F489396

General Info

Members Datasets Scaffolds Average Seq Length
1066 317 2132 114

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10041235|Ga0105240_100412353
Length 115
Sequence MSEPQMPRDKTGLLHGSLDLIVLRTLSLQPMHGYAITQHVARLTDGVLTADPGSLYPALERLKRNGWITAKWQQSPTGRRARYYAITRTGLKQLGRETSEFERFVDAMRRVLRAT

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
293 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
294 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
297 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
298 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 24.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10041235 3300009093 Bacteria 5894
2 JGI24750J21931_1087383 3300002070 Unclassified 525
3 JGI25406J46586_10028329 3300003203 Bacteria 2135
4 Ga0065712_10361323 3300005290 Unclassified 774
5 Ga0065715_10136937 3300005293 Bacteria 1915
6 Ga0065707_10018243 3300005295 Bacteria 1477
7 Ga0065707_10412262 3300005295 Bacteria 839
8 Ga0070658_10119638 3300005327 Unclassified 2188
9 Ga0070658_10794887 3300005327 Bacteria 822
10 Ga0070676_10091341 3300005328 Bacteria 1866
11 Ga0070676_10162634 3300005328 Bacteria 1438
12 Ga0070676_10395633 3300005328 Bacteria 960
13 Ga0070676_10402075 3300005328 Bacteria 953
14 Ga0070676_10874771 3300005328 Bacteria 668
15 Ga0070683_100133012 3300005329 Unclassified 2354
16 Ga0070683_100288308 3300005329 Bacteria 1561
17 Ga0070683_100311815 3300005329 Bacteria 1497
18 Ga0070683_100420309 3300005329 Bacteria 1275
19 Ga0070683_100442523 3300005329 Bacteria 1240
20 Ga0070683_100530045 3300005329 Bacteria 1126
21 Ga0070683_100643021 3300005329 Bacteria 1015
22 Ga0070683_100751286 3300005329 Bacteria 934
23 Ga0070683_101709683 3300005329 Unclassified 605
24 Ga0070690_100013382 3300005330 Unclassified 4845
25 Ga0070690_100086975 3300005330 Bacteria 2052
26 Ga0070690_100313332 3300005330 Bacteria 1128
27 Ga0070670_100000904 3300005331 Bacteria 23331
28 Ga0070670_100033628 3300005331 Bacteria 4416
29 Ga0070670_100719117 3300005331 Bacteria 899
30 Ga0070670_101307990 3300005331 Bacteria 664
31 Ga0070677_10111652 3300005333 Bacteria 1221
32 Ga0070677_10316509 3300005333 Bacteria 798
33 Ga0070677_10561652 3300005333 Bacteria 627
34 Ga0070677_10613889 3300005333 Unclassified 604
35 Ga0070677_10904215 3300005333 Bacteria 510
36 Ga0068869_100087372 3300005334 Bacteria 2339
37 Ga0068869_100126608 3300005334 Unclassified 1959
38 Ga0068869_100763969 3300005334 Bacteria 828
39 Ga0068869_101931419 3300005334 Bacteria 529
40 Ga0070666_10139238 3300005335 Bacteria 1690
41 Ga0070666_10181892 3300005335 Bacteria 1475
42 Ga0070666_10325538 3300005335 Unclassified 1097
43 Ga0070666_10368512 3300005335 Unclassified 1030
44 Ga0070680_100039609 3300005336 Bacteria 3812
45 Ga0070680_100060834 3300005336 Unclassified 3090
46 Ga0070680_100990621 3300005336 Bacteria 726
47 Ga0070682_100021644 3300005337 Bacteria 3798
48 Ga0068868_100125071 3300005338 Bacteria 2100
49 Ga0068868_100180363 3300005338 Bacteria 1752
50 Ga0068868_100211794 3300005338 Bacteria 1620
51 Ga0068868_100314694 3300005338 Bacteria 1332
52 Ga0068868_100497714 3300005338 Unclassified 1067
53 Ga0068868_100898620 3300005338 Bacteria 805
54 Ga0070660_100222707 3300005339 Bacteria 1533
55 Ga0070660_100384453 3300005339 Bacteria 1159
56 Ga0070660_100628258 3300005339 Bacteria 899
57 Ga0070689_100031910 3300005340 Bacteria 4004
58 Ga0070689_100042977 3300005340 Bacteria 3471
59 Ga0070689_100045520 3300005340 Bacteria 3379
60 Ga0070689_100963988 3300005340 Unclassified 757
61 Ga0070691_10045887 3300005341 Bacteria 2074
62 Ga0070691_10547305 3300005341 Unclassified 676
63 Ga0070687_100016310 3300005343 Unclassified 3385
64 Ga0070687_100044352 3300005343 Bacteria 2265
65 Ga0070687_100164469 3300005343 Bacteria 1315
66 Ga0070687_100794241 3300005343 Unclassified 670
67 Ga0070661_100007805 3300005344 Bacteria 7387
68 Ga0070661_100042506 3300005344 Bacteria 3318
69 Ga0070661_100228822 3300005344 Bacteria 1428
70 Ga0070661_100271959 3300005344 Bacteria 1312
71 Ga0070661_100679920 3300005344 Bacteria 837
72 Ga0070661_100991182 3300005344 Unclassified 697
73 Ga0070661_101190432 3300005344 Unclassified 637
74 Ga0070661_101639791 3300005344 Unclassified 544
75 Ga0070692_10732475 3300005345 Bacteria 668
76 Ga0070668_100047236 3300005347 Bacteria 3309
77 Ga0070668_100052685 3300005347 Unclassified 3137
78 Ga0070668_100888955 3300005347 Bacteria 796
79 Ga0070668_101958800 3300005347 Bacteria 540
80 Ga0070669_100423683 3300005353 Bacteria 1093
81 Ga0070669_100500613 3300005353 Bacteria 1008
82 Ga0070669_100675041 3300005353 Bacteria 871
83 Ga0070675_100053005 3300005354 Unclassified 3336
84 Ga0070675_100156430 3300005354 Bacteria 1957
85 Ga0070675_100182582 3300005354 Bacteria 1814
86 Ga0070675_100211350 3300005354 Bacteria 1686
87 Ga0070675_100231192 3300005354 Bacteria 1613
88 Ga0070675_100364585 3300005354 Bacteria 1283
89 Ga0070675_100691565 3300005354 Unclassified 928
90 Ga0070675_100706882 3300005354 Unclassified 918
91 Ga0070675_100799960 3300005354 Bacteria 862
92 Ga0070675_101280675 3300005354 Unclassified 675
93 Ga0070675_102185044 3300005354 Unclassified 510
94 Ga0070671_100210096 3300005355 Bacteria 1651
95 Ga0070671_100430753 3300005355 Unclassified 1130
96 Ga0070671_100534020 3300005355 Bacteria 1011
97 Ga0070671_101072630 3300005355 Unclassified 707
98 Ga0070674_100967953 3300005356 Unclassified 745
99 Ga0070674_101483806 3300005356 Bacteria 609
100 Ga0070674_101640313 3300005356 Bacteria 580
101 Ga0070673_100024240 3300005364 Bacteria 4446
102 Ga0070673_100071192 3300005364 Bacteria 2793
103 Ga0070673_100099714 3300005364 Bacteria 2390
104 Ga0070673_100295104 3300005364 Bacteria 1425
105 Ga0070673_100384080 3300005364 Bacteria 1252
106 Ga0070673_102153318 3300005364 Bacteria 530
107 Ga0070688_100010552 3300005365 Bacteria 5100
108 Ga0070688_100075181 3300005365 Bacteria 2171
109 Ga0070688_100186644 3300005365 Bacteria 1442
110 Ga0070688_100937831 3300005365 Bacteria 685
111 Ga0070659_100019223 3300005366 Bacteria 5171
112 Ga0070659_100026628 3300005366 Bacteria 4451
113 Ga0070659_100284441 3300005366 Bacteria 1376
114 Ga0070667_100011181 3300005367 Bacteria 7425
115 Ga0070667_100013813 3300005367 Bacteria 6676
116 Ga0070667_100041948 3300005367 Bacteria 3838
117 Ga0070667_100171648 3300005367 Bacteria 1915
118 Ga0070667_100501825 3300005367 Unclassified 1112
119 Ga0070667_101224458 3300005367 Bacteria 703
120 Ga0070714_100013853 3300005435 Bacteria 6465
121 Ga0070713_100011136 3300005436 Bacteria 6536
122 Ga0070713_100028372 3300005436 Bacteria 4420
123 Ga0070713_100101564 3300005436 Bacteria 2492
124 Ga0070701_10016785 3300005438 Bacteria 3410
125 Ga0070711_100032327 3300005439 Bacteria 3478
126 Ga0070711_100033209 3300005439 Bacteria 3435
127 Ga0070711_100817982 3300005439 Bacteria 791
128 Ga0070711_100850546 3300005439 Unclassified 776
129 Ga0070711_101108908 3300005439 Bacteria 682
130 Ga0070705_100027468 3300005440 Bacteria 3108
131 Ga0070705_100143614 3300005440 Unclassified 1574
132 Ga0070705_100499514 3300005440 Bacteria 923
133 Ga0070705_101347664 3300005440 Unclassified 593
134 Ga0070700_100220696 3300005441 Bacteria 1343
135 Ga0070700_100751143 3300005441 Unclassified 781
136 Ga0070700_101106530 3300005441 Unclassified 657
137 Ga0070694_100024296 3300005444 Bacteria 3911
138 Ga0070694_100093006 3300005444 Unclassified 2119
139 Ga0070708_102042697 3300005445 Bacteria 530
140 Ga0070663_100057117 3300005455 Bacteria 2799
141 Ga0070663_100988795 3300005455 Unclassified 731
142 Ga0070663_101290171 3300005455 Unclassified 644
143 Ga0070678_101231644 3300005456 Bacteria 695
144 Ga0070678_101249168 3300005456 Unclassified 690
145 Ga0070662_100017082 3300005457 Bacteria 4884
146 Ga0070662_100019646 3300005457 Bacteria 4589
147 Ga0070681_10001603 3300005458 Bacteria 20122
148 Ga0070681_10002295 3300005458 Bacteria 17491
149 Ga0070681_10008854 3300005458 Bacteria 9888
150 Ga0070681_10026191 3300005458 Bacteria 5863
151 Ga0070681_10097887 3300005458 Bacteria 2880
152 Ga0070681_10158889 3300005458 Bacteria 2184
153 Ga0070681_10172772 3300005458 Bacteria 2083
154 Ga0070681_10389505 3300005458 Unclassified 1304
155 Ga0070681_10428619 3300005458 Bacteria 1235
156 Ga0070681_10860457 3300005458 Bacteria 824
157 Ga0070681_11261192 3300005458 Bacteria 661
158 Ga0070681_11453147 3300005458 Bacteria 610
159 Ga0068867_100012151 3300005459 Bacteria 6083
160 Ga0068867_100065455 3300005459 Bacteria 2705
161 Ga0068867_100206350 3300005459 Bacteria 1576
162 Ga0068867_100319396 3300005459 Bacteria 1286
163 Ga0068867_100459748 3300005459 Bacteria 1086
164 Ga0068867_100516008 3300005459 Bacteria 1030
165 Ga0068867_101370975 3300005459 Bacteria 655
166 Ga0070685_10015127 3300005466 Bacteria 4095
167 Ga0070685_10042176 3300005466 Bacteria 2603
168 Ga0070706_100417470 3300005467 Bacteria 1249
169 Ga0070707_100005834 3300005468 Bacteria 11484
170 Ga0070707_100881402 3300005468 Bacteria 859
171 Ga0070707_101947140 3300005468 Unclassified 555
172 Ga0070698_100060264 3300005471 Bacteria 3830
173 Ga0070698_100122601 3300005471 Bacteria 2558
174 Ga0070698_100236108 3300005471 Bacteria 1761
175 Ga0070698_100534041 3300005471 Bacteria 1112
176 Ga0070699_100000057 3300005518 Bacteria 109108
177 Ga0070699_100047236 3300005518 Bacteria 3724
178 Ga0070679_100001128 3300005530 Bacteria 23328
179 Ga0070679_100003527 3300005530 Bacteria 14324
180 Ga0070679_100005952 3300005530 Bacteria 11338
181 Ga0070679_100006736 3300005530 Bacteria 10714
182 Ga0070679_100123913 3300005530 Bacteria 2567
183 Ga0070679_100568866 3300005530 Bacteria 1077
184 Ga0070679_100573956 3300005530 Bacteria 1071
185 Ga0070684_100003829 3300005535 Bacteria 11380
186 Ga0070684_100031684 3300005535 Bacteria 4503
187 Ga0070684_100132976 3300005535 Bacteria 2245
188 Ga0070684_100193515 3300005535 Bacteria 1851
189 Ga0070684_100249484 3300005535 Bacteria 1622
190 Ga0070684_100276353 3300005535 Unclassified 1538
191 Ga0070684_100948056 3300005535 Unclassified 807
192 Ga0070684_102071630 3300005535 Unclassified 537
193 Ga0068853_100074174 3300005539 Bacteria 2968
194 Ga0068853_100085519 3300005539 Bacteria 2764
195 Ga0068853_100305564 3300005539 Unclassified 1471
196 Ga0068853_100357474 3300005539 Bacteria 1360
197 Ga0070672_100049941 3300005543 Bacteria 3256
198 Ga0070672_100198883 3300005543 Bacteria 1675
199 Ga0070672_100405143 3300005543 Bacteria 1169
200 Ga0070672_100564049 3300005543 Unclassified 989
201 Ga0070672_101149723 3300005543 Bacteria 691
202 Ga0070672_101485028 3300005543 Bacteria 607
203 Ga0070686_100047813 3300005544 Unclassified 2707
204 Ga0070686_100888045 3300005544 Unclassified 724
205 Ga0070696_100541395 3300005546 Unclassified 932
206 Ga0070696_101717108 3300005546 Unclassified 541
207 Ga0070693_100002524 3300005547 Bacteria 8435
208 Ga0070693_100084545 3300005547 Bacteria 1899
209 Ga0070693_100988608 3300005547 Unclassified 636
210 Ga0070665_100061474 3300005548 Bacteria 3766
211 Ga0070665_100334146 3300005548 Bacteria 1520
212 Ga0070665_100711042 3300005548 Bacteria 1018
213 Ga0070665_100773766 3300005548 Bacteria 973
214 Ga0070665_101313989 3300005548 Bacteria 733
215 Ga0070704_100000531 3300005549 Bacteria 18265
216 Ga0070704_100178157 3300005549 Bacteria 1698
217 Ga0068855_100062475 3300005563 Bacteria 4348
218 Ga0068855_100088006 3300005563 Bacteria 3588
219 Ga0068855_100177426 3300005563 Bacteria 2410
220 Ga0068855_100695592 3300005563 Bacteria 1088
221 Ga0068855_100821581 3300005563 Bacteria 986
222 Ga0068855_102274887 3300005563 Unclassified 543
223 Ga0070664_100020551 3300005564 Bacteria 5437
224 Ga0070664_100031885 3300005564 Bacteria 4407
225 Ga0070664_100065824 3300005564 Unclassified 3093
226 Ga0070664_100146632 3300005564 Bacteria 2081
227 Ga0070664_100191620 3300005564 Bacteria 1822
228 Ga0070664_100221105 3300005564 Unclassified 1694
229 Ga0070664_100242055 3300005564 Bacteria 1620
230 Ga0070664_100769764 3300005564 Bacteria 899
231 Ga0070664_100920572 3300005564 Bacteria 820
232 Ga0068857_100021861 3300005577 Bacteria 5629
233 Ga0068857_100084177 3300005577 Bacteria 2842
234 Ga0068857_100270577 3300005577 Bacteria 1561
235 Ga0068857_100286195 3300005577 Bacteria 1517
236 Ga0068857_100404595 3300005577 Bacteria 1270
237 Ga0068857_100409478 3300005577 Bacteria 1263
238 Ga0068854_100033476 3300005578 Unclassified 3583
239 Ga0068854_100056047 3300005578 Bacteria 2840
240 Ga0068854_101098127 3300005578 Bacteria 708
241 Ga0068856_100016757 3300005614 Bacteria 7099
242 Ga0068856_100251183 3300005614 Bacteria 1783
243 Ga0068856_100288855 3300005614 Unclassified 1657
244 Ga0068856_100555179 3300005614 Bacteria 1170
245 Ga0068856_100642779 3300005614 Bacteria 1081
246 Ga0068856_101378737 3300005614 Bacteria 720
247 Ga0068856_101626486 3300005614 Bacteria 659
248 Ga0070702_100023240 3300005615 Bacteria 3291
249 Ga0070702_100569234 3300005615 Unclassified 844
250 Ga0070702_100943677 3300005615 Bacteria 679
251 Ga0068852_100062994 3300005616 Bacteria 3227
252 Ga0068852_100088266 3300005616 Unclassified 2769
253 Ga0068852_100107430 3300005616 Bacteria 2531
254 Ga0068852_100129472 3300005616 Bacteria 2322
255 Ga0068852_100207321 3300005616 Unclassified 1858
256 Ga0068852_100343675 3300005616 Bacteria 1455
257 Ga0068852_100367435 3300005616 Bacteria 1409
258 Ga0068852_101132556 3300005616 Bacteria 803
259 Ga0068859_100017193 3300005617 Bacteria 7262
260 Ga0068859_100040659 3300005617 Bacteria 4668
261 Ga0068859_100093556 3300005617 Bacteria 3057
262 Ga0068859_100174045 3300005617 Bacteria 2234
263 Ga0068864_100006515 3300005618 Bacteria 9570
264 Ga0068864_100413405 3300005618 Bacteria 1284
265 Ga0068864_101935185 3300005618 Unclassified 595
266 Ga0068866_10181416 3300005718 Bacteria 1244
267 Ga0068866_10327437 3300005718 Unclassified 966
268 Ga0068861_100007581 3300005719 Bacteria 7444
269 Ga0068851_10407791 3300005834 Unclassified 801
270 Ga0068870_10042309 3300005840 Bacteria 2371
271 Ga0068870_10197850 3300005840 Bacteria 1217
272 Ga0068870_10377440 3300005840 Bacteria 917
273 Ga0068863_100067858 3300005841 Bacteria 3373
274 Ga0068863_100426873 3300005841 Bacteria 1299
275 Ga0068863_100651529 3300005841 Unclassified 1044
276 Ga0068863_102137600 3300005841 Bacteria 570
277 Ga0068858_100235037 3300005842 Bacteria 1738
278 Ga0068858_100808842 3300005842 Bacteria 914
279 Ga0068860_100067002 3300005843 Bacteria 3412
280 Ga0068860_100086798 3300005843 Bacteria 2978
281 Ga0068860_100877157 3300005843 Bacteria 913
282 Ga0068862_100055055 3300005844 Bacteria 3407
283 Ga0068862_100069630 3300005844 Bacteria 3037
284 Ga0068862_100115639 3300005844 Bacteria 2359
285 Ga0068862_100330946 3300005844 Bacteria 1408
286 Ga0068862_101289908 3300005844 Bacteria 731
287 Ga0068862_101303415 3300005844 Bacteria 727
288 Ga0068862_102273451 3300005844 Unclassified 554
289 Ga0081539_10002155 3300005985 Bacteria 29026
290 Ga0075432_10161773 3300006058 Bacteria 866
291 Ga0075432_10248270 3300006058 Unclassified 721
292 Ga0070712_100041575 3300006175 Bacteria 3157
293 Ga0070712_100853918 3300006175 Bacteria 783
294 Ga0097621_100121813 3300006237 Bacteria 2213
295 Ga0097621_100383481 3300006237 Unclassified 1256
296 Ga0097621_100748093 3300006237 Bacteria 903
297 Ga0097621_101064996 3300006237 Bacteria 758
298 Ga0097621_101197993 3300006237 Bacteria 715
299 Ga0097621_102254217 3300006237 Unclassified 521
300 Ga0068871_100031846 3300006358 Bacteria 4161
301 Ga0068871_100189328 3300006358 Bacteria 1772
302 Ga0068871_100247130 3300006358 Bacteria 1553
303 Ga0068871_100464198 3300006358 Bacteria 1137
304 Ga0068871_100749360 3300006358 Bacteria 898
305 Ga0068871_100773376 3300006358 Bacteria 884
306 Ga0075428_100009803 3300006844 Bacteria 10645
307 Ga0075428_102542924 3300006844 Unclassified 524
308 Ga0075430_100006156 3300006846 Bacteria 10108
309 Ga0075430_100010546 3300006846 Bacteria 7822
310 Ga0075430_100025202 3300006846 Bacteria 5058
311 Ga0075430_100069204 3300006846 Bacteria 2961
312 Ga0075430_100206145 3300006846 Bacteria 1632
313 Ga0075430_100362574 3300006846 Unclassified 1197
314 Ga0075430_100636009 3300006846 Bacteria 880
315 Ga0075431_100016436 3300006847 Bacteria 7511
316 Ga0075431_100033112 3300006847 Bacteria 5326
317 Ga0075431_100177709 3300006847 Bacteria 2185
318 Ga0075431_100257460 3300006847 Bacteria 1772
319 Ga0075431_100336850 3300006847 Unclassified 1518
320 Ga0075431_101651264 3300006847 Bacteria 598
321 Ga0075433_10070059 3300006852 Unclassified 3081
322 Ga0075433_11007216 3300006852 Unclassified 726
323 Ga0075433_11051268 3300006852 Unclassified 709
324 Ga0075434_100364284 3300006871 Bacteria 1466
325 Ga0075434_100977096 3300006871 Unclassified 861
326 Ga0075429_100080005 3300006880 Bacteria 2848
327 Ga0075429_100610573 3300006880 Bacteria 956
328 Ga0075429_101440900 3300006880 Bacteria 600
329 Ga0068865_100711051 3300006881 Unclassified 859
330 Ga0068865_101113151 3300006881 Unclassified 696
331 Ga0068865_101388973 3300006881 Bacteria 627
332 Ga0075436_100005295 3300006914 Bacteria 8873
333 Ga0097620_100017193 3300006931 Bacteria 7262
334 Ga0097620_100040659 3300006931 Bacteria 4668
335 Ga0097620_100093566 3300006931 Bacteria 3057
336 Ga0097620_100174045 3300006931 Bacteria 2234
337 Ga0105240_10190521 3300009093 Bacteria 2412
338 Ga0105240_10227672 3300009093 Bacteria 2168
339 Ga0105240_10534431 3300009093 Unclassified 1299
340 Ga0105240_10739361 3300009093 Unclassified 1070
341 Ga0105240_10806833 3300009093 Unclassified 1016
342 Ga0105240_10931030 3300009093 Unclassified 933
343 Ga0105240_11766538 3300009093 Bacteria 645
344 Ga0111539_10039634 3300009094 Bacteria 5676
345 Ga0111539_10069428 3300009094 Bacteria 4161
346 Ga0111539_10571041 3300009094 Unclassified 1317
347 Ga0111539_10736563 3300009094 Bacteria 1147
348 Ga0105245_10007242 3300009098 Bacteria 9717
349 Ga0105245_10779545 3300009098 Bacteria 993
350 Ga0105245_11720415 3300009098 Bacteria 679
351 Ga0105247_10269700 3300009101 Unclassified 1170
352 Ga0105247_10665057 3300009101 Unclassified 780
353 Ga0114129_10145426 3300009147 Bacteria 3248
354 Ga0114129_10328531 3300009147 Bacteria 2031
355 Ga0114129_10584599 3300009147 Bacteria 1449
356 Ga0114129_12658119 3300009147 Bacteria 597
357 Ga0105243_10465289 3300009148 Bacteria 1190
358 Ga0105243_10643620 3300009148 Bacteria 1026
359 Ga0105243_10672849 3300009148 Bacteria 1006
360 Ga0105243_11316450 3300009148 Unclassified 740
361 Ga0105243_12314895 3300009148 Unclassified 575
362 Ga0105241_10013440 3300009174 Bacteria 6001
363 Ga0105241_10303450 3300009174 Bacteria 1371
364 Ga0105241_10400246 3300009174 Unclassified 1204
365 Ga0105242_10059781 3300009176 Bacteria 3128
366 Ga0105242_10333063 3300009176 Unclassified 1396
367 Ga0105242_10712276 3300009176 Bacteria 983
368 Ga0105242_11149461 3300009176 Bacteria 793
369 Ga0105242_11727198 3300009176 Unclassified 663
370 Ga0105248_10003817 3300009177 Bacteria 16711
371 Ga0105248_10029120 3300009177 Bacteria 6157
372 Ga0105248_10073913 3300009177 Bacteria 3832
373 Ga0105248_10112827 3300009177 Bacteria 3066
374 Ga0105248_10289681 3300009177 Unclassified 1844
375 Ga0105248_11115384 3300009177 Bacteria 892
376 Ga0105237_10048456 3300009545 Bacteria 4271
377 Ga0105237_10075964 3300009545 Unclassified 3350
378 Ga0105237_10107229 3300009545 Bacteria 2785
379 Ga0105237_10269506 3300009545 Bacteria 1705
380 Ga0105237_10362049 3300009545 Unclassified 1455
381 Ga0105237_10550172 3300009545 Bacteria 1161
382 Ga0105237_11054537 3300009545 Unclassified 820
383 Ga0105238_10071480 3300009551 Bacteria 3467
384 Ga0105238_10072112 3300009551 Bacteria 3450
385 Ga0105238_10109256 3300009551 Bacteria 2747
386 Ga0105238_10224419 3300009551 Bacteria 1855
387 Ga0105238_10894150 3300009551 Bacteria 906
388 Ga0105238_11990180 3300009551 Unclassified 614
389 Ga0105238_12253663 3300009551 Unclassified 580
390 Ga0105249_10063658 3300009553 Bacteria 3389
391 Ga0105249_10110725 3300009553 Bacteria 2595
392 Ga0105249_10477355 3300009553 Bacteria 1289
393 Ga0105239_12513338 3300010375 Bacteria 600
394 Ga0105239_13571907 3300010375 Unclassified 505
395 Ga0105246_10007915 3300011119 Bacteria 6522
396 Ga0105246_10224709 3300011119 Bacteria 1474
397 Ga0105246_11220027 3300011119 Bacteria 693
398 Ga0105246_12301840 3300011119 Bacteria 526
399 Ga0157316_1019887 3300012510 Bacteria 724
400 Ga0157373_10036032 3300013100 Bacteria 3551
401 Ga0157373_10157003 3300013100 Bacteria 1600
402 Ga0157373_10680262 3300013100 Unclassified 753
403 Ga0157371_10704215 3300013102 Bacteria 756
404 Ga0157371_11058472 3300013102 Bacteria 621
405 Ga0157371_11271931 3300013102 Unclassified 569
406 Ga0157370_10010027 3300013104 Bacteria 10023
407 Ga0157370_10011467 3300013104 Bacteria 9265
408 Ga0157370_10065570 3300013104 Bacteria 3435
409 Ga0157370_10118456 3300013104 Bacteria 2473
410 Ga0157370_10400529 3300013104 Bacteria 1263
411 Ga0157370_11103133 3300013104 Bacteria 717
412 Ga0157369_10214283 3300013105 Unclassified 2018
413 Ga0157369_10320945 3300013105 Unclassified 1610
414 Ga0157369_10540179 3300013105 Bacteria 1205
415 Ga0157369_10546608 3300013105 Unclassified 1197
416 Ga0157369_10621759 3300013105 Bacteria 1114
417 Ga0157369_10664188 3300013105 Unclassified 1074
418 Ga0157369_10671366 3300013105 Bacteria 1068
419 Ga0157369_10748289 3300013105 Bacteria 1006
420 Ga0157369_11048097 3300013105 Unclassified 834
421 Ga0157369_11076867 3300013105 Bacteria 822
422 Ga0157369_12285040 3300013105 Bacteria 548
423 Ga0157374_10066369 3300013296 Bacteria 3391
424 Ga0157374_10364645 3300013296 Unclassified 1437
425 Ga0157374_11345065 3300013296 Bacteria 737
426 Ga0157374_11616001 3300013296 Bacteria 672
427 Ga0157378_10111950 3300013297 Bacteria 2503
428 Ga0157378_11242987 3300013297 Unclassified 785
429 Ga0157378_13167498 3300013297 Unclassified 511
430 Ga0157378_13291544 3300013297 Unclassified 502
431 Ga0163162_10095293 3300013306 Bacteria 3063
432 Ga0163162_11373386 3300013306 Bacteria 803
433 Ga0157372_10001817 3300013307 Bacteria 23138
434 Ga0157372_10013190 3300013307 Bacteria 8818
435 Ga0157372_10057587 3300013307 Bacteria 4344
436 Ga0157372_10061767 3300013307 Bacteria 4196
437 Ga0157372_10092219 3300013307 Unclassified 3446
438 Ga0157372_10143161 3300013307 Bacteria 2757
439 Ga0157372_10212214 3300013307 Unclassified 2243
440 Ga0157372_10548067 3300013307 Bacteria 1348
441 Ga0157372_10629483 3300013307 Unclassified 1250
442 Ga0157372_10943846 3300013307 Unclassified 1000
443 Ga0157372_11612413 3300013307 Bacteria 747
444 Ga0157372_11975603 3300013307 Bacteria 670
445 Ga0157372_12353834 3300013307 Bacteria 612
446 Ga0157375_10006012 3300013308 Bacteria 10582
447 Ga0157375_10070737 3300013308 Bacteria 3500
448 Ga0157375_10432061 3300013308 Bacteria 1483
449 Ga0157375_10494971 3300013308 Bacteria 1387
450 Ga0157375_10597053 3300013308 Bacteria 1263
451 Ga0157375_10740699 3300013308 Unclassified 1135
452 Ga0157375_11050314 3300013308 Bacteria 952
453 Ga0157375_13690716 3300013308 Bacteria 509
454 Ga0163163_10181838 3300014325 Bacteria 2150
455 Ga0163163_10872474 3300014325 Bacteria 963
456 Ga0157380_10199431 3300014326 Bacteria 1774
457 Ga0157377_10038185 3300014745 Bacteria 2650
458 Ga0157377_10092017 3300014745 Bacteria 1792
459 Ga0157377_10744571 3300014745 Bacteria 716
460 Ga0157379_10032105 3300014968 Bacteria 4679
461 Ga0157379_10907750 3300014968 Unclassified 836
462 Ga0157379_12536000 3300014968 Unclassified 513
463 Ga0157376_10172316 3300014969 Bacteria 1972
464 Ga0157376_10305078 3300014969 Bacteria 1508
465 Ga0157376_10392945 3300014969 Unclassified 1339
466 Ga0182007_10230636 3300015262 Bacteria 657
467 Ga0163161_10055074 3300017792 Bacteria 2887
468 Ga0163161_11876906 3300017792 Unclassified 533
469 Ga0197907_10655093 3300020069 Bacteria 1117
470 Ga0206356_11747774 3300020070 Unclassified 880
471 Ga0206353_10375004 3300020082 Unclassified 1034
472 Ga0206353_11833831 3300020082 Unclassified 517
473 Ga0213876_10006682 3300021384 Bacteria 6296
474 Ga0213876_10033566 3300021384 Bacteria 2706
475 Ga0207697_10030749 3300025315 Bacteria 2197
476 Ga0207697_10116990 3300025315 Bacteria 1145
477 Ga0207656_10689662 3300025321 Unclassified 523
478 Ga0207682_10083049 3300025893 Bacteria 1376
479 Ga0207682_10419533 3300025893 Unclassified 633
480 Ga0207642_10008793 3300025899 Bacteria 3485
481 Ga0207642_10602623 3300025899 Unclassified 684
482 Ga0207688_10252230 3300025901 Unclassified 1069
483 Ga0207688_10316769 3300025901 Unclassified 956
484 Ga0207680_10161330 3300025903 Unclassified 1503
485 Ga0207680_10714337 3300025903 Unclassified 718
486 Ga0207680_10844699 3300025903 Unclassified 656
487 Ga0207647_10187262 3300025904 Bacteria 1200
488 Ga0207685_10585387 3300025905 Bacteria 597
489 Ga0207699_10004952 3300025906 Bacteria 6368
490 Ga0207645_10014647 3300025907 Bacteria 5238
491 Ga0207645_10019830 3300025907 Bacteria 4404
492 Ga0207645_10030696 3300025907 Unclassified 3463
493 Ga0207645_10149855 3300025907 Bacteria 1522
494 Ga0207645_10276860 3300025907 Bacteria 1114
495 Ga0207643_10010411 3300025908 Bacteria 5010
496 Ga0207643_10023178 3300025908 Bacteria 3423
497 Ga0207643_10052743 3300025908 Unclassified 2310
498 Ga0207705_10620709 3300025909 Bacteria 841
499 Ga0207705_11361390 3300025909 Bacteria 541
500 Ga0207684_10143724 3300025910 Bacteria 2052
501 Ga0207684_10817661 3300025910 Bacteria 787
502 Ga0207707_10020675 3300025912 Bacteria 5748
503 Ga0207707_10022689 3300025912 Bacteria 5489
504 Ga0207707_10050164 3300025912 Bacteria 3636
505 Ga0207707_10112665 3300025912 Bacteria 2378
506 Ga0207707_10149627 3300025912 Bacteria 2041
507 Ga0207707_10166290 3300025912 Unclassified 1928
508 Ga0207707_10641026 3300025912 Unclassified 896
509 Ga0207707_10956084 3300025912 Bacteria 705
510 Ga0207695_10011163 3300025913 Bacteria 10902
511 Ga0207695_10029248 3300025913 Bacteria 6094
512 Ga0207695_10089970 3300025913 Bacteria 3086
513 Ga0207695_10122102 3300025913 Bacteria 2572
514 Ga0207695_10432906 3300025913 Bacteria 1199
515 Ga0207671_10359251 3300025914 Bacteria 1156
516 Ga0207671_10639887 3300025914 Bacteria 847
517 Ga0207671_10732865 3300025914 Bacteria 785
518 Ga0207671_10801147 3300025914 Unclassified 747
519 Ga0207693_10084841 3300025915 Bacteria 2481
520 Ga0207663_10073697 3300025916 Unclassified 2210
521 Ga0207663_10402968 3300025916 Bacteria 1046
522 Ga0207663_11477049 3300025916 Bacteria 547
523 Ga0207660_10062347 3300025917 Bacteria 2686
524 Ga0207660_10062540 3300025917 Bacteria 2682
525 Ga0207660_10140432 3300025917 Bacteria 1846
526 Ga0207660_10521964 3300025917 Unclassified 964
527 Ga0207662_10012819 3300025918 Bacteria 4676
528 Ga0207662_10023547 3300025918 Bacteria 3539
529 Ga0207662_10027667 3300025918 Bacteria 3273
530 Ga0207657_10021308 3300025919 Bacteria 6103
531 Ga0207657_10068088 3300025919 Bacteria 3025
532 Ga0207649_10050898 3300025920 Bacteria 2564
533 Ga0207649_10070909 3300025920 Bacteria 2224
534 Ga0207649_10155728 3300025920 Bacteria 1578
535 Ga0207649_10194883 3300025920 Unclassified 1427
536 Ga0207649_10606764 3300025920 Bacteria 842
537 Ga0207652_10008038 3300025921 Bacteria 8466
538 Ga0207652_10015933 3300025921 Bacteria 6126
539 Ga0207652_10028951 3300025921 Unclassified 4625
540 Ga0207652_10034546 3300025921 Bacteria 4262
541 Ga0207652_10072733 3300025921 Bacteria 2990
542 Ga0207652_10599679 3300025921 Unclassified 988
543 Ga0207652_11264950 3300025921 Unclassified 640
544 Ga0207646_10008918 3300025922 Bacteria 9988
545 Ga0207646_10706264 3300025922 Bacteria 901
546 Ga0207646_11512835 3300025922 Unclassified 581
547 Ga0207681_10206938 3300025923 Bacteria 1510
548 Ga0207681_10260734 3300025923 Bacteria 1357
549 Ga0207681_10283811 3300025923 Bacteria 1304
550 Ga0207681_10858869 3300025923 Unclassified 759
551 Ga0207681_11041801 3300025923 Bacteria 687
552 Ga0207694_10081652 3300025924 Bacteria 2540
553 Ga0207694_10161397 3300025924 Bacteria 1810
554 Ga0207694_10309540 3300025924 Unclassified 1302
555 Ga0207694_11631714 3300025924 Bacteria 543
556 Ga0207650_10316434 3300025925 Unclassified 1277
557 Ga0207650_10621842 3300025925 Bacteria 909
558 Ga0207650_10807003 3300025925 Unclassified 795
559 Ga0207650_11480009 3300025925 Unclassified 577
560 Ga0207659_10073195 3300025926 Bacteria 2508
561 Ga0207659_10299378 3300025926 Bacteria 1320
562 Ga0207659_10402909 3300025926 Bacteria 1145
563 Ga0207659_10422535 3300025926 Bacteria 1118
564 Ga0207659_10456249 3300025926 Unclassified 1077
565 Ga0207659_10806479 3300025926 Bacteria 806
566 Ga0207659_11261926 3300025926 Bacteria 635
567 Ga0207659_11275200 3300025926 Unclassified 631
568 Ga0207659_11684242 3300025926 Unclassified 540
569 Ga0207687_10010157 3300025927 Bacteria 6155
570 Ga0207687_11440456 3300025927 Unclassified 592
571 Ga0207700_10072976 3300025928 Bacteria 2648
572 Ga0207700_10165913 3300025928 Bacteria 1838
573 Ga0207700_11319219 3300025928 Bacteria 643
574 Ga0207664_10372634 3300025929 Bacteria 1266
575 Ga0207664_10721782 3300025929 Bacteria 896
576 Ga0207644_10804587 3300025931 Unclassified 786
577 Ga0207644_10881537 3300025931 Unclassified 750
578 Ga0207644_10893216 3300025931 Bacteria 745
579 Ga0207690_10007970 3300025932 Bacteria 6289
580 Ga0207690_10228320 3300025932 Bacteria 1428
581 Ga0207690_11057013 3300025932 Unclassified 676
582 Ga0207706_10008609 3300025933 Bacteria 9402
583 Ga0207706_11269644 3300025933 Bacteria 609
584 Ga0207686_10027499 3300025934 Bacteria 3332
585 Ga0207686_10253360 3300025934 Bacteria 1287
586 Ga0207686_10358929 3300025934 Bacteria 1099
587 Ga0207686_11132748 3300025934 Bacteria 639
588 Ga0207709_10032296 3300025935 Bacteria 3064
589 Ga0207709_10882383 3300025935 Unclassified 726
590 Ga0207670_10135215 3300025936 Bacteria 1811
591 Ga0207670_10662852 3300025936 Unclassified 861
592 Ga0207669_10203266 3300025937 Unclassified 1440
593 Ga0207669_10993997 3300025937 Bacteria 705
594 Ga0207704_10113223 3300025938 Bacteria 1839
595 Ga0207704_10838547 3300025938 Unclassified 770
596 Ga0207704_11240827 3300025938 Bacteria 636
597 Ga0207704_11785981 3300025938 Bacteria 529
598 Ga0207691_10000993 3300025940 Bacteria 28178
599 Ga0207691_10008846 3300025940 Bacteria 9662
600 Ga0207691_10539917 3300025940 Bacteria 989
601 Ga0207691_11026917 3300025940 Bacteria 687
602 Ga0207711_10122262 3300025941 Bacteria 2325
603 Ga0207711_10512652 3300025941 Unclassified 1118
604 Ga0207711_10799058 3300025941 Unclassified 879
605 Ga0207711_10961047 3300025941 Bacteria 793
606 Ga0207711_11182149 3300025941 Unclassified 706
607 Ga0207689_10007028 3300025942 Bacteria 9896
608 Ga0207689_10105986 3300025942 Bacteria 2309
609 Ga0207689_11559128 3300025942 Bacteria 550
610 Ga0207661_10006057 3300025944 Bacteria 8543
611 Ga0207661_10010031 3300025944 Bacteria 6806
612 Ga0207661_10012407 3300025944 Bacteria 6191
613 Ga0207661_10054270 3300025944 Bacteria 3210
614 Ga0207661_10078495 3300025944 Unclassified 2718
615 Ga0207661_10196826 3300025944 Unclassified 1770
616 Ga0207661_10272664 3300025944 Unclassified 1510
617 Ga0207661_10360497 3300025944 Bacteria 1313
618 Ga0207661_10437903 3300025944 Bacteria 1189
619 Ga0207661_11844013 3300025944 Unclassified 550
620 Ga0207679_10025407 3300025945 Bacteria 4073
621 Ga0207679_10120794 3300025945 Bacteria 2085
622 Ga0207679_10135212 3300025945 Bacteria 1984
623 Ga0207679_10195725 3300025945 Bacteria 1685
624 Ga0207679_10255312 3300025945 Bacteria 1492
625 Ga0207679_10365512 3300025945 Bacteria 1261
626 Ga0207679_10463011 3300025945 Bacteria 1126
627 Ga0207679_10475709 3300025945 Bacteria 1111
628 Ga0207679_10587042 3300025945 Bacteria 1003
629 Ga0207679_10651915 3300025945 Unclassified 952
630 Ga0207679_11162024 3300025945 Unclassified 708
631 Ga0207667_10052014 3300025949 Bacteria 4316
632 Ga0207667_10390054 3300025949 Bacteria 1418
633 Ga0207667_10835008 3300025949 Bacteria 916
634 Ga0207667_11163151 3300025949 Bacteria 752
635 Ga0207651_10112223 3300025960 Bacteria 2049
636 Ga0207651_10334214 3300025960 Unclassified 1271
637 Ga0207651_10395562 3300025960 Bacteria 1174
638 Ga0207651_10461657 3300025960 Bacteria 1091
639 Ga0207651_10858275 3300025960 Unclassified 807
640 Ga0207651_10991138 3300025960 Bacteria 751
641 Ga0207651_11008852 3300025960 Bacteria 744
642 Ga0207712_10028452 3300025961 Bacteria 3739
643 Ga0207712_11307658 3300025961 Unclassified 648
644 Ga0207668_10028938 3300025972 Bacteria 3627
645 Ga0207668_10272698 3300025972 Bacteria 1384
646 Ga0207668_11331823 3300025972 Unclassified 647
647 Ga0207668_11889968 3300025972 Bacteria 538
648 Ga0207640_10475260 3300025981 Unclassified 1035
649 Ga0207640_10617047 3300025981 Bacteria 920
650 Ga0207658_10181906 3300025986 Bacteria 1740
651 Ga0207658_10361502 3300025986 Bacteria 1267
652 Ga0207658_10436627 3300025986 Unclassified 1157
653 Ga0207658_10558676 3300025986 Bacteria 1025
654 Ga0207658_11007285 3300025986 Unclassified 760
655 Ga0207677_10178216 3300026023 Unclassified 1669
656 Ga0207677_10269601 3300026023 Bacteria 1392
657 Ga0207677_10693450 3300026023 Bacteria 903
658 Ga0207677_10895031 3300026023 Bacteria 800
659 Ga0207677_11440882 3300026023 Unclassified 635
660 Ga0207677_12078095 3300026023 Unclassified 528
661 Ga0207703_10336769 3300026035 Bacteria 1385
662 Ga0207703_10431989 3300026035 Bacteria 1227
663 Ga0207703_12321950 3300026035 Unclassified 512
664 Ga0207639_10007860 3300026041 Bacteria 7285
665 Ga0207639_12071353 3300026041 Bacteria 530
666 Ga0207678_10170140 3300026067 Unclassified 1860
667 Ga0207678_10331225 3300026067 Bacteria 1311
668 Ga0207678_10406910 3300026067 Bacteria 1179
669 Ga0207678_10906983 3300026067 Unclassified 779
670 Ga0207708_10024989 3300026075 Bacteria 4518
671 Ga0207708_10829204 3300026075 Unclassified 797
672 Ga0207702_10017046 3300026078 Bacteria 6009
673 Ga0207702_10136380 3300026078 Bacteria 2215
674 Ga0207702_10230289 3300026078 Bacteria 1731
675 Ga0207702_10310465 3300026078 Unclassified 1499
676 Ga0207641_10122111 3300026088 Unclassified 2326
677 Ga0207641_10609981 3300026088 Bacteria 1069
678 Ga0207641_10892904 3300026088 Unclassified 882
679 Ga0207641_11061739 3300026088 Bacteria 808
680 Ga0207641_12441521 3300026088 Bacteria 521
681 Ga0207648_10045314 3300026089 Bacteria 3858
682 Ga0207648_10053286 3300026089 Bacteria 3536
683 Ga0207648_10090847 3300026089 Bacteria 2669
684 Ga0207648_10131749 3300026089 Bacteria 2201
685 Ga0207648_10511633 3300026089 Bacteria 1099
686 Ga0207676_10058105 3300026095 Unclassified 3049
687 Ga0207676_10261186 3300026095 Bacteria 1564
688 Ga0207676_10321196 3300026095 Bacteria 1421
689 Ga0207676_10787166 3300026095 Bacteria 927
690 Ga0207676_10928973 3300026095 Bacteria 855
691 Ga0207674_10000013 3300026116 Bacteria 187953
692 Ga0207674_10001053 3300026116 Bacteria 35954
693 Ga0207674_10028497 3300026116 Bacteria 5894
694 Ga0207674_10320692 3300026116 Bacteria 1499
695 Ga0207674_10333193 3300026116 Unclassified 1467
696 Ga0207674_12189313 3300026116 Bacteria 516
697 Ga0207675_100000916 3300026118 Bacteria 29421
698 Ga0207683_10038750 3300026121 Unclassified 4156
699 Ga0207683_10355646 3300026121 Bacteria 1345
700 Ga0207683_10614886 3300026121 Unclassified 1006
701 Ga0207698_10011010 3300026142 Bacteria 5847
702 Ga0207698_10104131 3300026142 Bacteria 2360
703 Ga0207698_10274236 3300026142 Bacteria 1556
704 Ga0207698_10437101 3300026142 Bacteria 1260
705 Ga0207698_11544183 3300026142 Bacteria 679
706 Ga0207428_10930687 3300027907 Archaea 613
707 Ga0268266_10071820 3300028379 Bacteria 3000
708 Ga0268266_10172335 3300028379 Bacteria 1965
709 Ga0268266_10714688 3300028379 Unclassified 966
710 Ga0268266_11379010 3300028379 Bacteria 680
711 Ga0268266_11752164 3300028379 Bacteria 596
712 Ga0268265_10063309 3300028380 Bacteria 2845
713 Ga0268265_10074959 3300028380 Bacteria 2649
714 Ga0268265_10075700 3300028380 Bacteria 2638
715 Ga0268265_10231102 3300028380 Bacteria 1625
716 Ga0268265_11188453 3300028380 Bacteria 760
717 Ga0268264_10030491 3300028381 Bacteria 4420
718 Ga0268264_10069562 3300028381 Bacteria 2977
719 Ga0268264_10977741 3300028381 Unclassified 852
720 Ga0307517_10355728 3300028786 Unclassified 793
721 Ga0265327_10000417 3300031251 Bacteria 77684
722 Ga0307408_100023128 3300031548 Bacteria 4230
723 Ga0307408_100168886 3300031548 Bacteria 1745
724 Ga0307408_100184099 3300031548 Bacteria 1677
725 Ga0307408_101107252 3300031548 Bacteria 735
726 Ga0307408_101268689 3300031548 Bacteria 689
727 Ga0307405_10017765 3300031731 Bacteria 3910
728 Ga0307405_10026406 3300031731 Bacteria 3349
729 Ga0307405_10188069 3300031731 Bacteria 1489
730 Ga0307405_10282416 3300031731 Bacteria 1250
731 Ga0307413_10002909 3300031824 Bacteria 7073
732 Ga0307413_10044787 3300031824 Bacteria 2618
733 Ga0307413_10112475 3300031824 Bacteria 1825
734 Ga0307413_10245812 3300031824 Bacteria 1324
735 Ga0307410_10012158 3300031852 Bacteria 4961
736 Ga0307410_10058425 3300031852 Bacteria 2630
737 Ga0307410_10081840 3300031852 Bacteria 2269
738 Ga0307410_10556128 3300031852 Bacteria 951
739 Ga0307406_10008103 3300031901 Bacteria 5854
740 Ga0307406_10034757 3300031901 Bacteria 3094
741 Ga0307406_10091966 3300031901 Bacteria 2044
742 Ga0307406_10106793 3300031901 Bacteria 1918
743 Ga0307406_10111813 3300031901 Bacteria 1882
744 Ga0307406_10700911 3300031901 Bacteria 845
745 Ga0307406_11681358 3300031901 Bacteria 562
746 Ga0307406_11738179 3300031901 Bacteria 553
747 Ga0307407_10001830 3300031903 Bacteria 7984
748 Ga0307407_10005355 3300031903 Bacteria 5559
749 Ga0307407_10262957 3300031903 Bacteria 1187
750 Ga0307407_10333232 3300031903 Bacteria 1069
751 Ga0307412_10029895 3300031911 Bacteria 3423
752 Ga0307412_10091095 3300031911 Bacteria 2133
753 Ga0307412_10145084 3300031911 Bacteria 1743
754 Ga0307409_100006457 3300031995 Bacteria 6893
755 Ga0307409_100027198 3300031995 Bacteria 4049
756 Ga0307409_100148750 3300031995 Bacteria 2030
757 Ga0307409_100389823 3300031995 Bacteria 1327
758 Ga0307409_100641638 3300031995 Bacteria 1055
759 Ga0307409_100645558 3300031995 Bacteria 1051
760 Ga0307409_100790838 3300031995 Bacteria 955
761 Ga0307409_101315580 3300031995 Bacteria 748
762 Ga0307416_100010847 3300032002 Bacteria 6042
763 Ga0307416_100042663 3300032002 Bacteria 3543
764 Ga0307416_100129701 3300032002 Bacteria 2267
765 Ga0307416_100193234 3300032002 Bacteria 1922
766 Ga0307416_100332267 3300032002 Bacteria 1528
767 Ga0307416_100600339 3300032002 Bacteria 1180
768 Ga0307416_100737464 3300032002 Bacteria 1077
769 Ga0307416_101534195 3300032002 Bacteria 772
770 Ga0307416_101757855 3300032002 Bacteria 724
771 Ga0307416_103251021 3300032002 Bacteria 544
772 Ga0307414_10005676 3300032004 Bacteria 6887
773 Ga0307414_10064436 3300032004 Bacteria 2609
774 Ga0307414_10194962 3300032004 Bacteria 1642
775 Ga0307414_10459080 3300032004 Bacteria 1119
776 Ga0307414_11308814 3300032004 Bacteria 672
777 Ga0307411_10011782 3300032005 Bacteria 4737
778 Ga0307411_10112641 3300032005 Bacteria 1950
779 Ga0307411_10225621 3300032005 Bacteria 1456
780 Ga0307411_10533789 3300032005 Bacteria 998
781 Ga0307415_100006699 3300032126 Bacteria 6238
782 Ga0307415_100126416 3300032126 Bacteria 1927
783 Ga0307415_100186830 3300032126 Bacteria 1631
784 Ga0307415_100237829 3300032126 Bacteria 1471
785 Ga0307415_100736785 3300032126 Bacteria 893
786 Ga0373958_0120301 3300034819 Bacteria 634
787 Ga0373959_0091092 3300034820 Unclassified 715
788 Ga0373926_0085051 3300035083 Bacteria 1173
789 Ga0373934_0000693 3300035086 Bacteria 11997
790 Ga0373934_0014355 3300035086 Bacteria 3001
791 Ga0373934_0074031 3300035086 Bacteria 1364
792 Ga0373949_0227228 3300035090 Bacteria 569
793 Ga0373945_0120387 3300035116 Bacteria 1043
794 Ga0373956_0023066 3300035119 Bacteria 2668
795 Ga0373956_0353497 3300035119 Bacteria 700
796 Ga0373957_0036561 3300035120 Unclassified 1830
797 Ga0373957_0071737 3300035120 Unclassified 1356
798 Ga0373957_0148206 3300035120 Bacteria 962
799 Ga0373943_0101115 3300035170 Bacteria 1508
800 Ga0373943_0395781 3300035170 Bacteria 797
801 Ga0373946_0245446 3300035171 Bacteria 872
802 Ga0373955_0020564 3300035172 Bacteria 3320
803 Ga0373955_0071215 3300035172 Bacteria 1944
804 Ga0373955_0124229 3300035172 Bacteria 1502
805 Ga0373955_0154570 3300035172 Unclassified 1351
806 Ga0373961_0372133 3300035241 Unclassified 543
807 Ga0373924_0374079 3300035410 Unclassified 636
808 Ga0373924_0419291 3300035410 Unclassified 599
809 Ga0373935_0788704 3300035692 Bacteria 701
810 Ga0373935_1133566 3300035692 Unclassified 582
811 Ga0373927_0002136 3300035695 Bacteria 14539
812 Ga0373927_0002804 3300035695 Bacteria 12725
813 Ga0373927_0009049 3300035695 Bacteria 6685
814 Ga0373927_0260678 3300035695 Bacteria 1140
815 Ga0373927_0874754 3300035695 Unclassified 593
816 Ga0373933_0004678 3300035724 Bacteria 7496
817 Ga0373933_0027897 3300035724 Unclassified 3255
818 Ga0373933_0274267 3300035724 Bacteria 1089
819 Ga0373933_0310752 3300035724 Bacteria 1021
820 Ga0373933_0900352 3300035724 Bacteria 582
821 Ga0373947_0086982 3300035725 Bacteria 1943
822 Ga0373947_0153410 3300035725 Bacteria 1485
823 Ga0373947_0438522 3300035725 Bacteria 884
824 Ga0373937_0019193 3300036401 Bacteria 6121
825 Ga0373937_0031746 3300036401 Bacteria 4787
826 Ga0373937_0109180 3300036401 Bacteria 2572
827 Ga0373937_0204639 3300036401 Bacteria 1856
828 Ga0373937_0939526 3300036401 Unclassified 813
829 Ga0373937_1894339 3300036401 Unclassified 542
830 Ga0373925_0022816 3300037068 Unclassified 4567
831 Ga0373925_0379767 3300037068 Bacteria 1150
832 Ga0373925_1605596 3300037068 Unclassified 531
833 Ga0395900_1282445 3300037418 Unclassified 647
834 Ga0395905_0284097 3300037471 Bacteria 1541
835 Ga0395905_1089935 3300037471 Bacteria 702
836 Ga0395901_1840426 3300038443 Unclassified 554
837 Ga0436365_0391692 3300039437 Bacteria 35650
838 Ga0436365_0740200 3300039437 Bacteria 2892
839 Ga0439453_0142002 3300041408 Bacteria 565
840 Ga0439462_0177247 3300042015 Bacteria 604
841 Ga0450923_033705 3300042125 Bacteria 1054
842 Ga0439464_0104162 3300042439 Bacteria 864
843 Ga0466964_0091616 3300044706 Unclassified 1324
844 Ga0451576_0296476 3300045051 Bacteria 1691
845 Ga0451576_0794957 3300045051 Bacteria 993
846 Ga0466958_0053764 3300045836 Unclassified 2442
847 Ga0466958_0086719 3300045836 Bacteria 1932
848 Ga0466967_0015550 3300045976 Bacteria 5968
849 Ga0466967_0015954 3300045976 Bacteria 5907
850 Ga0466967_0306125 3300045976 Bacteria 1530
851 Ga0495592_0101740 3300046454 Bacteria 2047
852 Ga0495592_0142433 3300046454 Unclassified 1666
853 Ga0495592_0484116 3300046454 Bacteria 770
854 Ga0495603_0841087 3300046455 Bacteria 523
855 Ga0495629_0137216 3300046459 Bacteria 1703
856 Ga0495651_0032941 3300046462 Unclassified 4041
857 Ga0495651_0050540 3300046462 Unclassified 3207
858 Ga0495651_0092926 3300046462 Bacteria 2259
859 Ga0495651_0105009 3300046462 Bacteria 2096
860 Ga0495653_0008699 3300046463 Bacteria 8316
861 Ga0495580_0049945 3300046472 Bacteria 2958
862 Ga0495580_0065713 3300046472 Bacteria 2540
863 Ga0495580_0097349 3300046472 Bacteria 2046
864 Ga0495580_0499133 3300046472 Unclassified 812
865 Ga0495582_0055303 3300046473 Unclassified 2188
866 Ga0495582_0367745 3300046473 Bacteria 828
867 Ga0495582_0620880 3300046473 Unclassified 625
868 Ga0495639_0042348 3300046475 Unclassified 2053
869 Ga0495639_0493225 3300046475 Bacteria 625
870 Ga0495639_0602578 3300046475 Unclassified 565
871 Ga0495662_0103835 3300046476 Bacteria 1391
872 Ga0495662_0540021 3300046476 Bacteria 571
873 Ga0495664_0018786 3300046477 Unclassified 3966
874 Ga0495664_0057551 3300046477 Bacteria 2313
875 Ga0495594_0002111 3300046499 Bacteria 10351
876 Ga0495594_0003138 3300046499 Bacteria 8546
877 Ga0495594_0007113 3300046499 Bacteria 5756
878 Ga0495594_0021108 3300046499 Unclassified 3475
879 Ga0495594_0030492 3300046499 Bacteria 2919
880 Ga0495594_0040576 3300046499 Bacteria 2547
881 Ga0495594_0322006 3300046499 Unclassified 881
882 Ga0495594_0400132 3300046499 Unclassified 781
883 Ga0495608_0016154 3300046511 Bacteria 5163
884 Ga0495608_0051283 3300046511 Bacteria 2734
885 Ga0495608_0071918 3300046511 Unclassified 2256
886 Ga0495618_0022896 3300046514 Bacteria 3860
887 Ga0495618_0164369 3300046514 Bacteria 1414
888 Ga0495628_0012776 3300046516 Bacteria 7069
889 Ga0495628_0095796 3300046516 Bacteria 2293
890 Ga0495628_0099739 3300046516 Bacteria 2242
891 Ga0495628_0202919 3300046516 Unclassified 1493
892 Ga0495628_0288861 3300046516 Unclassified 1216
893 Ga0495628_0467717 3300046516 Unclassified 914
894 Ga0495630_0120856 3300046517 Bacteria 1987
895 Ga0495630_0185393 3300046517 Bacteria 1587
896 Ga0495630_0243951 3300046517 Bacteria 1372
897 Ga0495652_0017461 3300046529 Bacteria 6401
898 Ga0495652_0045302 3300046529 Bacteria 3783
899 Ga0495652_0059988 3300046529 Unclassified 3217
900 Ga0495652_0155228 3300046529 Bacteria 1783
901 Ga0495665_0082335 3300046531 Bacteria 1692
902 Ga0495665_0218399 3300046531 Archaea 986
903 Ga0495665_0301535 3300046531 Unclassified 820
904 Ga0495640_0034623 3300046533 Bacteria 3578
905 Ga0495640_0111570 3300046533 Bacteria 1787
906 Ga0495640_0311189 3300046533 Bacteria 977
907 Ga0495640_0718498 3300046533 Unclassified 599
908 Ga0495586_0002607 3300046535 Bacteria 9752
909 Ga0495586_0003673 3300046535 Bacteria 8233
910 Ga0495586_0026076 3300046535 Bacteria 3127
911 Ga0495586_0069985 3300046535 Bacteria 1916
912 Ga0495586_0110555 3300046535 Bacteria 1529
913 Ga0495587_0007008 3300046536 Bacteria 7319
914 Ga0495587_0014065 3300046536 Bacteria 5025
915 Ga0495587_0135076 3300046536 Unclassified 1409
916 Ga0495645_0017377 3300046543 Bacteria 5152
917 Ga0495645_0019056 3300046543 Bacteria 4939
918 Ga0495645_0110736 3300046543 Unclassified 1943
919 Ga0495645_0128299 3300046543 Bacteria 1780
920 Ga0495645_0350342 3300046543 Bacteria 951
921 Ga0495645_0653435 3300046543 Bacteria 642
922 Ga0495645_0673844 3300046543 Bacteria 630
923 Ga0495667_0010503 3300046559 Bacteria 6266
924 Ga0495667_0011332 3300046559 Bacteria 6036
925 Ga0495667_0011632 3300046559 Bacteria 5958
926 Ga0495667_0016270 3300046559 Bacteria 5024
927 Ga0495667_0046770 3300046559 Unclassified 2860
928 Ga0495667_0070938 3300046559 Bacteria 2273
929 Ga0495634_0066592 3300046642 Bacteria 2384
930 Ga0495634_0271359 3300046642 Bacteria 1032
931 Ga0495635_0082292 3300046663 Bacteria 2203
932 Ga0495635_0193480 3300046663 Bacteria 1380
933 Ga0495635_0326867 3300046663 Unclassified 1026
934 Ga0495588_0013485 3300046674 Bacteria 3896
935 Ga0495588_0245743 3300046674 Unclassified 944
936 Ga0495588_0322660 3300046674 Bacteria 812
937 Ga0495657_0140617 3300046675 Bacteria 1505
938 Ga0495657_0151321 3300046675 Bacteria 1441
939 Ga0495657_0195518 3300046675 Bacteria 1234
940 Ga0495599_0022026 3300046678 Bacteria 3977
941 Ga0495599_0022949 3300046678 Bacteria 3897
942 Ga0495599_0094589 3300046678 Unclassified 1864
943 Ga0495599_0114445 3300046678 Bacteria 1678
944 Ga0495599_0248930 3300046678 Bacteria 1082
945 Ga0495623_0001340 3300046679 Bacteria 16707
946 Ga0495623_0016577 3300046679 Unclassified 4759
947 Ga0495623_0032108 3300046679 Unclassified 3375
948 Ga0495623_0067078 3300046679 Bacteria 2240
949 Ga0495623_0107879 3300046679 Bacteria 1690
950 Ga0495646_0016575 3300046680 Bacteria 4678
951 Ga0495646_0232195 3300046680 Bacteria 994
952 Ga0495646_0353858 3300046680 Bacteria 769
953 Ga0495646_0365894 3300046680 Unclassified 753
954 Ga0495658_0155846 3300046683 Bacteria 1406
955 Ga0495658_0354087 3300046683 Unclassified 933
956 Ga0495613_0169348 3300046689 Bacteria 1551
957 Ga0495613_0311500 3300046689 Bacteria 1088
958 Ga0495613_0443269 3300046689 Bacteria 880
959 Ga0495613_1067774 3300046689 Bacteria 516
960 Ga0495624_0077647 3300046690 Bacteria 2060
961 Ga0495624_0857423 3300046690 Bacteria 536
962 Ga0495600_0045967 3300046809 Unclassified 2849
963 Ga0495600_0066206 3300046809 Bacteria 2362
964 Ga0495600_0121104 3300046809 Bacteria 1702
965 Ga0495600_0264602 3300046809 Bacteria 1092
966 Ga0495600_0685060 3300046809 Bacteria 617
967 Ga0495581_0034852 3300047315 Bacteria 2912
968 Ga0495604_0019224 3300047317 Bacteria 5470
969 Ga0495604_0090315 3300047317 Bacteria 2275
970 Ga0495604_0310235 3300047317 Bacteria 1057
971 Ga0495636_0251815 3300047318 Bacteria 817
972 Ga0495636_0335513 3300047318 Bacteria 712
973 Ga0495636_0496547 3300047318 Unclassified 590
974 Ga0495674_0048461 3300047319 Bacteria 3760
975 Ga0495674_0060307 3300047319 Unclassified 3311
976 Ga0495674_1045626 3300047319 Bacteria 624
977 Ga0495680_0011219 3300047322 Bacteria 7957
978 Ga0495680_0734280 3300047322 Bacteria 649
979 Ga0495675_0014738 3300047444 Bacteria 4941
980 Ga0495675_0027932 3300047444 Bacteria 3596
981 Ga0495675_0028626 3300047444 Unclassified 3552
982 Ga0495675_0509801 3300047444 Bacteria 690
983 Ga0495684_0004115 3300047471 Bacteria 11360
984 Ga0495684_0004429 3300047471 Bacteria 10979
985 Ga0495684_0012968 3300047471 Bacteria 6434
986 Ga0495684_0046837 3300047471 Bacteria 3308
987 Ga0495684_0047964 3300047471 Unclassified 3266
988 Ga0495684_0197889 3300047471 Bacteria 1482
989 Ga0495684_0272059 3300047471 Bacteria 1225
990 Ga0495593_0126688 3300047673 Bacteria 1298
991 Ga0495593_0261273 3300047673 Unclassified 867
992 Ga0495593_0275296 3300047673 Bacteria 842
993 Ga0495602_0046845 3300048088 Bacteria 3901
994 Ga0495602_0108628 3300048088 Bacteria 2258
995 Ga0495602_0369474 3300048088 Bacteria 1030
996 Ga0495602_1169124 3300048088 Bacteria 502
997 Ga0495615_0097342 3300048090 Unclassified 827
998 Ga0496102_0712941 3300048905 Bacteria 926
999 Ga0496104_0241732 3300048907 Bacteria 1718
1000 Ga0496105_0104183 3300048908 Bacteria 2343
1001 Ga0496106_0381126 3300048909 Bacteria 1133
1002 Ga0496109_1277460 3300048912 Bacteria 670
1003 Ga0496109_1766021 3300048912 Bacteria 552
1004 Ga0496115_0957051 3300048918 Unclassified 657
1005 Ga0501034_0266506 3300049571 Bacteria 1655
1006 Ga0501037_0400299 3300049573 Bacteria 942
1007 Ga0501038_0235621 3300049574 Unclassified 1455
1008 Ga0501067_0383276 3300049583 Unclassified 784
1009 Ga0501073_0141971 3300049589 Bacteria 1664
1010 Ga0501235_100968 3300049669 Bacteria 705
1011 Ga0501235_221544 3300049669 Bacteria 519
1012 Ga0501239_080069 3300049672 Bacteria 522
1013 Ga0501250_057742 3300049680 Bacteria 612
1014 Ga0501260_010059 3300049689 Bacteria 946
1015 Ga0501260_036440 3300049689 Unclassified 584
1016 Ga0501221_232328 3300049704 Bacteria 524
1017 Ga0501245_145725 3300049708 Bacteria 519
1018 Ga0501268_018978 3300049765 Bacteria 1161
1019 Ga0501268_061754 3300049765 Bacteria 744
1020 Ga0501272_051019 3300049769 Bacteria 574
1021 Ga0501035_0290799 3300049822 Bacteria 1379
1022 Ga0501044_0304459 3300049823 Bacteria 1522
1023 Ga0501204_084766 3300049850 Bacteria 544
1024 nmdc:mga05p37_278768_c1 3300050507 Bacteria 1994
1025 nmdc:mga05p37_58074_c1 3300050507 Unclassified 4765
1026 nmdc:mga05p37_63592_c1 3300050507 Bacteria 4541
1027 nmdc:mga05p37_849005_c1 3300050507 Bacteria 992
1028 nmdc:mga09592_11306_c1 3300050508 Bacteria 7261
1029 nmdc:mga09592_61292_c1 3300050508 Bacteria 3182
1030 nmdc:mga0qj67_111215_c1 3300050509 Bacteria 2212
1031 nmdc:mga0qj67_20802_c1 3300050509 Bacteria 5025
1032 nmdc:mga0qj67_319746_c1 3300050509 Bacteria 1256
1033 nmdc:mga0qj67_578242_c1 3300050509 Bacteria 900
1034 nmdc:mga0qj67_78655_c1 3300050509 Bacteria 2640
1035 nmdc:mga06r32_1423218_c1 3300050510 Unclassified 635
1036 nmdc:mga06r32_172320_c1 3300050510 Bacteria 2148
1037 nmdc:mga06r32_1911043_c1 3300050510 Bacteria 528
1038 nmdc:mga06r32_503198_c1 3300050510 Bacteria 1188
1039 nmdc:mga06r32_789967_c1 3300050510 Bacteria 910
1040 nmdc:mga06r32_873600_c1 3300050510 Unclassified 857
1041 nmdc:mga08y16_1514781_c1 3300050511 Archaea 631
1042 nmdc:mga08y16_1925415_c1 3300050511 Bacteria 542
1043 nmdc:mga08y16_277190_c1 3300050511 Bacteria 1730
1044 nmdc:mga08y16_341183_c1 3300050511 Unclassified 1540
1045 nmdc:mga08y16_502688_c1 3300050511 Unclassified 1231
1046 nmdc:mga0n895_308922_c1 3300050512 Bacteria 1603
1047 nmdc:mga0n895_657487_c1 3300050512 Bacteria 1046
1048 nmdc:mga0n895_673_c1 3300050512 Bacteria 23978
1049 nmdc:mga0n895_890078_c1 3300050512 Unclassified 876
1050 nmdc:mga0n895_994680_c1 3300050512 Unclassified 820
1051 nmdc:mga0rr50_552261_c1 3300050513 Bacteria 981
1052 nmdc:mga08x19_25845_c1 3300050514 Bacteria 3661
1053 nmdc:mga0a205_27340_c1 3300050515 Bacteria 5448
1054 nmdc:mga0a205_76155_c1 3300050515 Unclassified 3242
1055 nmdc:mga0a205_828197_c1 3300050515 Unclassified 773
1056 Ga0495601_0071527 3300053077 Unclassified 2215
1057 Ga0495601_0503700 3300053077 Bacteria 781
1058 Ga0495601_0515543 3300053077 Bacteria 771
1059 Ga0495612_0143373 3300053078 Bacteria 1037
1060 Ga0495595_0050155 3300053084 Unclassified 1932
1061 Ga0495619_0072498 3300053085 Unclassified 2307
1062 Ga0495619_0510853 3300053085 Bacteria 826
1063 Ga0495619_1053432 3300053085 Bacteria 542
1064 Ga0590071_033301 3300059421 Unclassified 1231
1065 Ga0590075_027330 3300059424 Unclassified 1439
1066 Ga0590077_058019 3300059426 Unclassified 875
1067 Ga0105240_10041235
1068 JGI24750J21931_1087383
1069 JGI25406J46586_10028329
1070 Ga0065712_10361323
1071 Ga0065715_10136937
1072 Ga0065707_10018243
1073 Ga0065707_10412262
1074 Ga0070658_10119638
1075 Ga0070658_10794887
1076 Ga0070676_10091341
1077 Ga0070676_10162634
1078 Ga0070676_10395633
1079 Ga0070676_10402075
1080 Ga0070676_10874771
1081 Ga0070683_100133012
1082 Ga0070683_100288308
1083 Ga0070683_100311815
1084 Ga0070683_100420309
1085 Ga0070683_100442523
1086 Ga0070683_100530045
1087 Ga0070683_100643021
1088 Ga0070683_100751286
1089 Ga0070683_101709683
1090 Ga0070690_100013382
1091 Ga0070690_100086975
1092 Ga0070690_100313332
1093 Ga0070670_100000904
1094 Ga0070670_100033628
1095 Ga0070670_100719117
1096 Ga0070670_101307990
1097 Ga0070677_10111652
1098 Ga0070677_10316509
1099 Ga0070677_10561652
1100 Ga0070677_10613889
1101 Ga0070677_10904215
1102 Ga0068869_100087372
1103 Ga0068869_100126608
1104 Ga0068869_100763969
1105 Ga0068869_101931419
1106 Ga0070666_10139238
1107 Ga0070666_10181892
1108 Ga0070666_10325538
1109 Ga0070666_10368512
1110 Ga0070680_100039609
1111 Ga0070680_100060834
1112 Ga0070680_100990621
1113 Ga0070682_100021644
1114 Ga0068868_100125071
1115 Ga0068868_100180363
1116 Ga0068868_100211794
1117 Ga0068868_100314694
1118 Ga0068868_100497714
1119 Ga0068868_100898620
1120 Ga0070660_100222707
1121 Ga0070660_100384453
1122 Ga0070660_100628258
1123 Ga0070689_100031910
1124 Ga0070689_100042977
1125 Ga0070689_100045520
1126 Ga0070689_100963988
1127 Ga0070691_10045887
1128 Ga0070691_10547305
1129 Ga0070687_100016310
1130 Ga0070687_100044352
1131 Ga0070687_100164469
1132 Ga0070687_100794241
1133 Ga0070661_100007805
1134 Ga0070661_100042506
1135 Ga0070661_100228822
1136 Ga0070661_100271959
1137 Ga0070661_100679920
1138 Ga0070661_100991182
1139 Ga0070661_101190432
1140 Ga0070661_101639791
1141 Ga0070692_10732475
1142 Ga0070668_100047236
1143 Ga0070668_100052685
1144 Ga0070668_100888955
1145 Ga0070668_101958800
1146 Ga0070669_100423683
1147 Ga0070669_100500613
1148 Ga0070669_100675041
1149 Ga0070675_100053005
1150 Ga0070675_100156430
1151 Ga0070675_100182582
1152 Ga0070675_100211350
1153 Ga0070675_100231192
1154 Ga0070675_100364585
1155 Ga0070675_100691565
1156 Ga0070675_100706882
1157 Ga0070675_100799960
1158 Ga0070675_101280675
1159 Ga0070675_102185044
1160 Ga0070671_100210096
1161 Ga0070671_100430753
1162 Ga0070671_100534020
1163 Ga0070671_101072630
1164 Ga0070674_100967953
1165 Ga0070674_101483806
1166 Ga0070674_101640313
1167 Ga0070673_100024240
1168 Ga0070673_100071192
1169 Ga0070673_100099714
1170 Ga0070673_100295104
1171 Ga0070673_100384080
1172 Ga0070673_102153318
1173 Ga0070688_100010552
1174 Ga0070688_100075181
1175 Ga0070688_100186644
1176 Ga0070688_100937831
1177 Ga0070659_100019223
1178 Ga0070659_100026628
1179 Ga0070659_100284441
1180 Ga0070667_100011181
1181 Ga0070667_100013813
1182 Ga0070667_100041948
1183 Ga0070667_100171648
1184 Ga0070667_100501825
1185 Ga0070667_101224458
1186 Ga0070714_100013853
1187 Ga0070713_100011136
1188 Ga0070713_100028372
1189 Ga0070713_100101564
1190 Ga0070701_10016785
1191 Ga0070711_100032327
1192 Ga0070711_100033209
1193 Ga0070711_100817982
1194 Ga0070711_100850546
1195 Ga0070711_101108908
1196 Ga0070705_100027468
1197 Ga0070705_100143614
1198 Ga0070705_100499514
1199 Ga0070705_101347664
1200 Ga0070700_100220696
1201 Ga0070700_100751143
1202 Ga0070700_101106530
1203 Ga0070694_100024296
1204 Ga0070694_100093006
1205 Ga0070708_102042697
1206 Ga0070663_100057117
1207 Ga0070663_100988795
1208 Ga0070663_101290171
1209 Ga0070678_101231644
1210 Ga0070678_101249168
1211 Ga0070662_100017082
1212 Ga0070662_100019646
1213 Ga0070681_10001603
1214 Ga0070681_10002295
1215 Ga0070681_10008854
1216 Ga0070681_10026191
1217 Ga0070681_10097887
1218 Ga0070681_10158889
1219 Ga0070681_10172772
1220 Ga0070681_10389505
1221 Ga0070681_10428619
1222 Ga0070681_10860457
1223 Ga0070681_11261192
1224 Ga0070681_11453147
1225 Ga0068867_100012151
1226 Ga0068867_100065455
1227 Ga0068867_100206350
1228 Ga0068867_100319396
1229 Ga0068867_100459748
1230 Ga0068867_100516008
1231 Ga0068867_101370975
1232 Ga0070685_10015127
1233 Ga0070685_10042176
1234 Ga0070706_100417470
1235 Ga0070707_100005834
1236 Ga0070707_100881402
1237 Ga0070707_101947140
1238 Ga0070698_100060264
1239 Ga0070698_100122601
1240 Ga0070698_100236108
1241 Ga0070698_100534041
1242 Ga0070699_100000057
1243 Ga0070699_100047236
1244 Ga0070679_100001128
1245 Ga0070679_100003527
1246 Ga0070679_100005952
1247 Ga0070679_100006736
1248 Ga0070679_100123913
1249 Ga0070679_100568866
1250 Ga0070679_100573956
1251 Ga0070684_100003829
1252 Ga0070684_100031684
1253 Ga0070684_100132976
1254 Ga0070684_100193515
1255 Ga0070684_100249484
1256 Ga0070684_100276353
1257 Ga0070684_100948056
1258 Ga0070684_102071630
1259 Ga0068853_100074174
1260 Ga0068853_100085519
1261 Ga0068853_100305564
1262 Ga0068853_100357474
1263 Ga0070672_100049941
1264 Ga0070672_100198883
1265 Ga0070672_100405143
1266 Ga0070672_100564049
1267 Ga0070672_101149723
1268 Ga0070672_101485028
1269 Ga0070686_100047813
1270 Ga0070686_100888045
1271 Ga0070696_100541395
1272 Ga0070696_101717108
1273 Ga0070693_100002524
1274 Ga0070693_100084545
1275 Ga0070693_100988608
1276 Ga0070665_100061474
1277 Ga0070665_100334146
1278 Ga0070665_100711042
1279 Ga0070665_100773766
1280 Ga0070665_101313989
1281 Ga0070704_100000531
1282 Ga0070704_100178157
1283 Ga0068855_100062475
1284 Ga0068855_100088006
1285 Ga0068855_100177426
1286 Ga0068855_100695592
1287 Ga0068855_100821581
1288 Ga0068855_102274887
1289 Ga0070664_100020551
1290 Ga0070664_100031885
1291 Ga0070664_100065824
1292 Ga0070664_100146632
1293 Ga0070664_100191620
1294 Ga0070664_100221105
1295 Ga0070664_100242055
1296 Ga0070664_100769764
1297 Ga0070664_100920572
1298 Ga0068857_100021861
1299 Ga0068857_100084177
1300 Ga0068857_100270577
1301 Ga0068857_100286195
1302 Ga0068857_100404595
1303 Ga0068857_100409478
1304 Ga0068854_100033476
1305 Ga0068854_100056047
1306 Ga0068854_101098127
1307 Ga0068856_100016757
1308 Ga0068856_100251183
1309 Ga0068856_100288855
1310 Ga0068856_100555179
1311 Ga0068856_100642779
1312 Ga0068856_101378737
1313 Ga0068856_101626486
1314 Ga0070702_100023240
1315 Ga0070702_100569234
1316 Ga0070702_100943677
1317 Ga0068852_100062994
1318 Ga0068852_100088266
1319 Ga0068852_100107430
1320 Ga0068852_100129472
1321 Ga0068852_100207321
1322 Ga0068852_100343675
1323 Ga0068852_100367435
1324 Ga0068852_101132556
1325 Ga0068859_100017193
1326 Ga0068859_100040659
1327 Ga0068859_100093556
1328 Ga0068859_100174045
1329 Ga0068864_100006515
1330 Ga0068864_100413405
1331 Ga0068864_101935185
1332 Ga0068866_10181416
1333 Ga0068866_10327437
1334 Ga0068861_100007581
1335 Ga0068851_10407791
1336 Ga0068870_10042309
1337 Ga0068870_10197850
1338 Ga0068870_10377440
1339 Ga0068863_100067858
1340 Ga0068863_100426873
1341 Ga0068863_100651529
1342 Ga0068863_102137600
1343 Ga0068858_100235037
1344 Ga0068858_100808842
1345 Ga0068860_100067002
1346 Ga0068860_100086798
1347 Ga0068860_100877157
1348 Ga0068862_100055055
1349 Ga0068862_100069630
1350 Ga0068862_100115639
1351 Ga0068862_100330946
1352 Ga0068862_101289908
1353 Ga0068862_101303415
1354 Ga0068862_102273451
1355 Ga0081539_10002155
1356 Ga0075432_10161773
1357 Ga0075432_10248270
1358 Ga0070712_100041575
1359 Ga0070712_100853918
1360 Ga0097621_100121813
1361 Ga0097621_100383481
1362 Ga0097621_100748093
1363 Ga0097621_101064996
1364 Ga0097621_101197993
1365 Ga0097621_102254217
1366 Ga0068871_100031846
1367 Ga0068871_100189328
1368 Ga0068871_100247130
1369 Ga0068871_100464198
1370 Ga0068871_100749360
1371 Ga0068871_100773376
1372 Ga0075428_100009803
1373 Ga0075428_102542924
1374 Ga0075430_100006156
1375 Ga0075430_100010546
1376 Ga0075430_100025202
1377 Ga0075430_100069204
1378 Ga0075430_100206145
1379 Ga0075430_100362574
1380 Ga0075430_100636009
1381 Ga0075431_100016436
1382 Ga0075431_100033112
1383 Ga0075431_100177709
1384 Ga0075431_100257460
1385 Ga0075431_100336850
1386 Ga0075431_101651264
1387 Ga0075433_10070059
1388 Ga0075433_11007216
1389 Ga0075433_11051268
1390 Ga0075434_100364284
1391 Ga0075434_100977096
1392 Ga0075429_100080005
1393 Ga0075429_100610573
1394 Ga0075429_101440900
1395 Ga0068865_100711051
1396 Ga0068865_101113151
1397 Ga0068865_101388973
1398 Ga0075436_100005295
1399 Ga0097620_100017193
1400 Ga0097620_100040659
1401 Ga0097620_100093566
1402 Ga0097620_100174045
1403 Ga0105240_10190521
1404 Ga0105240_10227672
1405 Ga0105240_10534431
1406 Ga0105240_10739361
1407 Ga0105240_10806833
1408 Ga0105240_10931030
1409 Ga0105240_11766538
1410 Ga0111539_10039634
1411 Ga0111539_10069428
1412 Ga0111539_10571041
1413 Ga0111539_10736563
1414 Ga0105245_10007242
1415 Ga0105245_10779545
1416 Ga0105245_11720415
1417 Ga0105247_10269700
1418 Ga0105247_10665057
1419 Ga0114129_10145426
1420 Ga0114129_10328531
1421 Ga0114129_10584599
1422 Ga0114129_12658119
1423 Ga0105243_10465289
1424 Ga0105243_10643620
1425 Ga0105243_10672849
1426 Ga0105243_11316450
1427 Ga0105243_12314895
1428 Ga0105241_10013440
1429 Ga0105241_10303450
1430 Ga0105241_10400246
1431 Ga0105242_10059781
1432 Ga0105242_10333063
1433 Ga0105242_10712276
1434 Ga0105242_11149461
1435 Ga0105242_11727198
1436 Ga0105248_10003817
1437 Ga0105248_10029120
1438 Ga0105248_10073913
1439 Ga0105248_10112827
1440 Ga0105248_10289681
1441 Ga0105248_11115384
1442 Ga0105237_10048456
1443 Ga0105237_10075964
1444 Ga0105237_10107229
1445 Ga0105237_10269506
1446 Ga0105237_10362049
1447 Ga0105237_10550172
1448 Ga0105237_11054537
1449 Ga0105238_10071480
1450 Ga0105238_10072112
1451 Ga0105238_10109256
1452 Ga0105238_10224419
1453 Ga0105238_10894150
1454 Ga0105238_11990180
1455 Ga0105238_12253663
1456 Ga0105249_10063658
1457 Ga0105249_10110725
1458 Ga0105249_10477355
1459 Ga0105239_12513338
1460 Ga0105239_13571907
1461 Ga0105246_10007915
1462 Ga0105246_10224709
1463 Ga0105246_11220027
1464 Ga0105246_12301840
1465 Ga0157316_1019887
1466 Ga0157373_10036032
1467 Ga0157373_10157003
1468 Ga0157373_10680262
1469 Ga0157371_10704215
1470 Ga0157371_11058472
1471 Ga0157371_11271931
1472 Ga0157370_10010027
1473 Ga0157370_10011467
1474 Ga0157370_10065570
1475 Ga0157370_10118456
1476 Ga0157370_10400529
1477 Ga0157370_11103133
1478 Ga0157369_10214283
1479 Ga0157369_10320945
1480 Ga0157369_10540179
1481 Ga0157369_10546608
1482 Ga0157369_10621759
1483 Ga0157369_10664188
1484 Ga0157369_10671366
1485 Ga0157369_10748289
1486 Ga0157369_11048097
1487 Ga0157369_11076867
1488 Ga0157369_12285040
1489 Ga0157374_10066369
1490 Ga0157374_10364645
1491 Ga0157374_11345065
1492 Ga0157374_11616001
1493 Ga0157378_10111950
1494 Ga0157378_11242987
1495 Ga0157378_13167498
1496 Ga0157378_13291544
1497 Ga0163162_10095293
1498 Ga0163162_11373386
1499 Ga0157372_10001817
1500 Ga0157372_10013190
1501 Ga0157372_10057587
1502 Ga0157372_10061767
1503 Ga0157372_10092219
1504 Ga0157372_10143161
1505 Ga0157372_10212214
1506 Ga0157372_10548067
1507 Ga0157372_10629483
1508 Ga0157372_10943846
1509 Ga0157372_11612413
1510 Ga0157372_11975603
1511 Ga0157372_12353834
1512 Ga0157375_10006012
1513 Ga0157375_10070737
1514 Ga0157375_10432061
1515 Ga0157375_10494971
1516 Ga0157375_10597053
1517 Ga0157375_10740699
1518 Ga0157375_11050314
1519 Ga0157375_13690716
1520 Ga0163163_10181838
1521 Ga0163163_10872474
1522 Ga0157380_10199431
1523 Ga0157377_10038185
1524 Ga0157377_10092017
1525 Ga0157377_10744571
1526 Ga0157379_10032105
1527 Ga0157379_10907750
1528 Ga0157379_12536000
1529 Ga0157376_10172316
1530 Ga0157376_10305078
1531 Ga0157376_10392945
1532 Ga0182007_10230636
1533 Ga0163161_10055074
1534 Ga0163161_11876906
1535 Ga0197907_10655093
1536 Ga0206356_11747774
1537 Ga0206353_10375004
1538 Ga0206353_11833831
1539 Ga0213876_10006682
1540 Ga0213876_10033566
1541 Ga0207697_10030749
1542 Ga0207697_10116990
1543 Ga0207656_10689662
1544 Ga0207682_10083049
1545 Ga0207682_10419533
1546 Ga0207642_10008793
1547 Ga0207642_10602623
1548 Ga0207688_10252230
1549 Ga0207688_10316769
1550 Ga0207680_10161330
1551 Ga0207680_10714337
1552 Ga0207680_10844699
1553 Ga0207647_10187262
1554 Ga0207685_10585387
1555 Ga0207699_10004952
1556 Ga0207645_10014647
1557 Ga0207645_10019830
1558 Ga0207645_10030696
1559 Ga0207645_10149855
1560 Ga0207645_10276860
1561 Ga0207643_10010411
1562 Ga0207643_10023178
1563 Ga0207643_10052743
1564 Ga0207705_10620709
1565 Ga0207705_11361390
1566 Ga0207684_10143724
1567 Ga0207684_10817661
1568 Ga0207707_10020675
1569 Ga0207707_10022689
1570 Ga0207707_10050164
1571 Ga0207707_10112665
1572 Ga0207707_10149627
1573 Ga0207707_10166290
1574 Ga0207707_10641026
1575 Ga0207707_10956084
1576 Ga0207695_10011163
1577 Ga0207695_10029248
1578 Ga0207695_10089970
1579 Ga0207695_10122102
1580 Ga0207695_10432906
1581 Ga0207671_10359251
1582 Ga0207671_10639887
1583 Ga0207671_10732865
1584 Ga0207671_10801147
1585 Ga0207693_10084841
1586 Ga0207663_10073697
1587 Ga0207663_10402968
1588 Ga0207663_11477049
1589 Ga0207660_10062347
1590 Ga0207660_10062540
1591 Ga0207660_10140432
1592 Ga0207660_10521964
1593 Ga0207662_10012819
1594 Ga0207662_10023547
1595 Ga0207662_10027667
1596 Ga0207657_10021308
1597 Ga0207657_10068088
1598 Ga0207649_10050898
1599 Ga0207649_10070909
1600 Ga0207649_10155728
1601 Ga0207649_10194883
1602 Ga0207649_10606764
1603 Ga0207652_10008038
1604 Ga0207652_10015933
1605 Ga0207652_10028951
1606 Ga0207652_10034546
1607 Ga0207652_10072733
1608 Ga0207652_10599679
1609 Ga0207652_11264950
1610 Ga0207646_10008918
1611 Ga0207646_10706264
1612 Ga0207646_11512835
1613 Ga0207681_10206938
1614 Ga0207681_10260734
1615 Ga0207681_10283811
1616 Ga0207681_10858869
1617 Ga0207681_11041801
1618 Ga0207694_10081652
1619 Ga0207694_10161397
1620 Ga0207694_10309540
1621 Ga0207694_11631714
1622 Ga0207650_10316434
1623 Ga0207650_10621842
1624 Ga0207650_10807003
1625 Ga0207650_11480009
1626 Ga0207659_10073195
1627 Ga0207659_10299378
1628 Ga0207659_10402909
1629 Ga0207659_10422535
1630 Ga0207659_10456249
1631 Ga0207659_10806479
1632 Ga0207659_11261926
1633 Ga0207659_11275200
1634 Ga0207659_11684242
1635 Ga0207687_10010157
1636 Ga0207687_11440456
1637 Ga0207700_10072976
1638 Ga0207700_10165913
1639 Ga0207700_11319219
1640 Ga0207664_10372634
1641 Ga0207664_10721782
1642 Ga0207644_10804587
1643 Ga0207644_10881537
1644 Ga0207644_10893216
1645 Ga0207690_10007970
1646 Ga0207690_10228320
1647 Ga0207690_11057013
1648 Ga0207706_10008609
1649 Ga0207706_11269644
1650 Ga0207686_10027499
1651 Ga0207686_10253360
1652 Ga0207686_10358929
1653 Ga0207686_11132748
1654 Ga0207709_10032296
1655 Ga0207709_10882383
1656 Ga0207670_10135215
1657 Ga0207670_10662852
1658 Ga0207669_10203266
1659 Ga0207669_10993997
1660 Ga0207704_10113223
1661 Ga0207704_10838547
1662 Ga0207704_11240827
1663 Ga0207704_11785981
1664 Ga0207691_10000993
1665 Ga0207691_10008846
1666 Ga0207691_10539917
1667 Ga0207691_11026917
1668 Ga0207711_10122262
1669 Ga0207711_10512652
1670 Ga0207711_10799058
1671 Ga0207711_10961047
1672 Ga0207711_11182149
1673 Ga0207689_10007028
1674 Ga0207689_10105986
1675 Ga0207689_11559128
1676 Ga0207661_10006057
1677 Ga0207661_10010031
1678 Ga0207661_10012407
1679 Ga0207661_10054270
1680 Ga0207661_10078495
1681 Ga0207661_10196826
1682 Ga0207661_10272664
1683 Ga0207661_10360497
1684 Ga0207661_10437903
1685 Ga0207661_11844013
1686 Ga0207679_10025407
1687 Ga0207679_10120794
1688 Ga0207679_10135212
1689 Ga0207679_10195725
1690 Ga0207679_10255312
1691 Ga0207679_10365512
1692 Ga0207679_10463011
1693 Ga0207679_10475709
1694 Ga0207679_10587042
1695 Ga0207679_10651915
1696 Ga0207679_11162024
1697 Ga0207667_10052014
1698 Ga0207667_10390054
1699 Ga0207667_10835008
1700 Ga0207667_11163151
1701 Ga0207651_10112223
1702 Ga0207651_10334214
1703 Ga0207651_10395562
1704 Ga0207651_10461657
1705 Ga0207651_10858275
1706 Ga0207651_10991138
1707 Ga0207651_11008852
1708 Ga0207712_10028452
1709 Ga0207712_11307658
1710 Ga0207668_10028938
1711 Ga0207668_10272698
1712 Ga0207668_11331823
1713 Ga0207668_11889968
1714 Ga0207640_10475260
1715 Ga0207640_10617047
1716 Ga0207658_10181906
1717 Ga0207658_10361502
1718 Ga0207658_10436627
1719 Ga0207658_10558676
1720 Ga0207658_11007285
1721 Ga0207677_10178216
1722 Ga0207677_10269601
1723 Ga0207677_10693450
1724 Ga0207677_10895031
1725 Ga0207677_11440882
1726 Ga0207677_12078095
1727 Ga0207703_10336769
1728 Ga0207703_10431989
1729 Ga0207703_12321950
1730 Ga0207639_10007860
1731 Ga0207639_12071353
1732 Ga0207678_10170140
1733 Ga0207678_10331225
1734 Ga0207678_10406910
1735 Ga0207678_10906983
1736 Ga0207708_10024989
1737 Ga0207708_10829204
1738 Ga0207702_10017046
1739 Ga0207702_10136380
1740 Ga0207702_10230289
1741 Ga0207702_10310465
1742 Ga0207641_10122111
1743 Ga0207641_10609981
1744 Ga0207641_10892904
1745 Ga0207641_11061739
1746 Ga0207641_12441521
1747 Ga0207648_10045314
1748 Ga0207648_10053286
1749 Ga0207648_10090847
1750 Ga0207648_10131749
1751 Ga0207648_10511633
1752 Ga0207676_10058105
1753 Ga0207676_10261186
1754 Ga0207676_10321196
1755 Ga0207676_10787166
1756 Ga0207676_10928973
1757 Ga0207674_10000013
1758 Ga0207674_10001053
1759 Ga0207674_10028497
1760 Ga0207674_10320692
1761 Ga0207674_10333193
1762 Ga0207674_12189313
1763 Ga0207675_100000916
1764 Ga0207683_10038750
1765 Ga0207683_10355646
1766 Ga0207683_10614886
1767 Ga0207698_10011010
1768 Ga0207698_10104131
1769 Ga0207698_10274236
1770 Ga0207698_10437101
1771 Ga0207698_11544183
1772 Ga0207428_10930687
1773 Ga0268266_10071820
1774 Ga0268266_10172335
1775 Ga0268266_10714688
1776 Ga0268266_11379010
1777 Ga0268266_11752164
1778 Ga0268265_10063309
1779 Ga0268265_10074959
1780 Ga0268265_10075700
1781 Ga0268265_10231102
1782 Ga0268265_11188453
1783 Ga0268264_10030491
1784 Ga0268264_10069562
1785 Ga0268264_10977741
1786 Ga0307517_10355728
1787 Ga0265327_10000417
1788 Ga0307408_100023128
1789 Ga0307408_100168886
1790 Ga0307408_100184099
1791 Ga0307408_101107252
1792 Ga0307408_101268689
1793 Ga0307405_10017765
1794 Ga0307405_10026406
1795 Ga0307405_10188069
1796 Ga0307405_10282416
1797 Ga0307413_10002909
1798 Ga0307413_10044787
1799 Ga0307413_10112475
1800 Ga0307413_10245812
1801 Ga0307410_10012158
1802 Ga0307410_10058425
1803 Ga0307410_10081840
1804 Ga0307410_10556128
1805 Ga0307406_10008103
1806 Ga0307406_10034757
1807 Ga0307406_10091966
1808 Ga0307406_10106793
1809 Ga0307406_10111813
1810 Ga0307406_10700911
1811 Ga0307406_11681358
1812 Ga0307406_11738179
1813 Ga0307407_10001830
1814 Ga0307407_10005355
1815 Ga0307407_10262957
1816 Ga0307407_10333232
1817 Ga0307412_10029895
1818 Ga0307412_10091095
1819 Ga0307412_10145084
1820 Ga0307409_100006457
1821 Ga0307409_100027198
1822 Ga0307409_100148750
1823 Ga0307409_100389823
1824 Ga0307409_100641638
1825 Ga0307409_100645558
1826 Ga0307409_100790838
1827 Ga0307409_101315580
1828 Ga0307416_100010847
1829 Ga0307416_100042663
1830 Ga0307416_100129701
1831 Ga0307416_100193234
1832 Ga0307416_100332267
1833 Ga0307416_100600339
1834 Ga0307416_100737464
1835 Ga0307416_101534195
1836 Ga0307416_101757855
1837 Ga0307416_103251021
1838 Ga0307414_10005676
1839 Ga0307414_10064436
1840 Ga0307414_10194962
1841 Ga0307414_10459080
1842 Ga0307414_11308814
1843 Ga0307411_10011782
1844 Ga0307411_10112641
1845 Ga0307411_10225621
1846 Ga0307411_10533789
1847 Ga0307415_100006699
1848 Ga0307415_100126416
1849 Ga0307415_100186830
1850 Ga0307415_100237829
1851 Ga0307415_100736785
1852 Ga0373958_0120301
1853 Ga0373959_0091092
1854 Ga0373926_0085051
1855 Ga0373934_0000693
1856 Ga0373934_0014355
1857 Ga0373934_0074031
1858 Ga0373949_0227228
1859 Ga0373945_0120387
1860 Ga0373956_0023066
1861 Ga0373956_0353497
1862 Ga0373957_0036561
1863 Ga0373957_0071737
1864 Ga0373957_0148206
1865 Ga0373943_0101115
1866 Ga0373943_0395781
1867 Ga0373946_0245446
1868 Ga0373955_0020564
1869 Ga0373955_0071215
1870 Ga0373955_0124229
1871 Ga0373955_0154570
1872 Ga0373961_0372133
1873 Ga0373924_0374079
1874 Ga0373924_0419291
1875 Ga0373935_0788704
1876 Ga0373935_1133566
1877 Ga0373927_0002136
1878 Ga0373927_0002804
1879 Ga0373927_0009049
1880 Ga0373927_0260678
1881 Ga0373927_0874754
1882 Ga0373933_0004678
1883 Ga0373933_0027897
1884 Ga0373933_0274267
1885 Ga0373933_0310752
1886 Ga0373933_0900352
1887 Ga0373947_0086982
1888 Ga0373947_0153410
1889 Ga0373947_0438522
1890 Ga0373937_0019193
1891 Ga0373937_0031746
1892 Ga0373937_0109180
1893 Ga0373937_0204639
1894 Ga0373937_0939526
1895 Ga0373937_1894339
1896 Ga0373925_0022816
1897 Ga0373925_0379767
1898 Ga0373925_1605596
1899 Ga0395900_1282445
1900 Ga0395905_0284097
1901 Ga0395905_1089935
1902 Ga0395901_1840426
1903 Ga0436365_0391692
1904 Ga0436365_0740200
1905 Ga0439453_0142002
1906 Ga0439462_0177247
1907 Ga0450923_033705
1908 Ga0439464_0104162
1909 Ga0466964_0091616
1910 Ga0451576_0296476
1911 Ga0451576_0794957
1912 Ga0466958_0053764
1913 Ga0466958_0086719
1914 Ga0466967_0015550
1915 Ga0466967_0015954
1916 Ga0466967_0306125
1917 Ga0495592_0101740
1918 Ga0495592_0142433
1919 Ga0495592_0484116
1920 Ga0495603_0841087
1921 Ga0495629_0137216
1922 Ga0495651_0032941
1923 Ga0495651_0050540
1924 Ga0495651_0092926
1925 Ga0495651_0105009
1926 Ga0495653_0008699
1927 Ga0495580_0049945
1928 Ga0495580_0065713
1929 Ga0495580_0097349
1930 Ga0495580_0499133
1931 Ga0495582_0055303
1932 Ga0495582_0367745
1933 Ga0495582_0620880
1934 Ga0495639_0042348
1935 Ga0495639_0493225
1936 Ga0495639_0602578
1937 Ga0495662_0103835
1938 Ga0495662_0540021
1939 Ga0495664_0018786
1940 Ga0495664_0057551
1941 Ga0495594_0002111
1942 Ga0495594_0003138
1943 Ga0495594_0007113
1944 Ga0495594_0021108
1945 Ga0495594_0030492
1946 Ga0495594_0040576
1947 Ga0495594_0322006
1948 Ga0495594_0400132
1949 Ga0495608_0016154
1950 Ga0495608_0051283
1951 Ga0495608_0071918
1952 Ga0495618_0022896
1953 Ga0495618_0164369
1954 Ga0495628_0012776
1955 Ga0495628_0095796
1956 Ga0495628_0099739
1957 Ga0495628_0202919
1958 Ga0495628_0288861
1959 Ga0495628_0467717
1960 Ga0495630_0120856
1961 Ga0495630_0185393
1962 Ga0495630_0243951
1963 Ga0495652_0017461
1964 Ga0495652_0045302
1965 Ga0495652_0059988
1966 Ga0495652_0155228
1967 Ga0495665_0082335
1968 Ga0495665_0218399
1969 Ga0495665_0301535
1970 Ga0495640_0034623
1971 Ga0495640_0111570
1972 Ga0495640_0311189
1973 Ga0495640_0718498
1974 Ga0495586_0002607
1975 Ga0495586_0003673
1976 Ga0495586_0026076
1977 Ga0495586_0069985
1978 Ga0495586_0110555
1979 Ga0495587_0007008
1980 Ga0495587_0014065
1981 Ga0495587_0135076
1982 Ga0495645_0017377
1983 Ga0495645_0019056
1984 Ga0495645_0110736
1985 Ga0495645_0128299
1986 Ga0495645_0350342
1987 Ga0495645_0653435
1988 Ga0495645_0673844
1989 Ga0495667_0010503
1990 Ga0495667_0011332
1991 Ga0495667_0011632
1992 Ga0495667_0016270
1993 Ga0495667_0046770
1994 Ga0495667_0070938
1995 Ga0495634_0066592
1996 Ga0495634_0271359
1997 Ga0495635_0082292
1998 Ga0495635_0193480
1999 Ga0495635_0326867
2000 Ga0495588_0013485
2001 Ga0495588_0245743
2002 Ga0495588_0322660
2003 Ga0495657_0140617
2004 Ga0495657_0151321
2005 Ga0495657_0195518
2006 Ga0495599_0022026
2007 Ga0495599_0022949
2008 Ga0495599_0094589
2009 Ga0495599_0114445
2010 Ga0495599_0248930
2011 Ga0495623_0001340
2012 Ga0495623_0016577
2013 Ga0495623_0032108
2014 Ga0495623_0067078
2015 Ga0495623_0107879
2016 Ga0495646_0016575
2017 Ga0495646_0232195
2018 Ga0495646_0353858
2019 Ga0495646_0365894
2020 Ga0495658_0155846
2021 Ga0495658_0354087
2022 Ga0495613_0169348
2023 Ga0495613_0311500
2024 Ga0495613_0443269
2025 Ga0495613_1067774
2026 Ga0495624_0077647
2027 Ga0495624_0857423
2028 Ga0495600_0045967
2029 Ga0495600_0066206
2030 Ga0495600_0121104
2031 Ga0495600_0264602
2032 Ga0495600_0685060
2033 Ga0495581_0034852
2034 Ga0495604_0019224
2035 Ga0495604_0090315
2036 Ga0495604_0310235
2037 Ga0495636_0251815
2038 Ga0495636_0335513
2039 Ga0495636_0496547
2040 Ga0495674_0048461
2041 Ga0495674_0060307
2042 Ga0495674_1045626
2043 Ga0495680_0011219
2044 Ga0495680_0734280
2045 Ga0495675_0014738
2046 Ga0495675_0027932
2047 Ga0495675_0028626
2048 Ga0495675_0509801
2049 Ga0495684_0004115
2050 Ga0495684_0004429
2051 Ga0495684_0012968
2052 Ga0495684_0046837
2053 Ga0495684_0047964
2054 Ga0495684_0197889
2055 Ga0495684_0272059
2056 Ga0495593_0126688
2057 Ga0495593_0261273
2058 Ga0495593_0275296
2059 Ga0495602_0046845
2060 Ga0495602_0108628
2061 Ga0495602_0369474
2062 Ga0495602_1169124
2063 Ga0495615_0097342
2064 Ga0496102_0712941
2065 Ga0496104_0241732
2066 Ga0496105_0104183
2067 Ga0496106_0381126
2068 Ga0496109_1277460
2069 Ga0496109_1766021
2070 Ga0496115_0957051
2071 Ga0501034_0266506
2072 Ga0501037_0400299
2073 Ga0501038_0235621
2074 Ga0501067_0383276
2075 Ga0501073_0141971
2076 Ga0501235_100968
2077 Ga0501235_221544
2078 Ga0501239_080069
2079 Ga0501250_057742
2080 Ga0501260_010059
2081 Ga0501260_036440
2082 Ga0501221_232328
2083 Ga0501245_145725
2084 Ga0501268_018978
2085 Ga0501268_061754
2086 Ga0501272_051019
2087 Ga0501035_0290799
2088 Ga0501044_0304459
2089 Ga0501204_084766
2090 nmdc:mga05p37_278768_c1
2091 nmdc:mga05p37_58074_c1
2092 nmdc:mga05p37_63592_c1
2093 nmdc:mga05p37_849005_c1
2094 nmdc:mga09592_11306_c1
2095 nmdc:mga09592_61292_c1
2096 nmdc:mga0qj67_111215_c1
2097 nmdc:mga0qj67_20802_c1
2098 nmdc:mga0qj67_319746_c1
2099 nmdc:mga0qj67_578242_c1
2100 nmdc:mga0qj67_78655_c1
2101 nmdc:mga06r32_1423218_c1
2102 nmdc:mga06r32_172320_c1
2103 nmdc:mga06r32_1911043_c1
2104 nmdc:mga06r32_503198_c1
2105 nmdc:mga06r32_789967_c1
2106 nmdc:mga06r32_873600_c1
2107 nmdc:mga08y16_1514781_c1
2108 nmdc:mga08y16_1925415_c1
2109 nmdc:mga08y16_277190_c1
2110 nmdc:mga08y16_341183_c1
2111 nmdc:mga08y16_502688_c1
2112 nmdc:mga0n895_308922_c1
2113 nmdc:mga0n895_657487_c1
2114 nmdc:mga0n895_673_c1
2115 nmdc:mga0n895_890078_c1
2116 nmdc:mga0n895_994680_c1
2117 nmdc:mga0rr50_552261_c1
2118 nmdc:mga08x19_25845_c1
2119 nmdc:mga0a205_27340_c1
2120 nmdc:mga0a205_76155_c1
2121 nmdc:mga0a205_828197_c1
2122 Ga0495601_0071527
2123 Ga0495601_0503700
2124 Ga0495601_0515543
2125 Ga0495612_0143373
2126 Ga0495595_0050155
2127 Ga0495619_0072498
2128 Ga0495619_0510853
2129 Ga0495619_1053432
2130 Ga0590071_033301
2131 Ga0590075_027330
2132 Ga0590077_058019

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

22

96

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9518 14 109
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.926 13 113
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9229 10 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9184 10 112
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9127 13 113
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9229 10 109 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 14 103 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9184 14 113 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9072 10 112 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8886 17 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3A5G5J2-F1-model_v4 deleted 0.9967 20 114
AF-A0A1Q7C8R4-F1-model_v4 PadR family transcriptional regulator 0.996 20 114
AF-A0A3N5LHC2-F1-model_v4 PadR family transcriptional regulator 0.9955 16 114
AF-A0A7W1BIP0-F1-model_v4 PadR family transcriptional regulator 0.9944 14 114
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9941 14 111

Map