteria | 2572 |
| 749 | Ga0495647_0037907 | 3300046681 | Bacteria | 1821 |
| 750 | Ga0495658_0022413 | 3300046683 | Bacteria | 3339 |
| 751 | Ga0495613_0011338 | 3300046689 | Bacteria | 6623 |
| 752 | Ga0495613_0033171 | 3300046689 | Bacteria | 3837 |
| 753 | Ga0495613_0038008 | 3300046689 | Bacteria | 3568 |
| 754 | Ga0495613_0041387 | 3300046689 | Bacteria | 3412 |
| 755 | Ga0495624_0005144 | 3300046690 | Bacteria | 9447 |
| 756 | Ga0495600_0007628 | 3300046809 | Bacteria | 6628 |
| 757 | Ga0495600_0074040 | 3300046809 | Bacteria | 2223 |
| 758 | Ga0495600_0080505 | 3300046809 | Bacteria | 2126 |
| 759 | Ga0495600_0093876 | 3300046809 | Bacteria | 1956 |
| 760 | Ga0495581_0010675 | 3300047315 | Bacteria | 5309 |
| 761 | Ga0495581_0062102 | 3300047315 | Bacteria | 2158 |
| 762 | Ga0495581_0134371 | 3300047315 | Bacteria | 1442 |
| 763 | Ga0495604_0002573 | 3300047317 | Bacteria | 14521 |
| 764 | Ga0495604_0082400 | 3300047317 | Bacteria | 2406 |
| 765 | Ga0495604_0180634 | 3300047317 | Bacteria | 1476 |
| 766 | Ga0495674_0000257 | 3300047319 | Bacteria | 45119 |
| 767 | Ga0495674_0031264 | 3300047319 | Bacteria | 4837 |
| 768 | Ga0495674_0235212 | 3300047319 | Bacteria | 1511 |
| 769 | Ga0495676_0005541 | 3300047321 | Bacteria | 11580 |
| 770 | Ga0495676_0008224 | 3300047321 | Bacteria | 9567 |
| 771 | Ga0495676_0038979 | 3300047321 | Bacteria | 3941 |
| 772 | Ga0495680_0003922 | 3300047322 | Bacteria | 14390 |
| 773 | Ga0495680_0005834 | 3300047322 | Bacteria | 11522 |
| 774 | Ga0495680_0015599 | 3300047322 | Bacteria | 6551 |
| 775 | Ga0495680_0026095 | 3300047322 | Bacteria | 4823 |
| 776 | Ga0495680_0036051 | 3300047322 | Bacteria | 3976 |
| 777 | Ga0495680_0104034 | 3300047322 | Bacteria | 2112 |
| 778 | Ga0495680_0123201 | 3300047322 | Bacteria | 1912 |
| 779 | Ga0495675_0008400 | 3300047444 | Bacteria | 6393 |
| 780 | Ga0495675_0081995 | 3300047444 | Bacteria | 2031 |
| 781 | Ga0495675_0141542 | 3300047444 | Bacteria | 1491 |
| 782 | Ga0495684_0000981 | 3300047471 | Bacteria | 23174 |
| 783 | Ga0495684_0005341 | 3300047471 | Bacteria | 10001 |
| 784 | Ga0495684_0046663 | 3300047471 | Bacteria | 3313 |
| 785 | Ga0495684_0058671 | 3300047471 | Bacteria | 2931 |
| 786 | Ga0495684_0322092 | 3300047471 | Bacteria | 1105 |
| 787 | Ga0495602_0010703 | 3300048088 | Bacteria | 9512 |
| 788 | Ga0495602_0036428 | 3300048088 | Bacteria | 4579 |
| 789 | Ga0495602_0091288 | 3300048088 | Bacteria | 2527 |
| 790 | Ga0495602_0288950 | 3300048088 | Bacteria | 1204 |
| 791 | Ga0495602_0341206 | 3300048088 | Bacteria | 1083 |
| 792 | Ga0495614_0012996 | 3300048089 | Bacteria | 3650 |
| 793 | Ga0496100_0008167 | 3300048903 | Bacteria | 5829 |
| 794 | Ga0496100_0010081 | 3300048903 | Bacteria | 5338 |
| 795 | Ga0496100_0055141 | 3300048903 | Bacteria | 2596 |
| 796 | Ga0496101_0004103 | 3300048904 | Bacteria | 9113 |
| 797 | Ga0496101_0030252 | 3300048904 | Bacteria | 3795 |
| 798 | Ga0496101_0040032 | 3300048904 | Bacteria | 3337 |
| 799 | Ga0496101_0126672 | 3300048904 | Bacteria | 1936 |
| 800 | Ga0496102_0001623 | 3300048905 | Bacteria | 19807 |
| 801 | Ga0496102_0005668 | 3300048905 | Bacteria | 10601 |
| 802 | Ga0496102_0104765 | 3300048905 | Bacteria | 2631 |
| 803 | Ga0496102_0112017 | 3300048905 | Bacteria | 2544 |
| 804 | Ga0496103_0006938 | 3300048906 | Bacteria | 6762 |
| 805 | Ga0496103_0053378 | 3300048906 | Bacteria | 2505 |
| 806 | Ga0496103_0080597 | 3300048906 | Bacteria | 2047 |
| 807 | Ga0496103_0205476 | 3300048906 | Bacteria | 1267 |
| 808 | Ga0496103_0212647 | 3300048906 | Bacteria | 1243 |
| 809 | Ga0496104_0000254 | 3300048907 | Bacteria | 47479 |
| 810 | Ga0496104_0008860 | 3300048907 | Bacteria | 8943 |
| 811 | Ga0496104_0014694 | 3300048907 | Bacteria | 7073 |
| 812 | Ga0496104_0015680 | 3300048907 | Bacteria | 6872 |
| 813 | Ga0496104_0031489 | 3300048907 | Bacteria | 4933 |
| 814 | Ga0496104_0036667 | 3300048907 | Bacteria | 4584 |
| 815 | Ga0496104_0047252 | 3300048907 | Bacteria | 4057 |
| 816 | Ga0496104_0065886 | 3300048907 | Bacteria | 3438 |
| 817 | Ga0496104_0229033 | 3300048907 | Bacteria | 1770 |
| 818 | Ga0496104_0347742 | 3300048907 | Bacteria | 1395 |
| 819 | Ga0496104_0386762 | 3300048907 | Bacteria | 1311 |
| 820 | Ga0496104_0418885 | 3300048907 | Bacteria | 1251 |
| 821 | Ga0496105_0000055 | 3300048908 | Bacteria | 88389 |
| 822 | Ga0496105_0003044 | 3300048908 | Bacteria | 12325 |
| 823 | Ga0496105_0010670 | 3300048908 | Bacteria | 7227 |
| 824 | Ga0496105_0014256 | 3300048908 | Bacteria | 6325 |
| 825 | Ga0496105_0032850 | 3300048908 | Bacteria | 4258 |
| 826 | Ga0496105_0042293 | 3300048908 | Bacteria | 3755 |
| 827 | Ga0496105_0042707 | 3300048908 | Bacteria | 3739 |
| 828 | Ga0496105_0052598 | 3300048908 | Bacteria | 3364 |
| 829 | Ga0496105_0231037 | 3300048908 | Bacteria | 1503 |
| 830 | Ga0496106_0011270 | 3300048909 | Bacteria | 6617 |
| 831 | Ga0496106_0033323 | 3300048909 | Bacteria | 3843 |
| 832 | Ga0496106_0040300 | 3300048909 | Bacteria | 3497 |
| 833 | Ga0496106_0101550 | 3300048909 | Bacteria | 2231 |
| 834 | Ga0496106_0121000 | 3300048909 | Bacteria | 2046 |
| 835 | Ga0496107_0009801 | 3300048910 | Bacteria | 6643 |
| 836 | Ga0496107_0023308 | 3300048910 | Bacteria | 4377 |
| 837 | Ga0496107_0033007 | 3300048910 | Bacteria | 3702 |
| 838 | Ga0496107_0081402 | 3300048910 | Bacteria | 2361 |
| 839 | Ga0496108_0005384 | 3300048911 | Bacteria | 10344 |
| 840 | Ga0496108_0005962 | 3300048911 | Bacteria | 9871 |
| 841 | Ga0496108_0009422 | 3300048911 | Bacteria | 7907 |
| 842 | Ga0496108_0032706 | 3300048911 | Bacteria | 4320 |
| 843 | Ga0496108_0038778 | 3300048911 | Bacteria | 3970 |
| 844 | Ga0496108_0107817 | 3300048911 | Bacteria | 2379 |
| 845 | Ga0496108_0146048 | 3300048911 | Bacteria | 2039 |
| 846 | Ga0496108_0162522 | 3300048911 | Bacteria | 1930 |
| 847 | Ga0496108_0219488 | 3300048911 | Bacteria | 1652 |
| 848 | Ga0496108_0326619 | 3300048911 | Bacteria | 1337 |
| 849 | Ga0496108_0522629 | 3300048911 | Bacteria | 1036 |
| 850 | Ga0496109_0001140 | 3300048912 | Bacteria | 22090 |
| 851 | Ga0496109_0005718 | 3300048912 | Bacteria | 10407 |
| 852 | Ga0496109_0012060 | 3300048912 | Bacteria | 7445 |
| 853 | Ga0496109_0076080 | 3300048912 | Bacteria | 3087 |
| 854 | Ga0496109_0080461 | 3300048912 | Bacteria | 3001 |
| 855 | Ga0496109_0160880 | 3300048912 | Bacteria | 2104 |
| 856 | Ga0496109_0165713 | 3300048912 | Bacteria | 2071 |
| 857 | Ga0496109_0231858 | 3300048912 | Bacteria | 1737 |
| 858 | Ga0496109_0303254 | 3300048912 | Bacteria | 1506 |
| 859 | Ga0496109_0307428 | 3300048912 | Bacteria | 1495 |
| 860 | Ga0496110_0000306 | 3300048913 | Bacteria | 32370 |
| 861 | Ga0496110_0002326 | 3300048913 | Bacteria | 14207 |
| 862 | Ga0496110_0014402 | 3300048913 | Bacteria | 6564 |
| 863 | Ga0496110_0029828 | 3300048913 | Bacteria | 4699 |
| 864 | Ga0496110_0034589 | 3300048913 | Bacteria | 4378 |
| 865 | Ga0496110_0049253 | 3300048913 | Bacteria | 3695 |
| 866 | Ga0496110_0053846 | 3300048913 | Bacteria | 3538 |
| 867 | Ga0496110_0118572 | 3300048913 | Bacteria | 2383 |
| 868 | Ga0496110_0201054 | 3300048913 | Bacteria | 1810 |
| 869 | Ga0496110_0209365 | 3300048913 | Bacteria | 1772 |
| 870 | Ga0496110_0281699 | 3300048913 | Bacteria | 1514 |
| 871 | Ga0496111_0000166 | 3300048914 | Bacteria | 29882 |
| 872 | Ga0496111_0001388 | 3300048914 | Bacteria | 13743 |
| 873 | Ga0496111_0019761 | 3300048914 | Bacteria | 4684 |
| 874 | Ga0496111_0055766 | 3300048914 | Bacteria | 2858 |
| 875 | Ga0496111_0072893 | 3300048914 | Bacteria | 2500 |
| 876 | Ga0496111_0104494 | 3300048914 | Bacteria | 2083 |
| 877 | Ga0496111_0165732 | 3300048914 | Bacteria | 1641 |
| 878 | Ga0496111_0326644 | 3300048914 | Bacteria | 1136 |
| 879 | Ga0496112_0008060 | 3300048915 | Bacteria | 9402 |
| 880 | Ga0496112_0157257 | 3300048915 | Bacteria | 2240 |
| 881 | Ga0496112_0216107 | 3300048915 | Bacteria | 1873 |
| 882 | Ga0496112_0526192 | 3300048915 | Bacteria | 1117 |
| 883 | Ga0496113_0002213 | 3300048916 | Bacteria | 11219 |
| 884 | Ga0496113_0025416 | 3300048916 | Bacteria | 4221 |
| 885 | Ga0496113_0037152 | 3300048916 | Bacteria | 3572 |
| 886 | Ga0496113_0099307 | 3300048916 | Bacteria | 2254 |
| 887 | Ga0496113_0147625 | 3300048916 | Bacteria | 1853 |
| 888 | Ga0496113_0292434 | 3300048916 | Bacteria | 1303 |
| 889 | Ga0496113_0351406 | 3300048916 | Bacteria | 1183 |
| 890 | Ga0496113_0580610 | 3300048916 | Bacteria | 898 |
| 891 | Ga0496114_0000202 | 3300048917 | Bacteria | 43512 |
| 892 | Ga0496114_0000256 | 3300048917 | Bacteria | 38442 |
| 893 | Ga0496114_0004795 | 3300048917 | Bacteria | 10531 |
| 894 | Ga0496114_0005333 | 3300048917 | Bacteria | 10049 |
| 895 | Ga0496114_0015003 | 3300048917 | Bacteria | 6229 |
| 896 | Ga0496114_0261163 | 3300048917 | Bacteria | 1525 |
| 897 | Ga0496114_0281122 | 3300048917 | Bacteria | 1467 |
| 898 | Ga0496115_0011279 | 3300048918 | Bacteria | 6696 |
| 899 | Ga0496115_0028781 | 3300048918 | Bacteria | 4357 |
| 900 | Ga0496115_0037402 | 3300048918 | Bacteria | 3846 |
| 901 | Ga0496115_0039681 | 3300048918 | Bacteria | 3740 |
| 902 | Ga0496115_0071198 | 3300048918 | Bacteria | 2820 |
| 903 | Ga0496115_0132465 | 3300048918 | Bacteria | 2055 |
| 904 | Ga0496126_0168384 | 3300048929 | Bacteria | 1868 |
| 905 | Ga0501031_0009747 | 3300049568 | Bacteria | 6253 |
| 906 | Ga0501031_0034162 | 3300049568 | Bacteria | 3319 |
| 907 | Ga0501031_0102885 | 3300049568 | Bacteria | 1864 |
| 908 | Ga0501031_0117264 | 3300049568 | Bacteria | 1739 |
| 909 | Ga0501032_0067996 | 3300049569 | Bacteria | 2379 |
| 910 | Ga0501032_0138997 | 3300049569 | Bacteria | 1600 |
| 911 | Ga0501033_0001904 | 3300049570 | Bacteria | 18165 |
| 912 | Ga0501033_0006376 | 3300049570 | Bacteria | 9243 |
| 913 | Ga0501034_0024537 | 3300049571 | Bacteria | 6133 |
| 914 | Ga0501034_0103079 | 3300049571 | Bacteria | 2846 |
| 915 | Ga0501036_0012610 | 3300049572 | Bacteria | 7010 |
| 916 | Ga0501036_0083701 | 3300049572 | Bacteria | 2697 |
| 917 | Ga0501036_0604462 | 3300049572 | Bacteria | 909 |
| 918 | Ga0501037_0028422 | 3300049573 | Bacteria | 4130 |
| 919 | Ga0501037_0098518 | 3300049573 | Bacteria | 2112 |
| 920 | Ga0501037_0159680 | 3300049573 | Bacteria | 1607 |
| 921 | Ga0501038_0011586 | 3300049574 | Bacteria | 8044 |
| 922 | Ga0501038_0128197 | 3300049574 | Bacteria | 2086 |
| 923 | Ga0501038_0152100 | 3300049574 | Bacteria | 1886 |
| 924 | Ga0501038_0287351 | 3300049574 | Bacteria | 1293 |
| 925 | Ga0501039_0001500 | 3300049575 | Bacteria | 17173 |
| 926 | Ga0501039_0184855 | 3300049575 | Bacteria | 1639 |
| 927 | Ga0501039_0226981 | 3300049575 | Bacteria | 1468 |
| 928 | Ga0501039_0285534 | 3300049575 | Bacteria | 1297 |
| 929 | Ga0501040_0004386 | 3300049576 | Bacteria | 9173 |
| 930 | Ga0501040_0007052 | 3300049576 | Bacteria | 7282 |
| 931 | Ga0501040_0021853 | 3300049576 | Bacteria | 4278 |
| 932 | Ga0501040_0066861 | 3300049576 | Bacteria | 2476 |
| 933 | Ga0501041_0071764 | 3300049577 | Bacteria | 2126 |
| 934 | Ga0501041_0363211 | 3300049577 | Bacteria | 915 |
| 935 | Ga0501042_0092048 | 3300049578 | Bacteria | 2177 |
| 936 | Ga0501042_0131689 | 3300049578 | Bacteria | 1802 |
| 937 | Ga0501042_0142565 | 3300049578 | Bacteria | 1727 |
| 938 | Ga0501042_0479335 | 3300049578 | Bacteria | 903 |
| 939 | Ga0501043_0008340 | 3300049579 | Bacteria | 8157 |
| 940 | Ga0501043_0138894 | 3300049579 | Bacteria | 1903 |
| 941 | Ga0501043_0138990 | 3300049579 | Bacteria | 1903 |
| 942 | Ga0501043_0208922 | 3300049579 | Bacteria | 1513 |
| 943 | Ga0501043_0498193 | 3300049579 | Bacteria | 910 |
| 944 | Ga0501046_0043834 | 3300049580 | Bacteria | 3560 |
| 945 | Ga0501046_0056098 | 3300049580 | Bacteria | 3094 |
| 946 | Ga0501046_0241658 | 3300049580 | Bacteria | 1332 |
| 947 | Ga0501046_0475414 | 3300049580 | Bacteria | 897 |
| 948 | Ga0501047_0041964 | 3300049581 | Bacteria | 4421 |
| 949 | Ga0501047_0399393 | 3300049581 | Bacteria | 1207 |
| 950 | Ga0501048_0051621 | 3300049582 | Bacteria | 2927 |
| 951 | Ga0501048_0054446 | 3300049582 | Bacteria | 2842 |
| 952 | Ga0501048_0131295 | 3300049582 | Bacteria | 1770 |
| 953 | Ga0501067_0088735 | 3300049583 | Bacteria | 1716 |
| 954 | Ga0501067_0101054 | 3300049583 | Bacteria | 1602 |
| 955 | Ga0501067_0107324 | 3300049583 | Bacteria | 1552 |
| 956 | Ga0501068_0007821 | 3300049584 | Bacteria | 5921 |
| 957 | Ga0501068_0014213 | 3300049584 | Bacteria | 4547 |
| 958 | Ga0501068_0119082 | 3300049584 | Bacteria | 1645 |
| 959 | Ga0501068_0155979 | 3300049584 | Bacteria | 1437 |
| 960 | Ga0501069_0056429 | 3300049585 | Bacteria | 2188 |
| 961 | Ga0501070_0008311 | 3300049586 | Bacteria | 8769 |
| 962 | Ga0501070_0042762 | 3300049586 | Bacteria | 3773 |
| 963 | Ga0501070_0046448 | 3300049586 | Bacteria | 3611 |
| 964 | Ga0501070_0056883 | 3300049586 | Bacteria | 3242 |
| 965 | Ga0501070_0220248 | 3300049586 | Bacteria | 1556 |
| 966 | Ga0501070_0444296 | 3300049586 | Bacteria | 1046 |
| 967 | Ga0501071_0044122 | 3300049587 | Bacteria | 3198 |
| 968 | Ga0501071_0053022 | 3300049587 | Bacteria | 2924 |
| 969 | Ga0501071_0103323 | 3300049587 | Bacteria | 2102 |
| 970 | Ga0501071_0268722 | 3300049587 | Bacteria | 1289 |
| 971 | Ga0501071_0318678 | 3300049587 | Bacteria | 1180 |
| 972 | Ga0501072_0006286 | 3300049588 | Bacteria | 9042 |
| 973 | Ga0501072_0038369 | 3300049588 | Bacteria | 3759 |
| 974 | Ga0501072_0140543 | 3300049588 | Bacteria | 1925 |
| 975 | Ga0501072_0308336 | 3300049588 | Bacteria | 1258 |
| 976 | Ga0501072_0329461 | 3300049588 | Bacteria | 1213 |
| 977 | Ga0501072_0343604 | 3300049588 | Bacteria | 1185 |
| 978 | Ga0501073_0027805 | 3300049589 | Bacteria | 4042 |
| 979 | Ga0501073_0104938 | 3300049589 | Bacteria | 1961 |
| 980 | Ga0501073_0137950 | 3300049589 | Bacteria | 1690 |
| 981 | Ga0501073_0140357 | 3300049589 | Bacteria | 1674 |
| 982 | Ga0501073_0207375 | 3300049589 | Bacteria | 1354 |
| 983 | Ga0501074_0003457 | 3300049590 | Bacteria | 11205 |
| 984 | Ga0501074_0022511 | 3300049590 | Bacteria | 4578 |
| 985 | Ga0501074_0038175 | 3300049590 | Bacteria | 3481 |
| 986 | Ga0501074_0073800 | 3300049590 | Bacteria | 2450 |
| 987 | Ga0501074_0146247 | 3300049590 | Bacteria | 1690 |
| 988 | Ga0501074_0205490 | 3300049590 | Bacteria | 1403 |
| 989 | Ga0501075_0001147 | 3300049591 | Bacteria | 17101 |
| 990 | Ga0501075_0006209 | 3300049591 | Bacteria | 8212 |
| 991 | Ga0501075_0084598 | 3300049591 | Bacteria | 2403 |
| 992 | Ga0501075_0184033 | 3300049591 | Bacteria | 1593 |
| 993 | Ga0501075_0245045 | 3300049591 | Bacteria | 1366 |
| 994 | Ga0501075_0440695 | 3300049591 | Bacteria | 993 |
| 995 | Ga0501076_0002038 | 3300049592 | Bacteria | 13830 |
| 996 | Ga0501076_0023268 | 3300049592 | Bacteria | 4774 |
| 997 | Ga0501076_0102633 | 3300049592 | Bacteria | 2306 |
| 998 | Ga0501076_0113067 | 3300049592 | Bacteria | 2196 |
| 999 | Ga0501076_0165298 | 3300049592 | Bacteria | 1803 |
| 1000 | Ga0501077_0000293 | 3300049593 | Bacteria | 29649 |
| 1001 | Ga0501077_0088749 | 3300049593 | Bacteria | 1960 |
| 1002 | Ga0501077_0256495 | 3300049593 | Bacteria | 1112 |
| 1003 | Ga0501077_0302027 | 3300049593 | Bacteria | 1020 |
| 1004 | Ga0501079_0001626 | 3300049741 | Bacteria | 16009 |
| 1005 | Ga0501079_0003249 | 3300049741 | Bacteria | 11909 |
| 1006 | Ga0501079_0044178 | 3300049741 | Bacteria | 3439 |
| 1007 | Ga0501079_0140983 | 3300049741 | Bacteria | 1878 |
| 1008 | Ga0501079_0163986 | 3300049741 | Bacteria | 1733 |
| 1009 | Ga0501079_0171054 | 3300049741 | Bacteria | 1694 |
| 1010 | Ga0501080_0169127 | 3300049742 | Bacteria | 2016 |
| 1011 | Ga0501080_0319801 | 3300049742 | Bacteria | 1405 |
| 1012 | Ga0501080_0421610 | 3300049742 | Bacteria | 1199 |
| 1013 | Ga0501081_0005676 | 3300049743 | Bacteria | 8075 |
| 1014 | Ga0501081_0007144 | 3300049743 | Bacteria | 7259 |
| 1015 | Ga0501081_0015412 | 3300049743 | Bacteria | 5044 |
| 1016 | Ga0501083_0024804 | 3300049744 | Bacteria | 4154 |
| 1017 | Ga0501083_0054197 | 3300049744 | Bacteria | 2691 |
| 1018 | Ga0501083_0226907 | 3300049744 | Bacteria | 1216 |
| 1019 | Ga0501035_0003489 | 3300049822 | Bacteria | 15039 |
| 1020 | Ga0501035_0042761 | 3300049822 | Bacteria | 4086 |
| 1021 | Ga0501035_0255617 | 3300049822 | Bacteria | 1486 |
| 1022 | Ga0501035_0357676 | 3300049822 | Bacteria | 1221 |
| 1023 | Ga0501044_0399376 | 3300049823 | Bacteria | 1287 |
| 1024 | Ga0501045_0000645 | 3300049824 | Bacteria | 22078 |
| 1025 | Ga0501045_0009173 | 3300049824 | Bacteria | 6913 |
| 1026 | Ga0501045_0010473 | 3300049824 | Bacteria | 6494 |
| 1027 | Ga0501045_0027422 | 3300049824 | Bacteria | 4104 |
| 1028 | Ga0501045_0059058 | 3300049824 | Bacteria | 2809 |
| 1029 | Ga0501045_0063464 | 3300049824 | Bacteria | 2711 |
| 1030 | nmdc:mga05p37_5114_c1 | 3300050507 | Bacteria | 15383 |
| 1031 | nmdc:mga05p37_71538_c1 | 3300050507 | Bacteria | 4267 |
| 1032 | nmdc:mga09592_15116_c1 | 3300050508 | Bacteria | 6307 |
| 1033 | nmdc:mga09592_661185_c1 | 3300050508 | Bacteria | 892 |
| 1034 | nmdc:mga0qj67_22953_c1 | 3300050509 | Bacteria | 4794 |
| 1035 | nmdc:mga0qj67_419_c1 | 3300050509 | Bacteria | 4577 |
| 1036 | nmdc:mga06r32_43563_c1 | 3300050510 | Bacteria | 4270 |
| 1037 | nmdc:mga06r32_481_c1 | 3300050510 | Bacteria | 30864 |
| 1038 | nmdc:mga06r32_63463_c1 | 3300050510 | Bacteria | 3561 |
| 1039 | nmdc:mga06r32_69551_c1 | 3300050510 | Bacteria | 3402 |
| 1040 | nmdc:mga08y16_37460_c1 | 3300050511 | Bacteria | 5093 |
| 1041 | nmdc:mga08x19_324206_c1 | 3300050514 | Bacteria | 1072 |
| 1042 | nmdc:mga0a205_237419_c1 | 3300050515 | Bacteria | 1704 |
| 1043 | Ga0495601_0227358 | 3300053077 | Bacteria | 1219 |
| 1044 | Ga0495601_0263014 | 3300053077 | Bacteria | 1126 |
| 1045 | Ga0495601_0503704 | 3300053077 | Bacteria | 781 |
| 1046 | Ga0495595_0054679 | 3300053084 | Bacteria | 1857 |
| 1047 | Ga0495595_0102418 | 3300053084 | Bacteria | 1383 |
| 1048 | Ga0495619_0000657 | 3300053085 | Bacteria | 22715 |
| 1049 | Ga0495619_0002299 | 3300053085 | Bacteria | 12587 |
| 1050 | Ga0495619_0039046 | 3300053085 | Bacteria | 3098 |
| 1051 | Ga0495619_0161072 | 3300053085 | Bacteria | 1550 |
| 1052 | Ga0501084_0019206 | 3300054114 | Bacteria | 5692 |
| 1053 | Ga0501084_0022285 | 3300054114 | Bacteria | 5286 |
| 1054 | Ga0501084_0035743 | 3300054114 | Bacteria | 4153 |
| 1055 | Ga0501084_0058566 | 3300054114 | Bacteria | 3223 |
| 1056 | Ga0501084_0114451 | 3300054114 | Bacteria | 2268 |
| 1057 | Ga0501084_0132389 | 3300054114 | Bacteria | 2099 |
| 1058 | Ga0501082_0003497 | 3300060353 | Bacteria | 13703 |
| 1059 | Ga0501082_0007361 | 3300060353 | Bacteria | 9498 |
| 1060 | Ga0501082_0020391 | 3300060353 | Bacteria | 5714 |
| 1061 | Ga0501082_0024039 | 3300060353 | Bacteria | 5255 |
| 1062 | Ga0501082_0034967 | 3300060353 | Bacteria | 4331 |
| 1063 | Ga0501082_0175674 | 3300060353 | Bacteria | 1862 |
| 1064 | Ga0501082_0223850 | 3300060353 | Bacteria | 1637 |
| 1065 | Ga0501082_0604034 | 3300060353 | Bacteria | 960 |
| 1066 | Ga0501082_0737920 | 3300060353 | Bacteria | 862 |
| 1067 | Ga0530510_0000475 | 3300061734 | Bacteria | 25733 |
| 1068 | Ga0530510_0009115 | 3300061734 | Bacteria | 6954 |
| 1069 | Ga0530510_0305998 | 3300061734 | Bacteria | 1190 |
| 1070 | Ga0530510_0561438 | 3300061734 | Bacteria | 867 |
| 1071 | Ga0070707_100011762 | |||
| 1072 | JGI24743J22301_10016999 | |||
| 1073 | Ga0070658_10031578 | |||
| 1074 | Ga0070676_10008579 | |||
| 1075 | Ga0070683_100024182 | |||
| 1076 | Ga0070683_100035573 | |||
| 1077 | Ga0070683_100184669 | |||
| 1078 | Ga0070683_100572869 | |||
| 1079 | Ga0070690_100033637 | |||
| 1080 | Ga0070677_10036674 | |||
| 1081 | Ga0070677_10116912 | |||
| 1082 | Ga0068869_100077105 | |||
| 1083 | Ga0070666_10238638 | |||
| 1084 | Ga0070680_100012784 | |||
| 1085 | Ga0070680_100035628 | |||
| 1086 | Ga0070680_100058113 | |||
| 1087 | Ga0070680_100367038 | |||
| 1088 | Ga0070682_100001115 | |||
| 1089 | Ga0070682_100020568 | |||
| 1090 | Ga0070682_100022722 | |||
| 1091 | Ga0070682_100028402 | |||
| 1092 | Ga0070682_100047731 | |||
| 1093 | Ga0068868_100037538 | |||
| 1094 | Ga0068868_100060994 | |||
| 1095 | Ga0068868_100127828 | |||
| 1096 | Ga0068868_100141468 | |||
| 1097 | Ga0070660_100027045 | |||
| 1098 | Ga0070660_100075574 | |||
| 1099 | Ga0070660_100325809 | |||
| 1100 | Ga0070689_100015483 | |||
| 1101 | Ga0070689_100090077 | |||
| 1102 | Ga0070691_10020124 | |||
| 1103 | Ga0070691_10085721 | |||
| 1104 | Ga0070687_100037843 | |||
| 1105 | Ga0070687_100060290 | |||
| 1106 | Ga0070687_100105148 | |||
| 1107 | Ga0070661_100034847 | |||
| 1108 | Ga0070661_100205317 | |||
| 1109 | Ga0070661_100303886 | |||
| 1110 | Ga0070692_10000680 | |||
| 1111 | Ga0070668_100023742 | |||
| 1112 | Ga0070668_100110219 | |||
| 1113 | Ga0070669_100049735 | |||
| 1114 | Ga0070671_100077520 | |||
| 1115 | Ga0070671_100108597 | |||
| 1116 | Ga0070671_100166425 | |||
| 1117 | Ga0070671_100339114 | |||
| 1118 | Ga0070671_100630215 | |||
| 1119 | Ga0070674_100019942 | |||
| 1120 | Ga0070673_100001554 | |||
| 1121 | Ga0070673_100030569 | |||
| 1122 | Ga0070673_100205072 | |||
| 1123 | Ga0070688_100004156 | |||
| 1124 | Ga0070688_100153333 | |||
| 1125 | Ga0070659_100065518 | |||
| 1126 | Ga0070659_100127468 | |||
| 1127 | Ga0070659_100406559 | |||
| 1128 | Ga0070667_100185328 | |||
| 1129 | Ga0070709_10229597 | |||
| 1130 | Ga0070709_10256198 | |||
| 1131 | Ga0070709_10328457 | |||
| 1132 | Ga0070714_100005004 | |||
| 1133 | Ga0070714_100022763 | |||
| 1134 | Ga0070714_100025927 | |||
| 1135 | Ga0070714_100057117 | |||
| 1136 | Ga0070714_100094541 | |||
| 1137 | Ga0070714_100094776 | |||
| 1138 | Ga0070714_100350997 | |||
| 1139 | Ga0070714_100387008 | |||
| 1140 | Ga0070713_100026994 | |||
| 1141 | Ga0070713_100039538 | |||
| 1142 | Ga0070713_100039539 | |||
| 1143 | Ga0070713_100051557 | |||
| 1144 | Ga0070713_100051620 | |||
| 1145 | Ga0070713_100153435 | |||
| 1146 | Ga0070713_100157429 | |||
| 1147 | Ga0070713_100270683 | |||
| 1148 | Ga0070713_100292501 | |||
| 1149 | Ga0070713_100343374 | |||
| 1150 | Ga0070713_100498029 | |||
| 1151 | Ga0070710_10148799 | |||
| 1152 | Ga0070710_10154861 | |||
| 1153 | Ga0070710_10374976 | |||
| 1154 | Ga0070701_10001431 | |||
| 1155 | Ga0070701_10015879 | |||
| 1156 | Ga0070701_10030589 | |||
| 1157 | Ga0070701_10106211 | |||
| 1158 | Ga0070711_100078667 | |||
| 1159 | Ga0070711_100108594 | |||
| 1160 | Ga0070711_100211749 | |||
| 1161 | Ga0070700_100006064 | |||
| 1162 | Ga0070694_100019267 | |||
| 1163 | Ga0070694_100260119 | |||
| 1164 | Ga0070694_100297064 | |||
| 1165 | Ga0070708_100032029 | |||
| 1166 | Ga0070663_100010363 | |||
| 1167 | Ga0070663_100017685 | |||
| 1168 | Ga0070663_100029866 | |||
| 1169 | Ga0070663_100374628 | |||
| 1170 | Ga0070678_100001369 | |||
| 1171 | Ga0070678_100016846 | |||
| 1172 | Ga0070678_100172324 | |||
| 1173 | Ga0070662_100116871 | |||
| 1174 | Ga0070662_100125211 | |||
| 1175 | Ga0070681_10018491 | |||
| 1176 | Ga0070681_10041048 | |||
| 1177 | Ga0070681_10073782 | |||
| 1178 | Ga0070681_10092314 | |||
| 1179 | Ga0070681_10110043 | |||
| 1180 | Ga0068867_100110155 | |||
| 1181 | Ga0068867_100452683 | |||
| 1182 | Ga0070685_10002395 | |||
| 1183 | Ga0070706_100009548 | |||
| 1184 | Ga0070706_100619061 | |||
| 1185 | Ga0070707_100336942 | |||
| 1186 | Ga0070698_100001275 | |||
| 1187 | Ga0070698_100176229 | |||
| 1188 | Ga0070699_100012479 | |||
| 1189 | Ga0070699_100053961 | |||
| 1190 | Ga0070699_100057204 | |||
| 1191 | Ga0070679_100023595 | |||
| 1192 | Ga0070679_100030247 | |||
| 1193 | Ga0070679_100047803 | |||
| 1194 | Ga0070679_100061319 | |||
| 1195 | Ga0070679_100124243 | |||
| 1196 | Ga0070684_100000984 | |||
| 1197 | Ga0070684_100009376 | |||
| 1198 | Ga0070684_100038452 | |||
| 1199 | Ga0070684_100038871 | |||
| 1200 | Ga0070684_100071619 | |||
| 1201 | Ga0070684_100094680 | |||
| 1202 | Ga0070684_100183198 | |||
| 1203 | Ga0070684_100240561 | |||
| 1204 | Ga0070684_100542580 | |||
| 1205 | Ga0070684_100727333 | |||
| 1206 | Ga0070697_100037905 | |||
| 1207 | Ga0068853_100087029 | |||
| 1208 | Ga0068853_100087337 | |||
| 1209 | Ga0070672_100063501 | |||
| 1210 | Ga0070672_100068531 | |||
| 1211 | Ga0070672_100110123 | |||
| 1212 | Ga0070686_100015215 | |||
| 1213 | Ga0070695_100020800 | |||
| 1214 | Ga0070695_100349009 | |||
| 1215 | Ga0070696_100053705 | |||
| 1216 | Ga0070696_100053925 | |||
| 1217 | Ga0070693_100024538 | |||
| 1218 | Ga0070693_100091457 | |||
| 1219 | Ga0070665_100000229 | |||
| 1220 | Ga0070704_100012165 | |||
| 1221 | Ga0070704_100044570 | |||
| 1222 | Ga0070704_100228210 | |||
| 1223 | Ga0070704_100768533 | |||
| 1224 | Ga0068855_100060592 | |||
| 1225 | Ga0068855_100221308 | |||
| 1226 | Ga0070664_100078501 | |||
| 1227 | Ga0070664_100154334 | |||
| 1228 | Ga0070664_100382570 | |||
| 1229 | Ga0070664_100409649 | |||
| 1230 | Ga0070664_100434506 | |||
| 1231 | Ga0068857_100058441 | |||
| 1232 | Ga0068857_100070329 | |||
| 1233 | Ga0068857_100100905 | |||
| 1234 | Ga0068857_100605308 | |||
| 1235 | Ga0068857_100747016 | |||
| 1236 | Ga0068857_100952259 | |||
| 1237 | Ga0068854_100039289 | |||
| 1238 | Ga0068854_100203701 | |||
| 1239 | Ga0068856_100004569 | |||
| 1240 | Ga0068856_100022506 | |||
| 1241 | Ga0068856_100029150 | |||
| 1242 | Ga0068856_100110195 | |||
| 1243 | Ga0068856_100142010 | |||
| 1244 | Ga0068856_100303864 | |||
| 1245 | Ga0068856_100383617 | |||
| 1246 | Ga0068856_100415210 | |||
| 1247 | Ga0070702_100010375 | |||
| 1248 | Ga0070702_100032844 | |||
| 1249 | Ga0070702_100418455 | |||
| 1250 | Ga0068852_100039903 | |||
| 1251 | Ga0068852_100392579 | |||
| 1252 | Ga0068859_100027634 | |||
| 1253 | Ga0068859_100074258 | |||
| 1254 | Ga0068859_100114632 | |||
| 1255 | Ga0068864_100009949 | |||
| 1256 | Ga0068864_100061923 | |||
| 1257 | Ga0068866_10042518 | |||
| 1258 | Ga0068861_100024174 | |||
| 1259 | Ga0068861_100139915 | |||
| 1260 | Ga0068861_100408658 | |||
| 1261 | Ga0068851_10069990 | |||
| 1262 | Ga0068870_10023183 | |||
| 1263 | Ga0068870_10101084 | |||
| 1264 | Ga0068863_100134075 | |||
| 1265 | Ga0068858_100025876 | |||
| 1266 | Ga0068858_100212244 | |||
| 1267 | Ga0068858_100399964 | |||
| 1268 | Ga0068858_100415415 | |||
| 1269 | Ga0068860_100086887 | |||
| 1270 | Ga0068862_100091412 | |||
| 1271 | Ga0068862_100208837 | |||
| 1272 | Ga0081455_10010765 | |||
| 1273 | Ga0081455_10049660 | |||
| 1274 | Ga0081455_10220883 | |||
| 1275 | Ga0081538_10002360 | |||
| 1276 | Ga0081540_1000469 | |||
| 1277 | Ga0081540_1000812 | |||
| 1278 | Ga0081539_10001611 | |||
| 1279 | Ga0081539_10020745 | |||
| 1280 | Ga0070717_10048480 | |||
| 1281 | Ga0070717_10141101 | |||
| 1282 | Ga0070717_10170334 | |||
| 1283 | Ga0070717_10472630 | |||
| 1284 | Ga0075432_10036537 | |||
| 1285 | Ga0070715_10012008 | |||
| 1286 | Ga0070715_10016284 | |||
| 1287 | Ga0070716_100152699 | |||
| 1288 | Ga0070716_100510662 | |||
| 1289 | Ga0070712_100034813 | |||
| 1290 | Ga0070712_100050549 | |||
| 1291 | Ga0070712_100182249 | |||
| 1292 | Ga0070712_100211567 | |||
| 1293 | Ga0070712_100329074 | |||
| 1294 | Ga0097621_100061326 | |||
| 1295 | Ga0097621_100104322 | |||
| 1296 | Ga0097621_100132424 | |||
| 1297 | Ga0068871_100011741 | |||
| 1298 | Ga0068871_100149106 | |||
| 1299 | Ga0075430_100048618 | |||
| 1300 | Ga0075430_100049684 | |||
| 1301 | Ga0075431_100035661 | |||
| 1302 | Ga0075429_100023734 | |||
| 1303 | Ga0068865_100030003 | |||
| 1304 | Ga0068865_100117910 | |||
| 1305 | Ga0068865_100196425 | |||
| 1306 | Ga0068865_100221316 | |||
| 1307 | Ga0075436_100050805 | |||
| 1308 | Ga0075436_100073444 | |||
| 1309 | Ga0075436_100493713 | |||
| 1310 | Ga0097620_100027634 | |||
| 1311 | Ga0097620_100074256 | |||
| 1312 | Ga0097620_100114626 | |||
| 1313 | Ga0105251_10032807 | |||
| 1314 | Ga0105240_10378177 | |||
| 1315 | Ga0111539_10242722 | |||
| 1316 | Ga0111539_10745746 | |||
| 1317 | Ga0111539_11063826 | |||
| 1318 | Ga0111539_11168891 | |||
| 1319 | Ga0105245_10012593 | |||
| 1320 | Ga0105245_10047590 | |||
| 1321 | Ga0105245_10428957 | |||
| 1322 | Ga0105247_10002030 | |||
| 1323 | Ga0105247_10008171 | |||
| 1324 | Ga0105247_10081893 | |||
| 1325 | Ga0105247_10195441 | |||
| 1326 | Ga0114129_10104431 | |||
| 1327 | Ga0114129_10184702 | |||
| 1328 | Ga0105243_10005206 | |||
| 1329 | Ga0105243_10015264 | |||
| 1330 | Ga0105243_10024764 | |||
| 1331 | Ga0105241_10063879 | |||
| 1332 | Ga0105241_10087154 | |||
| 1333 | Ga0105241_10404025 | |||
| 1334 | Ga0105242_10005941 | |||
| 1335 | Ga0105242_10022342 | |||
| 1336 | Ga0105242_10063862 | |||
| 1337 | Ga0105248_10017616 | |||
| 1338 | Ga0105248_10225789 | |||
| 1339 | Ga0105248_10244377 | |||
| 1340 | Ga0105237_10374267 | |||
| 1341 | Ga0105237_10861161 | |||
| 1342 | Ga0105238_10454333 | |||
| 1343 | Ga0105249_10044630 | |||
| 1344 | Ga0105249_10046893 | |||
| 1345 | Ga0105249_10339298 | |||
| 1346 | Ga0105249_10395801 | |||
| 1347 | Ga0105249_10729413 | |||
| 1348 | Ga0105239_10180973 | |||
| 1349 | Ga0105239_10550633 | |||
| 1350 | Ga0105239_11309907 | |||
| 1351 | Ga0105246_10012761 | |||
| 1352 | Ga0157338_1000598 | |||
| 1353 | Ga0157373_10069495 | |||
| 1354 | Ga0157373_10075509 | |||
| 1355 | Ga0157373_10083384 | |||
| 1356 | Ga0157370_10110439 | |||
| 1357 | Ga0157370_10111214 | |||
| 1358 | Ga0157370_10571624 | |||
| 1359 | Ga0157369_10054340 | |||
| 1360 | Ga0157369_10077101 | |||
| 1361 | Ga0157369_10094244 | |||
| 1362 | Ga0157374_10039166 | |||
| 1363 | Ga0157374_10410258 | |||
| 1364 | Ga0157374_10547990 | |||
| 1365 | Ga0157378_10003662 | |||
| 1366 | Ga0157378_10464488 | |||
| 1367 | Ga0163162_10026748 | |||
| 1368 | Ga0163162_10056403 | |||
| 1369 | Ga0163162_10354346 | |||
| 1370 | Ga0157372_10259460 | |||
| 1371 | Ga0157372_10370018 | |||
| 1372 | Ga0157372_10549287 | |||
| 1373 | Ga0157372_10584689 | |||
| 1374 | Ga0157375_10010929 | |||
| 1375 | Ga0157375_10026169 | |||
| 1376 | Ga0157375_10148515 | |||
| 1377 | Ga0157375_10363253 | |||
| 1378 | Ga0163163_10009970 | |||
| 1379 | Ga0163163_10054030 | |||
| 1380 | Ga0163163_10254305 | |||
| 1381 | Ga0163163_10680464 | |||
| 1382 | Ga0157380_10054718 | |||
| 1383 | Ga0157380_10066621 | |||
| 1384 | Ga0157380_10663072 | |||
| 1385 | Ga0182008_10221690 | |||
| 1386 | Ga0157377_10044800 | |||
| 1387 | Ga0157377_10054184 | |||
| 1388 | Ga0157379_10000752 | |||
| 1389 | Ga0157379_10018107 | |||
| 1390 | Ga0157379_10178207 | |||
| 1391 | Ga0157379_10742799 | |||
| 1392 | Ga0206356_11776078 | |||
| 1393 | Ga0206350_10369510 | |||
| 1394 | Ga0206354_10648326 | |||
| 1395 | Ga0206353_11975746 | |||
| 1396 | Ga0213873_10066712 | |||
| 1397 | Ga0213874_10024128 | |||
| 1398 | Ga0213876_10004367 | |||
| 1399 | Ga0213875_10044787 | |||
| 1400 | Ga0213875_10058979 | |||
| 1401 | Ga0213875_10153172 | |||
| 1402 | Ga0224712_10014237 | |||
| 1403 | Ga0224712_10181362 | |||
| 1404 | Ga0224712_10240029 | |||
| 1405 | Ga0228598_1018640 | |||
| 1406 | Ga0207656_10047327 | |||
| 1407 | Ga0207653_10017181 | |||
| 1408 | Ga0207682_10012745 | |||
| 1409 | Ga0207692_10107792 | |||
| 1410 | Ga0207692_10209091 | |||
| 1411 | Ga0207642_10211688 | |||
| 1412 | Ga0207710_10012716 | |||
| 1413 | Ga0207710_10013223 | |||
| 1414 | Ga0207710_10178948 | |||
| 1415 | Ga0207688_10007413 | |||
| 1416 | Ga0207680_10131229 | |||
| 1417 | Ga0207647_10062932 | |||
| 1418 | Ga0207647_10164347 | |||
| 1419 | Ga0207699_10010248 | |||
| 1420 | Ga0207699_10018608 | |||
| 1421 | Ga0207699_10022468 | |||
| 1422 | Ga0207699_10161454 | |||
| 1423 | Ga0207699_10178569 | |||
| 1424 | Ga0207645_10165547 | |||
| 1425 | Ga0207643_10001157 | |||
| 1426 | Ga0207643_10022072 | |||
| 1427 | Ga0207705_10034857 | |||
| 1428 | Ga0207705_10089308 | |||
| 1429 | Ga0207705_10122297 | |||
| 1430 | Ga0207684_10011968 | |||
| 1431 | Ga0207684_10618645 | |||
| 1432 | Ga0207654_10089087 | |||
| 1433 | Ga0207654_10120824 | |||
| 1434 | Ga0207654_10161561 | |||
| 1435 | Ga0207707_10031202 | |||
| 1436 | Ga0207707_10073020 | |||
| 1437 | Ga0207707_10204816 | |||
| 1438 | Ga0207707_10423314 | |||
| 1439 | Ga0207695_10095283 | |||
| 1440 | Ga0207695_10295412 | |||
| 1441 | Ga0207671_10130171 | |||
| 1442 | Ga0207693_10003910 | |||
| 1443 | Ga0207693_10044334 | |||
| 1444 | Ga0207693_10144949 | |||
| 1445 | Ga0207693_10168853 | |||
| 1446 | Ga0207693_10300741 | |||
| 1447 | Ga0207663_10275184 | |||
| 1448 | Ga0207663_10306382 | |||
| 1449 | Ga0207663_10317760 | |||
| 1450 | Ga0207660_10007118 | |||
| 1451 | Ga0207662_10003814 | |||
| 1452 | Ga0207662_10020825 | |||
| 1453 | Ga0207662_10074091 | |||
| 1454 | Ga0207662_10185373 | |||
| 1455 | Ga0207657_10011229 | |||
| 1456 | Ga0207657_10018249 | |||
| 1457 | Ga0207657_10028393 | |||
| 1458 | Ga0207657_10126865 | |||
| 1459 | Ga0207657_10175356 | |||
| 1460 | Ga0207652_10008008 | |||
| 1461 | Ga0207652_10011450 | |||
| 1462 | Ga0207652_10018135 | |||
| 1463 | Ga0207652_10051214 | |||
| 1464 | Ga0207646_10025845 | |||
| 1465 | Ga0207646_10451319 | |||
| 1466 | Ga0207694_10426383 | |||
| 1467 | Ga0207687_10002244 | |||
| 1468 | Ga0207687_10010596 | |||
| 1469 | Ga0207687_10174584 | |||
| 1470 | Ga0207687_10325924 | |||
| 1471 | Ga0207687_10442461 | |||
| 1472 | Ga0207700_10017698 | |||
| 1473 | Ga0207700_10059904 | |||
| 1474 | Ga0207700_10076050 | |||
| 1475 | Ga0207700_10140372 | |||
| 1476 | Ga0207700_10156089 | |||
| 1477 | Ga0207700_10238388 | |||
| 1478 | Ga0207700_10296916 | |||
| 1479 | Ga0207700_10832675 | |||
| 1480 | Ga0207664_10009299 | |||
| 1481 | Ga0207664_10039978 | |||
| 1482 | Ga0207664_10074329 | |||
| 1483 | Ga0207664_10111497 | |||
| 1484 | Ga0207664_10156300 | |||
| 1485 | Ga0207664_10282318 | |||
| 1486 | Ga0207664_10373641 | |||
| 1487 | Ga0207644_10715561 | |||
| 1488 | Ga0207690_10046198 | |||
| 1489 | Ga0207690_10365221 | |||
| 1490 | Ga0207706_10004493 | |||
| 1491 | Ga0207706_10011072 | |||
| 1492 | Ga0207706_10168597 | |||
| 1493 | Ga0207706_10435728 | |||
| 1494 | Ga0207686_10030176 | |||
| 1495 | Ga0207686_10139505 | |||
| 1496 | Ga0207709_10061991 | |||
| 1497 | Ga0207709_10120750 | |||
| 1498 | Ga0207709_10195992 | |||
| 1499 | Ga0207709_10220045 | |||
| 1500 | Ga0207670_10120498 | |||
| 1501 | Ga0207670_10278271 | |||
| 1502 | Ga0207669_10013094 | |||
| 1503 | Ga0207704_10019367 | |||
| 1504 | Ga0207704_10175373 | |||
| 1505 | Ga0207665_10006692 | |||
| 1506 | Ga0207665_10035589 | |||
| 1507 | Ga0207665_10060505 | |||
| 1508 | Ga0207691_10005186 | |||
| 1509 | Ga0207691_10011648 | |||
| 1510 | Ga0207691_10075507 | |||
| 1511 | Ga0207691_10088284 | |||
| 1512 | Ga0207711_10046170 | |||
| 1513 | Ga0207711_10714960 | |||
| 1514 | Ga0207689_10005938 | |||
| 1515 | Ga0207689_10056182 | |||
| 1516 | Ga0207661_10006689 | |||
| 1517 | Ga0207661_10008139 | |||
| 1518 | Ga0207661_10011085 | |||
| 1519 | Ga0207661_10048471 | |||
| 1520 | Ga0207661_10140041 | |||
| 1521 | Ga0207661_10181786 | |||
| 1522 | Ga0207661_10263189 | |||
| 1523 | Ga0207661_10680109 | |||
| 1524 | Ga0207661_10790796 | |||
| 1525 | Ga0207679_10063765 | |||
| 1526 | Ga0207679_10070065 | |||
| 1527 | Ga0207679_10280931 | |||
| 1528 | Ga0207651_10278414 | |||
| 1529 | Ga0207651_10335663 | |||
| 1530 | Ga0207712_10028737 | |||
| 1531 | Ga0207712_10029993 | |||
| 1532 | Ga0207712_10236286 | |||
| 1533 | Ga0207640_10222441 | |||
| 1534 | Ga0207677_10018844 | |||
| 1535 | Ga0207677_10034224 | |||
| 1536 | Ga0207677_10048307 | |||
| 1537 | Ga0207703_10212277 | |||
| 1538 | Ga0207703_10246482 | |||
| 1539 | Ga0207703_10601427 | |||
| 1540 | Ga0207639_10051429 | |||
| 1541 | Ga0207639_10180438 | |||
| 1542 | Ga0207678_10012261 | |||
| 1543 | Ga0207678_10020413 | |||
| 1544 | Ga0207678_10053919 | |||
| 1545 | Ga0207678_10119930 | |||
| 1546 | Ga0207708_10004717 | |||
| 1547 | Ga0207708_10015717 | |||
| 1548 | Ga0207702_10027114 | |||
| 1549 | Ga0207702_10052244 | |||
| 1550 | Ga0207702_10170316 | |||
| 1551 | Ga0207702_10264670 | |||
| 1552 | Ga0207702_10379475 | |||
| 1553 | Ga0207641_10105064 | |||
| 1554 | Ga0207641_10135214 | |||
| 1555 | Ga0207648_10006493 | |||
| 1556 | Ga0207648_10070622 | |||
| 1557 | Ga0207648_10080988 | |||
| 1558 | Ga0207648_10304609 | |||
| 1559 | Ga0207676_10015899 | |||
| 1560 | Ga0207674_10015365 | |||
| 1561 | Ga0207674_10033304 | |||
| 1562 | Ga0207674_10041037 | |||
| 1563 | Ga0207674_10060000 | |||
| 1564 | Ga0207674_10098775 | |||
| 1565 | Ga0207674_10300387 | |||
| 1566 | Ga0207674_10411416 | |||
| 1567 | Ga0207675_100005731 | |||
| 1568 | Ga0207675_100018410 | |||
| 1569 | Ga0207675_100069644 | |||
| 1570 | Ga0207675_100616277 | |||
| 1571 | Ga0207675_100767649 | |||
| 1572 | Ga0207683_10000149 | |||
| 1573 | Ga0207683_10020233 | |||
| 1574 | Ga0207683_10021451 | |||
| 1575 | Ga0207683_10023650 | |||
| 1576 | Ga0207683_10037161 | |||
| 1577 | Ga0207683_10151618 | |||
| 1578 | Ga0207683_10404871 | |||
| 1579 | Ga0207698_10023386 | |||
| 1580 | Ga0207428_10309785 | |||
| 1581 | Ga0268266_10010760 | |||
| 1582 | Ga0268266_10221568 | |||
| 1583 | Ga0268265_10121865 | |||
| 1584 | Ga0268265_10193869 | |||
| 1585 | Ga0268265_10773261 | |||
| 1586 | Ga0268264_10059288 | |||
| 1587 | Ga0268264_10827504 | |||
| 1588 | Ga0265337_1000276 | |||
| 1589 | Ga0265326_10002480 | |||
| 1590 | Ga0265319_1005034 | |||
| 1591 | Ga0265334_10000924 | |||
| 1592 | Ga0265318_10007416 | |||
| 1593 | Ga0265323_10007197 | |||
| 1594 | Ga0265336_10010553 | |||
| 1595 | Ga0265338_10002647 | |||
| 1596 | Ga0265324_10001566 | |||
| 1597 | Ga0265332_10015019 | |||
| 1598 | Ga0265320_10004570 | |||
| 1599 | Ga0265325_10113760 | |||
| 1600 | Ga0265340_10002012 | |||
| 1601 | Ga0265316_10016656 | |||
| 1602 | Ga0265313_10037779 | |||
| 1603 | Ga0265314_10007805 | |||
| 1604 | Ga0265342_10001356 | |||
| 1605 | Ga0307410_10009428 | |||
| 1606 | Ga0307406_10013868 | |||
| 1607 | Ga0307406_10015209 | |||
| 1608 | Ga0307406_10497204 | |||
| 1609 | Ga0307407_10130883 | |||
| 1610 | Ga0307412_10086380 | |||
| 1611 | Ga0307409_100006151 | |||
| 1612 | Ga0307416_100000255 | |||
| 1613 | Ga0307416_100104350 | |||
| 1614 | Ga0307411_10271050 | |||
| 1615 | Ga0307415_100036731 | |||
| 1616 | Ga0307415_100218476 | |||
| 1617 | Ga0373950_0033451 | |||
| 1618 | Ga0373959_0035232 | |||
| 1619 | Ga0373938_0029736 | |||
| 1620 | Ga0373926_0002013 | |||
| 1621 | Ga0373926_0024005 | |||
| 1622 | Ga0373928_0016047 | |||
| 1623 | Ga0373928_0016437 | |||
| 1624 | Ga0373929_0003342 | |||
| 1625 | Ga0373934_0013897 | |||
| 1626 | Ga0373934_0022778 | |||
| 1627 | Ga0373934_0097921 | |||
| 1628 | Ga0373940_0005434 | |||
| 1629 | Ga0373944_0000389 | |||
| 1630 | Ga0373944_0058347 | |||
| 1631 | Ga0373951_0003925 | |||
| 1632 | Ga0373951_0057217 | |||
| 1633 | Ga0373952_0036385 | |||
| 1634 | Ga0373923_0030923 | |||
| 1635 | Ga0373932_0010739 | |||
| 1636 | Ga0373936_0000112 | |||
| 1637 | Ga0373936_0003805 | |||
| 1638 | Ga0373936_0049321 | |||
| 1639 | Ga0373939_0035228 | |||
| 1640 | Ga0373939_0038491 | |||
| 1641 | Ga0373941_0018484 | |||
| 1642 | Ga0373945_0000180 | |||
| 1643 | Ga0373945_0000291 | |||
| 1644 | Ga0373953_0006891 | |||
| 1645 | Ga0373953_0022773 | |||
| 1646 | Ga0373953_0047343 | |||
| 1647 | Ga0373953_0094796 | |||
| 1648 | Ga0373954_0002644 | |||
| 1649 | Ga0373954_0043591 | |||
| 1650 | Ga0373954_0123113 | |||
| 1651 | Ga0373956_0006193 | |||
| 1652 | Ga0373956_0023950 | |||
| 1653 | Ga0373956_0039319 | |||
| 1654 | Ga0373957_0007283 | |||
| 1655 | Ga0373957_0024728 | |||
| 1656 | Ga0373957_0045928 | |||
| 1657 | Ga0373960_0007606 | |||
| 1658 | Ga0373960_0014262 | |||
| 1659 | Ga0373943_0000414 | |||
| 1660 | Ga0373943_0102659 | |||
| 1661 | Ga0373946_0001584 | |||
| 1662 | Ga0373946_0012759 | |||
| 1663 | Ga0373955_0007888 | |||
| 1664 | Ga0373955_0009588 | |||
| 1665 | Ga0373955_0023895 | |||
| 1666 | Ga0373955_0031220 | |||
| 1667 | Ga0373955_0043271 | |||
| 1668 | Ga0373961_0096510 | |||
| 1669 | Ga0373962_0013383 | |||
| 1670 | Ga0373962_0052454 | |||
| 1671 | Ga0373924_0011007 | |||
| 1672 | Ga0373924_0050274 | |||
| 1673 | Ga0373931_0069160 | |||
| 1674 | Ga0373935_0000268 | |||
| 1675 | Ga0373935_0025301 | |||
| 1676 | Ga0373927_0005354 | |||
| 1677 | Ga0373927_0006642 | |||
| 1678 | Ga0373933_0070781 | |||
| 1679 | Ga0373933_0089801 | |||
| 1680 | Ga0373933_0249670 | |||
| 1681 | Ga0373947_0000374 | |||
| 1682 | Ga0373947_0001684 | |||
| 1683 | Ga0373937_0005834 | |||
| 1684 | Ga0373937_0080506 | |||
| 1685 | Ga0373937_0218168 | |||
| 1686 | Ga0373937_0558360 | |||
| 1687 | Ga0373925_0000366 | |||
| 1688 | Ga0373925_0004028 | |||
| 1689 | Ga0373925_0032104 | |||
| 1690 | Ga0395898_0219790 | |||
| 1691 | Ga0395898_0753429 | |||
| 1692 | Ga0395905_0239273 | |||
| 1693 | Ga0395905_0613392 | |||
| 1694 | Ga0436364_0099500 | |||
| 1695 | Ga0436364_0274704 | |||
| 1696 | Ga0436364_1049383 | |||
| 1697 | Ga0436364_1304558 | |||
| 1698 | Ga0436364_1394580 | |||
| 1699 | Ga0395901_0262301 | |||
| 1700 | Ga0436365_0080097 | |||
| 1701 | Ga0436365_0226989 | |||
| 1702 | Ga0436365_0445234 | |||
| 1703 | Ga0436365_1235428 | |||
| 1704 | Ga0436363_0230425 | |||
| 1705 | Ga0436362_1304003 | |||
| 1706 | Ga0439461_0026884 | |||
| 1707 | Ga0466963_0149897 | |||
| 1708 | Ga0466963_0190038 | |||
| 1709 | Ga0466960_0122728 | |||
| 1710 | Ga0466958_0063911 | |||
| 1711 | Ga0466967_0006871 | |||
| 1712 | Ga0466967_0016490 | |||
| 1713 | Ga0466967_0027220 | |||
| 1714 | Ga0466967_0598337 | |||
| 1715 | Ga0495592_0014225 | |||
| 1716 | Ga0495592_0065139 | |||
| 1717 | Ga0495592_0168597 | |||
| 1718 | Ga0495592_0261188 | |||
| 1719 | Ga0495592_0344915 | |||
| 1720 | Ga0495603_0000607 | |||
| 1721 | Ga0495603_0087045 | |||
| 1722 | Ga0495629_0020484 | |||
| 1723 | Ga0495641_0018052 | |||
| 1724 | Ga0495641_0039112 | |||
| 1725 | Ga0495641_0112430 | |||
| 1726 | Ga0495651_0002244 | |||
| 1727 | Ga0495651_0009366 | |||
| 1728 | Ga0495651_0099224 | |||
| 1729 | Ga0495651_0168098 | |||
| 1730 | Ga0495653_0000846 | |||
| 1731 | Ga0495653_0002582 | |||
| 1732 | Ga0495653_0016716 | |||
| 1733 | Ga0495653_0018503 | |||
| 1734 | Ga0495653_0029432 | |||
| 1735 | Ga0495653_0034410 | |||
| 1736 | Ga0495653_0192096 | |||
| 1737 | Ga0495653_0286324 | |||
| 1738 | Ga0495580_0035801 | |||
| 1739 | Ga0495582_0004531 | |||
| 1740 | Ga0495582_0069819 | |||
| 1741 | Ga0495582_0131003 | |||
| 1742 | Ga0495639_0002111 | |||
| 1743 | Ga0495639_0042209 | |||
| 1744 | Ga0495639_0141503 | |||
| 1745 | Ga0495662_0006080 | |||
| 1746 | Ga0495662_0009989 | |||
| 1747 | Ga0495664_0006875 | |||
| 1748 | Ga0495664_0318906 | |||
| 1749 | Ga0495584_0038168 | |||
| 1750 | Ga0495594_0001729 | |||
| 1751 | Ga0495596_0077150 | |||
| 1752 | Ga0495608_0001741 | |||
| 1753 | Ga0495608_0011846 | |||
| 1754 | Ga0495608_0034267 | |||
| 1755 | Ga0495608_0036852 | |||
| 1756 | Ga0495618_0011652 | |||
| 1757 | Ga0495618_0018660 | |||
| 1758 | Ga0495618_0025614 | |||
| 1759 | Ga0495628_0214967 | |||
| 1760 | Ga0495628_0266116 | |||
| 1761 | Ga0495630_0015268 | |||
| 1762 | Ga0495630_0374521 | |||
| 1763 | Ga0495630_0441323 | |||
| 1764 | Ga0495666_0000796 | |||
| 1765 | Ga0495652_0038052 | |||
| 1766 | Ga0495652_0045318 | |||
| 1767 | Ga0495652_0070018 | |||
| 1768 | Ga0495652_0080197 | |||
| 1769 | Ga0495652_0099154 | |||
| 1770 | Ga0495652_0442522 | |||
| 1771 | Ga0495665_0001759 | |||
| 1772 | Ga0495665_0049482 | |||
| 1773 | Ga0495665_0183715 | |||
| 1774 | Ga0495640_0011158 | |||
| 1775 | Ga0495640_0035037 | |||
| 1776 | Ga0495640_0069145 | |||
| 1777 | Ga0495640_0087838 | |||
| 1778 | Ga0495640_0340410 | |||
| 1779 | Ga0495586_0001514 | |||
| 1780 | Ga0495586_0053846 | |||
| 1781 | Ga0495587_0020492 | |||
| 1782 | Ga0495587_0090191 | |||
| 1783 | Ga0495645_0183278 | |||
| 1784 | Ga0495622_0038112 | |||
| 1785 | Ga0495667_0008762 | |||
| 1786 | Ga0495667_0031077 | |||
| 1787 | Ga0495667_0141005 | |||
| 1788 | Ga0495667_0167594 | |||
| 1789 | Ga0495667_0307726 | |||
| 1790 | Ga0495656_0077626 | |||
| 1791 | Ga0495634_0005096 | |||
| 1792 | Ga0495634_0012615 | |||
| 1793 | Ga0495634_0022040 | |||
| 1794 | Ga0495634_0112028 | |||
| 1795 | Ga0495635_0003934 | |||
| 1796 | Ga0495635_0033619 | |||
| 1797 | Ga0495635_0110738 | |||
| 1798 | Ga0495588_0099124 | |||
| 1799 | Ga0495657_0002535 | |||
| 1800 | Ga0495657_0014321 | |||
| 1801 | Ga0495657_0018097 | |||
| 1802 | Ga0495657_0022976 | |||
| 1803 | Ga0495657_0024842 | |||
| 1804 | Ga0495657_0098083 | |||
| 1805 | Ga0495599_0020196 | |||
| 1806 | Ga0495599_0046427 | |||
| 1807 | Ga0495599_0075159 | |||
| 1808 | Ga0495623_0017512 | |||
| 1809 | Ga0495623_0078914 | |||
| 1810 | Ga0495623_0087429 | |||
| 1811 | Ga0495623_0149329 | |||
| 1812 | Ga0495646_0009623 | |||
| 1813 | Ga0495646_0030180 | |||
| 1814 | Ga0495646_0032235 | |||
| 1815 | Ga0495646_0096960 | |||
| 1816 | Ga0495646_0137222 | |||
| 1817 | Ga0495646_0176159 | |||
| 1818 | Ga0495647_0016956 | |||
| 1819 | Ga0495647_0037907 | |||
| 1820 | Ga0495658_0022413 | |||
| 1821 | Ga0495613_0011338 | |||
| 1822 | Ga0495613_0033171 | |||
| 1823 | Ga0495613_0038008 | |||
| 1824 | Ga0495613_0041387 | |||
| 1825 | Ga0495624_0005144 | |||
| 1826 | Ga0495600_0007628 | |||
| 1827 | Ga0495600_0074040 | |||
| 1828 | Ga0495600_0080505 | |||
| 1829 | Ga0495600_0093876 | |||
| 1830 | Ga0495581_0010675 | |||
| 1831 | Ga0495581_0062102 | |||
| 1832 | Ga0495581_0134371 | |||
| 1833 | Ga0495604_0002573 | |||
| 1834 | Ga0495604_0082400 | |||
| 1835 | Ga0495604_0180634 | |||
| 1836 | Ga0495674_0000257 | |||
| 1837 | Ga0495674_0031264 | |||
| 1838 | Ga0495674_0235212 | |||
| 1839 | Ga0495676_0005541 | |||
| 1840 | Ga0495676_0008224 | |||
| 1841 | Ga0495676_0038979 | |||
| 1842 | Ga0495680_0003922 | |||
| 1843 | Ga0495680_0005834 | |||
| 1844 | Ga0495680_0015599 | |||
| 1845 | Ga0495680_0026095 | |||
| 1846 | Ga0495680_0036051 | |||
| 1847 | Ga0495680_0104034 | |||
| 1848 | Ga0495680_0123201 | |||
| 1849 | Ga0495675_0008400 | |||
| 1850 | Ga0495675_0081995 | |||
| 1851 | Ga0495675_0141542 | |||
| 1852 | Ga0495684_0000981 | |||
| 1853 | Ga0495684_0005341 | |||
| 1854 | Ga0495684_0046663 | |||
| 1855 | Ga0495684_0058671 | |||
| 1856 | Ga0495684_0322092 | |||
| 1857 | Ga0495602_0010703 | |||
| 1858 | Ga0495602_0036428 | |||
| 1859 | Ga0495602_0091288 | |||
| 1860 | Ga0495602_0288950 | |||
| 1861 | Ga0495602_0341206 | |||
| 1862 | Ga0495614_0012996 | |||
| 1863 | Ga0496100_0008167 | |||
| 1864 | Ga0496100_0010081 | |||
| 1865 | Ga0496100_0055141 | |||
| 1866 | Ga0496101_0004103 | |||
| 1867 | Ga0496101_0030252 | |||
| 1868 | Ga0496101_0040032 | |||
| 1869 | Ga0496101_0126672 | |||
| 1870 | Ga0496102_0001623 | |||
| 1871 | Ga0496102_0005668 | |||
| 1872 | Ga0496102_0104765 | |||
| 1873 | Ga0496102_0112017 | |||
| 1874 | Ga0496103_0006938 | |||
| 1875 | Ga0496103_0053378 | |||
| 1876 | Ga0496103_0080597 | |||
| 1877 | Ga0496103_0205476 | |||
| 1878 | Ga0496103_0212647 | |||
| 1879 | Ga0496104_0000254 | |||
| 1880 | Ga0496104_0008860 | |||
| 1881 | Ga0496104_0014694 | |||
| 1882 | Ga0496104_0015680 | |||
| 1883 | Ga0496104_0031489 | |||
| 1884 | Ga0496104_0036667 | |||
| 1885 | Ga0496104_0047252 | |||
| 1886 | Ga0496104_0065886 | |||
| 1887 | Ga0496104_0229033 | |||
| 1888 | Ga0496104_0347742 | |||
| 1889 | Ga0496104_0386762 | |||
| 1890 | Ga0496104_0418885 | |||
| 1891 | Ga0496105_0000055 | |||
| 1892 | Ga0496105_0003044 | |||
| 1893 | Ga0496105_0010670 | |||
| 1894 | Ga0496105_0014256 | |||
| 1895 | Ga0496105_0032850 | |||
| 1896 | Ga0496105_0042293 | |||
| 1897 | Ga0496105_0042707 | |||
| 1898 | Ga0496105_0052598 | |||
| 1899 | Ga0496105_0231037 | |||
| 1900 | Ga0496106_0011270 | |||
| 1901 | Ga0496106_0033323 | |||
| 1902 | Ga0496106_0040300 | |||
| 1903 | Ga0496106_0101550 | |||
| 1904 | Ga0496106_0121000 | |||
| 1905 | Ga0496107_0009801 | |||
| 1906 | Ga0496107_0023308 | |||
| 1907 | Ga0496107_0033007 | |||
| 1908 | Ga0496107_0081402 | |||
| 1909 | Ga0496108_0005384 | |||
| 1910 | Ga0496108_0005962 | |||
| 1911 | Ga0496108_0009422 | |||
| 1912 | Ga0496108_0032706 | |||
| 1913 | Ga0496108_0038778 | |||
| 1914 | Ga0496108_0107817 | |||
| 1915 | Ga0496108_0146048 | |||
| 1916 | Ga0496108_0162522 | |||
| 1917 | Ga0496108_0219488 | |||
| 1918 | Ga0496108_0326619 | |||
| 1919 | Ga0496108_0522629 | |||
| 1920 | Ga0496109_0001140 | |||
| 1921 | Ga0496109_0005718 | |||
| 1922 | Ga0496109_0012060 | |||
| 1923 | Ga0496109_0076080 | |||
| 1924 | Ga0496109_0080461 | |||
| 1925 | Ga0496109_0160880 | |||
| 1926 | Ga0496109_0165713 | |||
| 1927 | Ga0496109_0231858 | |||
| 1928 | Ga0496109_0303254 | |||
| 1929 | Ga0496109_0307428 | |||
| 1930 | Ga0496110_0000306 | |||
| 1931 | Ga0496110_0002326 | |||
| 1932 | Ga0496110_0014402 | |||
| 1933 | Ga0496110_0029828 | |||
| 1934 | Ga0496110_0034589 | |||
| 1935 | Ga0496110_0049253 | |||
| 1936 | Ga0496110_0053846 | |||
| 1937 | Ga0496110_0118572 | |||
| 1938 | Ga0496110_0201054 | |||
| 1939 | Ga0496110_0209365 | |||
| 1940 | Ga0496110_0281699 | |||
| 1941 | Ga0496111_0000166 | |||
| 1942 | Ga0496111_0001388 | |||
| 1943 | Ga0496111_0019761 | |||
| 1944 | Ga0496111_0055766 | |||
| 1945 | Ga0496111_0072893 | |||
| 1946 | Ga0496111_0104494 | |||
| 1947 | Ga0496111_0165732 | |||
| 1948 | Ga0496111_0326644 | |||
| 1949 | Ga0496112_0008060 | |||
| 1950 | Ga0496112_0157257 | |||
| 1951 | Ga0496112_0216107 | |||
| 1952 | Ga0496112_0526192 | |||
| 1953 | Ga0496113_0002213 | |||
| 1954 | Ga0496113_0025416 | |||
| 1955 | Ga0496113_0037152 | |||
| 1956 | Ga0496113_0099307 | |||
| 1957 | Ga0496113_0147625 | |||
| 1958 | Ga0496113_0292434 | |||
| 1959 | Ga0496113_0351406 | |||
| 1960 | Ga0496113_0580610 | |||
| 1961 | Ga0496114_0000202 | |||
| 1962 | Ga0496114_0000256 | |||
| 1963 | Ga0496114_0004795 | |||
| 1964 | Ga0496114_0005333 | |||
| 1965 | Ga0496114_0015003 | |||
| 1966 | Ga0496114_0261163 | |||
| 1967 | Ga0496114_0281122 | |||
| 1968 | Ga0496115_0011279 | |||
| 1969 | Ga0496115_0028781 | |||
| 1970 | Ga0496115_0037402 | |||
| 1971 | Ga0496115_0039681 | |||
| 1972 | Ga0496115_0071198 | |||
| 1973 | Ga0496115_0132465 | |||
| 1974 | Ga0496126_0168384 | |||
| 1975 | Ga0501031_0009747 | |||
| 1976 | Ga0501031_0034162 | |||
| 1977 | Ga0501031_0102885 | |||
| 1978 | Ga0501031_0117264 | |||
| 1979 | Ga0501032_0067996 | |||
| 1980 | Ga0501032_0138997 | |||
| 1981 | Ga0501033_0001904 | |||
| 1982 | Ga0501033_0006376 | |||
| 1983 | Ga0501034_0024537 | |||
| 1984 | Ga0501034_0103079 | |||
| 1985 | Ga0501036_0012610 | |||
| 1986 | Ga0501036_0083701 | |||
| 1987 | Ga0501036_0604462 | |||
| 1988 | Ga0501037_0028422 | |||
| 1989 | Ga0501037_0098518 | |||
| 1990 | Ga0501037_0159680 | |||
| 1991 | Ga0501038_0011586 | |||
| 1992 | Ga0501038_0128197 | |||
| 1993 | Ga0501038_0152100 | |||
| 1994 | Ga0501038_0287351 | |||
| 1995 | Ga0501039_0001500 | |||
| 1996 | Ga0501039_0184855 | |||
| 1997 | Ga0501039_0226981 | |||
| 1998 | Ga0501039_0285534 | |||
| 1999 | Ga0501040_0004386 | |||
| 2000 | Ga0501040_0007052 | |||
| 2001 | Ga0501040_0021853 | |||
| 2002 | Ga0501040_0066861 | |||
| 2003 | Ga0501041_0071764 | |||
| 2004 | Ga0501041_0363211 | |||
| 2005 | Ga0501042_0092048 | |||
| 2006 | Ga0501042_0131689 | |||
| 2007 | Ga0501042_0142565 | |||
| 2008 | Ga0501042_0479335 | |||
| 2009 | Ga0501043_0008340 | |||
| 2010 | Ga0501043_0138894 | |||
| 2011 | Ga0501043_0138990 | |||
| 2012 | Ga0501043_0208922 | |||
| 2013 | Ga0501043_0498193 | |||
| 2014 | Ga0501046_0043834 | |||
| 2015 | Ga0501046_0056098 | |||
| 2016 | Ga0501046_0241658 | |||
| 2017 | Ga0501046_0475414 | |||
| 2018 | Ga0501047_0041964 | |||
| 2019 | Ga0501047_0399393 | |||
| 2020 | Ga0501048_0051621 | |||
| 2021 | Ga0501048_0054446 | |||
| 2022 | Ga0501048_0131295 | |||
| 2023 | Ga0501067_0088735 | |||
| 2024 | Ga0501067_0101054 | |||
| 2025 | Ga0501067_0107324 | |||
| 2026 | Ga0501068_0007821 | |||
| 2027 | Ga0501068_0014213 | |||
| 2028 | Ga0501068_0119082 | |||
| 2029 | Ga0501068_0155979 | |||
| 2030 | Ga0501069_0056429 | |||
| 2031 | Ga0501070_0008311 | |||
| 2032 | Ga0501070_0042762 | |||
| 2033 | Ga0501070_0046448 | |||
| 2034 | Ga0501070_0056883 | |||
| 2035 | Ga0501070_0220248 | |||
| 2036 | Ga0501070_0444296 | |||
| 2037 | Ga0501071_0044122 | |||
| 2038 | Ga0501071_0053022 | |||
| 2039 | Ga0501071_0103323 | |||
| 2040 | Ga0501071_0268722 | |||
| 2041 | Ga0501071_0318678 | |||
| 2042 | Ga0501072_0006286 | |||
| 2043 | Ga0501072_0038369 | |||
| 2044 | Ga0501072_0140543 | |||
| 2045 | Ga0501072_0308336 | |||
| 2046 | Ga0501072_0329461 | |||
| 2047 | Ga0501072_0343604 | |||
| 2048 | Ga0501073_0027805 | |||
| 2049 | Ga0501073_0104938 | |||
| 2050 | Ga0501073_0137950 | |||
| 2051 | Ga0501073_0140357 | |||
| 2052 | Ga0501073_0207375 | |||
| 2053 | Ga0501074_0003457 | |||
| 2054 | Ga0501074_0022511 | |||
| 2055 | Ga0501074_0038175 | |||
| 2056 | Ga0501074_0073800 | |||
| 2057 | Ga0501074_0146247 | |||
| 2058 | Ga0501074_0205490 | |||
| 2059 | Ga0501075_0001147 | |||
| 2060 | Ga0501075_0006209 | |||
| 2061 | Ga0501075_0084598 | |||
| 2062 | Ga0501075_0184033 | |||
| 2063 | Ga0501075_0245045 | |||
| 2064 | Ga0501075_0440695 | |||
| 2065 | Ga0501076_0002038 | |||
| 2066 | Ga0501076_0023268 | |||
| 2067 | Ga0501076_0102633 | |||
| 2068 | Ga0501076_0113067 | |||
| 2069 | Ga0501076_0165298 | |||
| 2070 | Ga0501077_0000293 | |||
| 2071 | Ga0501077_0088749 | |||
| 2072 | Ga0501077_0256495 | |||
| 2073 | Ga0501077_0302027 | |||
| 2074 | Ga0501079_0001626 | |||
| 2075 | Ga0501079_0003249 | |||
| 2076 | Ga0501079_0044178 | |||
| 2077 | Ga0501079_0140983 | |||
| 2078 | Ga0501079_0163986 | |||
| 2079 | Ga0501079_0171054 | |||
| 2080 | Ga0501080_0169127 | |||
| 2081 | Ga0501080_0319801 | |||
| 2082 | Ga0501080_0421610 | |||
| 2083 | Ga0501081_0005676 | |||
| 2084 | Ga0501081_0007144 | |||
| 2085 | Ga0501081_0015412 | |||
| 2086 | Ga0501083_0024804 | |||
| 2087 | Ga0501083_0054197 | |||
| 2088 | Ga0501083_0226907 | |||
| 2089 | Ga0501035_0003489 | |||
| 2090 | Ga0501035_0042761 | |||
| 2091 | Ga0501035_0255617 | |||
| 2092 | Ga0501035_0357676 | |||
| 2093 | Ga0501044_0399376 | |||
| 2094 | Ga0501045_0000645 | |||
| 2095 | Ga0501045_0009173 | |||
| 2096 | Ga0501045_0010473 | |||
| 2097 | Ga0501045_0027422 | |||
| 2098 | Ga0501045_0059058 | |||
| 2099 | Ga0501045_0063464 | |||
| 2100 | nmdc:mga05p37_5114_c1 | |||
| 2101 | nmdc:mga05p37_71538_c1 | |||
| 2102 | nmdc:mga09592_15116_c1 | |||
| 2103 | nmdc:mga09592_661185_c1 | |||
| 2104 | nmdc:mga0qj67_22953_c1 | |||
| 2105 | nmdc:mga0qj67_419_c1 | |||
| 2106 | nmdc:mga06r32_43563_c1 | |||
| 2107 | nmdc:mga06r32_481_c1 | |||
| 2108 | nmdc:mga06r32_63463_c1 | |||
| 2109 | nmdc:mga06r32_69551_c1 | |||
| 2110 | nmdc:mga08y16_37460_c1 | |||
| 2111 | nmdc:mga08x19_324206_c1 | |||
| 2112 | nmdc:mga0a205_237419_c1 | |||
| 2113 | Ga0495601_0227358 | |||
| 2114 | Ga0495601_0263014 | |||
| 2115 | Ga0495601_0503704 | |||
| 2116 | Ga0495595_0054679 | |||
| 2117 | Ga0495595_0102418 | |||
| 2118 | Ga0495619_0000657 | |||
| 2119 | Ga0495619_0002299 | |||
| 2120 | Ga0495619_0039046 | |||
| 2121 | Ga0495619_0161072 | |||
| 2122 | Ga0501084_0019206 | |||
| 2123 | Ga0501084_0022285 | |||
| 2124 | Ga0501084_0035743 | |||
| 2125 | Ga0501084_0058566 | |||
| 2126 | Ga0501084_0114451 | |||
| 2127 | Ga0501084_0132389 | |||
| 2128 | Ga0501082_0003497 | |||
| 2129 | Ga0501082_0007361 | |||
| 2130 | Ga0501082_0020391 | |||
| 2131 | Ga0501082_0024039 | |||
| 2132 | Ga0501082_0034967 | |||
| 2133 | Ga0501082_0175674 | |||
| 2134 | Ga0501082_0223850 | |||
| 2135 | Ga0501082_0604034 | |||
| 2136 | Ga0501082_0737920 | |||
| 2137 | Ga0530510_0000475 | |||
| 2138 | Ga0530510_0009115 | |||
| 2139 | Ga0530510_0305998 | |||
| 2140 | Ga0530510_0561438 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9202 | 6 | 220 |
| 7x0q-assembly1.cif.gz_B | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9111 | 6 | 220 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9099 | 1 | 233 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.906 | 6 | 220 |
| 3pux-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 | 0.9026 | 6 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9285 | 1 | 233 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.928 | 6 | 233 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9206 | 6 | 215 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9147 | 6 | 211 | 3.40.50.300 |
| af_P31548_12_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9133 | 26 | 223 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N7IFK1-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9917 | 4 | 235 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A2V2SQV4-F1-model_v4 | deleted | 0.9816 | 4 | 238 |
|
| AF-A0A2A3EW38-F1-model_v4 | deleted | 0.9674 | 1 | 231 |
|
| AF-A0A7K3WDW6-F1-model_v4 | ABC transporter ATP-binding protein | 0.967 | 11 | 237 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A2E7NN84-F1-model_v4 | deleted | 0.9661 | 1 | 233 |
|