F489356

General Info

Members Datasets Scaffolds Average Seq Length
1064 740 468 578

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0000770|Ga0495610_0000770_20372_22162
Length 596
Sequence MPRNGSFCLPIAYRVPSCAIMSIIQTLAARSGRLVSLDFGARGGGRRLIKPRRKSASPRSRLAIVGGAIVVAYSVIFGKLVYYAEQGGIDISSIPPGPSMMASRPEIDDRNGQVLATDIRTVSMFAEPIKIVDVDDAVEKLSSVFPDLDRKTMYERLSNKRSHFAWLKRQLSPKQQSEVLKLGIPAIGFRPEVKRFYPGGSTAAHILGYVDIDNHGVAGMEKYLDDQGLSALASTGLAASDSLAPVRLSIDLRVQNIVHDVVVDALTRYQSKAAGAVILDVHTGEVLAMASAPDFDPNDPNAAGSRDGWLNRMSNGTDEMGSVFKTFSMAMAFDTGTVKMSDSFDASTPLHYGGFTIHDDRDVPRRVLSVAEIFRYSSNVGTAKMMEKVGMDNQRAYLTRFGLLSKMQTELPEVKTPSQPRVWKMINSLTAAFGHGVATTPMQTAVAGAALMDGGKLIEPTFLPRTEEEAEKTATVVVKKSTSDVIKSLFKLNGEQGSGRFADVPGFHVGGKTGTANKVINGHYSHTLSFNSFLGAFPIDNPKYVILSYIDQPLTGLYNLNLAAETAAPMVADIVKRSAPILGVQPDFSKNLLVGY

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
55 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
56 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
57 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
58 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
59 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
60 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
61 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
62 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
63 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
64 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
65 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
66 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
67 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
68 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
69 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
70 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
71 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
72 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
73 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
79 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
80 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
81 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
82 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
83 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
84 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
85 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
86 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
87 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
88 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
89 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
90 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
91 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
92 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
93 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
94 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
95 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
96 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
97 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221557 Ensifer sp. Root558 Isolate Unclassified
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2643221568 Rhizobium sp. Root564 Isolate Unclassified
103 2643221582 Rhizobium sp. Root651 Isolate Unclassified
104 2643221599 Rhizobium sp. Root708 Isolate Unclassified
105 2643221607 Rhizobium sp. Root73 Isolate Unclassified
106 2643221610 Ensifer sp. Root74 Isolate Unclassified
107 2643221618 Ensifer sp. Root231 Isolate Unclassified
108 2643221626 Ensifer sp. Root31 Isolate Unclassified
109 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
110 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
111 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
112 2643221655 Ensifer sp. Root1252 Isolate Unclassified
113 2643221659 Ensifer sp. Root127 Isolate Unclassified
114 2643221668 Ensifer sp. Root423 Isolate Unclassified
115 2643221675 Ensifer sp. Root1298 Isolate Unclassified
116 2643221680 Ensifer sp. Root1312 Isolate Unclassified
117 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
118 2643221688 Rhizobium sp. Root482 Isolate Unclassified
119 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
120 2643221693 Rhizobium sp. Root491 Isolate Unclassified
121 2643221698 Ensifer sp. Root142 Isolate Unclassified
122 2643221712 Ensifer sp. Root258 Isolate Unclassified
123 2643221723 Ensifer sp. Root278 Isolate Unclassified
124 2643221726 Ensifer sp. Root954 Isolate Unclassified
125 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
126 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
127 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
128 2718217882 Rhizobium sp. N741 Isolate Nodule
129 2718217927 Rhizobium sp. N324 Isolate Nodule
130 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
131 2718218009 Rhizobium sp. N561 Isolate Nodule
132 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
133 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
134 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
135 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
136 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
137 2718218363 Rhizobium sp. N113 Isolate Nodule
138 2718218365 Rhizobium sp. N731 Isolate Nodule
139 2718218366 Rhizobium sp. N621 Isolate Nodule
140 2718218423 Rhizobium sp. N941 Isolate Nodule
141 2721755514 Rhizobium sp. N6212 Isolate Nodule
142 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
143 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
144 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
145 2721755809 Rhizobium sp. N541 Isolate Nodule
146 2721755810 Rhizobium sp. N871 Isolate Nodule
147 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
148 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
149 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
150 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
151 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
152 2728369365 Rhizobium sp. N1341 Isolate Nodule
153 2728369397 Rhizobium sp. N1314 Isolate Nodule
154 2738541293 Rhizobium sp. GV031 Isolate Unclassified
155 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
156 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
157 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
158 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
159 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
160 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
161 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
162 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
163 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
164 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
165 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
166 2791355256 Rhizobium sp. M10 Isolate Nodule
167 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
168 2791355260 Rhizobium sp. L9 Isolate Nodule
169 2791355261 Rhizobium sp. J15 Isolate Nodule
170 2791355262 Rhizobium sp. M1 Isolate Nodule
171 2791355263 Rhizobium chutanense C5 Isolate Nodule
172 2791355264 Rhizobium sp. S9 Isolate Nodule
173 2791355265 Rhizobium sp. H4 Isolate Nodule
174 2791355266 Rhizobium sp. L43 Isolate Nodule
175 2791355267 Rhizobium sp. L18 Isolate Nodule
176 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
177 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
178 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
179 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
180 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
181 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
182 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
183 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
184 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
185 2802429633 Rhizobium anhuiense J3 Isolate Nodule
186 2802429634 Rhizobium anhuiense S10 Isolate Nodule
187 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
188 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
189 2802429637 Rhizobium anhuiense C15 Isolate Nodule
190 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
191 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
192 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
193 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
194 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
195 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
196 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
197 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
198 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
199 2838048938 Rhizobium pisi 27/80 Isolate Nodule
200 2838061910 Rhizobium phaseoli L15 Isolate Nodule
201 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
202 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
203 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
204 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
205 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
206 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
207 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
208 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
209 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
210 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
211 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
212 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
213 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
214 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
215 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
216 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
217 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
218 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
219 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
220 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
221 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
222 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
223 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
224 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
225 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
226 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
227 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
228 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
229 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
230 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
231 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
232 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
233 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
234 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
235 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
236 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
237 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
238 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
239 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
240 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
241 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
242 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
243 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
244 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
245 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
246 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
247 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
248 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
249 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
250 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
251 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
252 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
253 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
254 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
255 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
256 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
257 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
258 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
259 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
260 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
261 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
262 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
263 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
264 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
265 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
266 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
267 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
268 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
269 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
270 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
271 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
272 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
273 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
274 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
275 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
276 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
277 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
278 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
279 2844163670 Ensifer sp. 1H6 Isolate Unclassified
280 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
281 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
282 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
283 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
284 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
285 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
286 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
287 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
288 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
289 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
290 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
291 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
292 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
293 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
294 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
295 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
296 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
297 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
298 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
299 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
300 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
301 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
302 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
303 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
304 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
305 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
306 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
307 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
308 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
309 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
310 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
311 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
312 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
313 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
314 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
315 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
316 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
317 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
318 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
319 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
320 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
321 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
322 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
323 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
324 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
325 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
326 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
327 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
328 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
329 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
330 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
331 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
332 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
333 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
334 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
335 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
336 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
337 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
338 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
339 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
340 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
341 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
342 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
343 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
344 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
345 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
346 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
347 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
348 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
349 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
350 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
351 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
352 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
353 2933599457 Rhizobium phaseoli M3 Isolate Nodule
354 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
355 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
356 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
357 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
358 2936381700 Rhizobium chutanense C16 Isolate Unclassified
359 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
360 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
361 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
362 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
363 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
364 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
365 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
366 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
367 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
368 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
369 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
370 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
371 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
372 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
373 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
374 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
375 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
376 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
377 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
378 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
379 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
380 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
381 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
382 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
383 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
384 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
385 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
386 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
387 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
388 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
389 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
390 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
391 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
392 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
393 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
394 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
395 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
396 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
397 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
398 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
399 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
400 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
401 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
402 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
403 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
404 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
405 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
406 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
407 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
408 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
409 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
410 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
411 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
412 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
413 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
414 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
415 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
416 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
417 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
418 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
419 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
420 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
421 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
422 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
423 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
424 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
425 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
426 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
427 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
428 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
429 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
430 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
431 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
432 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
433 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
434 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
435 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
436 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
437 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
438 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
439 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
440 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
441 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
442 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
443 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
444 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
445 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
446 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
447 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
448 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
449 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
450 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
451 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
452 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
453 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
454 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
455 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
456 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
457 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
458 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
459 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
460 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
461 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
462 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
463 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
464 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
465 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
466 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
467 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
468 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
469 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
470 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
471 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
472 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
473 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
474 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
475 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
476 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
477 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
478 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
479 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
480 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
481 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
482 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
483 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
484 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
485 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
486 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
487 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
488 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
489 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
490 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
491 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
492 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
493 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
494 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
495 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
496 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
497 2996887358 Rhizobium sp. R711 Isolate Nodule
498 2996893221 Rhizobium sp. R635 Isolate Nodule
499 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
500 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
501 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
502 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
503 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
504 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
505 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
506 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
507 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
508 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
509 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
510 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
511 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
512 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
513 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
514 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
515 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
516 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
517 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
518 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
519 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
520 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
521 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
522 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
523 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
524 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
525 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
526 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
527 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
528 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
529 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
530 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
531 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
532 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
533 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
534 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
535 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
536 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
537 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
538 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
539 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
540 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
541 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
542 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
543 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
544 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
545 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
546 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
547 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
548 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
549 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
550 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
551 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
552 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
553 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
554 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
555 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
556 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
557 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
558 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
560 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
561 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
562 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
563 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
564 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
565 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
566 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
567 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
568 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
569 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
570 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
571 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
572 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
574 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
575 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
583 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
584 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
585 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
586 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
587 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
588 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
589 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
590 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
591 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
592 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
593 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
594 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
595 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
596 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
597 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
598 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
599 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
600 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
601 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
602 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
603 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
604 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
605 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
606 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
607 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
608 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
609 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
610 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
611 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
612 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
613 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
614 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
615 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
616 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
617 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
618 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
619 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
620 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
621 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
622 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
623 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
624 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
625 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
626 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
627 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
628 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
629 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
630 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
631 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
632 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
633 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
634 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
635 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
636 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
637 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
638 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
639 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
640 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
641 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
642 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
643 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
644 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
645 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
646 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
647 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
648 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
649 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
650 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
651 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
652 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
653 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
654 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
655 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
656 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
657 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
658 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
659 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
660 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
661 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
664 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
665 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
666 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
667 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
669 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
670 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
671 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
672 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
673 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
674 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
675 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
676 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
677 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
678 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
679 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
680 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
681 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
682 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
683 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
684 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
685 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
686 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
687 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
688 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
689 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
690 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
691 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
692 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
693 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
694 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
695 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
696 8005258706 Rhizobium sp. R693 Isolate Nodule
697 8005275841 Rhizobium sp. N4311 Isolate Nodule
698 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
699 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
700 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
701 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
702 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
703 8005321885 Rhizobium sp. R72 Isolate Nodule
704 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
705 8005382845 Rhizobium sp. R634 Isolate Nodule
706 8005395548 Rhizobium sp. R339 Isolate Nodule
707 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
708 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
709 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
710 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
711 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
712 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
713 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
714 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
715 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
716 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
717 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
718 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
719 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
720 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
721 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
722 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
723 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
724 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
725 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
726 8018176218 Rhizobium sp. N122 Isolate Nodule
727 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
728 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
729 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
730 8024501048 Rhizobium sp. H4 Isolate Nodule
731 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
732 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
733 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
734 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
735 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
736 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
737 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
738 8056382006 Rhizobium croatiense 13T Isolate Nodule
739 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
740 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.08
Metatranscriptomes 0
Isolates 55.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 20.11
Nodule 41.17
Rhizoplane 1.79
Rhizosphere 18.7
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000015 3300001979 Bacteria 58951
2 JGI24740J21852_10000464 3300001979 Bacteria 17398
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25155J39150_1000195 3300002704 Bacteria 25809
5 JGI25156J39149_1000001 3300002705 Bacteria 354557
6 JGI25156J39149_1000433 3300002705 Bacteria 25809
7 JGI25162J39368_1000366 3300002737 Bacteria 38535
8 JGI25162J39368_1000368 3300002737 Bacteria 38495
9 JGI25162J39368_1000477 3300002737 Bacteria 30773
10 JGI25162J39368_1000802 3300002737 Bacteria 20890
11 JGI25154J39366_1000122 3300002738 Bacteria 61892
12 JGI25154J39366_1000360 3300002738 Bacteria 25809
13 JGI25158J39367_1000038 3300002739 Bacteria 30017
14 JGI25158J39367_1000694 3300002739 Bacteria 6532
15 JGI25158J39367_1004417 3300002739 Bacteria 2112
16 JGI25157J39369_1000044 3300002741 Bacteria 122466
17 JGI25157J39369_1000458 3300002741 Bacteria 25809
18 JGI25152J39213_1000636 3300002773 Bacteria 18557
19 JGI25152J39213_1001023 3300002773 Bacteria 13396
20 JGI25152J39213_1005336 3300002773 Bacteria 3780
21 JGI25152J39213_1011099 3300002773 Bacteria 2013
22 JGI25152J39213_1011145 3300002773 Bacteria 2007
23 JGI25150J39212_1000026 3300002774 Bacteria 107804
24 JGI25150J39212_1000107 3300002774 Bacteria 48306
25 JGI25150J39212_1005870 3300002774 Bacteria 2582
26 JGI25159J45721_1000014 3300002987 Bacteria 147809
27 JGI25159J45721_1000424 3300002987 Bacteria 19457
28 JGI25159J45721_1000493 3300002987 Bacteria 18075
29 JGI25151J46595_10000053 3300003187 Bacteria 156841
30 JGI25151J46595_10000374 3300003187 Bacteria 46807
31 JGI25151J46595_10000839 3300003187 Bacteria 24488
32 JGI25151J46595_10003886 3300003187 Bacteria 8064
33 JGI25151J46595_10008401 3300003187 Bacteria 4969
34 JGI25151J46595_10033516 3300003187 Bacteria 1978
35 JGI25165J46597_1000516 3300003214 Bacteria 36635
36 JGI25165J46597_1000603 3300003214 Bacteria 30773
37 JGI25165J46597_1001042 3300003214 Bacteria 18102
38 JGI25165J46597_1001132 3300003214 Bacteria 16749
39 JGI25165J46597_1002650 3300003214 Bacteria 5382
40 JGI25153J46596_10000696 3300003215 Bacteria 20557
41 JGI25153J46596_10005690 3300003215 Bacteria 6503
42 JGI25153J46596_10009242 3300003215 Bacteria 4611
43 JGI25153J46596_10012015 3300003215 Bacteria 3781
44 JGI25153J46596_10027126 3300003215 Bacteria 2013
45 JGI25153J46596_10027232 3300003215 Bacteria 2007
46 JGI25160J50197_1000001 3300003354 Bacteria 782301
47 JGI25160J50197_1000020 3300003354 Bacteria 232739
48 JGI25160J50197_1002863 3300003354 Bacteria 7895
49 JGI25160J50197_1018252 3300003354 Bacteria 2192
50 JGI25161J50226_1000001 3300003374 Bacteria 655036
51 JGI25161J50226_1000010 3300003374 Bacteria 214823
52 JGI25161J50226_1000174 3300003374 Bacteria 43080
53 JGI25161J50226_1001138 3300003374 Bacteria 8895
54 JGI25161J50226_1003445 3300003374 Bacteria 3611
55 Ga0055526_1001490 3300003771 Bacteria 16607
56 Ga0055526_1003506 3300003771 Bacteria 9921
57 Ga0055526_1003741 3300003771 Bacteria 9498
58 Ga0055524_1002170 3300003775 Bacteria 10327
59 Ga0055524_1004376 3300003775 Bacteria 6520
60 Ga0055524_1007091 3300003775 Bacteria 4805
61 Ga0055536_1001187 3300003781 Bacteria 16224
62 Ga0055536_1002960 3300003781 Bacteria 9313
63 Ga0055528_1000584 3300003790 Bacteria 27492
64 Ga0055528_1001199 3300003790 Bacteria 16717
65 Ga0055528_1001734 3300003790 Bacteria 12611
66 Ga0055528_1002830 3300003790 Bacteria 9076
67 Ga0055528_1008190 3300003790 Bacteria 4519
68 Ga0055528_1021493 3300003790 Bacteria 2046
69 Ga0055530_10016062 3300003791 Bacteria 2410
70 Ga0055540_1000929 3300003792 Bacteria 19079
71 Ga0055540_1005992 3300003792 Bacteria 4928
72 Ga0055540_1007010 3300003792 Bacteria 4345
73 Ga0055540_1009093 3300003792 Bacteria 3482
74 Ga0055540_1015257 3300003792 Bacteria 2247
75 Ga0055531_10004794 3300003794 Bacteria 8079
76 Ga0055531_10007721 3300003794 Bacteria 5807
77 Ga0058692_1008129 3300003856 Bacteria 2720
78 Ga0055543_1000003 3300004625 Bacteria 358656
79 Ga0055543_1000047 3300004625 Bacteria 111073
80 Ga0055543_1000353 3300004625 Bacteria 31219
81 Ga0055543_1000500 3300004625 Bacteria 22620
82 Ga0055543_1001281 3300004625 Bacteria 10341
83 Ga0065165_1000013 3300005262 Bacteria 301887
84 Ga0065165_1000068 3300005262 Bacteria 170609
85 Ga0065165_1008678 3300005262 Bacteria 4705
86 Ga0065165_1009678 3300005262 Bacteria 4277
87 Ga0070670_100000515 3300005331 Bacteria 30924
88 Ga0070670_100002993 3300005331 Bacteria 13983
89 Ga0070665_100040748 3300005548 Bacteria 4668
90 Ga0068856_100007936 3300005614 Bacteria 10367
91 Ga0075365_10005814 3300006038 Bacteria 6702
92 Ga0075363_100027951 3300006048 Bacteria 2897
93 Ga0075364_10012850 3300006051 Bacteria 5136
94 Ga0075367_10063647 3300006178 Bacteria 2205
95 Ga0075369_10013843 3300006186 Bacteria 3211
96 Ga0075370_10010432 3300006353 Bacteria 4858
97 Ga0075370_10010686 3300006353 Bacteria 4811
98 Ga0079104_1001253 3300006946 Bacteria 17716
99 Ga0079104_1006084 3300006946 Bacteria 4665
100 Ga0105240_10000076 3300009093 Bacteria 198848
101 Ga0105240_10000201 3300009093 Bacteria 121112
102 Ga0105248_10077623 3300009177 Bacteria 3734
103 Ga0105237_10000226 3300009545 Bacteria 79798
104 Ga0105237_10010705 3300009545 Bacteria 9734
105 Ga0123341_1000007 3300009765 Bacteria 147072
106 Ga0123342_1004784 3300009766 Bacteria 20320
107 Ga0123342_1013992 3300009766 Bacteria 7821
108 Ga0105239_10000641 3300010375 Bacteria 49765
109 Ga0105239_10009932 3300010375 Bacteria 10687
110 Ga0157371_10000017 3300013102 Bacteria 320830
111 Ga0157370_10000455 3300013104 Bacteria 51231
112 Ga0157370_10000461 3300013104 Bacteria 50850
113 Ga0157370_10005282 3300013104 Bacteria 14508
114 Ga0157369_10016027 3300013105 Bacteria 8433
115 Ga0157369_10039605 3300013105 Bacteria 5149
116 Ga0171463_1003 3300013249 Bacteria 695693
117 Ga0182007_10000314 3300015262 Bacteria 30873
118 Ga0182007_10004384 3300015262 Bacteria 6406
119 Ga0182005_1001330 3300015265 Bacteria 10088
120 Ga0182005_1003578 3300015265 Bacteria 5231
121 Ga0183363_1156 3300015690 Bacteria 16690
122 Ga0214544_1001800 3300021320 Bacteria 45046
123 Ga0214542_1000012 3300021321 Bacteria 235800
124 Ga0214543_1000024 3300021327 Bacteria 235745
125 Ga0214543_1000038 3300021327 Bacteria 182106
126 Ga0228711_1000008 3300022739 Bacteria 169893
127 Ga0228710_1000009 3300022740 Bacteria 169770
128 Ga0209435_100012 3300025206 Bacteria 401621
129 Ga0209435_100122 3300025206 Bacteria 28422
130 Ga0209436_100025 3300025208 Bacteria 93575
131 Ga0209436_100150 3300025208 Bacteria 33510
132 Ga0209436_101065 3300025208 Bacteria 10387
133 Ga0209437_100051 3300025233 Bacteria 392523
134 Ga0209437_100064 3300025233 Bacteria 334360
135 Ga0209437_100098 3300025233 Bacteria 229766
136 Ga0209437_100469 3300025233 Bacteria 30961
137 Ga0207425_1000075 3300025245 Bacteria 107452
138 Ga0207425_1000113 3300025245 Bacteria 77236
139 Ga0207425_1005180 3300025245 Bacteria 3756
140 Ga0207425_1006502 3300025245 Bacteria 3190
141 Ga0207425_1009350 3300025245 Bacteria 2441
142 Ga0209646_1000026 3300025246 Bacteria 401621
143 Ga0209646_1000385 3300025246 Bacteria 28422
144 Ga0209026_1000014 3300025250 Bacteria 401621
145 Ga0209026_1000501 3300025250 Bacteria 28422
146 Ga0209759_1000012 3300025256 Bacteria 401621
147 Ga0209759_1000743 3300025256 Bacteria 28422
148 Ga0209129_1000156 3300025258 Bacteria 107484
149 Ga0209129_1000181 3300025258 Bacteria 89982
150 Ga0209129_1000218 3300025258 Bacteria 66076
151 Ga0209129_1000348 3300025258 Bacteria 39224
152 Ga0209129_1001767 3300025258 Bacteria 11565
153 Ga0209129_1005932 3300025258 Bacteria 4125
154 Ga0209129_1006736 3300025258 Bacteria 3622
155 Ga0209129_1007796 3300025258 Bacteria 3100
156 Ga0209129_1008863 3300025258 Bacteria 2734
157 Ga0209233_1000081 3300025261 Bacteria 336832
158 Ga0209233_1000095 3300025261 Bacteria 303783
159 Ga0209233_1000113 3300025261 Bacteria 253455
160 Ga0209233_1000217 3300025261 Bacteria 106187
161 Ga0209233_1000375 3300025261 Bacteria 39219
162 Ga0209233_1000427 3300025261 Bacteria 30799
163 Ga0209673_1000010 3300025273 Bacteria 596656
164 Ga0209673_1000117 3300025273 Bacteria 172081
165 Ga0209673_1000151 3300025273 Bacteria 148103
166 Ga0209673_1000863 3300025273 Bacteria 39346
167 Ga0209673_1001685 3300025273 Bacteria 18869
168 Ga0209673_1002134 3300025273 Bacteria 14747
169 Ga0209673_1009188 3300025273 Bacteria 4312
170 Ga0209673_1009281 3300025273 Bacteria 4285
171 Ga0209673_1021742 3300025273 Bacteria 2234
172 Ga0209130_1000001 3300025284 Bacteria 831557
173 Ga0209130_1000003 3300025284 Bacteria 677988
174 Ga0209130_1000020 3300025284 Bacteria 379297
175 Ga0209130_1000034 3300025284 Bacteria 302439
176 Ga0209676_1000482 3300025292 Bacteria 65372
177 Ga0209676_1010300 3300025292 Bacteria 3917
178 Ga0209025_1000070 3300025294 Bacteria 287776
179 Ga0209025_1000140 3300025294 Bacteria 184765
180 Ga0209025_1000181 3300025294 Bacteria 156894
181 Ga0209025_1000314 3300025294 Bacteria 107720
182 Ga0209025_1000506 3300025294 Bacteria 74798
183 Ga0209025_1001813 3300025294 Bacteria 25245
184 Ga0209025_1001869 3300025294 Bacteria 24674
185 Ga0209025_1004380 3300025294 Bacteria 12294
186 Ga0209025_1005193 3300025294 Bacteria 10759
187 Ga0209025_1008432 3300025294 Bacteria 7420
188 Ga0209025_1015317 3300025294 Bacteria 4635
189 Ga0209025_1016060 3300025294 Bacteria 4456
190 Ga0209025_1022888 3300025294 Bacteria 3293
191 Ga0209564_1000013 3300025295 Bacteria 775755
192 Ga0209564_1000647 3300025295 Bacteria 52658
193 Ga0209564_1001131 3300025295 Bacteria 31317
194 Ga0209564_1001780 3300025295 Bacteria 19956
195 Ga0209564_1004823 3300025295 Bacteria 8030
196 Ga0209758_1000156 3300025297 Bacteria 156894
197 Ga0209758_1000405 3300025297 Bacteria 73971
198 Ga0209758_1000413 3300025297 Bacteria 72744
199 Ga0209758_1000655 3300025297 Bacteria 52188
200 Ga0209758_1000758 3300025297 Bacteria 46817
201 Ga0209758_1001882 3300025297 Bacteria 22974
202 Ga0209758_1002154 3300025297 Bacteria 20718
203 Ga0209758_1002252 3300025297 Bacteria 20026
204 Ga0209758_1004734 3300025297 Bacteria 11072
205 Ga0209758_1006389 3300025297 Bacteria 8497
206 Ga0209758_1014125 3300025297 Bacteria 4279
207 Ga0209050_1000646 3300025298 Bacteria 54050
208 Ga0209050_1008819 3300025298 Bacteria 5293
209 Ga0209256_1000396 3300025299 Bacteria 69216
210 Ga0209256_1001653 3300025299 Bacteria 21690
211 Ga0209256_1001736 3300025299 Bacteria 20844
212 Ga0209256_1002721 3300025299 Bacteria 13712
213 Ga0209256_1005804 3300025299 Bacteria 6883
214 Ga0209256_1006650 3300025299 Bacteria 6025
215 Ga0209256_1012329 3300025299 Bacteria 3293
216 Ga0207426_1000006 3300025302 Bacteria 1025969
217 Ga0207426_1000008 3300025302 Bacteria 848730
218 Ga0207426_1000011 3300025302 Bacteria 791203
219 Ga0207426_1000045 3300025302 Bacteria 422847
220 Ga0207426_1000221 3300025302 Bacteria 134756
221 Ga0207426_1000869 3300025302 Bacteria 31530
222 Ga0209051_1000097 3300025303 Bacteria 167378
223 Ga0209051_1000314 3300025303 Bacteria 74316
224 Ga0209051_1001414 3300025303 Bacteria 20618
225 Ga0209051_1003927 3300025303 Bacteria 9473
226 Ga0209051_1007515 3300025303 Bacteria 5940
227 Ga0209051_1013189 3300025303 Bacteria 3948
228 Ga0209257_1001142 3300025304 Bacteria 33931
229 Ga0209257_1002070 3300025304 Bacteria 21158
230 Ga0209257_1003315 3300025304 Bacteria 13958
231 Ga0207695_10000011 3300025913 Bacteria 910221
232 Ga0207695_10000118 3300025913 Bacteria 237085
233 Ga0207671_10000093 3300025914 Bacteria 138939
234 Ga0207671_10000175 3300025914 Bacteria 98920
235 Ga0207650_10000837 3300025925 Bacteria 23356
236 Ga0207650_10002272 3300025925 Bacteria 13416
237 Ga0207711_10075060 3300025941 Bacteria 2942
238 Ga0207668_10107108 3300025972 Bacteria 2090
239 Ga0207702_10044361 3300026078 Bacteria 3737
240 Ga0209281_1000106 3300027111 Bacteria 219666
241 Ga0209281_1000318 3300027111 Bacteria 85039
242 Ga0209371_1000022 3300027312 Bacteria 536342
243 Ga0209371_1002282 3300027312 Bacteria 10948
244 Ga0209371_1006788 3300027312 Bacteria 4150
245 Ga0209371_1007555 3300027312 Bacteria 3763
246 Ga0209282_1000024 3300027666 Bacteria 170348
247 Ga0209282_1004803 3300027666 Bacteria 8196
248 Ga0307515_10001559 3300028794 Bacteria 51153
249 Ga0307515_10007368 3300028794 Bacteria 21770
250 Ga0268256_1000019 3300030500 Bacteria 587949
251 Ga0268256_1004953 3300030500 Bacteria 5374
252 Ga0268256_1006891 3300030500 Bacteria 4150
253 Ga0268256_1007789 3300030500 Bacteria 3763
254 Ga0265325_10016256 3300031241 Bacteria 4162
255 Ga0307513_10119150 3300031456 Bacteria 2612
256 Ga0307405_10000857 3300031731 Bacteria 11991
257 Ga0307405_10002833 3300031731 Bacteria 7789
258 Ga0307412_10000493 3300031911 Bacteria 23544
259 Ga0315914_1000012 3300031967 Bacteria 169896
260 Ga0315913_1000006 3300033430 Bacteria 169893
261 Ga0315915_1000010 3300033464 Bacteria 240214
262 Ga0373927_0000350 3300035695 Bacteria 36173
263 Ga0373925_0052624 3300037068 Bacteria 3042
264 Ga0395900_0010176 3300037418 Bacteria 9621
265 Ga0395905_0000867 3300037471 Bacteria 39452
266 Ga0395905_0005044 3300037471 Bacteria 13597
267 Ga0395901_0154081 3300038443 Bacteria 2414
268 Ga0439465_0003817 3300041413 Bacteria 4914
269 Ga0439465_0007101 3300041413 Bacteria 3560
270 Ga0439465_0013037 3300041413 Bacteria 2597
271 Ga0451853_2433547 3300041512 Bacteria 2216
272 Ga0466963_0037894 3300044694 Bacteria 3151
273 Ga0466970_0000026 3300044765 Bacteria 56864
274 Ga0466957_0010513 3300044842 Bacteria 5319
275 Ga0466957_0021187 3300044842 Bacteria 3829
276 Ga0466958_0062046 3300045836 Bacteria 2278
277 Ga0495638_0001181 3300046460 Bacteria 25058
278 Ga0495638_0024145 3300046460 Bacteria 3967
279 Ga0495605_0001952 3300046474 Bacteria 13095
280 Ga0495607_0022946 3300046501 Bacteria 3912
281 Ga0495583_0013196 3300046506 Bacteria 4623
282 Ga0495583_0019889 3300046506 Bacteria 3494
283 Ga0495606_0001601 3300046507 Bacteria 29530
284 Ga0495606_0002324 3300046507 Bacteria 22407
285 Ga0495606_0007174 3300046507 Bacteria 10058
286 Ga0495606_0025623 3300046507 Bacteria 4220
287 Ga0495606_0038135 3300046507 Bacteria 3254
288 Ga0495610_0000770 3300046512 Bacteria 30242
289 Ga0495610_0001969 3300046512 Bacteria 17628
290 Ga0495610_0002191 3300046512 Bacteria 16560
291 Ga0495610_0003825 3300046512 Bacteria 11469
292 Ga0495610_0027406 3300046512 Bacteria 3028
293 Ga0495616_0008906 3300046513 Bacteria 5898
294 Ga0495620_0012690 3300046515 Bacteria 4338
295 Ga0495631_0003360 3300046518 Bacteria 8775
296 Ga0495632_0001278 3300046519 Bacteria 21310
297 Ga0495632_0005104 3300046519 Bacteria 8775
298 Ga0495632_0007228 3300046519 Bacteria 7009
299 Ga0495632_0050993 3300046519 Bacteria 2038
300 Ga0495643_0002802 3300046522 Bacteria 13314
301 Ga0495643_0012570 3300046522 Bacteria 5102
302 Ga0495643_0027634 3300046522 Bacteria 3186
303 Ga0495648_0013780 3300046524 Bacteria 5956
304 Ga0495663_0014361 3300046525 Bacteria 2220
305 Ga0495654_0000045 3300046530 Bacteria 150593
306 Ga0495654_0035169 3300046530 Bacteria 2525
307 Ga0495609_0013320 3300046538 Bacteria 3888
308 Ga0495597_0014741 3300046542 Bacteria 3717
309 Ga0495622_0006123 3300046557 Bacteria 5589
310 Ga0495633_0026822 3300046558 Bacteria 2822
311 Ga0495668_0008091 3300046616 Bacteria 6621
312 Ga0495625_0001387 3300046660 Bacteria 29722
313 Ga0495625_0051086 3300046660 Bacteria 2965
314 Ga0495588_0000895 3300046674 Bacteria 13095
315 Ga0495657_0013648 3300046675 Bacteria 5986
316 Ga0495670_0007690 3300046691 Bacteria 5299
317 Ga0495649_0035998 3300046694 Bacteria 2721
318 Ga0495600_0044740 3300046809 Bacteria 2887
319 Ga0495660_0013338 3300046810 Bacteria 4763
320 Ga0495604_0029637 3300047317 Bacteria 4354
321 Ga0495672_0011266 3300047320 Bacteria 6319
322 Ga0495683_0009820 3300047323 Bacteria 5086
323 Ga0495681_0004658 3300047470 Bacteria 9301
324 Ga0495686_0001455 3300047472 Bacteria 25795
325 Ga0495686_0004688 3300047472 Bacteria 11089
326 Ga0495686_0006538 3300047472 Bacteria 8896
327 Ga0495686_0013660 3300047472 Bacteria 5627
328 Ga0495686_0062023 3300047472 Bacteria 2319
329 Ga0496100_0006892 3300048903 Bacteria 6221
330 Ga0496101_0009796 3300048904 Bacteria 6310
331 Ga0496102_0008153 3300048905 Bacteria 8964
332 Ga0496102_0017086 3300048905 Bacteria 6351
333 Ga0496103_0008310 3300048906 Bacteria 6166
334 Ga0496106_0000957 3300048909 Bacteria 21015
335 Ga0496106_0000982 3300048909 Bacteria 20805
336 Ga0496111_0001270 3300048914 Bacteria 14143
337 Ga0496113_0010326 3300048916 Bacteria 6171
338 Ga0496116_0000142 3300048919 Bacteria 150342
339 Ga0496116_0009760 3300048919 Bacteria 8146
340 Ga0496116_0013505 3300048919 Bacteria 6578
341 Ga0496116_0015034 3300048919 Bacteria 6137
342 Ga0496116_0015182 3300048919 Bacteria 6101
343 Ga0496116_0021260 3300048919 Bacteria 4899
344 Ga0496116_0022090 3300048919 Bacteria 4782
345 Ga0496116_0052557 3300048919 Bacteria 2698
346 Ga0496117_0000002 3300048920 Bacteria 2483758
347 Ga0496117_0001574 3300048920 Bacteria 32408
348 Ga0496117_0002367 3300048920 Bacteria 24048
349 Ga0496117_0004520 3300048920 Bacteria 15278
350 Ga0496117_0006762 3300048920 Bacteria 11452
351 Ga0496117_0018869 3300048920 Bacteria 5691
352 Ga0496117_0019692 3300048920 Bacteria 5532
353 Ga0496117_0023835 3300048920 Bacteria 4860
354 Ga0496117_0024641 3300048920 Bacteria 4750
355 Ga0496118_0000087 3300048921 Bacteria 176693
356 Ga0496118_0003357 3300048921 Bacteria 20255
357 Ga0496118_0004297 3300048921 Bacteria 17031
358 Ga0496118_0005314 3300048921 Bacteria 14681
359 Ga0496118_0017417 3300048921 Bacteria 6541
360 Ga0496118_0024847 3300048921 Bacteria 5158
361 Ga0496118_0025539 3300048921 Bacteria 5060
362 Ga0496119_0005947 3300048922 Bacteria 11472
363 Ga0496119_0011615 3300048922 Bacteria 7265
364 Ga0496119_0015392 3300048922 Bacteria 5893
365 Ga0496119_0040522 3300048922 Bacteria 2977
366 Ga0496120_0000413 3300048923 Bacteria 68125
367 Ga0496120_0004953 3300048923 Bacteria 10819
368 Ga0496120_0006147 3300048923 Bacteria 9309
369 Ga0496121_0000003 3300048924 Bacteria 1191431
370 Ga0496121_0002536 3300048924 Bacteria 27686
371 Ga0496121_0010503 3300048924 Bacteria 10430
372 Ga0496121_0015847 3300048924 Bacteria 7837
373 Ga0496121_0020370 3300048924 Bacteria 6572
374 Ga0496121_0023681 3300048924 Bacteria 5902
375 Ga0496121_0036685 3300048924 Bacteria 4364
376 Ga0496121_0039518 3300048924 Bacteria 4155
377 Ga0496121_0039603 3300048924 Bacteria 4148
378 Ga0496121_0106562 3300048924 Bacteria 2148
379 Ga0496122_0000004 3300048925 Bacteria 645283
380 Ga0496122_0000190 3300048925 Bacteria 140376
381 Ga0496122_0005980 3300048925 Bacteria 14236
382 Ga0496122_0008521 3300048925 Bacteria 11037
383 Ga0496122_0008959 3300048925 Bacteria 10641
384 Ga0496122_0010294 3300048925 Bacteria 9677
385 Ga0496122_0017023 3300048925 Bacteria 6825
386 Ga0496122_0018314 3300048925 Bacteria 6481
387 Ga0496122_0042821 3300048925 Bacteria 3556
388 Ga0496123_0000007 3300048926 Bacteria 645283
389 Ga0496123_0000336 3300048926 Bacteria 89161
390 Ga0496123_0010318 3300048926 Bacteria 8280
391 Ga0496123_0012104 3300048926 Bacteria 7391
392 Ga0496123_0033840 3300048926 Bacteria 3671
393 Ga0496124_0000285 3300048927 Bacteria 95893
394 Ga0496124_0001040 3300048927 Bacteria 43813
395 Ga0496124_0014720 3300048927 Bacteria 7549
396 Ga0496124_0026382 3300048927 Bacteria 5240
397 Ga0496124_0050763 3300048927 Bacteria 3532
398 Ga0496124_0090675 3300048927 Bacteria 2492
399 Ga0496125_0000039 3300048928 Bacteria 318665
400 Ga0496125_0000248 3300048928 Bacteria 110840
401 Ga0496125_0004925 3300048928 Bacteria 15116
402 Ga0496125_0016232 3300048928 Bacteria 7158
403 Ga0496125_0017415 3300048928 Bacteria 6850
404 Ga0496125_0018773 3300048928 Bacteria 6553
405 Ga0496125_0019671 3300048928 Bacteria 6358
406 Ga0496125_0027607 3300048928 Bacteria 5142
407 Ga0496126_0000866 3300048929 Bacteria 53241
408 Ga0496126_0001294 3300048929 Bacteria 39967
409 Ga0496126_0017426 3300048929 Bacteria 7157
410 Ga0496126_0047995 3300048929 Bacteria 3907
411 Ga0496126_0085604 3300048929 Bacteria 2778
412 Ga0496126_0144505 3300048929 Bacteria 2044
413 Ga0501031_0035722 3300049568 Bacteria 3242
414 Ga0501032_0036811 3300049569 Bacteria 3339
415 Ga0501033_0027473 3300049570 Bacteria 4277
416 Ga0501034_0097012 3300049571 Bacteria 2943
417 Ga0501036_0020924 3300049572 Bacteria 5494
418 Ga0501036_0070972 3300049572 Bacteria 2945
419 Ga0501037_0041769 3300049573 Bacteria 3371
420 Ga0501037_0075558 3300049573 Bacteria 2447
421 Ga0501043_0104581 3300049579 Bacteria 2225
422 Ga0501047_0198606 3300049581 Bacteria 1867
423 Ga0501068_0030071 3300049584 Bacteria 3220
424 Ga0501080_0055887 3300049742 Bacteria 3676
425 Ga0501080_0148226 3300049742 Bacteria 2169
426 Ga0501083_0017170 3300049744 Bacteria 5047
427 Ga0501083_0028925 3300049744 Bacteria 3816
428 Ga0501280_002144 3300049776 Bacteria 3393
429 Ga0501035_0071346 3300049822 Bacteria 3075
430 Ga0501044_0020289 3300049823 Bacteria 7093
431 Ga0501044_0077051 3300049823 Bacteria 3382
432 Ga0501044_0132993 3300049823 Bacteria 2480
433 nmdc:mga03683_4496_c1 3300050489 Bacteria 4636
434 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
435 nmdc:mga0yw44_291_c1 3300050492 Bacteria 17253
436 nmdc:mga0yw44_3456_c1 3300050492 Bacteria 6517
437 nmdc:mga07m45_36619_c1 3300050496 Bacteria 2734
438 nmdc:mga0sz30_23498_c1 3300050516 Bacteria 2509
439 nmdc:mga0sz30_3736_c1 3300050516 Bacteria 5488
440 nmdc:mga0sz30_7957_c1 3300050516 Bacteria 3989
441 Ga0500578_0046899 3300053086 Bacteria 2772
442 Ga0500560_002077 3300053107 Bacteria 3723
443 Ga0500569_012298 3300053109 Bacteria 2066
444 Ga0500618_000184 3300053125 Bacteria 51349
445 Ga0500618_000453 3300053125 Bacteria 26803
446 Ga0500618_000677 3300053125 Bacteria 20060
447 Ga0500618_001080 3300053125 Bacteria 13415
448 Ga0500618_001232 3300053125 Bacteria 11994
449 Ga0500618_008674 3300053125 Bacteria 2821
450 Ga0500658_0000526 3300053134 Bacteria 16212
451 Ga0500658_0002581 3300053134 Bacteria 6999
452 Ga0500658_0015165 3300053134 Bacteria 2858
453 Ga0500561_0000098 3300053137 Bacteria 16671
454 Ga0500568_0000076 3300053139 Bacteria 94411
455 Ga0500568_0004818 3300053139 Bacteria 7132
456 Ga0500573_0003980 3300053140 Bacteria 7714
457 Ga0500573_0005041 3300053140 Bacteria 7024
458 Ga0500590_003631 3300053148 Bacteria 7157
459 Ga0500616_0001018 3300053153 Bacteria 29841
460 Ga0500616_0005682 3300053153 Bacteria 8405
461 Ga0500622_0000215 3300053156 Bacteria 61272
462 Ga0500622_0000458 3300053156 Bacteria 38693
463 Ga0500624_000768 3300053157 Bacteria 7677
464 Ga0500633_0000082 3300053160 Bacteria 14067
465 Ga0500634_0000261 3300053161 Bacteria 16846
466 Ga0500634_0011617 3300053161 Bacteria 4553
467 Ga0500636_0000180 3300053177 Bacteria 33813
468 Ga0500636_0006724 3300053177 Bacteria 6616

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0026382 Ga0496124_0026382_3776_5191 467
2 3300049579 Ga0501043_0104581 Ga0501043_0104581_698_2191 487
3 3300049744 Ga0501083_0028925 Ga0501083_0028925_2314_3801 491
4 3300046513 Ga0495616_0008906 Ga0495616_0008906_3001_4542 513
5 3300050496 nmdc:mga07m45_36619_c1 nmdc:mga07m45_36619_c1_1168_2715 513
6 3300025273 Ga0209673_1000010 Ga0209673_1000010303 515
7 3300005262 Ga0065165_1009678 Ga0065165_10096784 520
8 3300046512 Ga0495610_0002191 Ga0495610_0002191_13388_14980 526
9 3300002704 JGI25155J39150_1000195 JGI25155J39150_10001956 527
10 3300002705 JGI25156J39149_1000433 JGI25156J39149_100043319 527
11 3300002738 JGI25154J39366_1000360 JGI25154J39366_10003606 527
12 3300002741 JGI25157J39369_1000458 JGI25157J39369_10004586 527
13 3300049573 Ga0501037_0075558 Ga0501037_0075558_295_2004 539
14 3300049742 Ga0501080_0148226 Ga0501080_0148226_362_2071 539
15 3300053125 Ga0500618_000184 Ga0500618_000184_5685_7322 540
16 iso_pu_bacteria 2582581304 2585257697 540
17 iso_pu_bacteria 8054563764 8054568608 543
18 3300035695 Ga0373927_0000350 Ga0373927_0000350_22156_23916 549
19 3300037068 Ga0373925_0052624 Ga0373925_0052624_1257_3017 549
20 3300003775 Ga0055524_1002170 Ga0055524_10021701 551
21 3300003790 Ga0055528_1000584 Ga0055528_100058437 551
22 3300025294 Ga0209025_1008432 Ga0209025_10084327 551
23 iso_pu_bacteria 2510917022 2511131327 551
24 iso_pu_bacteria 2582581307 2585274460 551
25 iso_pu_bacteria 2585427531 2585561819 551
26 iso_pu_bacteria 2585427609 2585907551 551
27 iso_pu_bacteria 2585428125 2587982972 551
28 iso_pu_bacteria 2957422303 2957427172 552
29 3300025245 Ga0207425_1005180 Ga0207425_10051801 556
30 3300053139 Ga0500568_0000076 Ga0500568_0000076_65481_67163 556
31 3300046530 Ga0495654_0000045 Ga0495654_0000045_80852_82594 558
32 3300053125 Ga0500618_001080 Ga0500618_001080_7911_9653 558
33 3300053125 Ga0500618_001232 Ga0500618_001232_8447_10189 558
34 3300031241 Ga0265325_10016256 Ga0265325_100162563 559
35 iso_pu_bacteria 2585427608 2585902426 559
36 iso_pu_bacteria 2615840698 2616557383 559
37 iso_pu_bacteria 2667528174 2671117062 559
38 iso_pu_bacteria 2838029111 2838034861 559
39 iso_pu_bacteria 2842475841 2842481645 559
40 iso_pu_bacteria 2842502639 2842508004 559
41 iso_pu_bacteria 2919408235 2919413875 559
42 iso_pu_bacteria 8005682033 8005686926 559
43 iso_pu_bacteria 2582581308 2585280869 560
44 iso_pu_bacteria 2582581315 2585324390 560
45 iso_pu_bacteria 2582581316 2585335929 560
46 iso_pu_bacteria 2585427527 2585530573 560
47 iso_pu_bacteria 2585427530 2585554748 560
48 iso_pu_bacteria 2615840626 2616310748 560
49 iso_pu_bacteria 2617270742 2617382085 560
50 iso_pu_bacteria 2738541317 2738945523 560
51 iso_pu_bacteria 2775507266 2778173558 560
52 iso_pu_bacteria 2818991453 2819641125 560
53 iso_pu_bacteria 2842482326 2842484432 560
54 iso_pu_bacteria 2913308742 2913310229 560
55 iso_pu_bacteria 2919100787 2919107458 560
56 iso_pu_bacteria 3005416602 3005419807 560
57 iso_pu_bacteria 3005445848 3005451110 560
58 iso_pu_bacteria 8005314921 8005316373 560
59 iso_pu_bacteria 8005658619 8005660062 560
60 iso_pu_bacteria 8046767195 8046773323 560
61 iso_pu_bacteria 2585427594 2585842893 561
62 iso_pu_bacteria 2643221634 2644191573 561
63 iso_pu_bacteria 2738541293 2738801503 561
64 3300001979 JGI24740J21852_10000464 JGI24740J21852_100004648 562
65 3300002737 JGI25162J39368_1000477 JGI25162J39368_100047725 562
66 3300003214 JGI25165J46597_1000603 JGI25165J46597_100060325 562
67 3300005331 Ga0070670_100000515 Ga0070670_1000005152 562
68 3300005614 Ga0068856_100007936 Ga0068856_10000793610 562
69 3300006353 Ga0075370_10010686 Ga0075370_100106862 562
70 3300025206 Ga0209435_100122 Ga0209435_10012218 562
71 3300025233 Ga0209437_100469 Ga0209437_1004694 562
72 3300025246 Ga0209646_1000385 Ga0209646_100038518 562
73 3300025250 Ga0209026_1000501 Ga0209026_100050118 562
74 3300025256 Ga0209759_1000743 Ga0209759_100074318 562
75 3300025261 Ga0209233_1000375 Ga0209233_100037527 562
76 3300025925 Ga0207650_10002272 Ga0207650_100022722 562
77 3300026078 Ga0207702_10044361 Ga0207702_100443613 562
78 3300027312 Ga0209371_1006788 Ga0209371_10067881 562
79 3300030500 Ga0268256_1006891 Ga0268256_10068911 562
80 3300044694 Ga0466963_0037894 Ga0466963_0037894_124_1845 562
81 3300044765 Ga0466970_0000026 Ga0466970_0000026_9552_11273 562
82 3300044842 Ga0466957_0010513 Ga0466957_0010513_2434_4155 562
83 3300045836 Ga0466958_0062046 Ga0466958_0062046_495_2216 562
84 3300046507 Ga0495606_0001601 Ga0495606_0001601_4595_6319 562
85 3300046660 Ga0495625_0051086 Ga0495625_0051086_609_2354 562
86 3300047472 Ga0495686_0062023 Ga0495686_0062023_481_2205 562
87 3300048924 Ga0496121_0039518 Ga0496121_0039518_2112_3836 562
88 3300048925 Ga0496122_0005980 Ga0496122_0005980_10805_12526 562
89 3300053140 Ga0500573_0003980 Ga0500573_0003980_3462_5183 562
90 3300053140 Ga0500573_0005041 Ga0500573_0005041_5142_6863 562
91 3300002737 JGI25162J39368_1000802 JGI25162J39368_10008022 563
92 3300002739 JGI25158J39367_1000694 JGI25158J39367_10006944 563
93 3300002773 JGI25152J39213_1001023 JGI25152J39213_10010237 563
94 3300002987 JGI25159J45721_1000493 JGI25159J45721_100049315 563
95 3300003187 JGI25151J46595_10003886 JGI25151J46595_100038864 563
96 3300003214 JGI25165J46597_1001132 JGI25165J46597_100113216 563
97 3300003214 JGI25165J46597_1002650 JGI25165J46597_10026504 563
98 3300003354 JGI25160J50197_1018252 JGI25160J50197_10182521 563
99 3300003374 JGI25161J50226_1000010 JGI25161J50226_1000010195 563
100 3300004625 Ga0055543_1000353 Ga0055543_100035324 563
101 3300005262 Ga0065165_1008678 Ga0065165_10086783 563
102 3300005548 Ga0070665_100040748 Ga0070665_1000407482 563
103 3300009093 Ga0105240_10000201 Ga0105240_1000020172 563
104 3300009545 Ga0105237_10010705 Ga0105237_100107055 563
105 3300010375 Ga0105239_10009932 Ga0105239_1000993210 563
106 3300013104 Ga0157370_10005282 Ga0157370_100052825 563
107 3300015262 Ga0182007_10000314 Ga0182007_1000031416 563
108 3300015265 Ga0182005_1001330 Ga0182005_10013305 563
109 3300025208 Ga0209436_100025 Ga0209436_10002524 563
110 3300025233 Ga0209437_100064 Ga0209437_100064285 563
111 3300025258 Ga0209129_1000348 Ga0209129_100034815 563
112 3300025258 Ga0209129_1007796 Ga0209129_10077962 563
113 3300025261 Ga0209233_1000081 Ga0209233_100008115 563
114 3300025261 Ga0209233_1000217 Ga0209233_100021736 563
115 3300025273 Ga0209673_1021742 Ga0209673_10217421 563
116 3300025284 Ga0209130_1000001 Ga0209130_1000001612 563
117 3300025294 Ga0209025_1001813 Ga0209025_100181311 563
118 3300025294 Ga0209025_1004380 Ga0209025_10043804 563
119 3300025295 Ga0209564_1001131 Ga0209564_100113123 563
120 3300025297 Ga0209758_1002252 Ga0209758_100225212 563
121 3300025297 Ga0209758_1006389 Ga0209758_10063897 563
122 3300025297 Ga0209758_1014125 Ga0209758_10141253 563
123 3300025299 Ga0209256_1002721 Ga0209256_100272110 563
124 3300025302 Ga0207426_1000045 Ga0207426_1000045221 563
125 3300025913 Ga0207695_10000118 Ga0207695_10000118190 563
126 3300025914 Ga0207671_10000175 Ga0207671_1000017511 563
127 3300041413 Ga0439465_0013037 Ga0439465_0013037_262_1986 563
128 3300046522 Ga0495643_0012570 Ga0495643_0012570_1519_3243 563
129 3300047472 Ga0495686_0001455 Ga0495686_0001455_9135_10859 563
130 3300048905 Ga0496102_0008153 Ga0496102_0008153_1567_3291 563
131 3300048909 Ga0496106_0000957 Ga0496106_0000957_15573_17297 563
132 3300048916 Ga0496113_0010326 Ga0496113_0010326_584_2308 563
133 3300048919 Ga0496116_0052557 Ga0496116_0052557_228_1952 563
134 3300048920 Ga0496117_0002367 Ga0496117_0002367_8440_10164 563
135 3300048920 Ga0496117_0024641 Ga0496117_0024641_169_1893 563
136 3300048921 Ga0496118_0004297 Ga0496118_0004297_8440_10164 563
137 3300048921 Ga0496118_0005314 Ga0496118_0005314_3860_5584 563
138 3300048923 Ga0496120_0006147 Ga0496120_0006147_4335_6059 563
139 3300048924 Ga0496121_0010503 Ga0496121_0010503_5456_7180 563
140 3300048924 Ga0496121_0015847 Ga0496121_0015847_3739_5463 563
141 3300048928 Ga0496125_0004925 Ga0496125_0004925_10071_11795 563
142 3300048928 Ga0496125_0016232 Ga0496125_0016232_4695_6419 563
143 3300048929 Ga0496126_0085604 Ga0496126_0085604_537_2261 563
144 3300049572 Ga0501036_0070972 Ga0501036_0070972_280_2004 563
145 3300049581 Ga0501047_0198606 Ga0501047_0198606_122_1846 563
146 3300049742 Ga0501080_0055887 Ga0501080_0055887_507_2231 563
147 3300049823 Ga0501044_0020289 Ga0501044_0020289_1441_3165 563
148 3300050516 nmdc:mga0sz30_7957_c1 nmdc:mga0sz30_7957_c1_28_1752 563
149 3300053125 Ga0500618_000453 Ga0500618_000453_861_2585 563
150 3300053125 Ga0500618_008674 Ga0500618_008674_465_2189 563
151 3300053134 Ga0500658_0015165 Ga0500658_0015165_177_1901 563
152 3300053156 Ga0500622_0000215 Ga0500622_0000215_37324_39048 563
153 3300053160 Ga0500633_0000082 Ga0500633_0000082_8988_10712 563
154 iso_pu_bacteria 2510917030 2511193907 563
155 iso_pu_bacteria 2582581298 2585226996 563
156 iso_pu_bacteria 2585427529 2585550411 563
157 3300002774 JGI25150J39212_1000026 JGI25150J39212_100002695 564
158 3300003187 JGI25151J46595_10000053 JGI25151J46595_1000005339 564
159 3300025245 Ga0207425_1000113 Ga0207425_100011340 564
160 3300025258 Ga0209129_1000181 Ga0209129_100018140 564
161 3300025294 Ga0209025_1000181 Ga0209025_1000181107 564
162 3300025297 Ga0209758_1000156 Ga0209758_1000156107 564
163 3300031731 Ga0307405_10002833 Ga0307405_100028334 564
164 3300046519 Ga0495632_0001278 Ga0495632_0001278_11265_12992 564
165 3300048904 Ga0496101_0009796 Ga0496101_0009796_3977_5704 564
166 3300048919 Ga0496116_0013505 Ga0496116_0013505_2021_3748 564
167 3300048919 Ga0496116_0015034 Ga0496116_0015034_662_2389 564
168 3300048920 Ga0496117_0006762 Ga0496117_0006762_1011_2738 564
169 3300048920 Ga0496117_0023835 Ga0496117_0023835_555_2282 564
170 3300048921 Ga0496118_0025539 Ga0496118_0025539_440_2167 564
171 3300048922 Ga0496119_0015392 Ga0496119_0015392_161_1888 564
172 3300048924 Ga0496121_0023681 Ga0496121_0023681_288_2015 564
173 3300048925 Ga0496122_0008521 Ga0496122_0008521_7192_8919 564
174 3300048926 Ga0496123_0010318 Ga0496123_0010318_3825_5552 564
175 3300048927 Ga0496124_0000285 Ga0496124_0000285_3805_5532 564
176 3300046512 Ga0495610_0000770 Ga0495610_0000770_20372_22162 565
177 3300046515 Ga0495620_0012690 Ga0495620_0012690_521_2311 565
178 3300047472 Ga0495686_0004688 Ga0495686_0004688_3768_5558 565
179 3300028794 Ga0307515_10001559 Ga0307515_1000155933 569
180 3300048919 Ga0496116_0000142 Ga0496116_0000142_92881_94599 571
181 3300048929 Ga0496126_0001294 Ga0496126_0001294_16115_17833 571
182 3300053177 Ga0500636_0000180 Ga0500636_0000180_11557_13275 571
183 3300048922 Ga0496119_0005947 Ga0496119_0005947_7295_9016 572
184 3300048928 Ga0496125_0019671 Ga0496125_0019671_2148_3869 572
185 3300049776 Ga0501280_002144 Ga0501280_002144_1101_2846 572
186 3300006946 Ga0079104_1001253 Ga0079104_100125313 573
187 3300022739 Ga0228711_1000008 Ga0228711_100000838 573
188 3300022740 Ga0228710_1000009 Ga0228710_100000937 573
189 3300027111 Ga0209281_1000106 Ga0209281_1000106194 573
190 3300027666 Ga0209282_1000024 Ga0209282_1000024125 573
191 3300031967 Ga0315914_1000012 Ga0315914_100001238 573
192 3300033430 Ga0315913_1000006 Ga0315913_100000638 573
193 3300033464 Ga0315915_1000010 Ga0315915_1000010227 573
194 3300048914 Ga0496111_0001270 Ga0496111_0001270_9026_10753 573
195 3300048926 Ga0496123_0033840 Ga0496123_0033840_315_2096 573
196 3300048927 Ga0496124_0001040 Ga0496124_0001040_15882_17606 573
197 3300048929 Ga0496126_0000866 Ga0496126_0000866_16623_18365 573
198 iso_pu_bacteria 2551306087 2551698979 573
199 3300046507 Ga0495606_0002324 Ga0495606_0002324_3865_5589 574
200 3300048924 Ga0496121_0020370 Ga0496121_0020370_4004_5728 574
201 iso_pu_bacteria 2643221568 2643856772 574
202 iso_pu_bacteria 2854896431 2854899587 574
203 iso_pu_bacteria 2854916844 2854918412 574
204 iso_pu_bacteria 2891373044 2891373346 574
205 iso_pu_bacteria 2919166419 2919169241 574
206 iso_pu_bacteria 2929138655 2929140869 574
207 iso_pu_bacteria 2978969890 2978974617 574
208 iso_pu_bacteria 8054460903 8054462973 574
209 iso_pu_bacteria 8054558443 8054558649 574
210 3300046557 Ga0495622_0006123 Ga0495622_0006123_670_2418 575
211 3300047317 Ga0495604_0029637 Ga0495604_0029637_1692_3425 575
212 iso_pu_bacteria 2510917026 2511174423 575
213 iso_pu_bacteria 2510917028 2511187053 575
214 iso_pu_bacteria 2513237088 2513596473 575
215 iso_pu_bacteria 2513237159 2514001504 575
216 iso_pu_bacteria 2534681796 2535516864 575
217 iso_pu_bacteria 2537561587 2537875435 575
218 iso_pu_bacteria 2551306090 2551715881 575
219 iso_pu_bacteria 2554235003 2554248231 575
220 iso_pu_bacteria 2558860242 2559295347 575
221 iso_pu_bacteria 2582581283 2585166347 575
222 iso_pu_bacteria 2582581306 2585267425 575
223 iso_pu_bacteria 2582581865 2585386493 575
224 iso_pu_bacteria 2582581866 2585393255 575
225 iso_pu_bacteria 2585427633 2585996202 575
226 iso_pu_bacteria 2585427634 2586000812 575
227 iso_pu_bacteria 2599185210 2599601659 575
228 iso_pu_bacteria 2600255279 2601610081 575
229 iso_pu_bacteria 2600255308 2601746856 575
230 iso_pu_bacteria 2643221558 2643811533 575
231 iso_pu_bacteria 2643221582 2643920345 575
232 iso_pu_bacteria 2643221607 2644050520 575
233 iso_pu_bacteria 2643221636 2644205748 575
234 iso_pu_bacteria 2643221686 2644483438 575
235 iso_pu_bacteria 2643221688 2644492029 575
236 iso_pu_bacteria 2643221689 2644499649 575
237 iso_pu_bacteria 2643221693 2644521959 575
238 iso_pu_bacteria 2808606387 2808987919 575
239 iso_pu_bacteria 2818991439 2819559060 575
240 iso_pu_bacteria 2838074704 2838076860 575
241 iso_pu_bacteria 2838675328 2838675778 575
242 iso_pu_bacteria 2838714209 2838714660 575
243 iso_pu_bacteria 2838719591 2838721539 575
244 iso_pu_bacteria 2838724970 2838725420 575
245 iso_pu_bacteria 2841846520 2841848491 575
246 iso_pu_bacteria 2841859092 2841862122 575
247 iso_pu_bacteria 2842124991 2842125478 575
248 iso_pu_bacteria 2842130223 2842130673 575
249 iso_pu_bacteria 2842152218 2842154157 575
250 iso_pu_bacteria 2842170452 2842170904 575
251 iso_pu_bacteria 2842175837 2842177777 575
252 iso_pu_bacteria 2842187318 2842187769 575
253 iso_pu_bacteria 2842211629 2842212080 575
254 iso_pu_bacteria 2842224351 2842226301 575
255 iso_pu_bacteria 2842515876 2842518906 575
256 iso_pu_bacteria 2842521101 2842521813 575
257 iso_pu_bacteria 2896384573 2896389027 575
258 iso_pu_bacteria 2899792073 2899796054 575
259 iso_pu_bacteria 2899845264 2899850632 575
260 iso_pu_bacteria 2919114240 2919114698 575
261 iso_pu_bacteria 2919171160 2919174712 575
262 iso_pu_bacteria 2920760137 2920761521 575
263 iso_pu_bacteria 2926754445 2926755714 575
264 iso_pu_bacteria 2926760298 2926762829 575
265 iso_pu_bacteria 2933006813 2933008802 575
266 iso_pu_bacteria 2933011516 2933014920 575
267 iso_pu_bacteria 2933594066 2933596597 575
268 iso_pu_bacteria 2979089926 2979094678 575
269 iso_pu_bacteria 2979095461 2979100757 575
270 iso_pu_bacteria 2979100975 2979103913 575
271 iso_pu_bacteria 2984509177 2984511520 575
272 iso_pu_bacteria 2984518228 2984522120 575
273 iso_pu_bacteria 2984537506 2984541418 575
274 iso_pu_bacteria 2984601300 2984603695 575
275 iso_pu_bacteria 2996887358 2996889040 575
276 iso_pu_bacteria 650716007 650740557 575
277 iso_pu_bacteria 8003570095 8003571622 575
278 iso_pu_bacteria 8005258706 8005260303 575
279 iso_pu_bacteria 8005321885 8005323567 575
280 iso_pu_bacteria 8005542996 8005545616 575
281 iso_pu_bacteria 2508501122 2509108397 576
282 iso_pu_bacteria 2509276019 2509376470 576
283 iso_pu_bacteria 2510065057 2510306454 576
284 iso_pu_bacteria 2511231052 2511502244 576
285 iso_pu_bacteria 2512047086 2512533617 576
286 iso_pu_bacteria 2512875026 2512970694 576
287 iso_pu_bacteria 2513237086 2513584384 576
288 iso_pu_bacteria 2513237089 2513604262 576
289 iso_pu_bacteria 2513237091 2513618804 576
290 iso_pu_bacteria 2513237140 2513884405 576
291 iso_pu_bacteria 2513237143 2513905009 576
292 iso_pu_bacteria 2513237156 2513986825 576
293 iso_pu_bacteria 2513237160 2514006389 576
294 iso_pu_bacteria 2515154107 2515609020 576
295 iso_pu_bacteria 2516143018 2516204144 576
296 iso_pu_bacteria 2516653046 2516893623 576
297 iso_pu_bacteria 2517487022 2517570335 576
298 iso_pu_bacteria 2524023207 2524448556 576
299 iso_pu_bacteria 2551306084 2551674544 576
300 iso_pu_bacteria 2551306084 2551677925 576
301 iso_pu_bacteria 2551306085 2551687738 576
302 iso_pu_bacteria 2551306089 2551715576 576
303 iso_pu_bacteria 2551306093 2551744428 576
304 iso_pu_bacteria 2558860100 2558864463 576
305 iso_pu_bacteria 2582581294 2585202272 576
306 iso_pu_bacteria 2599185156 2599331750 576
307 iso_pu_bacteria 2599185236 2599721913 576
308 iso_pu_bacteria 2599185352 2600194392 576
309 iso_pu_bacteria 2600254933 2600374360 576
310 iso_pu_bacteria 2643221557 2643803089 576
311 iso_pu_bacteria 2643221610 2644063451 576
312 iso_pu_bacteria 2643221618 2644107280 576
313 iso_pu_bacteria 2643221626 2644150846 576
314 iso_pu_bacteria 2643221655 2644308675 576
315 iso_pu_bacteria 2643221659 2644335493 576
316 iso_pu_bacteria 2643221668 2644374734 576
317 iso_pu_bacteria 2643221675 2644414214 576
318 iso_pu_bacteria 2643221680 2644447742 576
319 iso_pu_bacteria 2643221698 2644539898 576
320 iso_pu_bacteria 2643221712 2644614616 576
321 iso_pu_bacteria 2643221723 2644676080 576
322 iso_pu_bacteria 2643221726 2644690215 576
323 iso_pu_bacteria 2657244999 2657681560 576
324 iso_pu_bacteria 2690316117 2692315542 576
325 iso_pu_bacteria 2738541317 2738947336 576
326 iso_pu_bacteria 2751185821 2753462027 576
327 iso_pu_bacteria 2791355082 2792585128 576
328 iso_pu_bacteria 2791355091 2792620772 576
329 iso_pu_bacteria 2791355092 2792626131 576
330 iso_pu_bacteria 2791355094 2792639067 576
331 iso_pu_bacteria 2791355253 2793280305 576
332 iso_pu_bacteria 2802428858 2802720030 576
333 iso_pu_bacteria 2802428859 2802727037 576
334 iso_pu_bacteria 2802428860 2802731960 576
335 iso_pu_bacteria 2802428861 2802739291 576
336 iso_pu_bacteria 2802428862 2802745728 576
337 iso_pu_bacteria 2802428863 2802752329 576
338 iso_pu_bacteria 2802429268 2804752751 576
339 iso_pu_bacteria 2842922631 2842924155 576
340 iso_pu_bacteria 2844163670 2844164572 576
341 iso_pu_bacteria 2847417321 2847419396 576
342 iso_pu_bacteria 2848992105 2848994423 576
343 iso_pu_bacteria 2850079185 2850081466 576
344 iso_pu_bacteria 2855825444 2855826343 576
345 iso_pu_bacteria 2855839649 2855841733 576
346 iso_pu_bacteria 2855872281 2855872522 576
347 iso_pu_bacteria 2858800743 2858802518 576
348 iso_pu_bacteria 2899803654 2899807270 576
349 iso_pu_bacteria 2913295892 2913299312 576
350 iso_pu_bacteria 2913308742 2913312566 576
351 iso_pu_bacteria 2915980308 2915981442 576
352 iso_pu_bacteria 2915986958 2915991446 576
353 iso_pu_bacteria 2915993759 2915998703 576
354 iso_pu_bacteria 2916000859 2916003483 576
355 iso_pu_bacteria 2916007675 2916011654 576
356 iso_pu_bacteria 2916014648 2916020780 576
357 iso_pu_bacteria 2916021584 2916024955 576
358 iso_pu_bacteria 2916028427 2916033768 576
359 iso_pu_bacteria 2916035215 2916037869 576
360 iso_pu_bacteria 2916041962 2916045331 576
361 iso_pu_bacteria 2916048683 2916049045 576
362 iso_pu_bacteria 2916055098 2916055717 576
363 iso_pu_bacteria 2916061851 2916064901 576
364 iso_pu_bacteria 2916076590 2916083200 576
365 iso_pu_bacteria 2920822456 2920825213 576
366 iso_pu_bacteria 2921201388 2921201867 576
367 iso_pu_bacteria 2921208531 2921211109 576
368 iso_pu_bacteria 2921237296 2921240927 576
369 iso_pu_bacteria 2921244191 2921246771 576
370 iso_pu_bacteria 2921250672 2921252089 576
371 iso_pu_bacteria 2921257292 2921263768 576
372 iso_pu_bacteria 2921263974 2921266212 576
373 iso_pu_bacteria 2921282425 2921287978 576
374 iso_pu_bacteria 2921289301 2921290953 576
375 iso_pu_bacteria 2921296804 2921299040 576
376 iso_pu_bacteria 2924144063 2924146751 576
377 iso_pu_bacteria 2924150972 2924157989 576
378 iso_pu_bacteria 2924158325 2924159277 576
379 iso_pu_bacteria 2924165586 2924169157 576
380 iso_pu_bacteria 2924172951 2924174566 576
381 iso_pu_bacteria 2924179722 2924182997 576
382 iso_pu_bacteria 2924186466 2924192708 576
383 iso_pu_bacteria 2924193448 2924195387 576
384 iso_pu_bacteria 2924200457 2924203322 576
385 iso_pu_bacteria 2924207177 2924210741 576
386 iso_pu_bacteria 2924214083 2924217126 576
387 iso_pu_bacteria 2924221636 2924223291 576
388 iso_pu_bacteria 2924228884 2924230523 576
389 iso_pu_bacteria 2936996657 2937000707 576
390 iso_pu_bacteria 2937002841 2937004557 576
391 iso_pu_bacteria 2937009748 2937011199 576
392 iso_pu_bacteria 2937016420 2937019822 576
393 iso_pu_bacteria 2937023124 2937024585 576
394 iso_pu_bacteria 2937029754 2937030288 576
395 iso_pu_bacteria 2937036028 2937042670 576
396 iso_pu_bacteria 2937042894 2937045541 576
397 iso_pu_bacteria 2937049772 2937056155 576
398 iso_pu_bacteria 2937056579 2937063569 576
399 iso_pu_bacteria 2937063883 2937067775 576
400 iso_pu_bacteria 2937071275 2937074392 576
401 iso_pu_bacteria 2937078374 2937080274 576
402 iso_pu_bacteria 2937084907 2937086027 576
403 iso_pu_bacteria 2937091812 2937097222 576
404 iso_pu_bacteria 2937098957 2937103034 576
405 iso_pu_bacteria 2937106411 2937111258 576
406 iso_pu_bacteria 2937113482 2937116143 576
407 iso_pu_bacteria 2937119839 2937121986 576
408 iso_pu_bacteria 2937126314 2937128827 576
409 iso_pu_bacteria 2941499720 2941502138 576
410 iso_pu_bacteria 2957375807 2957376383 576
411 iso_pu_bacteria 2957382221 2957384276 576
412 iso_pu_bacteria 2957388812 2957390739 576
413 iso_pu_bacteria 2957395598 2957395895 576
414 iso_pu_bacteria 2957402308 2957404501 576
415 iso_pu_bacteria 2957408893 2957412088 576
416 iso_pu_bacteria 2957415311 2957421210 576
417 iso_pu_bacteria 2957430029 2957431717 576
418 iso_pu_bacteria 2957437181 2957438169 576
419 iso_pu_bacteria 2957443900 2957446907 576
420 iso_pu_bacteria 2957450854 2957453749 576
421 iso_pu_bacteria 2957457609 2957461945 576
422 iso_pu_bacteria 2957464669 2957467043 576
423 iso_pu_bacteria 2957471148 2957476387 576
424 iso_pu_bacteria 2957478035 2957479603 576
425 iso_pu_bacteria 2957484790 2957490461 576
426 iso_pu_bacteria 2957491536 2957494108 576
427 iso_pu_bacteria 2957498199 2957503311 576
428 iso_pu_bacteria 2957505466 2957510615 576
429 iso_pu_bacteria 2960584000 2960587488 576
430 iso_pu_bacteria 2960591022 2960592088 576
431 iso_pu_bacteria 2960597568 2960599992 576
432 iso_pu_bacteria 2960603979 2960610590 576
433 iso_pu_bacteria 2960610863 2960612315 576
434 iso_pu_bacteria 2960617483 2960620465 576
435 iso_pu_bacteria 2960624210 2960624480 576
436 iso_pu_bacteria 2960631154 2960632048 576
437 iso_pu_bacteria 2960637947 2960644123 576
438 iso_pu_bacteria 2960645483 2960648414 576
439 iso_pu_bacteria 2960652885 2960656525 576
440 iso_pu_bacteria 2960660292 2960665566 576
441 iso_pu_bacteria 2960667422 2960669659 576
442 iso_pu_bacteria 2960674078 2960675159 576
443 iso_pu_bacteria 2960680706 2960681623 576
444 iso_pu_bacteria 2960687367 2960691467 576
445 iso_pu_bacteria 2960693952 2960694801 576
446 iso_pu_bacteria 2964607997 2964614126 576
447 iso_pu_bacteria 2964615318 2964617747 576
448 iso_pu_bacteria 2964621998 2964623632 576
449 iso_pu_bacteria 2964628898 2964632587 576
450 iso_pu_bacteria 2964636051 2964640818 576
451 iso_pu_bacteria 2964643177 2964645685 576
452 iso_pu_bacteria 2964649959 2964651556 576
453 iso_pu_bacteria 2964656573 2964660526 576
454 iso_pu_bacteria 2964663802 2964666922 576
455 iso_pu_bacteria 2964670856 2964675343 576
456 iso_pu_bacteria 2964678106 2964682875 576
457 iso_pu_bacteria 2964685014 2964688483 576
458 iso_pu_bacteria 2964691889 2964692480 576
459 iso_pu_bacteria 2964698721 2964701642 576
460 iso_pu_bacteria 2964705432 2964711092 576
461 iso_pu_bacteria 2964712639 2964715159 576
462 iso_pu_bacteria 2964719344 2964720679 576
463 iso_pu_bacteria 2967664464 2967665124 576
464 iso_pu_bacteria 2967671571 2967678413 576
465 iso_pu_bacteria 2967678726 2967684425 576
466 iso_pu_bacteria 2967686174 2967689715 576
467 iso_pu_bacteria 2967693043 2967694644 576
468 iso_pu_bacteria 2967699805 2967706464 576
469 iso_pu_bacteria 2967706974 2967708622 576
470 iso_pu_bacteria 2967714385 2967714875 576
471 iso_pu_bacteria 2967721400 2967726123 576
472 iso_pu_bacteria 2967728569 2967728993 576
473 iso_pu_bacteria 2967735183 2967737148 576
474 iso_pu_bacteria 2967742019 2967742555 576
475 iso_pu_bacteria 2967748971 2967751602 576
476 iso_pu_bacteria 2967755722 2967760018 576
477 iso_pu_bacteria 2967762386 2967767515 576
478 iso_pu_bacteria 2967769361 2967772120 576
479 iso_pu_bacteria 2967775926 2967778981 576
480 iso_pu_bacteria 2970019648 2970021061 576
481 iso_pu_bacteria 2970026789 2970028343 576
482 iso_pu_bacteria 2970033650 2970040290 576
483 iso_pu_bacteria 2970040964 2970042640 576
484 iso_pu_bacteria 2970047711 2970050971 576
485 iso_pu_bacteria 2970054988 2970056701 576
486 iso_pu_bacteria 2970061556 2970067143 576
487 iso_pu_bacteria 2970068827 2970071587 576
488 iso_pu_bacteria 2970076120 2970078263 576
489 iso_pu_bacteria 2970082768 2970085245 576
490 iso_pu_bacteria 2970088815 2970092547 576
491 iso_pu_bacteria 2970095765 2970102155 576
492 iso_pu_bacteria 2970102677 2970107998 576
493 iso_pu_bacteria 2970109326 2970110709 576
494 iso_pu_bacteria 2970116247 2970117355 576
495 iso_pu_bacteria 2970122695 2970125822 576
496 iso_pu_bacteria 2970129317 2970131165 576
497 iso_pu_bacteria 2970136068 2970136293 576
498 iso_pu_bacteria 2970143518 2970146728 576
499 iso_pu_bacteria 2970149975 2970151615 576
500 iso_pu_bacteria 2970156795 2970159568 576
501 iso_pu_bacteria 2970164137 2970166977 576
502 iso_pu_bacteria 2970170962 2970174243 576
503 iso_pu_bacteria 2970177841 2970180825 576
504 iso_pu_bacteria 2970184632 2970189170 576
505 iso_pu_bacteria 2970191845 2970193600 576
506 iso_pu_bacteria 2977516862 2977519116 576
507 iso_pu_bacteria 2977523885 2977526329 576
508 iso_pu_bacteria 2977530762 2977534055 576
509 iso_pu_bacteria 2977537788 2977539626 576
510 iso_pu_bacteria 2977544691 2977546360 576
511 iso_pu_bacteria 2977551784 2977558432 576
512 iso_pu_bacteria 2977558990 2977563173 576
513 iso_pu_bacteria 2977565890 2977567665 576
514 iso_pu_bacteria 2977572785 2977575746 576
515 iso_pu_bacteria 2977579622 2977581997 576
516 iso_pu_bacteria 2989349275 2989349670 576
517 iso_pu_bacteria 2989771324 2989774285 576
518 iso_pu_bacteria 3003930520 3003934064 576
519 iso_pu_bacteria 643692032 643826312 576
520 iso_pu_bacteria 648276728 648739212 576
521 iso_pu_bacteria 8003992118 8003994166 576
522 iso_pu_bacteria 8003999396 8004001798 576
523 iso_pu_bacteria 8005658619 8005659031 576
524 iso_pu_bacteria 8049293176 8049295320 576
525 iso_pu_bacteria 8055431914 8055432762 576
526 iso_pu_bacteria 2510917030 2511199027 577
527 iso_pu_bacteria 2558860983 2561468372 577
528 iso_pu_bacteria 2582581298 2585222830 577
529 iso_pu_bacteria 2585427529 2585545413 577
530 iso_pu_bacteria 2775507049 2776913923 577
531 iso_pu_bacteria 2919100787 2919107659 577
532 iso_pu_bacteria 3005445848 3005448444 577
533 iso_pu_bacteria 3005452660 3005454634 577
534 iso_pu_bacteria 8018150411 8018153226 577
535 3300006038 Ga0075365_10005814 Ga0075365_100058145 578
536 3300006051 Ga0075364_10012850 Ga0075364_100128505 578
537 3300025294 Ga0209025_1000140 Ga0209025_100014071 578
538 3300037418 Ga0395900_0010176 Ga0395900_0010176_4282_6039 578
539 3300038443 Ga0395901_0154081 Ga0395901_0154081_558_2315 578
540 3300048920 Ga0496117_0004520 Ga0496117_0004520_6158_7897 578
541 3300048920 Ga0496117_0018869 Ga0496117_0018869_1244_2983 578
542 3300048924 Ga0496121_0000003 Ga0496121_0000003_390528_392267 578
543 3300048925 Ga0496122_0000190 Ga0496122_0000190_132594_134333 578
544 3300048925 Ga0496122_0008959 Ga0496122_0008959_2606_4345 578
545 3300048926 Ga0496123_0000336 Ga0496123_0000336_16590_18329 578
546 3300048927 Ga0496124_0090675 Ga0496124_0090675_149_1888 578
547 3300048928 Ga0496125_0000039 Ga0496125_0000039_169166_170905 578
548 3300048928 Ga0496125_0000248 Ga0496125_0000248_92358_94097 578
549 3300050492 nmdc:mga0yw44_3456_c1 nmdc:mga0yw44_3456_c1_4041_5783 578
550 3300053161 Ga0500634_0000261 Ga0500634_0000261_7474_9213 578
551 iso_pu_bacteria 2513237138 2513865598 578
552 iso_pu_bacteria 2513237144 2513909003 578
553 iso_pu_bacteria 2513237146 2513925385 578
554 iso_pu_bacteria 2524023209 2524459587 578
555 iso_pu_bacteria 2582581299 2585231741 578
556 iso_pu_bacteria 2582581304 2585255082 578
557 iso_pu_bacteria 2582581867 2585402399 578
558 iso_pu_bacteria 2585427590 2585822914 578
559 iso_pu_bacteria 2585427594 2585843225 578
560 iso_pu_bacteria 2585427608 2585898243 578
561 iso_pu_bacteria 2599185170 2599417301 578
562 iso_pu_bacteria 2643221599 2644003159 578
563 iso_pu_bacteria 2643221634 2644193507 578
564 iso_pu_bacteria 2643221643 2644238681 578
565 iso_pu_bacteria 2738541293 2738800083 578
566 iso_pu_bacteria 2838035591 2838038499 578
567 iso_pu_bacteria 2838661181 2838661590 578
568 iso_pu_bacteria 2842298080 2842301368 578
569 iso_pu_bacteria 2842357229 2842357905 578
570 iso_pu_bacteria 2923556063 2923558571 578
571 iso_pu_bacteria 2933016740 2933022323 578
572 iso_pu_bacteria 3005409236 3005414602 578
573 iso_pu_bacteria 8024486573 8024488025 578
574 3300003187 JGI25151J46595_10033516 JGI25151J46595_100335161 579
575 3300003781 Ga0055536_1002960 Ga0055536_10029603 579
576 3300003792 Ga0055540_1005992 Ga0055540_10059925 579
577 3300003794 Ga0055531_10007721 Ga0055531_100077215 579
578 3300003856 Ga0058692_1008129 Ga0058692_10081293 579
579 3300006178 Ga0075367_10063647 Ga0075367_100636471 579
580 3300006186 Ga0075369_10013843 Ga0075369_100138432 579
581 3300009766 Ga0123342_1004784 Ga0123342_100478410 579
582 3300013102 Ga0157371_10000017 Ga0157371_1000001756 579
583 3300013104 Ga0157370_10000461 Ga0157370_1000046124 579
584 3300025273 Ga0209673_1002134 Ga0209673_10021344 579
585 3300025294 Ga0209025_1001869 Ga0209025_100186920 579
586 3300025294 Ga0209025_1016060 Ga0209025_10160604 579
587 3300025297 Ga0209758_1000413 Ga0209758_100041333 579
588 3300025299 Ga0209256_1006650 Ga0209256_10066503 579
589 3300025302 Ga0207426_1000869 Ga0207426_100086911 579
590 3300025303 Ga0209051_1000314 Ga0209051_100031429 579
591 3300025304 Ga0209257_1002070 Ga0209257_10020705 579
592 3300025972 Ga0207668_10107108 Ga0207668_101071081 579
593 3300027312 Ga0209371_1000022 Ga0209371_100002284 579
594 3300027312 Ga0209371_1002282 Ga0209371_10022822 579
595 3300027666 Ga0209282_1004803 Ga0209282_10048033 579
596 3300030500 Ga0268256_1000019 Ga0268256_1000019436 579
597 3300030500 Ga0268256_1004953 Ga0268256_10049534 579
598 3300037471 Ga0395905_0000867 Ga0395905_0000867_588_2348 579
599 3300037471 Ga0395905_0005044 Ga0395905_0005044_5206_6969 579
600 3300041413 Ga0439465_0007101 Ga0439465_0007101_1260_3005 579
601 3300046558 Ga0495633_0026822 Ga0495633_0026822_195_1937 579
602 3300046674 Ga0495588_0000895 Ga0495588_0000895_8145_9887 579
603 3300047470 Ga0495681_0004658 Ga0495681_0004658_913_2655 579
604 3300048919 Ga0496116_0021260 Ga0496116_0021260_2001_3743 579
605 3300048920 Ga0496117_0000002 Ga0496117_0000002_470251_471993 579
606 3300048921 Ga0496118_0000087 Ga0496118_0000087_81810_83552 579
607 3300048922 Ga0496119_0040522 Ga0496119_0040522_62_1804 579
608 3300048923 Ga0496120_0000413 Ga0496120_0000413_13968_15710 579
609 3300048925 Ga0496122_0000004 Ga0496122_0000004_117865_119607 579
610 3300048926 Ga0496123_0000007 Ga0496123_0000007_117865_119607 579
611 3300048927 Ga0496124_0014720 Ga0496124_0014720_3600_5342 579
612 3300048929 Ga0496126_0047995 Ga0496126_0047995_593_2338 579
613 3300048929 Ga0496126_0144505 Ga0496126_0144505_180_1922 579
614 3300050489 nmdc:mga03683_4496_c1 nmdc:mga03683_4496_c1_597_2339 579
615 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_18102_19844 579
616 3300050492 nmdc:mga0yw44_291_c1 nmdc:mga0yw44_291_c1_4982_6724 579
617 3300050516 nmdc:mga0sz30_23498_c1 nmdc:mga0sz30_23498_c1_624_2366 579
618 3300050516 nmdc:mga0sz30_3736_c1 nmdc:mga0sz30_3736_c1_1887_3629 579
619 3300053107 Ga0500560_002077 Ga0500560_002077_544_2286 579
620 3300053137 Ga0500561_0000098 Ga0500561_0000098_14034_15776 579
621 3300053157 Ga0500624_000768 Ga0500624_000768_5096_6838 579
622 3300053161 Ga0500634_0011617 Ga0500634_0011617_2102_3844 579
623 3300053177 Ga0500636_0006724 Ga0500636_0006724_2746_4488 579
624 iso_pu_bacteria 2509276021 2509392057 579
625 iso_pu_bacteria 2509276033 2509445648 579
626 iso_pu_bacteria 2509276033 2509447051 579
627 iso_pu_bacteria 2510065019 2510133953 579
628 iso_pu_bacteria 2510461076 2510895371 579
629 iso_pu_bacteria 2510917022 2511135400 579
630 iso_pu_bacteria 2513237084 2513567974 579
631 iso_pu_bacteria 2513237085 2513576940 579
632 iso_pu_bacteria 2513237093 2513633388 579
633 iso_pu_bacteria 2513237103 2513708050 579
634 iso_pu_bacteria 2513237162 2514020009 579
635 iso_pu_bacteria 2515075009 2515113002 579
636 iso_pu_bacteria 2515154113 2515638512 579
637 iso_pu_bacteria 2515154114 2515640961 579
638 iso_pu_bacteria 2515154116 2515655357 579
639 iso_pu_bacteria 2515154134 2515739480 579
640 iso_pu_bacteria 2516653077 2517036702 579
641 iso_pu_bacteria 2516653085 2517077061 579
642 iso_pu_bacteria 2517093000 2517095829 579
643 iso_pu_bacteria 2517287029 2517407401 579
644 iso_pu_bacteria 2519899620 2520377194 579
645 iso_pu_bacteria 2529292951 2530645955 579
646 iso_pu_bacteria 2582581307 2585271137 579
647 iso_pu_bacteria 2585427526 2585527441 579
648 iso_pu_bacteria 2585427528 2585538182 579
649 iso_pu_bacteria 2585427531 2585558861 579
650 iso_pu_bacteria 2585427593 2585836131 579
651 iso_pu_bacteria 2585427609 2585904169 579
652 iso_pu_bacteria 2585428125 2587980714 579
653 iso_pu_bacteria 2615840624 2616293366 579
654 iso_pu_bacteria 2718217882 2719181804 579
655 iso_pu_bacteria 2718217927 2719386407 579
656 iso_pu_bacteria 2718217997 2719666155 579
657 iso_pu_bacteria 2718218009 2719732468 579
658 iso_pu_bacteria 2718218199 2720492575 579
659 iso_pu_bacteria 2718218232 2720614010 579
660 iso_pu_bacteria 2718218233 2720620815 579
661 iso_pu_bacteria 2718218235 2720632140 579
662 iso_pu_bacteria 2718218269 2720775868 579
663 iso_pu_bacteria 2718218363 2721147895 579
664 iso_pu_bacteria 2718218365 2721159346 579
665 iso_pu_bacteria 2718218366 2721164731 579
666 iso_pu_bacteria 2718218423 2721400111 579
667 iso_pu_bacteria 2721755514 2722840901 579
668 iso_pu_bacteria 2721755556 2723027472 579
669 iso_pu_bacteria 2721755684 2723561091 579
670 iso_pu_bacteria 2721755685 2723567687 579
671 iso_pu_bacteria 2721755809 2724038924 579
672 iso_pu_bacteria 2721755810 2724045224 579
673 iso_pu_bacteria 2721755819 2724090475 579
674 iso_pu_bacteria 2721755822 2724104952 579
675 iso_pu_bacteria 2721755823 2724110811 579
676 iso_pu_bacteria 2724679232 2725952563 579
677 iso_pu_bacteria 2728369352 2730108408 579
678 iso_pu_bacteria 2728369365 2730165039 579
679 iso_pu_bacteria 2728369397 2730298978 579
680 iso_pu_bacteria 2738541333 2739032839 579
681 iso_pu_bacteria 2765235942 2766065867 579
682 iso_pu_bacteria 2791355256 2793294439 579
683 iso_pu_bacteria 2791355259 2793314545 579
684 iso_pu_bacteria 2791355260 2793320373 579
685 iso_pu_bacteria 2791355261 2793329542 579
686 iso_pu_bacteria 2791355262 2793334488 579
687 iso_pu_bacteria 2791355263 2793339205 579
688 iso_pu_bacteria 2791355264 2793348878 579
689 iso_pu_bacteria 2791355265 2793351834 579
690 iso_pu_bacteria 2791355266 2793362586 579
691 iso_pu_bacteria 2791355267 2793368876 579
692 iso_pu_bacteria 2802429605 2805928803 579
693 iso_pu_bacteria 2802429606 2805935085 579
694 iso_pu_bacteria 2802429633 2806043819 579
695 iso_pu_bacteria 2802429634 2806050250 579
696 iso_pu_bacteria 2802429635 2806057066 579
697 iso_pu_bacteria 2802429636 2806064448 579
698 iso_pu_bacteria 2802429637 2806071715 579
699 iso_pu_bacteria 2818991448 2819609147 579
700 iso_pu_bacteria 2838016132 2838017655 579
701 iso_pu_bacteria 2838022645 2838027544 579
702 iso_pu_bacteria 2838042994 2838043966 579
703 iso_pu_bacteria 2838048938 2838054388 579
704 iso_pu_bacteria 2838061910 2838068017 579
705 iso_pu_bacteria 2838068647 2838070145 579
706 iso_pu_bacteria 2838668709 2838670358 579
707 iso_pu_bacteria 2838680041 2838683470 579
708 iso_pu_bacteria 2838686498 2838687057 579
709 iso_pu_bacteria 2838694306 2838697587 579
710 iso_pu_bacteria 2838701080 2838702729 579
711 iso_pu_bacteria 2838707686 2838710703 579
712 iso_pu_bacteria 2838729681 2838729970 579
713 iso_pu_bacteria 2838742623 2838743015 579
714 iso_pu_bacteria 2841851746 2841852501 579
715 iso_pu_bacteria 2841864319 2841870780 579
716 iso_pu_bacteria 2842077413 2842078876 579
717 iso_pu_bacteria 2842110456 2842113272 579
718 iso_pu_bacteria 2842118031 2842118614 579
719 iso_pu_bacteria 2842146304 2842148013 579
720 iso_pu_bacteria 2842156927 2842158039 579
721 iso_pu_bacteria 2842163707 2842168797 579
722 iso_pu_bacteria 2842180545 2842181658 579
723 iso_pu_bacteria 2842192696 2842197355 579
724 iso_pu_bacteria 2842198810 2842203554 579
725 iso_pu_bacteria 2842205361 2842205482 579
726 iso_pu_bacteria 2842217011 2842217934 579
727 iso_pu_bacteria 2842229732 2842230291 579
728 iso_pu_bacteria 2842237096 2842240526 579
729 iso_pu_bacteria 2842243621 2842244193 579
730 iso_pu_bacteria 2842250916 2842253079 579
731 iso_pu_bacteria 2842257432 2842257721 579
732 iso_pu_bacteria 2842264693 2842266264 579
733 iso_pu_bacteria 2842271015 2842271405 579
734 iso_pu_bacteria 2842278818 2842278939 579
735 iso_pu_bacteria 2842285085 2842285603 579
736 iso_pu_bacteria 2842291075 2842292538 579
737 iso_pu_bacteria 2842304105 2842305033 579
738 iso_pu_bacteria 2842311132 2842314915 579
739 iso_pu_bacteria 2842317721 2842320707 579
740 iso_pu_bacteria 2842341865 2842346456 579
741 iso_pu_bacteria 2842363717 2842368965 579
742 iso_pu_bacteria 2842370503 2842374101 579
743 iso_pu_bacteria 2842377471 2842378936 579
744 iso_pu_bacteria 2842384541 2842385125 579
745 iso_pu_bacteria 2842395702 2842399886 579
746 iso_pu_bacteria 2842402390 2842402963 579
747 iso_pu_bacteria 2842409023 2842409665 579
748 iso_pu_bacteria 2842415677 2842416316 579
749 iso_pu_bacteria 2842422224 2842423759 579
750 iso_pu_bacteria 2842428310 2842430727 579
751 iso_pu_bacteria 2842434925 2842437286 579
752 iso_pu_bacteria 2842441272 2842443656 579
753 iso_pu_bacteria 2842447887 2842454049 579
754 iso_pu_bacteria 2842462802 2842464870 579
755 iso_pu_bacteria 2842469257 2842471904 579
756 iso_pu_bacteria 2842489311 2842491975 579
757 iso_pu_bacteria 2842495871 2842496829 579
758 iso_pu_bacteria 2842509118 2842511131 579
759 iso_pu_bacteria 2844454524 2844458424 579
760 iso_pu_bacteria 2852387548 2852390223 579
761 iso_pu_bacteria 2857516855 2857517436 579
762 iso_pu_bacteria 2933570622 2933570841 579
763 iso_pu_bacteria 2933586486 2933588672 579
764 iso_pu_bacteria 2933599457 2933600951 579
765 iso_pu_bacteria 2935894831 2935897028 579
766 iso_pu_bacteria 2935901341 2935901961 579
767 iso_pu_bacteria 2936367885 2936372040 579
768 iso_pu_bacteria 2936375103 2936379903 579
769 iso_pu_bacteria 2936381700 2936382807 579
770 iso_pu_bacteria 2996893221 2996894333 579
771 iso_pu_bacteria 3005416602 3005419472 579
772 iso_pu_bacteria 639633055 639649186 579
773 iso_pu_bacteria 8005275841 8005281204 579
774 iso_pu_bacteria 8005282627 8005283260 579
775 iso_pu_bacteria 8005289223 8005293634 579
776 iso_pu_bacteria 8005301065 8005303119 579
777 iso_pu_bacteria 8005307578 8005312828 579
778 iso_pu_bacteria 8005314921 8005316763 579
779 iso_pu_bacteria 8005376324 8005380922 579
780 iso_pu_bacteria 8005382845 8005389128 579
781 iso_pu_bacteria 8005395548 8005396108 579
782 iso_pu_bacteria 8005430974 8005435151 579
783 iso_pu_bacteria 8005460587 8005463681 579
784 iso_pu_bacteria 8005484373 8005489189 579
785 iso_pu_bacteria 8005497431 8005500893 579
786 iso_pu_bacteria 8005556819 8005557021 579
787 iso_pu_bacteria 8005563573 8005567987 579
788 iso_pu_bacteria 8005570704 8005573468 579
789 iso_pu_bacteria 8005619151 8005622266 579
790 iso_pu_bacteria 8005626139 8005632254 579
791 iso_pu_bacteria 8005645114 8005648135 579
792 iso_pu_bacteria 8005668836 8005672311 579
793 iso_pu_bacteria 8005688590 8005692113 579
794 iso_pu_bacteria 8005695170 8005697394 579
795 iso_pu_bacteria 8018127388 8018134088 579
796 iso_pu_bacteria 8018163183 8018164632 579
797 iso_pu_bacteria 8018176218 8018181331 579
798 iso_pu_bacteria 8023680758 8023683174 579
799 iso_pu_bacteria 8024479707 8024482869 579
800 iso_pu_bacteria 8024501048 8024504417 579
801 iso_pu_bacteria 8046767195 8046771931 579
802 iso_pu_bacteria 8056375014 8056375928 579
803 iso_pu_bacteria 8056382006 8056386719 579
804 iso_pu_bacteria 8057575449 8057575739 579
805 iso_pu_bacteria 8057874678 8057877680 579
806 3300002739 JGI25158J39367_1004417 JGI25158J39367_10044171 580
807 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001456 580
808 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002056 580
809 3300003374 JGI25161J50226_1001138 JGI25161J50226_10011388 580
810 3300003771 Ga0055526_1001490 Ga0055526_100149010 580
811 3300003781 Ga0055536_1001187 Ga0055536_10011879 580
812 3300003791 Ga0055530_10016062 Ga0055530_100160622 580
813 3300003794 Ga0055531_10004794 Ga0055531_100047944 580
814 3300004625 Ga0055543_1000047 Ga0055543_100004742 580
815 3300005262 Ga0065165_1000013 Ga0065165_1000013164 580
816 3300006946 Ga0079104_1006084 Ga0079104_10060842 580
817 3300013105 Ga0157369_10016027 Ga0157369_100160274 580
818 3300013249 Ga0171463_1003 Ga0171463_1003165 580
819 3300015690 Ga0183363_1156 Ga0183363_115614 580
820 3300021320 Ga0214544_1001800 Ga0214544_100180016 580
821 3300021321 Ga0214542_1000012 Ga0214542_100001288 580
822 3300021327 Ga0214543_1000024 Ga0214543_100002489 580
823 3300021327 Ga0214543_1000038 Ga0214543_100003867 580
824 3300025208 Ga0209436_101065 Ga0209436_1010653 580
825 3300025284 Ga0209130_1000034 Ga0209130_1000034159 580
826 3300025292 Ga0209676_1000482 Ga0209676_100048244 580
827 3300025294 Ga0209025_1000314 Ga0209025_100031421 580
828 3300025295 Ga0209564_1000013 Ga0209564_1000013158 580
829 3300025298 Ga0209050_1000646 Ga0209050_100064631 580
830 3300025299 Ga0209256_1000396 Ga0209256_10003962 580
831 3300025302 Ga0207426_1000006 Ga0207426_1000006532 580
832 3300025303 Ga0209051_1001414 Ga0209051_10014143 580
833 3300025304 Ga0209257_1003315 Ga0209257_10033155 580
834 3300027111 Ga0209281_1000318 Ga0209281_100031825 580
835 3300048929 Ga0496126_0017426 Ga0496126_0017426_1396_3144 580
836 3300049568 Ga0501031_0035722 Ga0501031_0035722_1186_2934 580
837 3300049569 Ga0501032_0036811 Ga0501032_0036811_645_2393 580
838 3300049570 Ga0501033_0027473 Ga0501033_0027473_2222_3970 580
839 3300049572 Ga0501036_0020924 Ga0501036_0020924_2468_4216 580
840 3300049573 Ga0501037_0041769 Ga0501037_0041769_647_2395 580
841 3300049822 Ga0501035_0071346 Ga0501035_0071346_233_1981 580
842 3300049823 Ga0501044_0132993 Ga0501044_0132993_675_2423 580
843 3300053125 Ga0500618_000677 Ga0500618_000677_2243_3988 580
844 iso_pu_bacteria 2582581308 2585277481 580
845 iso_pu_bacteria 2582581315 2585323335 580
846 iso_pu_bacteria 2582581316 2585331477 580
847 iso_pu_bacteria 2585427527 2585535108 580
848 iso_pu_bacteria 2585427530 2585555958 580
849 iso_pu_bacteria 2615840626 2616308956 580
850 iso_pu_bacteria 2615840698 2616554227 580
851 iso_pu_bacteria 2617270742 2617384719 580
852 iso_pu_bacteria 2667528174 2671111431 580
853 iso_pu_bacteria 2775507266 2778175414 580
854 iso_pu_bacteria 2818991453 2819637625 580
855 iso_pu_bacteria 2838029111 2838029807 580
856 iso_pu_bacteria 2842475841 2842476908 580
857 iso_pu_bacteria 2842482326 2842484562 580
858 iso_pu_bacteria 2842502639 2842503335 580
859 iso_pu_bacteria 2919408235 2919409978 580
860 iso_pu_bacteria 8005682033 8005682891 580
861 3300002739 JGI25158J39367_1000038 JGI25158J39367_100003815 581
862 3300002773 JGI25152J39213_1005336 JGI25152J39213_10053365 581
863 3300002773 JGI25152J39213_1011145 JGI25152J39213_10111452 581
864 3300002774 JGI25150J39212_1005870 JGI25150J39212_10058702 581
865 3300002987 JGI25159J45721_1000424 JGI25159J45721_100042421 581
866 3300003215 JGI25153J46596_10012015 JGI25153J46596_100120154 581
867 3300003215 JGI25153J46596_10027232 JGI25153J46596_100272322 581
868 3300003354 JGI25160J50197_1002863 JGI25160J50197_10028635 581
869 3300003374 JGI25161J50226_1000174 JGI25161J50226_100017437 581
870 3300003790 Ga0055528_1002830 Ga0055528_10028305 581
871 3300003792 Ga0055540_1007010 Ga0055540_10070102 581
872 3300004625 Ga0055543_1001281 Ga0055543_10012814 581
873 3300025208 Ga0209436_100150 Ga0209436_10015021 581
874 3300025245 Ga0207425_1006502 Ga0207425_10065022 581
875 3300025245 Ga0207425_1009350 Ga0207425_10093502 581
876 3300025258 Ga0209129_1005932 Ga0209129_10059324 581
877 3300025258 Ga0209129_1008863 Ga0209129_10088632 581
878 3300025273 Ga0209673_1009281 Ga0209673_10092812 581
879 3300025284 Ga0209130_1000020 Ga0209130_1000020253 581
880 3300025295 Ga0209564_1000647 Ga0209564_100064713 581
881 3300025297 Ga0209758_1001882 Ga0209758_100188216 581
882 3300025297 Ga0209758_1004734 Ga0209758_10047347 581
883 3300025299 Ga0209256_1001653 Ga0209256_100165310 581
884 3300025302 Ga0207426_1000008 Ga0207426_1000008321 581
885 3300025303 Ga0209051_1003927 Ga0209051_10039272 581
886 3300041413 Ga0439465_0003817 Ga0439465_0003817_1448_3196 581
887 3300046460 Ga0495638_0024145 Ga0495638_0024145_1126_2889 581
888 3300046507 Ga0495606_0025623 Ga0495606_0025623_2383_4131 581
889 3300046512 Ga0495610_0027406 Ga0495610_0027406_1218_2966 581
890 3300046522 Ga0495643_0002802 Ga0495643_0002802_7354_9102 581
891 3300047472 Ga0495686_0013660 Ga0495686_0013660_975_2720 581
892 3300048909 Ga0496106_0000982 Ga0496106_0000982_17416_19164 581
893 3300048920 Ga0496117_0019692 Ga0496117_0019692_2329_4077 581
894 3300048921 Ga0496118_0017417 Ga0496118_0017417_3199_4947 581
895 3300048924 Ga0496121_0039603 Ga0496121_0039603_854_2602 581
896 3300048928 Ga0496125_0017415 Ga0496125_0017415_1751_3499 581
897 3300049571 Ga0501034_0097012 Ga0501034_0097012_616_2367 581
898 3300049584 Ga0501068_0030071 Ga0501068_0030071_563_2311 581
899 3300049744 Ga0501083_0017170 Ga0501083_0017170_1955_3703 581
900 3300049823 Ga0501044_0077051 Ga0501044_0077051_256_2007 581
901 3300053134 Ga0500658_0002581 Ga0500658_0002581_1455_3203 581
902 3300053156 Ga0500622_0000458 Ga0500622_0000458_19657_21405 581
903 3300002773 JGI25152J39213_1000636 JGI25152J39213_10006365 582
904 3300002773 JGI25152J39213_1011099 JGI25152J39213_10110992 582
905 3300002774 JGI25150J39212_1000107 JGI25150J39212_10001077 582
906 3300003187 JGI25151J46595_10000374 JGI25151J46595_1000037439 582
907 3300003187 JGI25151J46595_10008401 JGI25151J46595_100084013 582
908 3300003215 JGI25153J46596_10000696 JGI25153J46596_100006963 582
909 3300003215 JGI25153J46596_10027126 JGI25153J46596_100271262 582
910 3300003775 Ga0055524_1007091 Ga0055524_10070913 582
911 3300003790 Ga0055528_1001734 Ga0055528_10017347 582
912 3300025245 Ga0207425_1000075 Ga0207425_100007559 582
913 3300025258 Ga0209129_1000156 Ga0209129_100015639 582
914 3300025258 Ga0209129_1000218 Ga0209129_10002185 582
915 3300025258 Ga0209129_1006736 Ga0209129_10067362 582
916 3300025273 Ga0209673_1000010 Ga0209673_1000010213 582
917 3300025294 Ga0209025_1000070 Ga0209025_1000070238 582
918 3300025294 Ga0209025_1005193 Ga0209025_10051937 582
919 3300025294 Ga0209025_1015317 Ga0209025_10153174 582
920 3300025294 Ga0209025_1022888 Ga0209025_10228883 582
921 3300025295 Ga0209564_1004823 Ga0209564_10048236 582
922 3300025297 Ga0209758_1000758 Ga0209758_10007584 582
923 3300025297 Ga0209758_1002154 Ga0209758_10021544 582
924 3300025299 Ga0209256_1001736 Ga0209256_100173610 582
925 3300031731 Ga0307405_10000857 Ga0307405_100008576 582
926 3300031911 Ga0307412_10000493 Ga0307412_100004935 582
927 3300046460 Ga0495638_0001181 Ga0495638_0001181_17762_19513 582
928 3300046474 Ga0495605_0001952 Ga0495605_0001952_1833_3584 582
929 3300046506 Ga0495583_0013196 Ga0495583_0013196_1496_3247 582
930 3300046506 Ga0495583_0019889 Ga0495583_0019889_417_2168 582
931 3300046512 Ga0495610_0003825 Ga0495610_0003825_3144_4895 582
932 3300046518 Ga0495631_0003360 Ga0495631_0003360_5508_7259 582
933 3300046519 Ga0495632_0005104 Ga0495632_0005104_5492_7243 582
934 3300046519 Ga0495632_0007228 Ga0495632_0007228_4357_6108 582
935 3300046538 Ga0495609_0013320 Ga0495609_0013320_380_2131 582
936 3300046616 Ga0495668_0008091 Ga0495668_0008091_1758_3509 582
937 3300046660 Ga0495625_0001387 Ga0495625_0001387_19968_21719 582
938 3300046675 Ga0495657_0013648 Ga0495657_0013648_3507_5261 582
939 3300046691 Ga0495670_0007690 Ga0495670_0007690_2000_3751 582
940 3300046809 Ga0495600_0044740 Ga0495600_0044740_609_2363 582
941 3300046810 Ga0495660_0013338 Ga0495660_0013338_294_2045 582
942 3300047320 Ga0495672_0011266 Ga0495672_0011266_3027_4778 582
943 3300048919 Ga0496116_0015182 Ga0496116_0015182_439_2190 582
944 3300048919 Ga0496116_0022090 Ga0496116_0022090_1484_3235 582
945 3300048921 Ga0496118_0024847 Ga0496118_0024847_2969_4720 582
946 3300048924 Ga0496121_0036685 Ga0496121_0036685_1235_2986 582
947 3300048924 Ga0496121_0106562 Ga0496121_0106562_172_1923 582
948 3300048925 Ga0496122_0017023 Ga0496122_0017023_1986_3737 582
949 3300048925 Ga0496122_0042821 Ga0496122_0042821_1758_3509 582
950 3300048927 Ga0496124_0050763 Ga0496124_0050763_649_2400 582
951 3300048928 Ga0496125_0027607 Ga0496125_0027607_3220_4971 582
952 3300053139 Ga0500568_0004818 Ga0500568_0004818_3850_5601 582
953 3300053148 Ga0500590_003631 Ga0500590_003631_751_2505 582
954 3300053153 Ga0500616_0001018 Ga0500616_0001018_22581_24332 582
955 3300003187 JGI25151J46595_10000839 JGI25151J46595_100008395 583
956 3300003215 JGI25153J46596_10005690 JGI25153J46596_100056904 583
957 3300003215 JGI25153J46596_10009242 JGI25153J46596_100092422 583
958 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001654 583
959 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000199 583
960 3300003374 JGI25161J50226_1003445 JGI25161J50226_10034452 583
961 3300003771 Ga0055526_1003506 Ga0055526_10035065 583
962 3300003771 Ga0055526_1003741 Ga0055526_10037414 583
963 3300003775 Ga0055524_1004376 Ga0055524_10043763 583
964 3300003790 Ga0055528_1001199 Ga0055528_100119911 583
965 3300003790 Ga0055528_1008190 Ga0055528_10081905 583
966 3300003790 Ga0055528_1021493 Ga0055528_10214932 583
967 3300003792 Ga0055540_1000929 Ga0055540_100092914 583
968 3300003792 Ga0055540_1009093 Ga0055540_10090932 583
969 3300003792 Ga0055540_1015257 Ga0055540_10152572 583
970 3300004625 Ga0055543_1000003 Ga0055543_1000003115 583
971 3300004625 Ga0055543_1000500 Ga0055543_10005005 583
972 3300005262 Ga0065165_1000068 Ga0065165_100006854 583
973 3300005331 Ga0070670_100002993 Ga0070670_1000029938 583
974 3300006048 Ga0075363_100027951 Ga0075363_1000279512 583
975 3300006353 Ga0075370_10010432 Ga0075370_100104323 583
976 3300009765 Ga0123341_1000007 Ga0123341_100000784 583
977 3300009766 Ga0123342_1013992 Ga0123342_10139925 583
978 3300025258 Ga0209129_1001767 Ga0209129_10017677 583
979 3300025273 Ga0209673_1000117 Ga0209673_100011781 583
980 3300025273 Ga0209673_1000151 Ga0209673_100015170 583
981 3300025273 Ga0209673_1000863 Ga0209673_100086329 583
982 3300025273 Ga0209673_1001685 Ga0209673_10016854 583
983 3300025273 Ga0209673_1009188 Ga0209673_10091883 583
984 3300025284 Ga0209130_1000003 Ga0209130_1000003123 583
985 3300025292 Ga0209676_1010300 Ga0209676_10103004 583
986 3300025294 Ga0209025_1000506 Ga0209025_10005064 583
987 3300025295 Ga0209564_1001780 Ga0209564_100178014 583
988 3300025297 Ga0209758_1000405 Ga0209758_10004054 583
989 3300025297 Ga0209758_1000655 Ga0209758_10006554 583
990 3300025298 Ga0209050_1008819 Ga0209050_10088194 583
991 3300025299 Ga0209256_1005804 Ga0209256_10058045 583
992 3300025299 Ga0209256_1012329 Ga0209256_10123292 583
993 3300025302 Ga0207426_1000011 Ga0207426_1000011656 583
994 3300025302 Ga0207426_1000221 Ga0207426_1000221126 583
995 3300025303 Ga0209051_1000097 Ga0209051_100009761 583
996 3300025303 Ga0209051_1007515 Ga0209051_10075152 583
997 3300025303 Ga0209051_1013189 Ga0209051_10131894 583
998 3300025304 Ga0209257_1001142 Ga0209257_100114225 583
999 3300025925 Ga0207650_10000837 Ga0207650_100008377 583
1000 3300028794 Ga0307515_10007368 Ga0307515_1000736816 583
1001 3300031456 Ga0307513_10119150 Ga0307513_101191502 583
1002 3300041512 Ga0451853_2433547 Ga0451853_2433547_378_2138 583
1003 3300046501 Ga0495607_0022946 Ga0495607_0022946_1054_2814 583
1004 3300046507 Ga0495606_0007174 Ga0495606_0007174_4489_6249 583
1005 3300046507 Ga0495606_0038135 Ga0495606_0038135_332_2083 583
1006 3300046512 Ga0495610_0001969 Ga0495610_0001969_9096_10856 583
1007 3300046519 Ga0495632_0050993 Ga0495632_0050993_188_1948 583
1008 3300046522 Ga0495643_0027634 Ga0495643_0027634_122_1882 583
1009 3300046524 Ga0495648_0013780 Ga0495648_0013780_3907_5667 583
1010 3300046525 Ga0495663_0014361 Ga0495663_0014361_194_1954 583
1011 3300046530 Ga0495654_0035169 Ga0495654_0035169_707_2467 583
1012 3300046542 Ga0495597_0014741 Ga0495597_0014741_1238_2998 583
1013 3300046694 Ga0495649_0035998 Ga0495649_0035998_563_2323 583
1014 3300047323 Ga0495683_0009820 Ga0495683_0009820_2701_4461 583
1015 3300047472 Ga0495686_0006538 Ga0495686_0006538_441_2201 583
1016 3300053086 Ga0500578_0046899 Ga0500578_0046899_891_2651 583
1017 3300053109 Ga0500569_012298 Ga0500569_012298_62_1822 583
1018 3300053134 Ga0500658_0000526 Ga0500658_0000526_5382_7142 583
1019 3300053153 Ga0500616_0005682 Ga0500616_0005682_4401_6161 583
1020 3300001979 JGI24740J21852_10000015 JGI24740J21852_1000001542 584
1021 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001292 584
1022 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000141 584
1023 3300002737 JGI25162J39368_1000366 JGI25162J39368_100036623 584
1024 3300002737 JGI25162J39368_1000368 JGI25162J39368_100036821 584
1025 3300002738 JGI25154J39366_1000122 JGI25154J39366_100012216 584
1026 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004440 584
1027 3300003214 JGI25165J46597_1000516 JGI25165J46597_100051613 584
1028 3300003214 JGI25165J46597_1001042 JGI25165J46597_100104214 584
1029 3300009093 Ga0105240_10000076 Ga0105240_10000076161 584
1030 3300009177 Ga0105248_10077623 Ga0105248_100776233 584
1031 3300009545 Ga0105237_10000226 Ga0105237_1000022634 584
1032 3300010375 Ga0105239_10000641 Ga0105239_100006416 584
1033 3300013104 Ga0157370_10000455 Ga0157370_1000045542 584
1034 3300013105 Ga0157369_10039605 Ga0157369_100396054 584
1035 3300015262 Ga0182007_10004384 Ga0182007_100043844 584
1036 3300015265 Ga0182005_1003578 Ga0182005_10035782 584
1037 3300025206 Ga0209435_100012 Ga0209435_100012343 584
1038 3300025233 Ga0209437_100051 Ga0209437_100051328 584
1039 3300025233 Ga0209437_100098 Ga0209437_100098168 584
1040 3300025246 Ga0209646_1000026 Ga0209646_1000026343 584
1041 3300025250 Ga0209026_1000014 Ga0209026_1000014343 584
1042 3300025256 Ga0209759_1000012 Ga0209759_1000012343 584
1043 3300025261 Ga0209233_1000095 Ga0209233_1000095285 584
1044 3300025261 Ga0209233_1000113 Ga0209233_100011315 584
1045 3300025261 Ga0209233_1000427 Ga0209233_10004274 584
1046 3300025913 Ga0207695_10000011 Ga0207695_1000001140 584
1047 3300025914 Ga0207671_10000093 Ga0207671_1000009392 584
1048 3300025941 Ga0207711_10075060 Ga0207711_100750602 584
1049 3300027312 Ga0209371_1007555 Ga0209371_10075552 584
1050 3300030500 Ga0268256_1007789 Ga0268256_10077892 584
1051 3300044842 Ga0466957_0021187 Ga0466957_0021187_581_2335 584
1052 3300048903 Ga0496100_0006892 Ga0496100_0006892_1691_3445 584
1053 3300048905 Ga0496102_0017086 Ga0496102_0017086_1846_3600 584
1054 3300048906 Ga0496103_0008310 Ga0496103_0008310_1654_3408 584
1055 3300048919 Ga0496116_0009760 Ga0496116_0009760_5606_7360 584
1056 3300048920 Ga0496117_0001574 Ga0496117_0001574_16860_18614 584
1057 3300048921 Ga0496118_0003357 Ga0496118_0003357_5473_7227 584
1058 3300048922 Ga0496119_0011615 Ga0496119_0011615_4355_6109 584
1059 3300048923 Ga0496120_0004953 Ga0496120_0004953_6626_8380 584
1060 3300048924 Ga0496121_0002536 Ga0496121_0002536_19904_21658 584
1061 3300048925 Ga0496122_0010294 Ga0496122_0010294_6306_8060 584
1062 3300048925 Ga0496122_0018314 Ga0496122_0018314_1837_3591 584
1063 3300048926 Ga0496123_0012104 Ga0496123_0012104_1672_3426 584
1064 3300048928 Ga0496125_0018773 Ga0496125_0018773_3003_4757 584

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03717

PBP_dimer

Penicillin-binding Protein dimerisation domain

99

228

0.91

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

274

576

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xqx-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae with the h514a mutation at ph 7.5 0.9513 234 572
6xqz-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 7.5 0.9497 234 572
6xqy-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 9.5 0.9492 234 572
6p54-assembly2.cif.gz_B crystal structure of transpeptidase domain of pbp2 from neisseria gonorrhoeae acylated by ceftriaxone 0.9463 234 576
6p56-assembly1.cif.gz_A crystal structure of the transpeptidase domain of a t498a mutant of pbp2 from neisseria gonorrhoeae 0.9431 234 571
ID Description Score Start End Superfamily
3ue3A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9259 296 477 3.40.710.10
5uy7A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9238 234 572 3.40.710.10
5df7A02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9207 235 572 3.40.710.10
4u3tA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9174 234 572 3.40.710.10
3ue3A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9114 296 477 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A4Q3H5U8-F1-model_v4 Penicillin-binding protein 2 0.9552 321 578 GO:0005886
GO:0008658
GO:0071555
AF-A0A836QQU9-F1-model_v4 Penicillin-binding protein 2 0.9546 229 562 GO:0005886
GO:0008658
GO:0071555
AF-A0A522SM81-F1-model_v4 Penicillin-binding protein 2 0.9526 162 584 GO:0005886
GO:0008658
GO:0071555
AF-A0A1G3IIE1-F1-model_v4 Penicillin-binding protein transpeptidase domain-containing protein 0.9493 317 576 GO:0005886
GO:0008658
GO:0071555
AF-I5BQZ1-F1-model_v4 Penicillin-binding protein, transpeptidase 0.9492 317 584 GO:0005886
GO:0008658
GO:0071555

Feature Viewer

pLDDT pTM Quality
86.41 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map