F489396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 317 | 2132 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10041235|Ga0105240_100412353 |
| Length | 115 |
| Sequence | MSEPQMPRDKTGLLHGSLDLIVLRTLSLQPMHGYAITQHVARLTDGVLTADPGSLYPALERLKRNGWITAKWQQSPTGRRARYYAITRTGLKQLGRETSEFERFVDAMRRVLRAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 232 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 297 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 317 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.66 |
| Rhizosphere | 98.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10041235 | 3300009093 | Bacteria | 5894 |
| 2 | JGI24750J21931_1087383 | 3300002070 | Unclassified | 525 |
| 3 | JGI25406J46586_10028329 | 3300003203 | Bacteria | 2135 |
| 4 | Ga0065712_10361323 | 3300005290 | Unclassified | 774 |
| 5 | Ga0065715_10136937 | 3300005293 | Bacteria | 1915 |
| 6 | Ga0065707_10018243 | 3300005295 | Bacteria | 1477 |
| 7 | Ga0065707_10412262 | 3300005295 | Bacteria | 839 |
| 8 | Ga0070658_10119638 | 3300005327 | Unclassified | 2188 |
| 9 | Ga0070658_10794887 | 3300005327 | Bacteria | 822 |
| 10 | Ga0070676_10091341 | 3300005328 | Bacteria | 1866 |
| 11 | Ga0070676_10162634 | 3300005328 | Bacteria | 1438 |
| 12 | Ga0070676_10395633 | 3300005328 | Bacteria | 960 |
| 13 | Ga0070676_10402075 | 3300005328 | Bacteria | 953 |
| 14 | Ga0070676_10874771 | 3300005328 | Bacteria | 668 |
| 15 | Ga0070683_100133012 | 3300005329 | Unclassified | 2354 |
| 16 | Ga0070683_100288308 | 3300005329 | Bacteria | 1561 |
| 17 | Ga0070683_100311815 | 3300005329 | Bacteria | 1497 |
| 18 | Ga0070683_100420309 | 3300005329 | Bacteria | 1275 |
| 19 | Ga0070683_100442523 | 3300005329 | Bacteria | 1240 |
| 20 | Ga0070683_100530045 | 3300005329 | Bacteria | 1126 |
| 21 | Ga0070683_100643021 | 3300005329 | Bacteria | 1015 |
| 22 | Ga0070683_100751286 | 3300005329 | Bacteria | 934 |
| 23 | Ga0070683_101709683 | 3300005329 | Unclassified | 605 |
| 24 | Ga0070690_100013382 | 3300005330 | Unclassified | 4845 |
| 25 | Ga0070690_100086975 | 3300005330 | Bacteria | 2052 |
| 26 | Ga0070690_100313332 | 3300005330 | Bacteria | 1128 |
| 27 | Ga0070670_100000904 | 3300005331 | Bacteria | 23331 |
| 28 | Ga0070670_100033628 | 3300005331 | Bacteria | 4416 |
| 29 | Ga0070670_100719117 | 3300005331 | Bacteria | 899 |
| 30 | Ga0070670_101307990 | 3300005331 | Bacteria | 664 |
| 31 | Ga0070677_10111652 | 3300005333 | Bacteria | 1221 |
| 32 | Ga0070677_10316509 | 3300005333 | Bacteria | 798 |
| 33 | Ga0070677_10561652 | 3300005333 | Bacteria | 627 |
| 34 | Ga0070677_10613889 | 3300005333 | Unclassified | 604 |
| 35 | Ga0070677_10904215 | 3300005333 | Bacteria | 510 |
| 36 | Ga0068869_100087372 | 3300005334 | Bacteria | 2339 |
| 37 | Ga0068869_100126608 | 3300005334 | Unclassified | 1959 |
| 38 | Ga0068869_100763969 | 3300005334 | Bacteria | 828 |
| 39 | Ga0068869_101931419 | 3300005334 | Bacteria | 529 |
| 40 | Ga0070666_10139238 | 3300005335 | Bacteria | 1690 |
| 41 | Ga0070666_10181892 | 3300005335 | Bacteria | 1475 |
| 42 | Ga0070666_10325538 | 3300005335 | Unclassified | 1097 |
| 43 | Ga0070666_10368512 | 3300005335 | Unclassified | 1030 |
| 44 | Ga0070680_100039609 | 3300005336 | Bacteria | 3812 |
| 45 | Ga0070680_100060834 | 3300005336 | Unclassified | 3090 |
| 46 | Ga0070680_100990621 | 3300005336 | Bacteria | 726 |
| 47 | Ga0070682_100021644 | 3300005337 | Bacteria | 3798 |
| 48 | Ga0068868_100125071 | 3300005338 | Bacteria | 2100 |
| 49 | Ga0068868_100180363 | 3300005338 | Bacteria | 1752 |
| 50 | Ga0068868_100211794 | 3300005338 | Bacteria | 1620 |
| 51 | Ga0068868_100314694 | 3300005338 | Bacteria | 1332 |
| 52 | Ga0068868_100497714 | 3300005338 | Unclassified | 1067 |
| 53 | Ga0068868_100898620 | 3300005338 | Bacteria | 805 |
| 54 | Ga0070660_100222707 | 3300005339 | Bacteria | 1533 |
| 55 | Ga0070660_100384453 | 3300005339 | Bacteria | 1159 |
| 56 | Ga0070660_100628258 | 3300005339 | Bacteria | 899 |
| 57 | Ga0070689_100031910 | 3300005340 | Bacteria | 4004 |
| 58 | Ga0070689_100042977 | 3300005340 | Bacteria | 3471 |
| 59 | Ga0070689_100045520 | 3300005340 | Bacteria | 3379 |
| 60 | Ga0070689_100963988 | 3300005340 | Unclassified | 757 |
| 61 | Ga0070691_10045887 | 3300005341 | Bacteria | 2074 |
| 62 | Ga0070691_10547305 | 3300005341 | Unclassified | 676 |
| 63 | Ga0070687_100016310 | 3300005343 | Unclassified | 3385 |
| 64 | Ga0070687_100044352 | 3300005343 | Bacteria | 2265 |
| 65 | Ga0070687_100164469 | 3300005343 | Bacteria | 1315 |
| 66 | Ga0070687_100794241 | 3300005343 | Unclassified | 670 |
| 67 | Ga0070661_100007805 | 3300005344 | Bacteria | 7387 |
| 68 | Ga0070661_100042506 | 3300005344 | Bacteria | 3318 |
| 69 | Ga0070661_100228822 | 3300005344 | Bacteria | 1428 |
| 70 | Ga0070661_100271959 | 3300005344 | Bacteria | 1312 |
| 71 | Ga0070661_100679920 | 3300005344 | Bacteria | 837 |
| 72 | Ga0070661_100991182 | 3300005344 | Unclassified | 697 |
| 73 | Ga0070661_101190432 | 3300005344 | Unclassified | 637 |
| 74 | Ga0070661_101639791 | 3300005344 | Unclassified | 544 |
| 75 | Ga0070692_10732475 | 3300005345 | Bacteria | 668 |
| 76 | Ga0070668_100047236 | 3300005347 | Bacteria | 3309 |
| 77 | Ga0070668_100052685 | 3300005347 | Unclassified | 3137 |
| 78 | Ga0070668_100888955 | 3300005347 | Bacteria | 796 |
| 79 | Ga0070668_101958800 | 3300005347 | Bacteria | 540 |
| 80 | Ga0070669_100423683 | 3300005353 | Bacteria | 1093 |
| 81 | Ga0070669_100500613 | 3300005353 | Bacteria | 1008 |
| 82 | Ga0070669_100675041 | 3300005353 | Bacteria | 871 |
| 83 | Ga0070675_100053005 | 3300005354 | Unclassified | 3336 |
| 84 | Ga0070675_100156430 | 3300005354 | Bacteria | 1957 |
| 85 | Ga0070675_100182582 | 3300005354 | Bacteria | 1814 |
| 86 | Ga0070675_100211350 | 3300005354 | Bacteria | 1686 |
| 87 | Ga0070675_100231192 | 3300005354 | Bacteria | 1613 |
| 88 | Ga0070675_100364585 | 3300005354 | Bacteria | 1283 |
| 89 | Ga0070675_100691565 | 3300005354 | Unclassified | 928 |
| 90 | Ga0070675_100706882 | 3300005354 | Unclassified | 918 |
| 91 | Ga0070675_100799960 | 3300005354 | Bacteria | 862 |
| 92 | Ga0070675_101280675 | 3300005354 | Unclassified | 675 |
| 93 | Ga0070675_102185044 | 3300005354 | Unclassified | 510 |
| 94 | Ga0070671_100210096 | 3300005355 | Bacteria | 1651 |
| 95 | Ga0070671_100430753 | 3300005355 | Unclassified | 1130 |
| 96 | Ga0070671_100534020 | 3300005355 | Bacteria | 1011 |
| 97 | Ga0070671_101072630 | 3300005355 | Unclassified | 707 |
| 98 | Ga0070674_100967953 | 3300005356 | Unclassified | 745 |
| 99 | Ga0070674_101483806 | 3300005356 | Bacteria | 609 |
| 100 | Ga0070674_101640313 | 3300005356 | Bacteria | 580 |
| 101 | Ga0070673_100024240 | 3300005364 | Bacteria | 4446 |
| 102 | Ga0070673_100071192 | 3300005364 | Bacteria | 2793 |
| 103 | Ga0070673_100099714 | 3300005364 | Bacteria | 2390 |
| 104 | Ga0070673_100295104 | 3300005364 | Bacteria | 1425 |
| 105 | Ga0070673_100384080 | 3300005364 | Bacteria | 1252 |
| 106 | Ga0070673_102153318 | 3300005364 | Bacteria | 530 |
| 107 | Ga0070688_100010552 | 3300005365 | Bacteria | 5100 |
| 108 | Ga0070688_100075181 | 3300005365 | Bacteria | 2171 |
| 109 | Ga0070688_100186644 | 3300005365 | Bacteria | 1442 |
| 110 | Ga0070688_100937831 | 3300005365 | Bacteria | 685 |
| 111 | Ga0070659_100019223 | 3300005366 | Bacteria | 5171 |
| 112 | Ga0070659_100026628 | 3300005366 | Bacteria | 4451 |
| 113 | Ga0070659_100284441 | 3300005366 | Bacteria | 1376 |
| 114 | Ga0070667_100011181 | 3300005367 | Bacteria | 7425 |
| 115 | Ga0070667_100013813 | 3300005367 | Bacteria | 6676 |
| 116 | Ga0070667_100041948 | 3300005367 | Bacteria | 3838 |
| 117 | Ga0070667_100171648 | 3300005367 | Bacteria | 1915 |
| 118 | Ga0070667_100501825 | 3300005367 | Unclassified | 1112 |
| 119 | Ga0070667_101224458 | 3300005367 | Bacteria | 703 |
| 120 | Ga0070714_100013853 | 3300005435 | Bacteria | 6465 |
| 121 | Ga0070713_100011136 | 3300005436 | Bacteria | 6536 |
| 122 | Ga0070713_100028372 | 3300005436 | Bacteria | 4420 |
| 123 | Ga0070713_100101564 | 3300005436 | Bacteria | 2492 |
| 124 | Ga0070701_10016785 | 3300005438 | Bacteria | 3410 |
| 125 | Ga0070711_100032327 | 3300005439 | Bacteria | 3478 |
| 126 | Ga0070711_100033209 | 3300005439 | Bacteria | 3435 |
| 127 | Ga0070711_100817982 | 3300005439 | Bacteria | 791 |
| 128 | Ga0070711_100850546 | 3300005439 | Unclassified | 776 |
| 129 | Ga0070711_101108908 | 3300005439 | Bacteria | 682 |
| 130 | Ga0070705_100027468 | 3300005440 | Bacteria | 3108 |
| 131 | Ga0070705_100143614 | 3300005440 | Unclassified | 1574 |
| 132 | Ga0070705_100499514 | 3300005440 | Bacteria | 923 |
| 133 | Ga0070705_101347664 | 3300005440 | Unclassified | 593 |
| 134 | Ga0070700_100220696 | 3300005441 | Bacteria | 1343 |
| 135 | Ga0070700_100751143 | 3300005441 | Unclassified | 781 |
| 136 | Ga0070700_101106530 | 3300005441 | Unclassified | 657 |
| 137 | Ga0070694_100024296 | 3300005444 | Bacteria | 3911 |
| 138 | Ga0070694_100093006 | 3300005444 | Unclassified | 2119 |
| 139 | Ga0070708_102042697 | 3300005445 | Bacteria | 530 |
| 140 | Ga0070663_100057117 | 3300005455 | Bacteria | 2799 |
| 141 | Ga0070663_100988795 | 3300005455 | Unclassified | 731 |
| 142 | Ga0070663_101290171 | 3300005455 | Unclassified | 644 |
| 143 | Ga0070678_101231644 | 3300005456 | Bacteria | 695 |
| 144 | Ga0070678_101249168 | 3300005456 | Unclassified | 690 |
| 145 | Ga0070662_100017082 | 3300005457 | Bacteria | 4884 |
| 146 | Ga0070662_100019646 | 3300005457 | Bacteria | 4589 |
| 147 | Ga0070681_10001603 | 3300005458 | Bacteria | 20122 |
| 148 | Ga0070681_10002295 | 3300005458 | Bacteria | 17491 |
| 149 | Ga0070681_10008854 | 3300005458 | Bacteria | 9888 |
| 150 | Ga0070681_10026191 | 3300005458 | Bacteria | 5863 |
| 151 | Ga0070681_10097887 | 3300005458 | Bacteria | 2880 |
| 152 | Ga0070681_10158889 | 3300005458 | Bacteria | 2184 |
| 153 | Ga0070681_10172772 | 3300005458 | Bacteria | 2083 |
| 154 | Ga0070681_10389505 | 3300005458 | Unclassified | 1304 |
| 155 | Ga0070681_10428619 | 3300005458 | Bacteria | 1235 |
| 156 | Ga0070681_10860457 | 3300005458 | Bacteria | 824 |
| 157 | Ga0070681_11261192 | 3300005458 | Bacteria | 661 |
| 158 | Ga0070681_11453147 | 3300005458 | Bacteria | 610 |
| 159 | Ga0068867_100012151 | 3300005459 | Bacteria | 6083 |
| 160 | Ga0068867_100065455 | 3300005459 | Bacteria | 2705 |
| 161 | Ga0068867_100206350 | 3300005459 | Bacteria | 1576 |
| 162 | Ga0068867_100319396 | 3300005459 | Bacteria | 1286 |
| 163 | Ga0068867_100459748 | 3300005459 | Bacteria | 1086 |
| 164 | Ga0068867_100516008 | 3300005459 | Bacteria | 1030 |
| 165 | Ga0068867_101370975 | 3300005459 | Bacteria | 655 |
| 166 | Ga0070685_10015127 | 3300005466 | Bacteria | 4095 |
| 167 | Ga0070685_10042176 | 3300005466 | Bacteria | 2603 |
| 168 | Ga0070706_100417470 | 3300005467 | Bacteria | 1249 |
| 169 | Ga0070707_100005834 | 3300005468 | Bacteria | 11484 |
| 170 | Ga0070707_100881402 | 3300005468 | Bacteria | 859 |
| 171 | Ga0070707_101947140 | 3300005468 | Unclassified | 555 |
| 172 | Ga0070698_100060264 | 3300005471 | Bacteria | 3830 |
| 173 | Ga0070698_100122601 | 3300005471 | Bacteria | 2558 |
| 174 | Ga0070698_100236108 | 3300005471 | Bacteria | 1761 |
| 175 | Ga0070698_100534041 | 3300005471 | Bacteria | 1112 |
| 176 | Ga0070699_100000057 | 3300005518 | Bacteria | 109108 |
| 177 | Ga0070699_100047236 | 3300005518 | Bacteria | 3724 |
| 178 | Ga0070679_100001128 | 3300005530 | Bacteria | 23328 |
| 179 | Ga0070679_100003527 | 3300005530 | Bacteria | 14324 |
| 180 | Ga0070679_100005952 | 3300005530 | Bacteria | 11338 |
| 181 | Ga0070679_100006736 | 3300005530 | Bacteria | 10714 |
| 182 | Ga0070679_100123913 | 3300005530 | Bacteria | 2567 |
| 183 | Ga0070679_100568866 | 3300005530 | Bacteria | 1077 |
| 184 | Ga0070679_100573956 | 3300005530 | Bacteria | 1071 |
| 185 | Ga0070684_100003829 | 3300005535 | Bacteria | 11380 |
| 186 | Ga0070684_100031684 | 3300005535 | Bacteria | 4503 |
| 187 | Ga0070684_100132976 | 3300005535 | Bacteria | 2245 |
| 188 | Ga0070684_100193515 | 3300005535 | Bacteria | 1851 |
| 189 | Ga0070684_100249484 | 3300005535 | Bacteria | 1622 |
| 190 | Ga0070684_100276353 | 3300005535 | Unclassified | 1538 |
| 191 | Ga0070684_100948056 | 3300005535 | Unclassified | 807 |
| 192 | Ga0070684_102071630 | 3300005535 | Unclassified | 537 |
| 193 | Ga0068853_100074174 | 3300005539 | Bacteria | 2968 |
| 194 | Ga0068853_100085519 | 3300005539 | Bacteria | 2764 |
| 195 | Ga0068853_100305564 | 3300005539 | Unclassified | 1471 |
| 196 | Ga0068853_100357474 | 3300005539 | Bacteria | 1360 |
| 197 | Ga0070672_100049941 | 3300005543 | Bacteria | 3256 |
| 198 | Ga0070672_100198883 | 3300005543 | Bacteria | 1675 |
| 199 | Ga0070672_100405143 | 3300005543 | Bacteria | 1169 |
| 200 | Ga0070672_100564049 | 3300005543 | Unclassified | 989 |
| 201 | Ga0070672_101149723 | 3300005543 | Bacteria | 691 |
| 202 | Ga0070672_101485028 | 3300005543 | Bacteria | 607 |
| 203 | Ga0070686_100047813 | 3300005544 | Unclassified | 2707 |
| 204 | Ga0070686_100888045 | 3300005544 | Unclassified | 724 |
| 205 | Ga0070696_100541395 | 3300005546 | Unclassified | 932 |
| 206 | Ga0070696_101717108 | 3300005546 | Unclassified | 541 |
| 207 | Ga0070693_100002524 | 3300005547 | Bacteria | 8435 |
| 208 | Ga0070693_100084545 | 3300005547 | Bacteria | 1899 |
| 209 | Ga0070693_100988608 | 3300005547 | Unclassified | 636 |
| 210 | Ga0070665_100061474 | 3300005548 | Bacteria | 3766 |
| 211 | Ga0070665_100334146 | 3300005548 | Bacteria | 1520 |
| 212 | Ga0070665_100711042 | 3300005548 | Bacteria | 1018 |
| 213 | Ga0070665_100773766 | 3300005548 | Bacteria | 973 |
| 214 | Ga0070665_101313989 | 3300005548 | Bacteria | 733 |
| 215 | Ga0070704_100000531 | 3300005549 | Bacteria | 18265 |
| 216 | Ga0070704_100178157 | 3300005549 | Bacteria | 1698 |
| 217 | Ga0068855_100062475 | 3300005563 | Bacteria | 4348 |
| 218 | Ga0068855_100088006 | 3300005563 | Bacteria | 3588 |
| 219 | Ga0068855_100177426 | 3300005563 | Bacteria | 2410 |
| 220 | Ga0068855_100695592 | 3300005563 | Bacteria | 1088 |
| 221 | Ga0068855_100821581 | 3300005563 | Bacteria | 986 |
| 222 | Ga0068855_102274887 | 3300005563 | Unclassified | 543 |
| 223 | Ga0070664_100020551 | 3300005564 | Bacteria | 5437 |
| 224 | Ga0070664_100031885 | 3300005564 | Bacteria | 4407 |
| 225 | Ga0070664_100065824 | 3300005564 | Unclassified | 3093 |
| 226 | Ga0070664_100146632 | 3300005564 | Bacteria | 2081 |
| 227 | Ga0070664_100191620 | 3300005564 | Bacteria | 1822 |
| 228 | Ga0070664_100221105 | 3300005564 | Unclassified | 1694 |
| 229 | Ga0070664_100242055 | 3300005564 | Bacteria | 1620 |
| 230 | Ga0070664_100769764 | 3300005564 | Bacteria | 899 |
| 231 | Ga0070664_100920572 | 3300005564 | Bacteria | 820 |
| 232 | Ga0068857_100021861 | 3300005577 | Bacteria | 5629 |
| 233 | Ga0068857_100084177 | 3300005577 | Bacteria | 2842 |
| 234 | Ga0068857_100270577 | 3300005577 | Bacteria | 1561 |
| 235 | Ga0068857_100286195 | 3300005577 | Bacteria | 1517 |
| 236 | Ga0068857_100404595 | 3300005577 | Bacteria | 1270 |
| 237 | Ga0068857_100409478 | 3300005577 | Bacteria | 1263 |
| 238 | Ga0068854_100033476 | 3300005578 | Unclassified | 3583 |
| 239 | Ga0068854_100056047 | 3300005578 | Bacteria | 2840 |
| 240 | Ga0068854_101098127 | 3300005578 | Bacteria | 708 |
| 241 | Ga0068856_100016757 | 3300005614 | Bacteria | 7099 |
| 242 | Ga0068856_100251183 | 3300005614 | Bacteria | 1783 |
| 243 | Ga0068856_100288855 | 3300005614 | Unclassified | 1657 |
| 244 | Ga0068856_100555179 | 3300005614 | Bacteria | 1170 |
| 245 | Ga0068856_100642779 | 3300005614 | Bacteria | 1081 |
| 246 | Ga0068856_101378737 | 3300005614 | Bacteria | 720 |
| 247 | Ga0068856_101626486 | 3300005614 | Bacteria | 659 |
| 248 | Ga0070702_100023240 | 3300005615 | Bacteria | 3291 |
| 249 | Ga0070702_100569234 | 3300005615 | Unclassified | 844 |
| 250 | Ga0070702_100943677 | 3300005615 | Bacteria | 679 |
| 251 | Ga0068852_100062994 | 3300005616 | Bacteria | 3227 |
| 252 | Ga0068852_100088266 | 3300005616 | Unclassified | 2769 |
| 253 | Ga0068852_100107430 | 3300005616 | Bacteria | 2531 |
| 254 | Ga0068852_100129472 | 3300005616 | Bacteria | 2322 |
| 255 | Ga0068852_100207321 | 3300005616 | Unclassified | 1858 |
| 256 | Ga0068852_100343675 | 3300005616 | Bacteria | 1455 |
| 257 | Ga0068852_100367435 | 3300005616 | Bacteria | 1409 |
| 258 | Ga0068852_101132556 | 3300005616 | Bacteria | 803 |
| 259 | Ga0068859_100017193 | 3300005617 | Bacteria | 7262 |
| 260 | Ga0068859_100040659 | 3300005617 | Bacteria | 4668 |
| 261 | Ga0068859_100093556 | 3300005617 | Bacteria | 3057 |
| 262 | Ga0068859_100174045 | 3300005617 | Bacteria | 2234 |
| 263 | Ga0068864_100006515 | 3300005618 | Bacteria | 9570 |
| 264 | Ga0068864_100413405 | 3300005618 | Bacteria | 1284 |
| 265 | Ga0068864_101935185 | 3300005618 | Unclassified | 595 |
| 266 | Ga0068866_10181416 | 3300005718 | Bacteria | 1244 |
| 267 | Ga0068866_10327437 | 3300005718 | Unclassified | 966 |
| 268 | Ga0068861_100007581 | 3300005719 | Bacteria | 7444 |
| 269 | Ga0068851_10407791 | 3300005834 | Unclassified | 801 |
| 270 | Ga0068870_10042309 | 3300005840 | Bacteria | 2371 |
| 271 | Ga0068870_10197850 | 3300005840 | Bacteria | 1217 |
| 272 | Ga0068870_10377440 | 3300005840 | Bacteria | 917 |
| 273 | Ga0068863_100067858 | 3300005841 | Bacteria | 3373 |
| 274 | Ga0068863_100426873 | 3300005841 | Bacteria | 1299 |
| 275 | Ga0068863_100651529 | 3300005841 | Unclassified | 1044 |
| 276 | Ga0068863_102137600 | 3300005841 | Bacteria | 570 |
| 277 | Ga0068858_100235037 | 3300005842 | Bacteria | 1738 |
| 278 | Ga0068858_100808842 | 3300005842 | Bacteria | 914 |
| 279 | Ga0068860_100067002 | 3300005843 | Bacteria | 3412 |
| 280 | Ga0068860_100086798 | 3300005843 | Bacteria | 2978 |
| 281 | Ga0068860_100877157 | 3300005843 | Bacteria | 913 |
| 282 | Ga0068862_100055055 | 3300005844 | Bacteria | 3407 |
| 283 | Ga0068862_100069630 | 3300005844 | Bacteria | 3037 |
| 284 | Ga0068862_100115639 | 3300005844 | Bacteria | 2359 |
| 285 | Ga0068862_100330946 | 3300005844 | Bacteria | 1408 |
| 286 | Ga0068862_101289908 | 3300005844 | Bacteria | 731 |
| 287 | Ga0068862_101303415 | 3300005844 | Bacteria | 727 |
| 288 | Ga0068862_102273451 | 3300005844 | Unclassified | 554 |
| 289 | Ga0081539_10002155 | 3300005985 | Bacteria | 29026 |
| 290 | Ga0075432_10161773 | 3300006058 | Bacteria | 866 |
| 291 | Ga0075432_10248270 | 3300006058 | Unclassified | 721 |
| 292 | Ga0070712_100041575 | 3300006175 | Bacteria | 3157 |
| 293 | Ga0070712_100853918 | 3300006175 | Bacteria | 783 |
| 294 | Ga0097621_100121813 | 3300006237 | Bacteria | 2213 |
| 295 | Ga0097621_100383481 | 3300006237 | Unclassified | 1256 |
| 296 | Ga0097621_100748093 | 3300006237 | Bacteria | 903 |
| 297 | Ga0097621_101064996 | 3300006237 | Bacteria | 758 |
| 298 | Ga0097621_101197993 | 3300006237 | Bacteria | 715 |
| 299 | Ga0097621_102254217 | 3300006237 | Unclassified | 521 |
| 300 | Ga0068871_100031846 | 3300006358 | Bacteria | 4161 |
| 301 | Ga0068871_100189328 | 3300006358 | Bacteria | 1772 |
| 302 | Ga0068871_100247130 | 3300006358 | Bacteria | 1553 |
| 303 | Ga0068871_100464198 | 3300006358 | Bacteria | 1137 |
| 304 | Ga0068871_100749360 | 3300006358 | Bacteria | 898 |
| 305 | Ga0068871_100773376 | 3300006358 | Bacteria | 884 |
| 306 | Ga0075428_100009803 | 3300006844 | Bacteria | 10645 |
| 307 | Ga0075428_102542924 | 3300006844 | Unclassified | 524 |
| 308 | Ga0075430_100006156 | 3300006846 | Bacteria | 10108 |
| 309 | Ga0075430_100010546 | 3300006846 | Bacteria | 7822 |
| 310 | Ga0075430_100025202 | 3300006846 | Bacteria | 5058 |
| 311 | Ga0075430_100069204 | 3300006846 | Bacteria | 2961 |
| 312 | Ga0075430_100206145 | 3300006846 | Bacteria | 1632 |
| 313 | Ga0075430_100362574 | 3300006846 | Unclassified | 1197 |
| 314 | Ga0075430_100636009 | 3300006846 | Bacteria | 880 |
| 315 | Ga0075431_100016436 | 3300006847 | Bacteria | 7511 |
| 316 | Ga0075431_100033112 | 3300006847 | Bacteria | 5326 |
| 317 | Ga0075431_100177709 | 3300006847 | Bacteria | 2185 |
| 318 | Ga0075431_100257460 | 3300006847 | Bacteria | 1772 |
| 319 | Ga0075431_100336850 | 3300006847 | Unclassified | 1518 |
| 320 | Ga0075431_101651264 | 3300006847 | Bacteria | 598 |
| 321 | Ga0075433_10070059 | 3300006852 | Unclassified | 3081 |
| 322 | Ga0075433_11007216 | 3300006852 | Unclassified | 726 |
| 323 | Ga0075433_11051268 | 3300006852 | Unclassified | 709 |
| 324 | Ga0075434_100364284 | 3300006871 | Bacteria | 1466 |
| 325 | Ga0075434_100977096 | 3300006871 | Unclassified | 861 |
| 326 | Ga0075429_100080005 | 3300006880 | Bacteria | 2848 |
| 327 | Ga0075429_100610573 | 3300006880 | Bacteria | 956 |
| 328 | Ga0075429_101440900 | 3300006880 | Bacteria | 600 |
| 329 | Ga0068865_100711051 | 3300006881 | Unclassified | 859 |
| 330 | Ga0068865_101113151 | 3300006881 | Unclassified | 696 |
| 331 | Ga0068865_101388973 | 3300006881 | Bacteria | 627 |
| 332 | Ga0075436_100005295 | 3300006914 | Bacteria | 8873 |
| 333 | Ga0097620_100017193 | 3300006931 | Bacteria | 7262 |
| 334 | Ga0097620_100040659 | 3300006931 | Bacteria | 4668 |
| 335 | Ga0097620_100093566 | 3300006931 | Bacteria | 3057 |
| 336 | Ga0097620_100174045 | 3300006931 | Bacteria | 2234 |
| 337 | Ga0105240_10190521 | 3300009093 | Bacteria | 2412 |
| 338 | Ga0105240_10227672 | 3300009093 | Bacteria | 2168 |
| 339 | Ga0105240_10534431 | 3300009093 | Unclassified | 1299 |
| 340 | Ga0105240_10739361 | 3300009093 | Unclassified | 1070 |
| 341 | Ga0105240_10806833 | 3300009093 | Unclassified | 1016 |
| 342 | Ga0105240_10931030 | 3300009093 | Unclassified | 933 |
| 343 | Ga0105240_11766538 | 3300009093 | Bacteria | 645 |
| 344 | Ga0111539_10039634 | 3300009094 | Bacteria | 5676 |
| 345 | Ga0111539_10069428 | 3300009094 | Bacteria | 4161 |
| 346 | Ga0111539_10571041 | 3300009094 | Unclassified | 1317 |
| 347 | Ga0111539_10736563 | 3300009094 | Bacteria | 1147 |
| 348 | Ga0105245_10007242 | 3300009098 | Bacteria | 9717 |
| 349 | Ga0105245_10779545 | 3300009098 | Bacteria | 993 |
| 350 | Ga0105245_11720415 | 3300009098 | Bacteria | 679 |
| 351 | Ga0105247_10269700 | 3300009101 | Unclassified | 1170 |
| 352 | Ga0105247_10665057 | 3300009101 | Unclassified | 780 |
| 353 | Ga0114129_10145426 | 3300009147 | Bacteria | 3248 |
| 354 | Ga0114129_10328531 | 3300009147 | Bacteria | 2031 |
| 355 | Ga0114129_10584599 | 3300009147 | Bacteria | 1449 |
| 356 | Ga0114129_12658119 | 3300009147 | Bacteria | 597 |
| 357 | Ga0105243_10465289 | 3300009148 | Bacteria | 1190 |
| 358 | Ga0105243_10643620 | 3300009148 | Bacteria | 1026 |
| 359 | Ga0105243_10672849 | 3300009148 | Bacteria | 1006 |
| 360 | Ga0105243_11316450 | 3300009148 | Unclassified | 740 |
| 361 | Ga0105243_12314895 | 3300009148 | Unclassified | 575 |
| 362 | Ga0105241_10013440 | 3300009174 | Bacteria | 6001 |
| 363 | Ga0105241_10303450 | 3300009174 | Bacteria | 1371 |
| 364 | Ga0105241_10400246 | 3300009174 | Unclassified | 1204 |
| 365 | Ga0105242_10059781 | 3300009176 | Bacteria | 3128 |
| 366 | Ga0105242_10333063 | 3300009176 | Unclassified | 1396 |
| 367 | Ga0105242_10712276 | 3300009176 | Bacteria | 983 |
| 368 | Ga0105242_11149461 | 3300009176 | Bacteria | 793 |
| 369 | Ga0105242_11727198 | 3300009176 | Unclassified | 663 |
| 370 | Ga0105248_10003817 | 3300009177 | Bacteria | 16711 |
| 371 | Ga0105248_10029120 | 3300009177 | Bacteria | 6157 |
| 372 | Ga0105248_10073913 | 3300009177 | Bacteria | 3832 |
| 373 | Ga0105248_10112827 | 3300009177 | Bacteria | 3066 |
| 374 | Ga0105248_10289681 | 3300009177 | Unclassified | 1844 |
| 375 | Ga0105248_11115384 | 3300009177 | Bacteria | 892 |
| 376 | Ga0105237_10048456 | 3300009545 | Bacteria | 4271 |
| 377 | Ga0105237_10075964 | 3300009545 | Unclassified | 3350 |
| 378 | Ga0105237_10107229 | 3300009545 | Bacteria | 2785 |
| 379 | Ga0105237_10269506 | 3300009545 | Bacteria | 1705 |
| 380 | Ga0105237_10362049 | 3300009545 | Unclassified | 1455 |
| 381 | Ga0105237_10550172 | 3300009545 | Bacteria | 1161 |
| 382 | Ga0105237_11054537 | 3300009545 | Unclassified | 820 |
| 383 | Ga0105238_10071480 | 3300009551 | Bacteria | 3467 |
| 384 | Ga0105238_10072112 | 3300009551 | Bacteria | 3450 |
| 385 | Ga0105238_10109256 | 3300009551 | Bacteria | 2747 |
| 386 | Ga0105238_10224419 | 3300009551 | Bacteria | 1855 |
| 387 | Ga0105238_10894150 | 3300009551 | Bacteria | 906 |
| 388 | Ga0105238_11990180 | 3300009551 | Unclassified | 614 |
| 389 | Ga0105238_12253663 | 3300009551 | Unclassified | 580 |
| 390 | Ga0105249_10063658 | 3300009553 | Bacteria | 3389 |
| 391 | Ga0105249_10110725 | 3300009553 | Bacteria | 2595 |
| 392 | Ga0105249_10477355 | 3300009553 | Bacteria | 1289 |
| 393 | Ga0105239_12513338 | 3300010375 | Bacteria | 600 |
| 394 | Ga0105239_13571907 | 3300010375 | Unclassified | 505 |
| 395 | Ga0105246_10007915 | 3300011119 | Bacteria | 6522 |
| 396 | Ga0105246_10224709 | 3300011119 | Bacteria | 1474 |
| 397 | Ga0105246_11220027 | 3300011119 | Bacteria | 693 |
| 398 | Ga0105246_12301840 | 3300011119 | Bacteria | 526 |
| 399 | Ga0157316_1019887 | 3300012510 | Bacteria | 724 |
| 400 | Ga0157373_10036032 | 3300013100 | Bacteria | 3551 |
| 401 | Ga0157373_10157003 | 3300013100 | Bacteria | 1600 |
| 402 | Ga0157373_10680262 | 3300013100 | Unclassified | 753 |
| 403 | Ga0157371_10704215 | 3300013102 | Bacteria | 756 |
| 404 | Ga0157371_11058472 | 3300013102 | Bacteria | 621 |
| 405 | Ga0157371_11271931 | 3300013102 | Unclassified | 569 |
| 406 | Ga0157370_10010027 | 3300013104 | Bacteria | 10023 |
| 407 | Ga0157370_10011467 | 3300013104 | Bacteria | 9265 |
| 408 | Ga0157370_10065570 | 3300013104 | Bacteria | 3435 |
| 409 | Ga0157370_10118456 | 3300013104 | Bacteria | 2473 |
| 410 | Ga0157370_10400529 | 3300013104 | Bacteria | 1263 |
| 411 | Ga0157370_11103133 | 3300013104 | Bacteria | 717 |
| 412 | Ga0157369_10214283 | 3300013105 | Unclassified | 2018 |
| 413 | Ga0157369_10320945 | 3300013105 | Unclassified | 1610 |
| 414 | Ga0157369_10540179 | 3300013105 | Bacteria | 1205 |
| 415 | Ga0157369_10546608 | 3300013105 | Unclassified | 1197 |
| 416 | Ga0157369_10621759 | 3300013105 | Bacteria | 1114 |
| 417 | Ga0157369_10664188 | 3300013105 | Unclassified | 1074 |
| 418 | Ga0157369_10671366 | 3300013105 | Bacteria | 1068 |
| 419 | Ga0157369_10748289 | 3300013105 | Bacteria | 1006 |
| 420 | Ga0157369_11048097 | 3300013105 | Unclassified | 834 |
| 421 | Ga0157369_11076867 | 3300013105 | Bacteria | 822 |
| 422 | Ga0157369_12285040 | 3300013105 | Bacteria | 548 |
| 423 | Ga0157374_10066369 | 3300013296 | Bacteria | 3391 |
| 424 | Ga0157374_10364645 | 3300013296 | Unclassified | 1437 |
| 425 | Ga0157374_11345065 | 3300013296 | Bacteria | 737 |
| 426 | Ga0157374_11616001 | 3300013296 | Bacteria | 672 |
| 427 | Ga0157378_10111950 | 3300013297 | Bacteria | 2503 |
| 428 | Ga0157378_11242987 | 3300013297 | Unclassified | 785 |
| 429 | Ga0157378_13167498 | 3300013297 | Unclassified | 511 |
| 430 | Ga0157378_13291544 | 3300013297 | Unclassified | 502 |
| 431 | Ga0163162_10095293 | 3300013306 | Bacteria | 3063 |
| 432 | Ga0163162_11373386 | 3300013306 | Bacteria | 803 |
| 433 | Ga0157372_10001817 | 3300013307 | Bacteria | 23138 |
| 434 | Ga0157372_10013190 | 3300013307 | Bacteria | 8818 |
| 435 | Ga0157372_10057587 | 3300013307 | Bacteria | 4344 |
| 436 | Ga0157372_10061767 | 3300013307 | Bacteria | 4196 |
| 437 | Ga0157372_10092219 | 3300013307 | Unclassified | 3446 |
| 438 | Ga0157372_10143161 | 3300013307 | Bacteria | 2757 |
| 439 | Ga0157372_10212214 | 3300013307 | Unclassified | 2243 |
| 440 | Ga0157372_10548067 | 3300013307 | Bacteria | 1348 |
| 441 | Ga0157372_10629483 | 3300013307 | Unclassified | 1250 |
| 442 | Ga0157372_10943846 | 3300013307 | Unclassified | 1000 |
| 443 | Ga0157372_11612413 | 3300013307 | Bacteria | 747 |
| 444 | Ga0157372_11975603 | 3300013307 | Bacteria | 670 |
| 445 | Ga0157372_12353834 | 3300013307 | Bacteria | 612 |
| 446 | Ga0157375_10006012 | 3300013308 | Bacteria | 10582 |
| 447 | Ga0157375_10070737 | 3300013308 | Bacteria | 3500 |
| 448 | Ga0157375_10432061 | 3300013308 | Bacteria | 1483 |
| 449 | Ga0157375_10494971 | 3300013308 | Bacteria | 1387 |
| 450 | Ga0157375_10597053 | 3300013308 | Bacteria | 1263 |
| 451 | Ga0157375_10740699 | 3300013308 | Unclassified | 1135 |
| 452 | Ga0157375_11050314 | 3300013308 | Bacteria | 952 |
| 453 | Ga0157375_13690716 | 3300013308 | Bacteria | 509 |
| 454 | Ga0163163_10181838 | 3300014325 | Bacteria | 2150 |
| 455 | Ga0163163_10872474 | 3300014325 | Bacteria | 963 |
| 456 | Ga0157380_10199431 | 3300014326 | Bacteria | 1774 |
| 457 | Ga0157377_10038185 | 3300014745 | Bacteria | 2650 |
| 458 | Ga0157377_10092017 | 3300014745 | Bacteria | 1792 |
| 459 | Ga0157377_10744571 | 3300014745 | Bacteria | 716 |
| 460 | Ga0157379_10032105 | 3300014968 | Bacteria | 4679 |
| 461 | Ga0157379_10907750 | 3300014968 | Unclassified | 836 |
| 462 | Ga0157379_12536000 | 3300014968 | Unclassified | 513 |
| 463 | Ga0157376_10172316 | 3300014969 | Bacteria | 1972 |
| 464 | Ga0157376_10305078 | 3300014969 | Bacteria | 1508 |
| 465 | Ga0157376_10392945 | 3300014969 | Unclassified | 1339 |
| 466 | Ga0182007_10230636 | 3300015262 | Bacteria | 657 |
| 467 | Ga0163161_10055074 | 3300017792 | Bacteria | 2887 |
| 468 | Ga0163161_11876906 | 3300017792 | Unclassified | 533 |
| 469 | Ga0197907_10655093 | 3300020069 | Bacteria | 1117 |
| 470 | Ga0206356_11747774 | 3300020070 | Unclassified | 880 |
| 471 | Ga0206353_10375004 | 3300020082 | Unclassified | 1034 |
| 472 | Ga0206353_11833831 | 3300020082 | Unclassified | 517 |
| 473 | Ga0213876_10006682 | 3300021384 | Bacteria | 6296 |
| 474 | Ga0213876_10033566 | 3300021384 | Bacteria | 2706 |
| 475 | Ga0207697_10030749 | 3300025315 | Bacteria | 2197 |
| 476 | Ga0207697_10116990 | 3300025315 | Bacteria | 1145 |
| 477 | Ga0207656_10689662 | 3300025321 | Unclassified | 523 |
| 478 | Ga0207682_10083049 | 3300025893 | Bacteria | 1376 |
| 479 | Ga0207682_10419533 | 3300025893 | Unclassified | 633 |
| 480 | Ga0207642_10008793 | 3300025899 | Bacteria | 3485 |
| 481 | Ga0207642_10602623 | 3300025899 | Unclassified | 684 |
| 482 | Ga0207688_10252230 | 3300025901 | Unclassified | 1069 |
| 483 | Ga0207688_10316769 | 3300025901 | Unclassified | 956 |
| 484 | Ga0207680_10161330 | 3300025903 | Unclassified | 1503 |
| 485 | Ga0207680_10714337 | 3300025903 | Unclassified | 718 |
| 486 | Ga0207680_10844699 | 3300025903 | Unclassified | 656 |
| 487 | Ga0207647_10187262 | 3300025904 | Bacteria | 1200 |
| 488 | Ga0207685_10585387 | 3300025905 | Bacteria | 597 |
| 489 | Ga0207699_10004952 | 3300025906 | Bacteria | 6368 |
| 490 | Ga0207645_10014647 | 3300025907 | Bacteria | 5238 |
| 491 | Ga0207645_10019830 | 3300025907 | Bacteria | 4404 |
| 492 | Ga0207645_10030696 | 3300025907 | Unclassified | 3463 |
| 493 | Ga0207645_10149855 | 3300025907 | Bacteria | 1522 |
| 494 | Ga0207645_10276860 | 3300025907 | Bacteria | 1114 |
| 495 | Ga0207643_10010411 | 3300025908 | Bacteria | 5010 |
| 496 | Ga0207643_10023178 | 3300025908 | Bacteria | 3423 |
| 497 | Ga0207643_10052743 | 3300025908 | Unclassified | 2310 |
| 498 | Ga0207705_10620709 | 3300025909 | Bacteria | 841 |
| 499 | Ga0207705_11361390 | 3300025909 | Bacteria | 541 |
| 500 | Ga0207684_10143724 | 3300025910 | Bacteria | 2052 |
| 501 | Ga0207684_10817661 | 3300025910 | Bacteria | 787 |
| 502 | Ga0207707_10020675 | 3300025912 | Bacteria | 5748 |
| 503 | Ga0207707_10022689 | 3300025912 | Bacteria | 5489 |
| 504 | Ga0207707_10050164 | 3300025912 | Bacteria | 3636 |
| 505 | Ga0207707_10112665 | 3300025912 | Bacteria | 2378 |
| 506 | Ga0207707_10149627 | 3300025912 | Bacteria | 2041 |
| 507 | Ga0207707_10166290 | 3300025912 | Unclassified | 1928 |
| 508 | Ga0207707_10641026 | 3300025912 | Unclassified | 896 |
| 509 | Ga0207707_10956084 | 3300025912 | Bacteria | 705 |
| 510 | Ga0207695_10011163 | 3300025913 | Bacteria | 10902 |
| 511 | Ga0207695_10029248 | 3300025913 | Bacteria | 6094 |
| 512 | Ga0207695_10089970 | 3300025913 | Bacteria | 3086 |
| 513 | Ga0207695_10122102 | 3300025913 | Bacteria | 2572 |
| 514 | Ga0207695_10432906 | 3300025913 | Bacteria | 1199 |
| 515 | Ga0207671_10359251 | 3300025914 | Bacteria | 1156 |
| 516 | Ga0207671_10639887 | 3300025914 | Bacteria | 847 |
| 517 | Ga0207671_10732865 | 3300025914 | Bacteria | 785 |
| 518 | Ga0207671_10801147 | 3300025914 | Unclassified | 747 |
| 519 | Ga0207693_10084841 | 3300025915 | Bacteria | 2481 |
| 520 | Ga0207663_10073697 | 3300025916 | Unclassified | 2210 |
| 521 | Ga0207663_10402968 | 3300025916 | Bacteria | 1046 |
| 522 | Ga0207663_11477049 | 3300025916 | Bacteria | 547 |
| 523 | Ga0207660_10062347 | 3300025917 | Bacteria | 2686 |
| 524 | Ga0207660_10062540 | 3300025917 | Bacteria | 2682 |
| 525 | Ga0207660_10140432 | 3300025917 | Bacteria | 1846 |
| 526 | Ga0207660_10521964 | 3300025917 | Unclassified | 964 |
| 527 | Ga0207662_10012819 | 3300025918 | Bacteria | 4676 |
| 528 | Ga0207662_10023547 | 3300025918 | Bacteria | 3539 |
| 529 | Ga0207662_10027667 | 3300025918 | Bacteria | 3273 |
| 530 | Ga0207657_10021308 | 3300025919 | Bacteria | 6103 |
| 531 | Ga0207657_10068088 | 3300025919 | Bacteria | 3025 |
| 532 | Ga0207649_10050898 | 3300025920 | Bacteria | 2564 |
| 533 | Ga0207649_10070909 | 3300025920 | Bacteria | 2224 |
| 534 | Ga0207649_10155728 | 3300025920 | Bacteria | 1578 |
| 535 | Ga0207649_10194883 | 3300025920 | Unclassified | 1427 |
| 536 | Ga0207649_10606764 | 3300025920 | Bacteria | 842 |
| 537 | Ga0207652_10008038 | 3300025921 | Bacteria | 8466 |
| 538 | Ga0207652_10015933 | 3300025921 | Bacteria | 6126 |
| 539 | Ga0207652_10028951 | 3300025921 | Unclassified | 4625 |
| 540 | Ga0207652_10034546 | 3300025921 | Bacteria | 4262 |
| 541 | Ga0207652_10072733 | 3300025921 | Bacteria | 2990 |
| 542 | Ga0207652_10599679 | 3300025921 | Unclassified | 988 |
| 543 | Ga0207652_11264950 | 3300025921 | Unclassified | 640 |
| 544 | Ga0207646_10008918 | 3300025922 | Bacteria | 9988 |
| 545 | Ga0207646_10706264 | 3300025922 | Bacteria | 901 |
| 546 | Ga0207646_11512835 | 3300025922 | Unclassified | 581 |
| 547 | Ga0207681_10206938 | 3300025923 | Bacteria | 1510 |
| 548 | Ga0207681_10260734 | 3300025923 | Bacteria | 1357 |
| 549 | Ga0207681_10283811 | 3300025923 | Bacteria | 1304 |
| 550 | Ga0207681_10858869 | 3300025923 | Unclassified | 759 |
| 551 | Ga0207681_11041801 | 3300025923 | Bacteria | 687 |
| 552 | Ga0207694_10081652 | 3300025924 | Bacteria | 2540 |
| 553 | Ga0207694_10161397 | 3300025924 | Bacteria | 1810 |
| 554 | Ga0207694_10309540 | 3300025924 | Unclassified | 1302 |
| 555 | Ga0207694_11631714 | 3300025924 | Bacteria | 543 |
| 556 | Ga0207650_10316434 | 3300025925 | Unclassified | 1277 |
| 557 | Ga0207650_10621842 | 3300025925 | Bacteria | 909 |
| 558 | Ga0207650_10807003 | 3300025925 | Unclassified | 795 |
| 559 | Ga0207650_11480009 | 3300025925 | Unclassified | 577 |
| 560 | Ga0207659_10073195 | 3300025926 | Bacteria | 2508 |
| 561 | Ga0207659_10299378 | 3300025926 | Bacteria | 1320 |
| 562 | Ga0207659_10402909 | 3300025926 | Bacteria | 1145 |
| 563 | Ga0207659_10422535 | 3300025926 | Bacteria | 1118 |
| 564 | Ga0207659_10456249 | 3300025926 | Unclassified | 1077 |
| 565 | Ga0207659_10806479 | 3300025926 | Bacteria | 806 |
| 566 | Ga0207659_11261926 | 3300025926 | Bacteria | 635 |
| 567 | Ga0207659_11275200 | 3300025926 | Unclassified | 631 |
| 568 | Ga0207659_11684242 | 3300025926 | Unclassified | 540 |
| 569 | Ga0207687_10010157 | 3300025927 | Bacteria | 6155 |
| 570 | Ga0207687_11440456 | 3300025927 | Unclassified | 592 |
| 571 | Ga0207700_10072976 | 3300025928 | Bacteria | 2648 |
| 572 | Ga0207700_10165913 | 3300025928 | Bacteria | 1838 |
| 573 | Ga0207700_11319219 | 3300025928 | Bacteria | 643 |
| 574 | Ga0207664_10372634 | 3300025929 | Bacteria | 1266 |
| 575 | Ga0207664_10721782 | 3300025929 | Bacteria | 896 |
| 576 | Ga0207644_10804587 | 3300025931 | Unclassified | 786 |
| 577 | Ga0207644_10881537 | 3300025931 | Unclassified | 750 |
| 578 | Ga0207644_10893216 | 3300025931 | Bacteria | 745 |
| 579 | Ga0207690_10007970 | 3300025932 | Bacteria | 6289 |
| 580 | Ga0207690_10228320 | 3300025932 | Bacteria | 1428 |
| 581 | Ga0207690_11057013 | 3300025932 | Unclassified | 676 |
| 582 | Ga0207706_10008609 | 3300025933 | Bacteria | 9402 |
| 583 | Ga0207706_11269644 | 3300025933 | Bacteria | 609 |
| 584 | Ga0207686_10027499 | 3300025934 | Bacteria | 3332 |
| 585 | Ga0207686_10253360 | 3300025934 | Bacteria | 1287 |
| 586 | Ga0207686_10358929 | 3300025934 | Bacteria | 1099 |
| 587 | Ga0207686_11132748 | 3300025934 | Bacteria | 639 |
| 588 | Ga0207709_10032296 | 3300025935 | Bacteria | 3064 |
| 589 | Ga0207709_10882383 | 3300025935 | Unclassified | 726 |
| 590 | Ga0207670_10135215 | 3300025936 | Bacteria | 1811 |
| 591 | Ga0207670_10662852 | 3300025936 | Unclassified | 861 |
| 592 | Ga0207669_10203266 | 3300025937 | Unclassified | 1440 |
| 593 | Ga0207669_10993997 | 3300025937 | Bacteria | 705 |
| 594 | Ga0207704_10113223 | 3300025938 | Bacteria | 1839 |
| 595 | Ga0207704_10838547 | 3300025938 | Unclassified | 770 |
| 596 | Ga0207704_11240827 | 3300025938 | Bacteria | 636 |
| 597 | Ga0207704_11785981 | 3300025938 | Bacteria | 529 |
| 598 | Ga0207691_10000993 | 3300025940 | Bacteria | 28178 |
| 599 | Ga0207691_10008846 | 3300025940 | Bacteria | 9662 |
| 600 | Ga0207691_10539917 | 3300025940 | Bacteria | 989 |
| 601 | Ga0207691_11026917 | 3300025940 | Bacteria | 687 |
| 602 | Ga0207711_10122262 | 3300025941 | Bacteria | 2325 |
| 603 | Ga0207711_10512652 | 3300025941 | Unclassified | 1118 |
| 604 | Ga0207711_10799058 | 3300025941 | Unclassified | 879 |
| 605 | Ga0207711_10961047 | 3300025941 | Bacteria | 793 |
| 606 | Ga0207711_11182149 | 3300025941 | Unclassified | 706 |
| 607 | Ga0207689_10007028 | 3300025942 | Bacteria | 9896 |
| 608 | Ga0207689_10105986 | 3300025942 | Bacteria | 2309 |
| 609 | Ga0207689_11559128 | 3300025942 | Bacteria | 550 |
| 610 | Ga0207661_10006057 | 3300025944 | Bacteria | 8543 |
| 611 | Ga0207661_10010031 | 3300025944 | Bacteria | 6806 |
| 612 | Ga0207661_10012407 | 3300025944 | Bacteria | 6191 |
| 613 | Ga0207661_10054270 | 3300025944 | Bacteria | 3210 |
| 614 | Ga0207661_10078495 | 3300025944 | Unclassified | 2718 |
| 615 | Ga0207661_10196826 | 3300025944 | Unclassified | 1770 |
| 616 | Ga0207661_10272664 | 3300025944 | Unclassified | 1510 |
| 617 | Ga0207661_10360497 | 3300025944 | Bacteria | 1313 |
| 618 | Ga0207661_10437903 | 3300025944 | Bacteria | 1189 |
| 619 | Ga0207661_11844013 | 3300025944 | Unclassified | 550 |
| 620 | Ga0207679_10025407 | 3300025945 | Bacteria | 4073 |
| 621 | Ga0207679_10120794 | 3300025945 | Bacteria | 2085 |
| 622 | Ga0207679_10135212 | 3300025945 | Bacteria | 1984 |
| 623 | Ga0207679_10195725 | 3300025945 | Bacteria | 1685 |
| 624 | Ga0207679_10255312 | 3300025945 | Bacteria | 1492 |
| 625 | Ga0207679_10365512 | 3300025945 | Bacteria | 1261 |
| 626 | Ga0207679_10463011 | 3300025945 | Bacteria | 1126 |
| 627 | Ga0207679_10475709 | 3300025945 | Bacteria | 1111 |
| 628 | Ga0207679_10587042 | 3300025945 | Bacteria | 1003 |
| 629 | Ga0207679_10651915 | 3300025945 | Unclassified | 952 |
| 630 | Ga0207679_11162024 | 3300025945 | Unclassified | 708 |
| 631 | Ga0207667_10052014 | 3300025949 | Bacteria | 4316 |
| 632 | Ga0207667_10390054 | 3300025949 | Bacteria | 1418 |
| 633 | Ga0207667_10835008 | 3300025949 | Bacteria | 916 |
| 634 | Ga0207667_11163151 | 3300025949 | Bacteria | 752 |
| 635 | Ga0207651_10112223 | 3300025960 | Bacteria | 2049 |
| 636 | Ga0207651_10334214 | 3300025960 | Unclassified | 1271 |
| 637 | Ga0207651_10395562 | 3300025960 | Bacteria | 1174 |
| 638 | Ga0207651_10461657 | 3300025960 | Bacteria | 1091 |
| 639 | Ga0207651_10858275 | 3300025960 | Unclassified | 807 |
| 640 | Ga0207651_10991138 | 3300025960 | Bacteria | 751 |
| 641 | Ga0207651_11008852 | 3300025960 | Bacteria | 744 |
| 642 | Ga0207712_10028452 | 3300025961 | Bacteria | 3739 |
| 643 | Ga0207712_11307658 | 3300025961 | Unclassified | 648 |
| 644 | Ga0207668_10028938 | 3300025972 | Bacteria | 3627 |
| 645 | Ga0207668_10272698 | 3300025972 | Bacteria | 1384 |
| 646 | Ga0207668_11331823 | 3300025972 | Unclassified | 647 |
| 647 | Ga0207668_11889968 | 3300025972 | Bacteria | 538 |
| 648 | Ga0207640_10475260 | 3300025981 | Unclassified | 1035 |
| 649 | Ga0207640_10617047 | 3300025981 | Bacteria | 920 |
| 650 | Ga0207658_10181906 | 3300025986 | Bacteria | 1740 |
| 651 | Ga0207658_10361502 | 3300025986 | Bacteria | 1267 |
| 652 | Ga0207658_10436627 | 3300025986 | Unclassified | 1157 |
| 653 | Ga0207658_10558676 | 3300025986 | Bacteria | 1025 |
| 654 | Ga0207658_11007285 | 3300025986 | Unclassified | 760 |
| 655 | Ga0207677_10178216 | 3300026023 | Unclassified | 1669 |
| 656 | Ga0207677_10269601 | 3300026023 | Bacteria | 1392 |
| 657 | Ga0207677_10693450 | 3300026023 | Bacteria | 903 |
| 658 | Ga0207677_10895031 | 3300026023 | Bacteria | 800 |
| 659 | Ga0207677_11440882 | 3300026023 | Unclassified | 635 |
| 660 | Ga0207677_12078095 | 3300026023 | Unclassified | 528 |
| 661 | Ga0207703_10336769 | 3300026035 | Bacteria | 1385 |
| 662 | Ga0207703_10431989 | 3300026035 | Bacteria | 1227 |
| 663 | Ga0207703_12321950 | 3300026035 | Unclassified | 512 |
| 664 | Ga0207639_10007860 | 3300026041 | Bacteria | 7285 |
| 665 | Ga0207639_12071353 | 3300026041 | Bacteria | 530 |
| 666 | Ga0207678_10170140 | 3300026067 | Unclassified | 1860 |
| 667 | Ga0207678_10331225 | 3300026067 | Bacteria | 1311 |
| 668 | Ga0207678_10406910 | 3300026067 | Bacteria | 1179 |
| 669 | Ga0207678_10906983 | 3300026067 | Unclassified | 779 |
| 670 | Ga0207708_10024989 | 3300026075 | Bacteria | 4518 |
| 671 | Ga0207708_10829204 | 3300026075 | Unclassified | 797 |
| 672 | Ga0207702_10017046 | 3300026078 | Bacteria | 6009 |
| 673 | Ga0207702_10136380 | 3300026078 | Bacteria | 2215 |
| 674 | Ga0207702_10230289 | 3300026078 | Bacteria | 1731 |
| 675 | Ga0207702_10310465 | 3300026078 | Unclassified | 1499 |
| 676 | Ga0207641_10122111 | 3300026088 | Unclassified | 2326 |
| 677 | Ga0207641_10609981 | 3300026088 | Bacteria | 1069 |
| 678 | Ga0207641_10892904 | 3300026088 | Unclassified | 882 |
| 679 | Ga0207641_11061739 | 3300026088 | Bacteria | 808 |
| 680 | Ga0207641_12441521 | 3300026088 | Bacteria | 521 |
| 681 | Ga0207648_10045314 | 3300026089 | Bacteria | 3858 |
| 682 | Ga0207648_10053286 | 3300026089 | Bacteria | 3536 |
| 683 | Ga0207648_10090847 | 3300026089 | Bacteria | 2669 |
| 684 | Ga0207648_10131749 | 3300026089 | Bacteria | 2201 |
| 685 | Ga0207648_10511633 | 3300026089 | Bacteria | 1099 |
| 686 | Ga0207676_10058105 | 3300026095 | Unclassified | 3049 |
| 687 | Ga0207676_10261186 | 3300026095 | Bacteria | 1564 |
| 688 | Ga0207676_10321196 | 3300026095 | Bacteria | 1421 |
| 689 | Ga0207676_10787166 | 3300026095 | Bacteria | 927 |
| 690 | Ga0207676_10928973 | 3300026095 | Bacteria | 855 |
| 691 | Ga0207674_10000013 | 3300026116 | Bacteria | 187953 |
| 692 | Ga0207674_10001053 | 3300026116 | Bacteria | 35954 |
| 693 | Ga0207674_10028497 | 3300026116 | Bacteria | 5894 |
| 694 | Ga0207674_10320692 | 3300026116 | Bacteria | 1499 |
| 695 | Ga0207674_10333193 | 3300026116 | Unclassified | 1467 |
| 696 | Ga0207674_12189313 | 3300026116 | Bacteria | 516 |
| 697 | Ga0207675_100000916 | 3300026118 | Bacteria | 29421 |
| 698 | Ga0207683_10038750 | 3300026121 | Unclassified | 4156 |
| 699 | Ga0207683_10355646 | 3300026121 | Bacteria | 1345 |
| 700 | Ga0207683_10614886 | 3300026121 | Unclassified | 1006 |
| 701 | Ga0207698_10011010 | 3300026142 | Bacteria | 5847 |
| 702 | Ga0207698_10104131 | 3300026142 | Bacteria | 2360 |
| 703 | Ga0207698_10274236 | 3300026142 | Bacteria | 1556 |
| 704 | Ga0207698_10437101 | 3300026142 | Bacteria | 1260 |
| 705 | Ga0207698_11544183 | 3300026142 | Bacteria | 679 |
| 706 | Ga0207428_10930687 | 3300027907 | Archaea | 613 |
| 707 | Ga0268266_10071820 | 3300028379 | Bacteria | 3000 |
| 708 | Ga0268266_10172335 | 3300028379 | Bacteria | 1965 |
| 709 | Ga0268266_10714688 | 3300028379 | Unclassified | 966 |
| 710 | Ga0268266_11379010 | 3300028379 | Bacteria | 680 |
| 711 | Ga0268266_11752164 | 3300028379 | Bacteria | 596 |
| 712 | Ga0268265_10063309 | 3300028380 | Bacteria | 2845 |
| 713 | Ga0268265_10074959 | 3300028380 | Bacteria | 2649 |
| 714 | Ga0268265_10075700 | 3300028380 | Bacteria | 2638 |
| 715 | Ga0268265_10231102 | 3300028380 | Bacteria | 1625 |
| 716 | Ga0268265_11188453 | 3300028380 | Bacteria | 760 |
| 717 | Ga0268264_10030491 | 3300028381 | Bacteria | 4420 |
| 718 | Ga0268264_10069562 | 3300028381 | Bacteria | 2977 |
| 719 | Ga0268264_10977741 | 3300028381 | Unclassified | 852 |
| 720 | Ga0307517_10355728 | 3300028786 | Unclassified | 793 |
| 721 | Ga0265327_10000417 | 3300031251 | Bacteria | 77684 |
| 722 | Ga0307408_100023128 | 3300031548 | Bacteria | 4230 |
| 723 | Ga0307408_100168886 | 3300031548 | Bacteria | 1745 |
| 724 | Ga0307408_100184099 | 3300031548 | Bacteria | 1677 |
| 725 | Ga0307408_101107252 | 3300031548 | Bacteria | 735 |
| 726 | Ga0307408_101268689 | 3300031548 | Bacteria | 689 |
| 727 | Ga0307405_10017765 | 3300031731 | Bacteria | 3910 |
| 728 | Ga0307405_10026406 | 3300031731 | Bacteria | 3349 |
| 729 | Ga0307405_10188069 | 3300031731 | Bacteria | 1489 |
| 730 | Ga0307405_10282416 | 3300031731 | Bacteria | 1250 |
| 731 | Ga0307413_10002909 | 3300031824 | Bacteria | 7073 |
| 732 | Ga0307413_10044787 | 3300031824 | Bacteria | 2618 |
| 733 | Ga0307413_10112475 | 3300031824 | Bacteria | 1825 |
| 734 | Ga0307413_10245812 | 3300031824 | Bacteria | 1324 |
| 735 | Ga0307410_10012158 | 3300031852 | Bacteria | 4961 |
| 736 | Ga0307410_10058425 | 3300031852 | Bacteria | 2630 |
| 737 | Ga0307410_10081840 | 3300031852 | Bacteria | 2269 |
| 738 | Ga0307410_10556128 | 3300031852 | Bacteria | 951 |
| 739 | Ga0307406_10008103 | 3300031901 | Bacteria | 5854 |
| 740 | Ga0307406_10034757 | 3300031901 | Bacteria | 3094 |
| 741 | Ga0307406_10091966 | 3300031901 | Bacteria | 2044 |
| 742 | Ga0307406_10106793 | 3300031901 | Bacteria | 1918 |
| 743 | Ga0307406_10111813 | 3300031901 | Bacteria | 1882 |
| 744 | Ga0307406_10700911 | 3300031901 | Bacteria | 845 |
| 745 | Ga0307406_11681358 | 3300031901 | Bacteria | 562 |
| 746 | Ga0307406_11738179 | 3300031901 | Bacteria | 553 |
| 747 | Ga0307407_10001830 | 3300031903 | Bacteria | 7984 |
| 748 | Ga0307407_10005355 | 3300031903 | Bacteria | 5559 |
| 749 | Ga0307407_10262957 | 3300031903 | Bacteria | 1187 |
| 750 | Ga0307407_10333232 | 3300031903 | Bacteria | 1069 |
| 751 | Ga0307412_10029895 | 3300031911 | Bacteria | 3423 |
| 752 | Ga0307412_10091095 | 3300031911 | Bacteria | 2133 |
| 753 | Ga0307412_10145084 | 3300031911 | Bacteria | 1743 |
| 754 | Ga0307409_100006457 | 3300031995 | Bacteria | 6893 |
| 755 | Ga0307409_100027198 | 3300031995 | Bacteria | 4049 |
| 756 | Ga0307409_100148750 | 3300031995 | Bacteria | 2030 |
| 757 | Ga0307409_100389823 | 3300031995 | Bacteria | 1327 |
| 758 | Ga0307409_100641638 | 3300031995 | Bacteria | 1055 |
| 759 | Ga0307409_100645558 | 3300031995 | Bacteria | 1051 |
| 760 | Ga0307409_100790838 | 3300031995 | Bacteria | 955 |
| 761 | Ga0307409_101315580 | 3300031995 | Bacteria | 748 |
| 762 | Ga0307416_100010847 | 3300032002 | Bacteria | 6042 |
| 763 | Ga0307416_100042663 | 3300032002 | Bacteria | 3543 |
| 764 | Ga0307416_100129701 | 3300032002 | Bacteria | 2267 |
| 765 | Ga0307416_100193234 | 3300032002 | Bacteria | 1922 |
| 766 | Ga0307416_100332267 | 3300032002 | Bacteria | 1528 |
| 767 | Ga0307416_100600339 | 3300032002 | Bacteria | 1180 |
| 768 | Ga0307416_100737464 | 3300032002 | Bacteria | 1077 |
| 769 | Ga0307416_101534195 | 3300032002 | Bacteria | 772 |
| 770 | Ga0307416_101757855 | 3300032002 | Bacteria | 724 |
| 771 | Ga0307416_103251021 | 3300032002 | Bacteria | 544 |
| 772 | Ga0307414_10005676 | 3300032004 | Bacteria | 6887 |
| 773 | Ga0307414_10064436 | 3300032004 | Bacteria | 2609 |
| 774 | Ga0307414_10194962 | 3300032004 | Bacteria | 1642 |
| 775 | Ga0307414_10459080 | 3300032004 | Bacteria | 1119 |
| 776 | Ga0307414_11308814 | 3300032004 | Bacteria | 672 |
| 777 | Ga0307411_10011782 | 3300032005 | Bacteria | 4737 |
| 778 | Ga0307411_10112641 | 3300032005 | Bacteria | 1950 |
| 779 | Ga0307411_10225621 | 3300032005 | Bacteria | 1456 |
| 780 | Ga0307411_10533789 | 3300032005 | Bacteria | 998 |
| 781 | Ga0307415_100006699 | 3300032126 | Bacteria | 6238 |
| 782 | Ga0307415_100126416 | 3300032126 | Bacteria | 1927 |
| 783 | Ga0307415_100186830 | 3300032126 | Bacteria | 1631 |
| 784 | Ga0307415_100237829 | 3300032126 | Bacteria | 1471 |
| 785 | Ga0307415_100736785 | 3300032126 | Bacteria | 893 |
| 786 | Ga0373958_0120301 | 3300034819 | Bacteria | 634 |
| 787 | Ga0373959_0091092 | 3300034820 | Unclassified | 715 |
| 788 | Ga0373926_0085051 | 3300035083 | Bacteria | 1173 |
| 789 | Ga0373934_0000693 | 3300035086 | Bacteria | 11997 |
| 790 | Ga0373934_0014355 | 3300035086 | Bacteria | 3001 |
| 791 | Ga0373934_0074031 | 3300035086 | Bacteria | 1364 |
| 792 | Ga0373949_0227228 | 3300035090 | Bacteria | 569 |
| 793 | Ga0373945_0120387 | 3300035116 | Bacteria | 1043 |
| 794 | Ga0373956_0023066 | 3300035119 | Bacteria | 2668 |
| 795 | Ga0373956_0353497 | 3300035119 | Bacteria | 700 |
| 796 | Ga0373957_0036561 | 3300035120 | Unclassified | 1830 |
| 797 | Ga0373957_0071737 | 3300035120 | Unclassified | 1356 |
| 798 | Ga0373957_0148206 | 3300035120 | Bacteria | 962 |
| 799 | Ga0373943_0101115 | 3300035170 | Bacteria | 1508 |
| 800 | Ga0373943_0395781 | 3300035170 | Bacteria | 797 |
| 801 | Ga0373946_0245446 | 3300035171 | Bacteria | 872 |
| 802 | Ga0373955_0020564 | 3300035172 | Bacteria | 3320 |
| 803 | Ga0373955_0071215 | 3300035172 | Bacteria | 1944 |
| 804 | Ga0373955_0124229 | 3300035172 | Bacteria | 1502 |
| 805 | Ga0373955_0154570 | 3300035172 | Unclassified | 1351 |
| 806 | Ga0373961_0372133 | 3300035241 | Unclassified | 543 |
| 807 | Ga0373924_0374079 | 3300035410 | Unclassified | 636 |
| 808 | Ga0373924_0419291 | 3300035410 | Unclassified | 599 |
| 809 | Ga0373935_0788704 | 3300035692 | Bacteria | 701 |
| 810 | Ga0373935_1133566 | 3300035692 | Unclassified | 582 |
| 811 | Ga0373927_0002136 | 3300035695 | Bacteria | 14539 |
| 812 | Ga0373927_0002804 | 3300035695 | Bacteria | 12725 |
| 813 | Ga0373927_0009049 | 3300035695 | Bacteria | 6685 |
| 814 | Ga0373927_0260678 | 3300035695 | Bacteria | 1140 |
| 815 | Ga0373927_0874754 | 3300035695 | Unclassified | 593 |
| 816 | Ga0373933_0004678 | 3300035724 | Bacteria | 7496 |
| 817 | Ga0373933_0027897 | 3300035724 | Unclassified | 3255 |
| 818 | Ga0373933_0274267 | 3300035724 | Bacteria | 1089 |
| 819 | Ga0373933_0310752 | 3300035724 | Bacteria | 1021 |
| 820 | Ga0373933_0900352 | 3300035724 | Bacteria | 582 |
| 821 | Ga0373947_0086982 | 3300035725 | Bacteria | 1943 |
| 822 | Ga0373947_0153410 | 3300035725 | Bacteria | 1485 |
| 823 | Ga0373947_0438522 | 3300035725 | Bacteria | 884 |
| 824 | Ga0373937_0019193 | 3300036401 | Bacteria | 6121 |
| 825 | Ga0373937_0031746 | 3300036401 | Bacteria | 4787 |
| 826 | Ga0373937_0109180 | 3300036401 | Bacteria | 2572 |
| 827 | Ga0373937_0204639 | 3300036401 | Bacteria | 1856 |
| 828 | Ga0373937_0939526 | 3300036401 | Unclassified | 813 |
| 829 | Ga0373937_1894339 | 3300036401 | Unclassified | 542 |
| 830 | Ga0373925_0022816 | 3300037068 | Unclassified | 4567 |
| 831 | Ga0373925_0379767 | 3300037068 | Bacteria | 1150 |
| 832 | Ga0373925_1605596 | 3300037068 | Unclassified | 531 |
| 833 | Ga0395900_1282445 | 3300037418 | Unclassified | 647 |
| 834 | Ga0395905_0284097 | 3300037471 | Bacteria | 1541 |
| 835 | Ga0395905_1089935 | 3300037471 | Bacteria | 702 |
| 836 | Ga0395901_1840426 | 3300038443 | Unclassified | 554 |
| 837 | Ga0436365_0391692 | 3300039437 | Bacteria | 35650 |
| 838 | Ga0436365_0740200 | 3300039437 | Bacteria | 2892 |
| 839 | Ga0439453_0142002 | 3300041408 | Bacteria | 565 |
| 840 | Ga0439462_0177247 | 3300042015 | Bacteria | 604 |
| 841 | Ga0450923_033705 | 3300042125 | Bacteria | 1054 |
| 842 | Ga0439464_0104162 | 3300042439 | Bacteria | 864 |
| 843 | Ga0466964_0091616 | 3300044706 | Unclassified | 1324 |
| 844 | Ga0451576_0296476 | 3300045051 | Bacteria | 1691 |
| 845 | Ga0451576_0794957 | 3300045051 | Bacteria | 993 |
| 846 | Ga0466958_0053764 | 3300045836 | Unclassified | 2442 |
| 847 | Ga0466958_0086719 | 3300045836 | Bacteria | 1932 |
| 848 | Ga0466967_0015550 | 3300045976 | Bacteria | 5968 |
| 849 | Ga0466967_0015954 | 3300045976 | Bacteria | 5907 |
| 850 | Ga0466967_0306125 | 3300045976 | Bacteria | 1530 |
| 851 | Ga0495592_0101740 | 3300046454 | Bacteria | 2047 |
| 852 | Ga0495592_0142433 | 3300046454 | Unclassified | 1666 |
| 853 | Ga0495592_0484116 | 3300046454 | Bacteria | 770 |
| 854 | Ga0495603_0841087 | 3300046455 | Bacteria | 523 |
| 855 | Ga0495629_0137216 | 3300046459 | Bacteria | 1703 |
| 856 | Ga0495651_0032941 | 3300046462 | Unclassified | 4041 |
| 857 | Ga0495651_0050540 | 3300046462 | Unclassified | 3207 |
| 858 | Ga0495651_0092926 | 3300046462 | Bacteria | 2259 |
| 859 | Ga0495651_0105009 | 3300046462 | Bacteria | 2096 |
| 860 | Ga0495653_0008699 | 3300046463 | Bacteria | 8316 |
| 861 | Ga0495580_0049945 | 3300046472 | Bacteria | 2958 |
| 862 | Ga0495580_0065713 | 3300046472 | Bacteria | 2540 |
| 863 | Ga0495580_0097349 | 3300046472 | Bacteria | 2046 |
| 864 | Ga0495580_0499133 | 3300046472 | Unclassified | 812 |
| 865 | Ga0495582_0055303 | 3300046473 | Unclassified | 2188 |
| 866 | Ga0495582_0367745 | 3300046473 | Bacteria | 828 |
| 867 | Ga0495582_0620880 | 3300046473 | Unclassified | 625 |
| 868 | Ga0495639_0042348 | 3300046475 | Unclassified | 2053 |
| 869 | Ga0495639_0493225 | 3300046475 | Bacteria | 625 |
| 870 | Ga0495639_0602578 | 3300046475 | Unclassified | 565 |
| 871 | Ga0495662_0103835 | 3300046476 | Bacteria | 1391 |
| 872 | Ga0495662_0540021 | 3300046476 | Bacteria | 571 |
| 873 | Ga0495664_0018786 | 3300046477 | Unclassified | 3966 |
| 874 | Ga0495664_0057551 | 3300046477 | Bacteria | 2313 |
| 875 | Ga0495594_0002111 | 3300046499 | Bacteria | 10351 |
| 876 | Ga0495594_0003138 | 3300046499 | Bacteria | 8546 |
| 877 | Ga0495594_0007113 | 3300046499 | Bacteria | 5756 |
| 878 | Ga0495594_0021108 | 3300046499 | Unclassified | 3475 |
| 879 | Ga0495594_0030492 | 3300046499 | Bacteria | 2919 |
| 880 | Ga0495594_0040576 | 3300046499 | Bacteria | 2547 |
| 881 | Ga0495594_0322006 | 3300046499 | Unclassified | 881 |
| 882 | Ga0495594_0400132 | 3300046499 | Unclassified | 781 |
| 883 | Ga0495608_0016154 | 3300046511 | Bacteria | 5163 |
| 884 | Ga0495608_0051283 | 3300046511 | Bacteria | 2734 |
| 885 | Ga0495608_0071918 | 3300046511 | Unclassified | 2256 |
| 886 | Ga0495618_0022896 | 3300046514 | Bacteria | 3860 |
| 887 | Ga0495618_0164369 | 3300046514 | Bacteria | 1414 |
| 888 | Ga0495628_0012776 | 3300046516 | Bacteria | 7069 |
| 889 | Ga0495628_0095796 | 3300046516 | Bacteria | 2293 |
| 890 | Ga0495628_0099739 | 3300046516 | Bacteria | 2242 |
| 891 | Ga0495628_0202919 | 3300046516 | Unclassified | 1493 |
| 892 | Ga0495628_0288861 | 3300046516 | Unclassified | 1216 |
| 893 | Ga0495628_0467717 | 3300046516 | Unclassified | 914 |
| 894 | Ga0495630_0120856 | 3300046517 | Bacteria | 1987 |
| 895 | Ga0495630_0185393 | 3300046517 | Bacteria | 1587 |
| 896 | Ga0495630_0243951 | 3300046517 | Bacteria | 1372 |
| 897 | Ga0495652_0017461 | 3300046529 | Bacteria | 6401 |
| 898 | Ga0495652_0045302 | 3300046529 | Bacteria | 3783 |
| 899 | Ga0495652_0059988 | 3300046529 | Unclassified | 3217 |
| 900 | Ga0495652_0155228 | 3300046529 | Bacteria | 1783 |
| 901 | Ga0495665_0082335 | 3300046531 | Bacteria | 1692 |
| 902 | Ga0495665_0218399 | 3300046531 | Archaea | 986 |
| 903 | Ga0495665_0301535 | 3300046531 | Unclassified | 820 |
| 904 | Ga0495640_0034623 | 3300046533 | Bacteria | 3578 |
| 905 | Ga0495640_0111570 | 3300046533 | Bacteria | 1787 |
| 906 | Ga0495640_0311189 | 3300046533 | Bacteria | 977 |
| 907 | Ga0495640_0718498 | 3300046533 | Unclassified | 599 |
| 908 | Ga0495586_0002607 | 3300046535 | Bacteria | 9752 |
| 909 | Ga0495586_0003673 | 3300046535 | Bacteria | 8233 |
| 910 | Ga0495586_0026076 | 3300046535 | Bacteria | 3127 |
| 911 | Ga0495586_0069985 | 3300046535 | Bacteria | 1916 |
| 912 | Ga0495586_0110555 | 3300046535 | Bacteria | 1529 |
| 913 | Ga0495587_0007008 | 3300046536 | Bacteria | 7319 |
| 914 | Ga0495587_0014065 | 3300046536 | Bacteria | 5025 |
| 915 | Ga0495587_0135076 | 3300046536 | Unclassified | 1409 |
| 916 | Ga0495645_0017377 | 3300046543 | Bacteria | 5152 |
| 917 | Ga0495645_0019056 | 3300046543 | Bacteria | 4939 |
| 918 | Ga0495645_0110736 | 3300046543 | Unclassified | 1943 |
| 919 | Ga0495645_0128299 | 3300046543 | Bacteria | 1780 |
| 920 | Ga0495645_0350342 | 3300046543 | Bacteria | 951 |
| 921 | Ga0495645_0653435 | 3300046543 | Bacteria | 642 |
| 922 | Ga0495645_0673844 | 3300046543 | Bacteria | 630 |
| 923 | Ga0495667_0010503 | 3300046559 | Bacteria | 6266 |
| 924 | Ga0495667_0011332 | 3300046559 | Bacteria | 6036 |
| 925 | Ga0495667_0011632 | 3300046559 | Bacteria | 5958 |
| 926 | Ga0495667_0016270 | 3300046559 | Bacteria | 5024 |
| 927 | Ga0495667_0046770 | 3300046559 | Unclassified | 2860 |
| 928 | Ga0495667_0070938 | 3300046559 | Bacteria | 2273 |
| 929 | Ga0495634_0066592 | 3300046642 | Bacteria | 2384 |
| 930 | Ga0495634_0271359 | 3300046642 | Bacteria | 1032 |
| 931 | Ga0495635_0082292 | 3300046663 | Bacteria | 2203 |
| 932 | Ga0495635_0193480 | 3300046663 | Bacteria | 1380 |
| 933 | Ga0495635_0326867 | 3300046663 | Unclassified | 1026 |
| 934 | Ga0495588_0013485 | 3300046674 | Bacteria | 3896 |
| 935 | Ga0495588_0245743 | 3300046674 | Unclassified | 944 |
| 936 | Ga0495588_0322660 | 3300046674 | Bacteria | 812 |
| 937 | Ga0495657_0140617 | 3300046675 | Bacteria | 1505 |
| 938 | Ga0495657_0151321 | 3300046675 | Bacteria | 1441 |
| 939 | Ga0495657_0195518 | 3300046675 | Bacteria | 1234 |
| 940 | Ga0495599_0022026 | 3300046678 | Bacteria | 3977 |
| 941 | Ga0495599_0022949 | 3300046678 | Bacteria | 3897 |
| 942 | Ga0495599_0094589 | 3300046678 | Unclassified | 1864 |
| 943 | Ga0495599_0114445 | 3300046678 | Bacteria | 1678 |
| 944 | Ga0495599_0248930 | 3300046678 | Bacteria | 1082 |
| 945 | Ga0495623_0001340 | 3300046679 | Bacteria | 16707 |
| 946 | Ga0495623_0016577 | 3300046679 | Unclassified | 4759 |
| 947 | Ga0495623_0032108 | 3300046679 | Unclassified | 3375 |
| 948 | Ga0495623_0067078 | 3300046679 | Bacteria | 2240 |
| 949 | Ga0495623_0107879 | 3300046679 | Bacteria | 1690 |
| 950 | Ga0495646_0016575 | 3300046680 | Bacteria | 4678 |
| 951 | Ga0495646_0232195 | 3300046680 | Bacteria | 994 |
| 952 | Ga0495646_0353858 | 3300046680 | Bacteria | 769 |
| 953 | Ga0495646_0365894 | 3300046680 | Unclassified | 753 |
| 954 | Ga0495658_0155846 | 3300046683 | Bacteria | 1406 |
| 955 | Ga0495658_0354087 | 3300046683 | Unclassified | 933 |
| 956 | Ga0495613_0169348 | 3300046689 | Bacteria | 1551 |
| 957 | Ga0495613_0311500 | 3300046689 | Bacteria | 1088 |
| 958 | Ga0495613_0443269 | 3300046689 | Bacteria | 880 |
| 959 | Ga0495613_1067774 | 3300046689 | Bacteria | 516 |
| 960 | Ga0495624_0077647 | 3300046690 | Bacteria | 2060 |
| 961 | Ga0495624_0857423 | 3300046690 | Bacteria | 536 |
| 962 | Ga0495600_0045967 | 3300046809 | Unclassified | 2849 |
| 963 | Ga0495600_0066206 | 3300046809 | Bacteria | 2362 |
| 964 | Ga0495600_0121104 | 3300046809 | Bacteria | 1702 |
| 965 | Ga0495600_0264602 | 3300046809 | Bacteria | 1092 |
| 966 | Ga0495600_0685060 | 3300046809 | Bacteria | 617 |
| 967 | Ga0495581_0034852 | 3300047315 | Bacteria | 2912 |
| 968 | Ga0495604_0019224 | 3300047317 | Bacteria | 5470 |
| 969 | Ga0495604_0090315 | 3300047317 | Bacteria | 2275 |
| 970 | Ga0495604_0310235 | 3300047317 | Bacteria | 1057 |
| 971 | Ga0495636_0251815 | 3300047318 | Bacteria | 817 |
| 972 | Ga0495636_0335513 | 3300047318 | Bacteria | 712 |
| 973 | Ga0495636_0496547 | 3300047318 | Unclassified | 590 |
| 974 | Ga0495674_0048461 | 3300047319 | Bacteria | 3760 |
| 975 | Ga0495674_0060307 | 3300047319 | Unclassified | 3311 |
| 976 | Ga0495674_1045626 | 3300047319 | Bacteria | 624 |
| 977 | Ga0495680_0011219 | 3300047322 | Bacteria | 7957 |
| 978 | Ga0495680_0734280 | 3300047322 | Bacteria | 649 |
| 979 | Ga0495675_0014738 | 3300047444 | Bacteria | 4941 |
| 980 | Ga0495675_0027932 | 3300047444 | Bacteria | 3596 |
| 981 | Ga0495675_0028626 | 3300047444 | Unclassified | 3552 |
| 982 | Ga0495675_0509801 | 3300047444 | Bacteria | 690 |
| 983 | Ga0495684_0004115 | 3300047471 | Bacteria | 11360 |
| 984 | Ga0495684_0004429 | 3300047471 | Bacteria | 10979 |
| 985 | Ga0495684_0012968 | 3300047471 | Bacteria | 6434 |
| 986 | Ga0495684_0046837 | 3300047471 | Bacteria | 3308 |
| 987 | Ga0495684_0047964 | 3300047471 | Unclassified | 3266 |
| 988 | Ga0495684_0197889 | 3300047471 | Bacteria | 1482 |
| 989 | Ga0495684_0272059 | 3300047471 | Bacteria | 1225 |
| 990 | Ga0495593_0126688 | 3300047673 | Bacteria | 1298 |
| 991 | Ga0495593_0261273 | 3300047673 | Unclassified | 867 |
| 992 | Ga0495593_0275296 | 3300047673 | Bacteria | 842 |
| 993 | Ga0495602_0046845 | 3300048088 | Bacteria | 3901 |
| 994 | Ga0495602_0108628 | 3300048088 | Bacteria | 2258 |
| 995 | Ga0495602_0369474 | 3300048088 | Bacteria | 1030 |
| 996 | Ga0495602_1169124 | 3300048088 | Bacteria | 502 |
| 997 | Ga0495615_0097342 | 3300048090 | Unclassified | 827 |
| 998 | Ga0496102_0712941 | 3300048905 | Bacteria | 926 |
| 999 | Ga0496104_0241732 | 3300048907 | Bacteria | 1718 |
| 1000 | Ga0496105_0104183 | 3300048908 | Bacteria | 2343 |
| 1001 | Ga0496106_0381126 | 3300048909 | Bacteria | 1133 |
| 1002 | Ga0496109_1277460 | 3300048912 | Bacteria | 670 |
| 1003 | Ga0496109_1766021 | 3300048912 | Bacteria | 552 |
| 1004 | Ga0496115_0957051 | 3300048918 | Unclassified | 657 |
| 1005 | Ga0501034_0266506 | 3300049571 | Bacteria | 1655 |
| 1006 | Ga0501037_0400299 | 3300049573 | Bacteria | 942 |
| 1007 | Ga0501038_0235621 | 3300049574 | Unclassified | 1455 |
| 1008 | Ga0501067_0383276 | 3300049583 | Unclassified | 784 |
| 1009 | Ga0501073_0141971 | 3300049589 | Bacteria | 1664 |
| 1010 | Ga0501235_100968 | 3300049669 | Bacteria | 705 |
| 1011 | Ga0501235_221544 | 3300049669 | Bacteria | 519 |
| 1012 | Ga0501239_080069 | 3300049672 | Bacteria | 522 |
| 1013 | Ga0501250_057742 | 3300049680 | Bacteria | 612 |
| 1014 | Ga0501260_010059 | 3300049689 | Bacteria | 946 |
| 1015 | Ga0501260_036440 | 3300049689 | Unclassified | 584 |
| 1016 | Ga0501221_232328 | 3300049704 | Bacteria | 524 |
| 1017 | Ga0501245_145725 | 3300049708 | Bacteria | 519 |
| 1018 | Ga0501268_018978 | 3300049765 | Bacteria | 1161 |
| 1019 | Ga0501268_061754 | 3300049765 | Bacteria | 744 |
| 1020 | Ga0501272_051019 | 3300049769 | Bacteria | 574 |
| 1021 | Ga0501035_0290799 | 3300049822 | Bacteria | 1379 |
| 1022 | Ga0501044_0304459 | 3300049823 | Bacteria | 1522 |
| 1023 | Ga0501204_084766 | 3300049850 | Bacteria | 544 |
| 1024 | nmdc:mga05p37_278768_c1 | 3300050507 | Bacteria | 1994 |
| 1025 | nmdc:mga05p37_58074_c1 | 3300050507 | Unclassified | 4765 |
| 1026 | nmdc:mga05p37_63592_c1 | 3300050507 | Bacteria | 4541 |
| 1027 | nmdc:mga05p37_849005_c1 | 3300050507 | Bacteria | 992 |
| 1028 | nmdc:mga09592_11306_c1 | 3300050508 | Bacteria | 7261 |
| 1029 | nmdc:mga09592_61292_c1 | 3300050508 | Bacteria | 3182 |
| 1030 | nmdc:mga0qj67_111215_c1 | 3300050509 | Bacteria | 2212 |
| 1031 | nmdc:mga0qj67_20802_c1 | 3300050509 | Bacteria | 5025 |
| 1032 | nmdc:mga0qj67_319746_c1 | 3300050509 | Bacteria | 1256 |
| 1033 | nmdc:mga0qj67_578242_c1 | 3300050509 | Bacteria | 900 |
| 1034 | nmdc:mga0qj67_78655_c1 | 3300050509 | Bacteria | 2640 |
| 1035 | nmdc:mga06r32_1423218_c1 | 3300050510 | Unclassified | 635 |
| 1036 | nmdc:mga06r32_172320_c1 | 3300050510 | Bacteria | 2148 |
| 1037 | nmdc:mga06r32_1911043_c1 | 3300050510 | Bacteria | 528 |
| 1038 | nmdc:mga06r32_503198_c1 | 3300050510 | Bacteria | 1188 |
| 1039 | nmdc:mga06r32_789967_c1 | 3300050510 | Bacteria | 910 |
| 1040 | nmdc:mga06r32_873600_c1 | 3300050510 | Unclassified | 857 |
| 1041 | nmdc:mga08y16_1514781_c1 | 3300050511 | Archaea | 631 |
| 1042 | nmdc:mga08y16_1925415_c1 | 3300050511 | Bacteria | 542 |
| 1043 | nmdc:mga08y16_277190_c1 | 3300050511 | Bacteria | 1730 |
| 1044 | nmdc:mga08y16_341183_c1 | 3300050511 | Unclassified | 1540 |
| 1045 | nmdc:mga08y16_502688_c1 | 3300050511 | Unclassified | 1231 |
| 1046 | nmdc:mga0n895_308922_c1 | 3300050512 | Bacteria | 1603 |
| 1047 | nmdc:mga0n895_657487_c1 | 3300050512 | Bacteria | 1046 |
| 1048 | nmdc:mga0n895_673_c1 | 3300050512 | Bacteria | 23978 |
| 1049 | nmdc:mga0n895_890078_c1 | 3300050512 | Unclassified | 876 |
| 1050 | nmdc:mga0n895_994680_c1 | 3300050512 | Unclassified | 820 |
| 1051 | nmdc:mga0rr50_552261_c1 | 3300050513 | Bacteria | 981 |
| 1052 | nmdc:mga08x19_25845_c1 | 3300050514 | Bacteria | 3661 |
| 1053 | nmdc:mga0a205_27340_c1 | 3300050515 | Bacteria | 5448 |
| 1054 | nmdc:mga0a205_76155_c1 | 3300050515 | Unclassified | 3242 |
| 1055 | nmdc:mga0a205_828197_c1 | 3300050515 | Unclassified | 773 |
| 1056 | Ga0495601_0071527 | 3300053077 | Unclassified | 2215 |
| 1057 | Ga0495601_0503700 | 3300053077 | Bacteria | 781 |
| 1058 | Ga0495601_0515543 | 3300053077 | Bacteria | 771 |
| 1059 | Ga0495612_0143373 | 3300053078 | Bacteria | 1037 |
| 1060 | Ga0495595_0050155 | 3300053084 | Unclassified | 1932 |
| 1061 | Ga0495619_0072498 | 3300053085 | Unclassified | 2307 |
| 1062 | Ga0495619_0510853 | 3300053085 | Bacteria | 826 |
| 1063 | Ga0495619_1053432 | 3300053085 | Bacteria | 542 |
| 1064 | Ga0590071_033301 | 3300059421 | Unclassified | 1231 |
| 1065 | Ga0590075_027330 | 3300059424 | Unclassified | 1439 |
| 1066 | Ga0590077_058019 | 3300059426 | Unclassified | 875 |
| 1067 | Ga0105240_10041235 | |||
| 1068 | JGI24750J21931_1087383 | |||
| 1069 | JGI25406J46586_10028329 | |||
| 1070 | Ga0065712_10361323 | |||
| 1071 | Ga0065715_10136937 | |||
| 1072 | Ga0065707_10018243 | |||
| 1073 | Ga0065707_10412262 | |||
| 1074 | Ga0070658_10119638 | |||
| 1075 | Ga0070658_10794887 | |||
| 1076 | Ga0070676_10091341 | |||
| 1077 | Ga0070676_10162634 | |||
| 1078 | Ga0070676_10395633 | |||
| 1079 | Ga0070676_10402075 | |||
| 1080 | Ga0070676_10874771 | |||
| 1081 | Ga0070683_100133012 | |||
| 1082 | Ga0070683_100288308 | |||
| 1083 | Ga0070683_100311815 | |||
| 1084 | Ga0070683_100420309 | |||
| 1085 | Ga0070683_100442523 | |||
| 1086 | Ga0070683_100530045 | |||
| 1087 | Ga0070683_100643021 | |||
| 1088 | Ga0070683_100751286 | |||
| 1089 | Ga0070683_101709683 | |||
| 1090 | Ga0070690_100013382 | |||
| 1091 | Ga0070690_100086975 | |||
| 1092 | Ga0070690_100313332 | |||
| 1093 | Ga0070670_100000904 | |||
| 1094 | Ga0070670_100033628 | |||
| 1095 | Ga0070670_100719117 | |||
| 1096 | Ga0070670_101307990 | |||
| 1097 | Ga0070677_10111652 | |||
| 1098 | Ga0070677_10316509 | |||
| 1099 | Ga0070677_10561652 | |||
| 1100 | Ga0070677_10613889 | |||
| 1101 | Ga0070677_10904215 | |||
| 1102 | Ga0068869_100087372 | |||
| 1103 | Ga0068869_100126608 | |||
| 1104 | Ga0068869_100763969 | |||
| 1105 | Ga0068869_101931419 | |||
| 1106 | Ga0070666_10139238 | |||
| 1107 | Ga0070666_10181892 | |||
| 1108 | Ga0070666_10325538 | |||
| 1109 | Ga0070666_10368512 | |||
| 1110 | Ga0070680_100039609 | |||
| 1111 | Ga0070680_100060834 | |||
| 1112 | Ga0070680_100990621 | |||
| 1113 | Ga0070682_100021644 | |||
| 1114 | Ga0068868_100125071 | |||
| 1115 | Ga0068868_100180363 | |||
| 1116 | Ga0068868_100211794 | |||
| 1117 | Ga0068868_100314694 | |||
| 1118 | Ga0068868_100497714 | |||
| 1119 | Ga0068868_100898620 | |||
| 1120 | Ga0070660_100222707 | |||
| 1121 | Ga0070660_100384453 | |||
| 1122 | Ga0070660_100628258 | |||
| 1123 | Ga0070689_100031910 | |||
| 1124 | Ga0070689_100042977 | |||
| 1125 | Ga0070689_100045520 | |||
| 1126 | Ga0070689_100963988 | |||
| 1127 | Ga0070691_10045887 | |||
| 1128 | Ga0070691_10547305 | |||
| 1129 | Ga0070687_100016310 | |||
| 1130 | Ga0070687_100044352 | |||
| 1131 | Ga0070687_100164469 | |||
| 1132 | Ga0070687_100794241 | |||
| 1133 | Ga0070661_100007805 | |||
| 1134 | Ga0070661_100042506 | |||
| 1135 | Ga0070661_100228822 | |||
| 1136 | Ga0070661_100271959 | |||
| 1137 | Ga0070661_100679920 | |||
| 1138 | Ga0070661_100991182 | |||
| 1139 | Ga0070661_101190432 | |||
| 1140 | Ga0070661_101639791 | |||
| 1141 | Ga0070692_10732475 | |||
| 1142 | Ga0070668_100047236 | |||
| 1143 | Ga0070668_100052685 | |||
| 1144 | Ga0070668_100888955 | |||
| 1145 | Ga0070668_101958800 | |||
| 1146 | Ga0070669_100423683 | |||
| 1147 | Ga0070669_100500613 | |||
| 1148 | Ga0070669_100675041 | |||
| 1149 | Ga0070675_100053005 | |||
| 1150 | Ga0070675_100156430 | |||
| 1151 | Ga0070675_100182582 | |||
| 1152 | Ga0070675_100211350 | |||
| 1153 | Ga0070675_100231192 | |||
| 1154 | Ga0070675_100364585 | |||
| 1155 | Ga0070675_100691565 | |||
| 1156 | Ga0070675_100706882 | |||
| 1157 | Ga0070675_100799960 | |||
| 1158 | Ga0070675_101280675 | |||
| 1159 | Ga0070675_102185044 | |||
| 1160 | Ga0070671_100210096 | |||
| 1161 | Ga0070671_100430753 | |||
| 1162 | Ga0070671_100534020 | |||
| 1163 | Ga0070671_101072630 | |||
| 1164 | Ga0070674_100967953 | |||
| 1165 | Ga0070674_101483806 | |||
| 1166 | Ga0070674_101640313 | |||
| 1167 | Ga0070673_100024240 | |||
| 1168 | Ga0070673_100071192 | |||
| 1169 | Ga0070673_100099714 | |||
| 1170 | Ga0070673_100295104 | |||
| 1171 | Ga0070673_100384080 | |||
| 1172 | Ga0070673_102153318 | |||
| 1173 | Ga0070688_100010552 | |||
| 1174 | Ga0070688_100075181 | |||
| 1175 | Ga0070688_100186644 | |||
| 1176 | Ga0070688_100937831 | |||
| 1177 | Ga0070659_100019223 | |||
| 1178 | Ga0070659_100026628 | |||
| 1179 | Ga0070659_100284441 | |||
| 1180 | Ga0070667_100011181 | |||
| 1181 | Ga0070667_100013813 | |||
| 1182 | Ga0070667_100041948 | |||
| 1183 | Ga0070667_100171648 | |||
| 1184 | Ga0070667_100501825 | |||
| 1185 | Ga0070667_101224458 | |||
| 1186 | Ga0070714_100013853 | |||
| 1187 | Ga0070713_100011136 | |||
| 1188 | Ga0070713_100028372 | |||
| 1189 | Ga0070713_100101564 | |||
| 1190 | Ga0070701_10016785 | |||
| 1191 | Ga0070711_100032327 | |||
| 1192 | Ga0070711_100033209 | |||
| 1193 | Ga0070711_100817982 | |||
| 1194 | Ga0070711_100850546 | |||
| 1195 | Ga0070711_101108908 | |||
| 1196 | Ga0070705_100027468 | |||
| 1197 | Ga0070705_100143614 | |||
| 1198 | Ga0070705_100499514 | |||
| 1199 | Ga0070705_101347664 | |||
| 1200 | Ga0070700_100220696 | |||
| 1201 | Ga0070700_100751143 | |||
| 1202 | Ga0070700_101106530 | |||
| 1203 | Ga0070694_100024296 | |||
| 1204 | Ga0070694_100093006 | |||
| 1205 | Ga0070708_102042697 | |||
| 1206 | Ga0070663_100057117 | |||
| 1207 | Ga0070663_100988795 | |||
| 1208 | Ga0070663_101290171 | |||
| 1209 | Ga0070678_101231644 | |||
| 1210 | Ga0070678_101249168 | |||
| 1211 | Ga0070662_100017082 | |||
| 1212 | Ga0070662_100019646 | |||
| 1213 | Ga0070681_10001603 | |||
| 1214 | Ga0070681_10002295 | |||
| 1215 | Ga0070681_10008854 | |||
| 1216 | Ga0070681_10026191 | |||
| 1217 | Ga0070681_10097887 | |||
| 1218 | Ga0070681_10158889 | |||
| 1219 | Ga0070681_10172772 | |||
| 1220 | Ga0070681_10389505 | |||
| 1221 | Ga0070681_10428619 | |||
| 1222 | Ga0070681_10860457 | |||
| 1223 | Ga0070681_11261192 | |||
| 1224 | Ga0070681_11453147 | |||
| 1225 | Ga0068867_100012151 | |||
| 1226 | Ga0068867_100065455 | |||
| 1227 | Ga0068867_100206350 | |||
| 1228 | Ga0068867_100319396 | |||
| 1229 | Ga0068867_100459748 | |||
| 1230 | Ga0068867_100516008 | |||
| 1231 | Ga0068867_101370975 | |||
| 1232 | Ga0070685_10015127 | |||
| 1233 | Ga0070685_10042176 | |||
| 1234 | Ga0070706_100417470 | |||
| 1235 | Ga0070707_100005834 | |||
| 1236 | Ga0070707_100881402 | |||
| 1237 | Ga0070707_101947140 | |||
| 1238 | Ga0070698_100060264 | |||
| 1239 | Ga0070698_100122601 | |||
| 1240 | Ga0070698_100236108 | |||
| 1241 | Ga0070698_100534041 | |||
| 1242 | Ga0070699_100000057 | |||
| 1243 | Ga0070699_100047236 | |||
| 1244 | Ga0070679_100001128 | |||
| 1245 | Ga0070679_100003527 | |||
| 1246 | Ga0070679_100005952 | |||
| 1247 | Ga0070679_100006736 | |||
| 1248 | Ga0070679_100123913 | |||
| 1249 | Ga0070679_100568866 | |||
| 1250 | Ga0070679_100573956 | |||
| 1251 | Ga0070684_100003829 | |||
| 1252 | Ga0070684_100031684 | |||
| 1253 | Ga0070684_100132976 | |||
| 1254 | Ga0070684_100193515 | |||
| 1255 | Ga0070684_100249484 | |||
| 1256 | Ga0070684_100276353 | |||
| 1257 | Ga0070684_100948056 | |||
| 1258 | Ga0070684_102071630 | |||
| 1259 | Ga0068853_100074174 | |||
| 1260 | Ga0068853_100085519 | |||
| 1261 | Ga0068853_100305564 | |||
| 1262 | Ga0068853_100357474 | |||
| 1263 | Ga0070672_100049941 | |||
| 1264 | Ga0070672_100198883 | |||
| 1265 | Ga0070672_100405143 | |||
| 1266 | Ga0070672_100564049 | |||
| 1267 | Ga0070672_101149723 | |||
| 1268 | Ga0070672_101485028 | |||
| 1269 | Ga0070686_100047813 | |||
| 1270 | Ga0070686_100888045 | |||
| 1271 | Ga0070696_100541395 | |||
| 1272 | Ga0070696_101717108 | |||
| 1273 | Ga0070693_100002524 | |||
| 1274 | Ga0070693_100084545 | |||
| 1275 | Ga0070693_100988608 | |||
| 1276 | Ga0070665_100061474 | |||
| 1277 | Ga0070665_100334146 | |||
| 1278 | Ga0070665_100711042 | |||
| 1279 | Ga0070665_100773766 | |||
| 1280 | Ga0070665_101313989 | |||
| 1281 | Ga0070704_100000531 | |||
| 1282 | Ga0070704_100178157 | |||
| 1283 | Ga0068855_100062475 | |||
| 1284 | Ga0068855_100088006 | |||
| 1285 | Ga0068855_100177426 | |||
| 1286 | Ga0068855_100695592 | |||
| 1287 | Ga0068855_100821581 | |||
| 1288 | Ga0068855_102274887 | |||
| 1289 | Ga0070664_100020551 | |||
| 1290 | Ga0070664_100031885 | |||
| 1291 | Ga0070664_100065824 | |||
| 1292 | Ga0070664_100146632 | |||
| 1293 | Ga0070664_100191620 | |||
| 1294 | Ga0070664_100221105 | |||
| 1295 | Ga0070664_100242055 | |||
| 1296 | Ga0070664_100769764 | |||
| 1297 | Ga0070664_100920572 | |||
| 1298 | Ga0068857_100021861 | |||
| 1299 | Ga0068857_100084177 | |||
| 1300 | Ga0068857_100270577 | |||
| 1301 | Ga0068857_100286195 | |||
| 1302 | Ga0068857_100404595 | |||
| 1303 | Ga0068857_100409478 | |||
| 1304 | Ga0068854_100033476 | |||
| 1305 | Ga0068854_100056047 | |||
| 1306 | Ga0068854_101098127 | |||
| 1307 | Ga0068856_100016757 | |||
| 1308 | Ga0068856_100251183 | |||
| 1309 | Ga0068856_100288855 | |||
| 1310 | Ga0068856_100555179 | |||
| 1311 | Ga0068856_100642779 | |||
| 1312 | Ga0068856_101378737 | |||
| 1313 | Ga0068856_101626486 | |||
| 1314 | Ga0070702_100023240 | |||
| 1315 | Ga0070702_100569234 | |||
| 1316 | Ga0070702_100943677 | |||
| 1317 | Ga0068852_100062994 | |||
| 1318 | Ga0068852_100088266 | |||
| 1319 | Ga0068852_100107430 | |||
| 1320 | Ga0068852_100129472 | |||
| 1321 | Ga0068852_100207321 | |||
| 1322 | Ga0068852_100343675 | |||
| 1323 | Ga0068852_100367435 | |||
| 1324 | Ga0068852_101132556 | |||
| 1325 | Ga0068859_100017193 | |||
| 1326 | Ga0068859_100040659 | |||
| 1327 | Ga0068859_100093556 | |||
| 1328 | Ga0068859_100174045 | |||
| 1329 | Ga0068864_100006515 | |||
| 1330 | Ga0068864_100413405 | |||
| 1331 | Ga0068864_101935185 | |||
| 1332 | Ga0068866_10181416 | |||
| 1333 | Ga0068866_10327437 | |||
| 1334 | Ga0068861_100007581 | |||
| 1335 | Ga0068851_10407791 | |||
| 1336 | Ga0068870_10042309 | |||
| 1337 | Ga0068870_10197850 | |||
| 1338 | Ga0068870_10377440 | |||
| 1339 | Ga0068863_100067858 | |||
| 1340 | Ga0068863_100426873 | |||
| 1341 | Ga0068863_100651529 | |||
| 1342 | Ga0068863_102137600 | |||
| 1343 | Ga0068858_100235037 | |||
| 1344 | Ga0068858_100808842 | |||
| 1345 | Ga0068860_100067002 | |||
| 1346 | Ga0068860_100086798 | |||
| 1347 | Ga0068860_100877157 | |||
| 1348 | Ga0068862_100055055 | |||
| 1349 | Ga0068862_100069630 | |||
| 1350 | Ga0068862_100115639 | |||
| 1351 | Ga0068862_100330946 | |||
| 1352 | Ga0068862_101289908 | |||
| 1353 | Ga0068862_101303415 | |||
| 1354 | Ga0068862_102273451 | |||
| 1355 | Ga0081539_10002155 | |||
| 1356 | Ga0075432_10161773 | |||
| 1357 | Ga0075432_10248270 | |||
| 1358 | Ga0070712_100041575 | |||
| 1359 | Ga0070712_100853918 | |||
| 1360 | Ga0097621_100121813 | |||
| 1361 | Ga0097621_100383481 | |||
| 1362 | Ga0097621_100748093 | |||
| 1363 | Ga0097621_101064996 | |||
| 1364 | Ga0097621_101197993 | |||
| 1365 | Ga0097621_102254217 | |||
| 1366 | Ga0068871_100031846 | |||
| 1367 | Ga0068871_100189328 | |||
| 1368 | Ga0068871_100247130 | |||
| 1369 | Ga0068871_100464198 | |||
| 1370 | Ga0068871_100749360 | |||
| 1371 | Ga0068871_100773376 | |||
| 1372 | Ga0075428_100009803 | |||
| 1373 | Ga0075428_102542924 | |||
| 1374 | Ga0075430_100006156 | |||
| 1375 | Ga0075430_100010546 | |||
| 1376 | Ga0075430_100025202 | |||
| 1377 | Ga0075430_100069204 | |||
| 1378 | Ga0075430_100206145 | |||
| 1379 | Ga0075430_100362574 | |||
| 1380 | Ga0075430_100636009 | |||
| 1381 | Ga0075431_100016436 | |||
| 1382 | Ga0075431_100033112 | |||
| 1383 | Ga0075431_100177709 | |||
| 1384 | Ga0075431_100257460 | |||
| 1385 | Ga0075431_100336850 | |||
| 1386 | Ga0075431_101651264 | |||
| 1387 | Ga0075433_10070059 | |||
| 1388 | Ga0075433_11007216 | |||
| 1389 | Ga0075433_11051268 | |||
| 1390 | Ga0075434_100364284 | |||
| 1391 | Ga0075434_100977096 | |||
| 1392 | Ga0075429_100080005 | |||
| 1393 | Ga0075429_100610573 | |||
| 1394 | Ga0075429_101440900 | |||
| 1395 | Ga0068865_100711051 | |||
| 1396 | Ga0068865_101113151 | |||
| 1397 | Ga0068865_101388973 | |||
| 1398 | Ga0075436_100005295 | |||
| 1399 | Ga0097620_100017193 | |||
| 1400 | Ga0097620_100040659 | |||
| 1401 | Ga0097620_100093566 | |||
| 1402 | Ga0097620_100174045 | |||
| 1403 | Ga0105240_10190521 | |||
| 1404 | Ga0105240_10227672 | |||
| 1405 | Ga0105240_10534431 | |||
| 1406 | Ga0105240_10739361 | |||
| 1407 | Ga0105240_10806833 | |||
| 1408 | Ga0105240_10931030 | |||
| 1409 | Ga0105240_11766538 | |||
| 1410 | Ga0111539_10039634 | |||
| 1411 | Ga0111539_10069428 | |||
| 1412 | Ga0111539_10571041 | |||
| 1413 | Ga0111539_10736563 | |||
| 1414 | Ga0105245_10007242 | |||
| 1415 | Ga0105245_10779545 | |||
| 1416 | Ga0105245_11720415 | |||
| 1417 | Ga0105247_10269700 | |||
| 1418 | Ga0105247_10665057 | |||
| 1419 | Ga0114129_10145426 | |||
| 1420 | Ga0114129_10328531 | |||
| 1421 | Ga0114129_10584599 | |||
| 1422 | Ga0114129_12658119 | |||
| 1423 | Ga0105243_10465289 | |||
| 1424 | Ga0105243_10643620 | |||
| 1425 | Ga0105243_10672849 | |||
| 1426 | Ga0105243_11316450 | |||
| 1427 | Ga0105243_12314895 | |||
| 1428 | Ga0105241_10013440 | |||
| 1429 | Ga0105241_10303450 | |||
| 1430 | Ga0105241_10400246 | |||
| 1431 | Ga0105242_10059781 | |||
| 1432 | Ga0105242_10333063 | |||
| 1433 | Ga0105242_10712276 | |||
| 1434 | Ga0105242_11149461 | |||
| 1435 | Ga0105242_11727198 | |||
| 1436 | Ga0105248_10003817 | |||
| 1437 | Ga0105248_10029120 | |||
| 1438 | Ga0105248_10073913 | |||
| 1439 | Ga0105248_10112827 | |||
| 1440 | Ga0105248_10289681 | |||
| 1441 | Ga0105248_11115384 | |||
| 1442 | Ga0105237_10048456 | |||
| 1443 | Ga0105237_10075964 | |||
| 1444 | Ga0105237_10107229 | |||
| 1445 | Ga0105237_10269506 | |||
| 1446 | Ga0105237_10362049 | |||
| 1447 | Ga0105237_10550172 | |||
| 1448 | Ga0105237_11054537 | |||
| 1449 | Ga0105238_10071480 | |||
| 1450 | Ga0105238_10072112 | |||
| 1451 | Ga0105238_10109256 | |||
| 1452 | Ga0105238_10224419 | |||
| 1453 | Ga0105238_10894150 | |||
| 1454 | Ga0105238_11990180 | |||
| 1455 | Ga0105238_12253663 | |||
| 1456 | Ga0105249_10063658 | |||
| 1457 | Ga0105249_10110725 | |||
| 1458 | Ga0105249_10477355 | |||
| 1459 | Ga0105239_12513338 | |||
| 1460 | Ga0105239_13571907 | |||
| 1461 | Ga0105246_10007915 | |||
| 1462 | Ga0105246_10224709 | |||
| 1463 | Ga0105246_11220027 | |||
| 1464 | Ga0105246_12301840 | |||
| 1465 | Ga0157316_1019887 | |||
| 1466 | Ga0157373_10036032 | |||
| 1467 | Ga0157373_10157003 | |||
| 1468 | Ga0157373_10680262 | |||
| 1469 | Ga0157371_10704215 | |||
| 1470 | Ga0157371_11058472 | |||
| 1471 | Ga0157371_11271931 | |||
| 1472 | Ga0157370_10010027 | |||
| 1473 | Ga0157370_10011467 | |||
| 1474 | Ga0157370_10065570 | |||
| 1475 | Ga0157370_10118456 | |||
| 1476 | Ga0157370_10400529 | |||
| 1477 | Ga0157370_11103133 | |||
| 1478 | Ga0157369_10214283 | |||
| 1479 | Ga0157369_10320945 | |||
| 1480 | Ga0157369_10540179 | |||
| 1481 | Ga0157369_10546608 | |||
| 1482 | Ga0157369_10621759 | |||
| 1483 | Ga0157369_10664188 | |||
| 1484 | Ga0157369_10671366 | |||
| 1485 | Ga0157369_10748289 | |||
| 1486 | Ga0157369_11048097 | |||
| 1487 | Ga0157369_11076867 | |||
| 1488 | Ga0157369_12285040 | |||
| 1489 | Ga0157374_10066369 | |||
| 1490 | Ga0157374_10364645 | |||
| 1491 | Ga0157374_11345065 | |||
| 1492 | Ga0157374_11616001 | |||
| 1493 | Ga0157378_10111950 | |||
| 1494 | Ga0157378_11242987 | |||
| 1495 | Ga0157378_13167498 | |||
| 1496 | Ga0157378_13291544 | |||
| 1497 | Ga0163162_10095293 | |||
| 1498 | Ga0163162_11373386 | |||
| 1499 | Ga0157372_10001817 | |||
| 1500 | Ga0157372_10013190 | |||
| 1501 | Ga0157372_10057587 | |||
| 1502 | Ga0157372_10061767 | |||
| 1503 | Ga0157372_10092219 | |||
| 1504 | Ga0157372_10143161 | |||
| 1505 | Ga0157372_10212214 | |||
| 1506 | Ga0157372_10548067 | |||
| 1507 | Ga0157372_10629483 | |||
| 1508 | Ga0157372_10943846 | |||
| 1509 | Ga0157372_11612413 | |||
| 1510 | Ga0157372_11975603 | |||
| 1511 | Ga0157372_12353834 | |||
| 1512 | Ga0157375_10006012 | |||
| 1513 | Ga0157375_10070737 | |||
| 1514 | Ga0157375_10432061 | |||
| 1515 | Ga0157375_10494971 | |||
| 1516 | Ga0157375_10597053 | |||
| 1517 | Ga0157375_10740699 | |||
| 1518 | Ga0157375_11050314 | |||
| 1519 | Ga0157375_13690716 | |||
| 1520 | Ga0163163_10181838 | |||
| 1521 | Ga0163163_10872474 | |||
| 1522 | Ga0157380_10199431 | |||
| 1523 | Ga0157377_10038185 | |||
| 1524 | Ga0157377_10092017 | |||
| 1525 | Ga0157377_10744571 | |||
| 1526 | Ga0157379_10032105 | |||
| 1527 | Ga0157379_10907750 | |||
| 1528 | Ga0157379_12536000 | |||
| 1529 | Ga0157376_10172316 | |||
| 1530 | Ga0157376_10305078 | |||
| 1531 | Ga0157376_10392945 | |||
| 1532 | Ga0182007_10230636 | |||
| 1533 | Ga0163161_10055074 | |||
| 1534 | Ga0163161_11876906 | |||
| 1535 | Ga0197907_10655093 | |||
| 1536 | Ga0206356_11747774 | |||
| 1537 | Ga0206353_10375004 | |||
| 1538 | Ga0206353_11833831 | |||
| 1539 | Ga0213876_10006682 | |||
| 1540 | Ga0213876_10033566 | |||
| 1541 | Ga0207697_10030749 | |||
| 1542 | Ga0207697_10116990 | |||
| 1543 | Ga0207656_10689662 | |||
| 1544 | Ga0207682_10083049 | |||
| 1545 | Ga0207682_10419533 | |||
| 1546 | Ga0207642_10008793 | |||
| 1547 | Ga0207642_10602623 | |||
| 1548 | Ga0207688_10252230 | |||
| 1549 | Ga0207688_10316769 | |||
| 1550 | Ga0207680_10161330 | |||
| 1551 | Ga0207680_10714337 | |||
| 1552 | Ga0207680_10844699 | |||
| 1553 | Ga0207647_10187262 | |||
| 1554 | Ga0207685_10585387 | |||
| 1555 | Ga0207699_10004952 | |||
| 1556 | Ga0207645_10014647 | |||
| 1557 | Ga0207645_10019830 | |||
| 1558 | Ga0207645_10030696 | |||
| 1559 | Ga0207645_10149855 | |||
| 1560 | Ga0207645_10276860 | |||
| 1561 | Ga0207643_10010411 | |||
| 1562 | Ga0207643_10023178 | |||
| 1563 | Ga0207643_10052743 | |||
| 1564 | Ga0207705_10620709 | |||
| 1565 | Ga0207705_11361390 | |||
| 1566 | Ga0207684_10143724 | |||
| 1567 | Ga0207684_10817661 | |||
| 1568 | Ga0207707_10020675 | |||
| 1569 | Ga0207707_10022689 | |||
| 1570 | Ga0207707_10050164 | |||
| 1571 | Ga0207707_10112665 | |||
| 1572 | Ga0207707_10149627 | |||
| 1573 | Ga0207707_10166290 | |||
| 1574 | Ga0207707_10641026 | |||
| 1575 | Ga0207707_10956084 | |||
| 1576 | Ga0207695_10011163 | |||
| 1577 | Ga0207695_10029248 | |||
| 1578 | Ga0207695_10089970 | |||
| 1579 | Ga0207695_10122102 | |||
| 1580 | Ga0207695_10432906 | |||
| 1581 | Ga0207671_10359251 | |||
| 1582 | Ga0207671_10639887 | |||
| 1583 | Ga0207671_10732865 | |||
| 1584 | Ga0207671_10801147 | |||
| 1585 | Ga0207693_10084841 | |||
| 1586 | Ga0207663_10073697 | |||
| 1587 | Ga0207663_10402968 | |||
| 1588 | Ga0207663_11477049 | |||
| 1589 | Ga0207660_10062347 | |||
| 1590 | Ga0207660_10062540 | |||
| 1591 | Ga0207660_10140432 | |||
| 1592 | Ga0207660_10521964 | |||
| 1593 | Ga0207662_10012819 | |||
| 1594 | Ga0207662_10023547 | |||
| 1595 | Ga0207662_10027667 | |||
| 1596 | Ga0207657_10021308 | |||
| 1597 | Ga0207657_10068088 | |||
| 1598 | Ga0207649_10050898 | |||
| 1599 | Ga0207649_10070909 | |||
| 1600 | Ga0207649_10155728 | |||
| 1601 | Ga0207649_10194883 | |||
| 1602 | Ga0207649_10606764 | |||
| 1603 | Ga0207652_10008038 | |||
| 1604 | Ga0207652_10015933 | |||
| 1605 | Ga0207652_10028951 | |||
| 1606 | Ga0207652_10034546 | |||
| 1607 | Ga0207652_10072733 | |||
| 1608 | Ga0207652_10599679 | |||
| 1609 | Ga0207652_11264950 | |||
| 1610 | Ga0207646_10008918 | |||
| 1611 | Ga0207646_10706264 | |||
| 1612 | Ga0207646_11512835 | |||
| 1613 | Ga0207681_10206938 | |||
| 1614 | Ga0207681_10260734 | |||
| 1615 | Ga0207681_10283811 | |||
| 1616 | Ga0207681_10858869 | |||
| 1617 | Ga0207681_11041801 | |||
| 1618 | Ga0207694_10081652 | |||
| 1619 | Ga0207694_10161397 | |||
| 1620 | Ga0207694_10309540 | |||
| 1621 | Ga0207694_11631714 | |||
| 1622 | Ga0207650_10316434 | |||
| 1623 | Ga0207650_10621842 | |||
| 1624 | Ga0207650_10807003 | |||
| 1625 | Ga0207650_11480009 | |||
| 1626 | Ga0207659_10073195 | |||
| 1627 | Ga0207659_10299378 | |||
| 1628 | Ga0207659_10402909 | |||
| 1629 | Ga0207659_10422535 | |||
| 1630 | Ga0207659_10456249 | |||
| 1631 | Ga0207659_10806479 | |||
| 1632 | Ga0207659_11261926 | |||
| 1633 | Ga0207659_11275200 | |||
| 1634 | Ga0207659_11684242 | |||
| 1635 | Ga0207687_10010157 | |||
| 1636 | Ga0207687_11440456 | |||
| 1637 | Ga0207700_10072976 | |||
| 1638 | Ga0207700_10165913 | |||
| 1639 | Ga0207700_11319219 | |||
| 1640 | Ga0207664_10372634 | |||
| 1641 | Ga0207664_10721782 | |||
| 1642 | Ga0207644_10804587 | |||
| 1643 | Ga0207644_10881537 | |||
| 1644 | Ga0207644_10893216 | |||
| 1645 | Ga0207690_10007970 | |||
| 1646 | Ga0207690_10228320 | |||
| 1647 | Ga0207690_11057013 | |||
| 1648 | Ga0207706_10008609 | |||
| 1649 | Ga0207706_11269644 | |||
| 1650 | Ga0207686_10027499 | |||
| 1651 | Ga0207686_10253360 | |||
| 1652 | Ga0207686_10358929 | |||
| 1653 | Ga0207686_11132748 | |||
| 1654 | Ga0207709_10032296 | |||
| 1655 | Ga0207709_10882383 | |||
| 1656 | Ga0207670_10135215 | |||
| 1657 | Ga0207670_10662852 | |||
| 1658 | Ga0207669_10203266 | |||
| 1659 | Ga0207669_10993997 | |||
| 1660 | Ga0207704_10113223 | |||
| 1661 | Ga0207704_10838547 | |||
| 1662 | Ga0207704_11240827 | |||
| 1663 | Ga0207704_11785981 | |||
| 1664 | Ga0207691_10000993 | |||
| 1665 | Ga0207691_10008846 | |||
| 1666 | Ga0207691_10539917 | |||
| 1667 | Ga0207691_11026917 | |||
| 1668 | Ga0207711_10122262 | |||
| 1669 | Ga0207711_10512652 | |||
| 1670 | Ga0207711_10799058 | |||
| 1671 | Ga0207711_10961047 | |||
| 1672 | Ga0207711_11182149 | |||
| 1673 | Ga0207689_10007028 | |||
| 1674 | Ga0207689_10105986 | |||
| 1675 | Ga0207689_11559128 | |||
| 1676 | Ga0207661_10006057 | |||
| 1677 | Ga0207661_10010031 | |||
| 1678 | Ga0207661_10012407 | |||
| 1679 | Ga0207661_10054270 | |||
| 1680 | Ga0207661_10078495 | |||
| 1681 | Ga0207661_10196826 | |||
| 1682 | Ga0207661_10272664 | |||
| 1683 | Ga0207661_10360497 | |||
| 1684 | Ga0207661_10437903 | |||
| 1685 | Ga0207661_11844013 | |||
| 1686 | Ga0207679_10025407 | |||
| 1687 | Ga0207679_10120794 | |||
| 1688 | Ga0207679_10135212 | |||
| 1689 | Ga0207679_10195725 | |||
| 1690 | Ga0207679_10255312 | |||
| 1691 | Ga0207679_10365512 | |||
| 1692 | Ga0207679_10463011 | |||
| 1693 | Ga0207679_10475709 | |||
| 1694 | Ga0207679_10587042 | |||
| 1695 | Ga0207679_10651915 | |||
| 1696 | Ga0207679_11162024 | |||
| 1697 | Ga0207667_10052014 | |||
| 1698 | Ga0207667_10390054 | |||
| 1699 | Ga0207667_10835008 | |||
| 1700 | Ga0207667_11163151 | |||
| 1701 | Ga0207651_10112223 | |||
| 1702 | Ga0207651_10334214 | |||
| 1703 | Ga0207651_10395562 | |||
| 1704 | Ga0207651_10461657 | |||
| 1705 | Ga0207651_10858275 | |||
| 1706 | Ga0207651_10991138 | |||
| 1707 | Ga0207651_11008852 | |||
| 1708 | Ga0207712_10028452 | |||
| 1709 | Ga0207712_11307658 | |||
| 1710 | Ga0207668_10028938 | |||
| 1711 | Ga0207668_10272698 | |||
| 1712 | Ga0207668_11331823 | |||
| 1713 | Ga0207668_11889968 | |||
| 1714 | Ga0207640_10475260 | |||
| 1715 | Ga0207640_10617047 | |||
| 1716 | Ga0207658_10181906 | |||
| 1717 | Ga0207658_10361502 | |||
| 1718 | Ga0207658_10436627 | |||
| 1719 | Ga0207658_10558676 | |||
| 1720 | Ga0207658_11007285 | |||
| 1721 | Ga0207677_10178216 | |||
| 1722 | Ga0207677_10269601 | |||
| 1723 | Ga0207677_10693450 | |||
| 1724 | Ga0207677_10895031 | |||
| 1725 | Ga0207677_11440882 | |||
| 1726 | Ga0207677_12078095 | |||
| 1727 | Ga0207703_10336769 | |||
| 1728 | Ga0207703_10431989 | |||
| 1729 | Ga0207703_12321950 | |||
| 1730 | Ga0207639_10007860 | |||
| 1731 | Ga0207639_12071353 | |||
| 1732 | Ga0207678_10170140 | |||
| 1733 | Ga0207678_10331225 | |||
| 1734 | Ga0207678_10406910 | |||
| 1735 | Ga0207678_10906983 | |||
| 1736 | Ga0207708_10024989 | |||
| 1737 | Ga0207708_10829204 | |||
| 1738 | Ga0207702_10017046 | |||
| 1739 | Ga0207702_10136380 | |||
| 1740 | Ga0207702_10230289 | |||
| 1741 | Ga0207702_10310465 | |||
| 1742 | Ga0207641_10122111 | |||
| 1743 | Ga0207641_10609981 | |||
| 1744 | Ga0207641_10892904 | |||
| 1745 | Ga0207641_11061739 | |||
| 1746 | Ga0207641_12441521 | |||
| 1747 | Ga0207648_10045314 | |||
| 1748 | Ga0207648_10053286 | |||
| 1749 | Ga0207648_10090847 | |||
| 1750 | Ga0207648_10131749 | |||
| 1751 | Ga0207648_10511633 | |||
| 1752 | Ga0207676_10058105 | |||
| 1753 | Ga0207676_10261186 | |||
| 1754 | Ga0207676_10321196 | |||
| 1755 | Ga0207676_10787166 | |||
| 1756 | Ga0207676_10928973 | |||
| 1757 | Ga0207674_10000013 | |||
| 1758 | Ga0207674_10001053 | |||
| 1759 | Ga0207674_10028497 | |||
| 1760 | Ga0207674_10320692 | |||
| 1761 | Ga0207674_10333193 | |||
| 1762 | Ga0207674_12189313 | |||
| 1763 | Ga0207675_100000916 | |||
| 1764 | Ga0207683_10038750 | |||
| 1765 | Ga0207683_10355646 | |||
| 1766 | Ga0207683_10614886 | |||
| 1767 | Ga0207698_10011010 | |||
| 1768 | Ga0207698_10104131 | |||
| 1769 | Ga0207698_10274236 | |||
| 1770 | Ga0207698_10437101 | |||
| 1771 | Ga0207698_11544183 | |||
| 1772 | Ga0207428_10930687 | |||
| 1773 | Ga0268266_10071820 | |||
| 1774 | Ga0268266_10172335 | |||
| 1775 | Ga0268266_10714688 | |||
| 1776 | Ga0268266_11379010 | |||
| 1777 | Ga0268266_11752164 | |||
| 1778 | Ga0268265_10063309 | |||
| 1779 | Ga0268265_10074959 | |||
| 1780 | Ga0268265_10075700 | |||
| 1781 | Ga0268265_10231102 | |||
| 1782 | Ga0268265_11188453 | |||
| 1783 | Ga0268264_10030491 | |||
| 1784 | Ga0268264_10069562 | |||
| 1785 | Ga0268264_10977741 | |||
| 1786 | Ga0307517_10355728 | |||
| 1787 | Ga0265327_10000417 | |||
| 1788 | Ga0307408_100023128 | |||
| 1789 | Ga0307408_100168886 | |||
| 1790 | Ga0307408_100184099 | |||
| 1791 | Ga0307408_101107252 | |||
| 1792 | Ga0307408_101268689 | |||
| 1793 | Ga0307405_10017765 | |||
| 1794 | Ga0307405_10026406 | |||
| 1795 | Ga0307405_10188069 | |||
| 1796 | Ga0307405_10282416 | |||
| 1797 | Ga0307413_10002909 | |||
| 1798 | Ga0307413_10044787 | |||
| 1799 | Ga0307413_10112475 | |||
| 1800 | Ga0307413_10245812 | |||
| 1801 | Ga0307410_10012158 | |||
| 1802 | Ga0307410_10058425 | |||
| 1803 | Ga0307410_10081840 | |||
| 1804 | Ga0307410_10556128 | |||
| 1805 | Ga0307406_10008103 | |||
| 1806 | Ga0307406_10034757 | |||
| 1807 | Ga0307406_10091966 | |||
| 1808 | Ga0307406_10106793 | |||
| 1809 | Ga0307406_10111813 | |||
| 1810 | Ga0307406_10700911 | |||
| 1811 | Ga0307406_11681358 | |||
| 1812 | Ga0307406_11738179 | |||
| 1813 | Ga0307407_10001830 | |||
| 1814 | Ga0307407_10005355 | |||
| 1815 | Ga0307407_10262957 | |||
| 1816 | Ga0307407_10333232 | |||
| 1817 | Ga0307412_10029895 | |||
| 1818 | Ga0307412_10091095 | |||
| 1819 | Ga0307412_10145084 | |||
| 1820 | Ga0307409_100006457 | |||
| 1821 | Ga0307409_100027198 | |||
| 1822 | Ga0307409_100148750 | |||
| 1823 | Ga0307409_100389823 | |||
| 1824 | Ga0307409_100641638 | |||
| 1825 | Ga0307409_100645558 | |||
| 1826 | Ga0307409_100790838 | |||
| 1827 | Ga0307409_101315580 | |||
| 1828 | Ga0307416_100010847 | |||
| 1829 | Ga0307416_100042663 | |||
| 1830 | Ga0307416_100129701 | |||
| 1831 | Ga0307416_100193234 | |||
| 1832 | Ga0307416_100332267 | |||
| 1833 | Ga0307416_100600339 | |||
| 1834 | Ga0307416_100737464 | |||
| 1835 | Ga0307416_101534195 | |||
| 1836 | Ga0307416_101757855 | |||
| 1837 | Ga0307416_103251021 | |||
| 1838 | Ga0307414_10005676 | |||
| 1839 | Ga0307414_10064436 | |||
| 1840 | Ga0307414_10194962 | |||
| 1841 | Ga0307414_10459080 | |||
| 1842 | Ga0307414_11308814 | |||
| 1843 | Ga0307411_10011782 | |||
| 1844 | Ga0307411_10112641 | |||
| 1845 | Ga0307411_10225621 | |||
| 1846 | Ga0307411_10533789 | |||
| 1847 | Ga0307415_100006699 | |||
| 1848 | Ga0307415_100126416 | |||
| 1849 | Ga0307415_100186830 | |||
| 1850 | Ga0307415_100237829 | |||
| 1851 | Ga0307415_100736785 | |||
| 1852 | Ga0373958_0120301 | |||
| 1853 | Ga0373959_0091092 | |||
| 1854 | Ga0373926_0085051 | |||
| 1855 | Ga0373934_0000693 | |||
| 1856 | Ga0373934_0014355 | |||
| 1857 | Ga0373934_0074031 | |||
| 1858 | Ga0373949_0227228 | |||
| 1859 | Ga0373945_0120387 | |||
| 1860 | Ga0373956_0023066 | |||
| 1861 | Ga0373956_0353497 | |||
| 1862 | Ga0373957_0036561 | |||
| 1863 | Ga0373957_0071737 | |||
| 1864 | Ga0373957_0148206 | |||
| 1865 | Ga0373943_0101115 | |||
| 1866 | Ga0373943_0395781 | |||
| 1867 | Ga0373946_0245446 | |||
| 1868 | Ga0373955_0020564 | |||
| 1869 | Ga0373955_0071215 | |||
| 1870 | Ga0373955_0124229 | |||
| 1871 | Ga0373955_0154570 | |||
| 1872 | Ga0373961_0372133 | |||
| 1873 | Ga0373924_0374079 | |||
| 1874 | Ga0373924_0419291 | |||
| 1875 | Ga0373935_0788704 | |||
| 1876 | Ga0373935_1133566 | |||
| 1877 | Ga0373927_0002136 | |||
| 1878 | Ga0373927_0002804 | |||
| 1879 | Ga0373927_0009049 | |||
| 1880 | Ga0373927_0260678 | |||
| 1881 | Ga0373927_0874754 | |||
| 1882 | Ga0373933_0004678 | |||
| 1883 | Ga0373933_0027897 | |||
| 1884 | Ga0373933_0274267 | |||
| 1885 | Ga0373933_0310752 | |||
| 1886 | Ga0373933_0900352 | |||
| 1887 | Ga0373947_0086982 | |||
| 1888 | Ga0373947_0153410 | |||
| 1889 | Ga0373947_0438522 | |||
| 1890 | Ga0373937_0019193 | |||
| 1891 | Ga0373937_0031746 | |||
| 1892 | Ga0373937_0109180 | |||
| 1893 | Ga0373937_0204639 | |||
| 1894 | Ga0373937_0939526 | |||
| 1895 | Ga0373937_1894339 | |||
| 1896 | Ga0373925_0022816 | |||
| 1897 | Ga0373925_0379767 | |||
| 1898 | Ga0373925_1605596 | |||
| 1899 | Ga0395900_1282445 | |||
| 1900 | Ga0395905_0284097 | |||
| 1901 | Ga0395905_1089935 | |||
| 1902 | Ga0395901_1840426 | |||
| 1903 | Ga0436365_0391692 | |||
| 1904 | Ga0436365_0740200 | |||
| 1905 | Ga0439453_0142002 | |||
| 1906 | Ga0439462_0177247 | |||
| 1907 | Ga0450923_033705 | |||
| 1908 | Ga0439464_0104162 | |||
| 1909 | Ga0466964_0091616 | |||
| 1910 | Ga0451576_0296476 | |||
| 1911 | Ga0451576_0794957 | |||
| 1912 | Ga0466958_0053764 | |||
| 1913 | Ga0466958_0086719 | |||
| 1914 | Ga0466967_0015550 | |||
| 1915 | Ga0466967_0015954 | |||
| 1916 | Ga0466967_0306125 | |||
| 1917 | Ga0495592_0101740 | |||
| 1918 | Ga0495592_0142433 | |||
| 1919 | Ga0495592_0484116 | |||
| 1920 | Ga0495603_0841087 | |||
| 1921 | Ga0495629_0137216 | |||
| 1922 | Ga0495651_0032941 | |||
| 1923 | Ga0495651_0050540 | |||
| 1924 | Ga0495651_0092926 | |||
| 1925 | Ga0495651_0105009 | |||
| 1926 | Ga0495653_0008699 | |||
| 1927 | Ga0495580_0049945 | |||
| 1928 | Ga0495580_0065713 | |||
| 1929 | Ga0495580_0097349 | |||
| 1930 | Ga0495580_0499133 | |||
| 1931 | Ga0495582_0055303 | |||
| 1932 | Ga0495582_0367745 | |||
| 1933 | Ga0495582_0620880 | |||
| 1934 | Ga0495639_0042348 | |||
| 1935 | Ga0495639_0493225 | |||
| 1936 | Ga0495639_0602578 | |||
| 1937 | Ga0495662_0103835 | |||
| 1938 | Ga0495662_0540021 | |||
| 1939 | Ga0495664_0018786 | |||
| 1940 | Ga0495664_0057551 | |||
| 1941 | Ga0495594_0002111 | |||
| 1942 | Ga0495594_0003138 | |||
| 1943 | Ga0495594_0007113 | |||
| 1944 | Ga0495594_0021108 | |||
| 1945 | Ga0495594_0030492 | |||
| 1946 | Ga0495594_0040576 | |||
| 1947 | Ga0495594_0322006 | |||
| 1948 | Ga0495594_0400132 | |||
| 1949 | Ga0495608_0016154 | |||
| 1950 | Ga0495608_0051283 | |||
| 1951 | Ga0495608_0071918 | |||
| 1952 | Ga0495618_0022896 | |||
| 1953 | Ga0495618_0164369 | |||
| 1954 | Ga0495628_0012776 | |||
| 1955 | Ga0495628_0095796 | |||
| 1956 | Ga0495628_0099739 | |||
| 1957 | Ga0495628_0202919 | |||
| 1958 | Ga0495628_0288861 | |||
| 1959 | Ga0495628_0467717 | |||
| 1960 | Ga0495630_0120856 | |||
| 1961 | Ga0495630_0185393 | |||
| 1962 | Ga0495630_0243951 | |||
| 1963 | Ga0495652_0017461 | |||
| 1964 | Ga0495652_0045302 | |||
| 1965 | Ga0495652_0059988 | |||
| 1966 | Ga0495652_0155228 | |||
| 1967 | Ga0495665_0082335 | |||
| 1968 | Ga0495665_0218399 | |||
| 1969 | Ga0495665_0301535 | |||
| 1970 | Ga0495640_0034623 | |||
| 1971 | Ga0495640_0111570 | |||
| 1972 | Ga0495640_0311189 | |||
| 1973 | Ga0495640_0718498 | |||
| 1974 | Ga0495586_0002607 | |||
| 1975 | Ga0495586_0003673 | |||
| 1976 | Ga0495586_0026076 | |||
| 1977 | Ga0495586_0069985 | |||
| 1978 | Ga0495586_0110555 | |||
| 1979 | Ga0495587_0007008 | |||
| 1980 | Ga0495587_0014065 | |||
| 1981 | Ga0495587_0135076 | |||
| 1982 | Ga0495645_0017377 | |||
| 1983 | Ga0495645_0019056 | |||
| 1984 | Ga0495645_0110736 | |||
| 1985 | Ga0495645_0128299 | |||
| 1986 | Ga0495645_0350342 | |||
| 1987 | Ga0495645_0653435 | |||
| 1988 | Ga0495645_0673844 | |||
| 1989 | Ga0495667_0010503 | |||
| 1990 | Ga0495667_0011332 | |||
| 1991 | Ga0495667_0011632 | |||
| 1992 | Ga0495667_0016270 | |||
| 1993 | Ga0495667_0046770 | |||
| 1994 | Ga0495667_0070938 | |||
| 1995 | Ga0495634_0066592 | |||
| 1996 | Ga0495634_0271359 | |||
| 1997 | Ga0495635_0082292 | |||
| 1998 | Ga0495635_0193480 | |||
| 1999 | Ga0495635_0326867 | |||
| 2000 | Ga0495588_0013485 | |||
| 2001 | Ga0495588_0245743 | |||
| 2002 | Ga0495588_0322660 | |||
| 2003 | Ga0495657_0140617 | |||
| 2004 | Ga0495657_0151321 | |||
| 2005 | Ga0495657_0195518 | |||
| 2006 | Ga0495599_0022026 | |||
| 2007 | Ga0495599_0022949 | |||
| 2008 | Ga0495599_0094589 | |||
| 2009 | Ga0495599_0114445 | |||
| 2010 | Ga0495599_0248930 | |||
| 2011 | Ga0495623_0001340 | |||
| 2012 | Ga0495623_0016577 | |||
| 2013 | Ga0495623_0032108 | |||
| 2014 | Ga0495623_0067078 | |||
| 2015 | Ga0495623_0107879 | |||
| 2016 | Ga0495646_0016575 | |||
| 2017 | Ga0495646_0232195 | |||
| 2018 | Ga0495646_0353858 | |||
| 2019 | Ga0495646_0365894 | |||
| 2020 | Ga0495658_0155846 | |||
| 2021 | Ga0495658_0354087 | |||
| 2022 | Ga0495613_0169348 | |||
| 2023 | Ga0495613_0311500 | |||
| 2024 | Ga0495613_0443269 | |||
| 2025 | Ga0495613_1067774 | |||
| 2026 | Ga0495624_0077647 | |||
| 2027 | Ga0495624_0857423 | |||
| 2028 | Ga0495600_0045967 | |||
| 2029 | Ga0495600_0066206 | |||
| 2030 | Ga0495600_0121104 | |||
| 2031 | Ga0495600_0264602 | |||
| 2032 | Ga0495600_0685060 | |||
| 2033 | Ga0495581_0034852 | |||
| 2034 | Ga0495604_0019224 | |||
| 2035 | Ga0495604_0090315 | |||
| 2036 | Ga0495604_0310235 | |||
| 2037 | Ga0495636_0251815 | |||
| 2038 | Ga0495636_0335513 | |||
| 2039 | Ga0495636_0496547 | |||
| 2040 | Ga0495674_0048461 | |||
| 2041 | Ga0495674_0060307 | |||
| 2042 | Ga0495674_1045626 | |||
| 2043 | Ga0495680_0011219 | |||
| 2044 | Ga0495680_0734280 | |||
| 2045 | Ga0495675_0014738 | |||
| 2046 | Ga0495675_0027932 | |||
| 2047 | Ga0495675_0028626 | |||
| 2048 | Ga0495675_0509801 | |||
| 2049 | Ga0495684_0004115 | |||
| 2050 | Ga0495684_0004429 | |||
| 2051 | Ga0495684_0012968 | |||
| 2052 | Ga0495684_0046837 | |||
| 2053 | Ga0495684_0047964 | |||
| 2054 | Ga0495684_0197889 | |||
| 2055 | Ga0495684_0272059 | |||
| 2056 | Ga0495593_0126688 | |||
| 2057 | Ga0495593_0261273 | |||
| 2058 | Ga0495593_0275296 | |||
| 2059 | Ga0495602_0046845 | |||
| 2060 | Ga0495602_0108628 | |||
| 2061 | Ga0495602_0369474 | |||
| 2062 | Ga0495602_1169124 | |||
| 2063 | Ga0495615_0097342 | |||
| 2064 | Ga0496102_0712941 | |||
| 2065 | Ga0496104_0241732 | |||
| 2066 | Ga0496105_0104183 | |||
| 2067 | Ga0496106_0381126 | |||
| 2068 | Ga0496109_1277460 | |||
| 2069 | Ga0496109_1766021 | |||
| 2070 | Ga0496115_0957051 | |||
| 2071 | Ga0501034_0266506 | |||
| 2072 | Ga0501037_0400299 | |||
| 2073 | Ga0501038_0235621 | |||
| 2074 | Ga0501067_0383276 | |||
| 2075 | Ga0501073_0141971 | |||
| 2076 | Ga0501235_100968 | |||
| 2077 | Ga0501235_221544 | |||
| 2078 | Ga0501239_080069 | |||
| 2079 | Ga0501250_057742 | |||
| 2080 | Ga0501260_010059 | |||
| 2081 | Ga0501260_036440 | |||
| 2082 | Ga0501221_232328 | |||
| 2083 | Ga0501245_145725 | |||
| 2084 | Ga0501268_018978 | |||
| 2085 | Ga0501268_061754 | |||
| 2086 | Ga0501272_051019 | |||
| 2087 | Ga0501035_0290799 | |||
| 2088 | Ga0501044_0304459 | |||
| 2089 | Ga0501204_084766 | |||
| 2090 | nmdc:mga05p37_278768_c1 | |||
| 2091 | nmdc:mga05p37_58074_c1 | |||
| 2092 | nmdc:mga05p37_63592_c1 | |||
| 2093 | nmdc:mga05p37_849005_c1 | |||
| 2094 | nmdc:mga09592_11306_c1 | |||
| 2095 | nmdc:mga09592_61292_c1 | |||
| 2096 | nmdc:mga0qj67_111215_c1 | |||
| 2097 | nmdc:mga0qj67_20802_c1 | |||
| 2098 | nmdc:mga0qj67_319746_c1 | |||
| 2099 | nmdc:mga0qj67_578242_c1 | |||
| 2100 | nmdc:mga0qj67_78655_c1 | |||
| 2101 | nmdc:mga06r32_1423218_c1 | |||
| 2102 | nmdc:mga06r32_172320_c1 | |||
| 2103 | nmdc:mga06r32_1911043_c1 | |||
| 2104 | nmdc:mga06r32_503198_c1 | |||
| 2105 | nmdc:mga06r32_789967_c1 | |||
| 2106 | nmdc:mga06r32_873600_c1 | |||
| 2107 | nmdc:mga08y16_1514781_c1 | |||
| 2108 | nmdc:mga08y16_1925415_c1 | |||
| 2109 | nmdc:mga08y16_277190_c1 | |||
| 2110 | nmdc:mga08y16_341183_c1 | |||
| 2111 | nmdc:mga08y16_502688_c1 | |||
| 2112 | nmdc:mga0n895_308922_c1 | |||
| 2113 | nmdc:mga0n895_657487_c1 | |||
| 2114 | nmdc:mga0n895_673_c1 | |||
| 2115 | nmdc:mga0n895_890078_c1 | |||
| 2116 | nmdc:mga0n895_994680_c1 | |||
| 2117 | nmdc:mga0rr50_552261_c1 | |||
| 2118 | nmdc:mga08x19_25845_c1 | |||
| 2119 | nmdc:mga0a205_27340_c1 | |||
| 2120 | nmdc:mga0a205_76155_c1 | |||
| 2121 | nmdc:mga0a205_828197_c1 | |||
| 2122 | Ga0495601_0071527 | |||
| 2123 | Ga0495601_0503700 | |||
| 2124 | Ga0495601_0515543 | |||
| 2125 | Ga0495612_0143373 | |||
| 2126 | Ga0495595_0050155 | |||
| 2127 | Ga0495619_0072498 | |||
| 2128 | Ga0495619_0510853 | |||
| 2129 | Ga0495619_1053432 | |||
| 2130 | Ga0590071_033301 | |||
| 2131 | Ga0590075_027330 | |||
| 2132 | Ga0590077_058019 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9518 | 14 | 109 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.926 | 13 | 113 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9229 | 10 | 109 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.9184 | 10 | 112 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9127 | 13 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9229 | 10 | 109 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9215 | 14 | 103 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9184 | 14 | 113 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9072 | 10 | 112 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8886 | 17 | 97 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A5G5J2-F1-model_v4 | deleted | 0.9967 | 20 | 114 |
|
| AF-A0A1Q7C8R4-F1-model_v4 | PadR family transcriptional regulator | 0.996 | 20 | 114 |
|
| AF-A0A3N5LHC2-F1-model_v4 | PadR family transcriptional regulator | 0.9955 | 16 | 114 |
|
| AF-A0A7W1BIP0-F1-model_v4 | PadR family transcriptional regulator | 0.9944 | 14 | 114 |
|
| AF-A0A7Y3ICY8-F1-model_v4 | PadR family transcriptional regulator | 0.9941 | 14 | 111 |
|