F489356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1064 | 740 | 468 | 578 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0000770|Ga0495610_0000770_20372_22162 |
| Length | 596 |
| Sequence | MPRNGSFCLPIAYRVPSCAIMSIIQTLAARSGRLVSLDFGARGGGRRLIKPRRKSASPRSRLAIVGGAIVVAYSVIFGKLVYYAEQGGIDISSIPPGPSMMASRPEIDDRNGQVLATDIRTVSMFAEPIKIVDVDDAVEKLSSVFPDLDRKTMYERLSNKRSHFAWLKRQLSPKQQSEVLKLGIPAIGFRPEVKRFYPGGSTAAHILGYVDIDNHGVAGMEKYLDDQGLSALASTGLAASDSLAPVRLSIDLRVQNIVHDVVVDALTRYQSKAAGAVILDVHTGEVLAMASAPDFDPNDPNAAGSRDGWLNRMSNGTDEMGSVFKTFSMAMAFDTGTVKMSDSFDASTPLHYGGFTIHDDRDVPRRVLSVAEIFRYSSNVGTAKMMEKVGMDNQRAYLTRFGLLSKMQTELPEVKTPSQPRVWKMINSLTAAFGHGVATTPMQTAVAGAALMDGGKLIEPTFLPRTEEEAEKTATVVVKKSTSDVIKSLFKLNGEQGSGRFADVPGFHVGGKTGTANKVINGHYSHTLSFNSFLGAFPIDNPKYVILSYIDQPLTGLYNLNLAAETAAPMVADIVKRSAPILGVQPDFSKNLLVGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 16 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 17 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 18 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 23 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 29 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 30 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 31 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 32 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 33 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 34 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 35 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 36 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 37 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 38 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 39 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 40 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 41 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 42 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 43 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 44 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 45 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 46 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 47 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 48 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 49 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 50 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 51 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 52 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 53 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 54 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 55 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 56 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 57 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 58 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 59 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 60 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 61 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 62 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 63 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 64 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 65 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 66 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 67 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 68 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 69 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 70 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 71 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 72 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 73 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 74 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 75 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 78 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 79 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 80 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 81 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 82 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 83 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 84 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 85 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 86 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 87 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 88 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 89 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 90 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 91 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 92 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 93 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 94 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 95 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 96 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 97 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 98 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 99 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 100 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 101 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 102 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 103 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 104 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 105 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 106 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 107 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 108 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 109 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 110 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 111 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 112 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 113 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 114 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 115 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 116 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 117 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 118 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 119 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 120 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 121 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 122 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 123 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 124 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 125 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 126 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 127 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 128 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 129 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 130 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 131 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 132 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 133 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 134 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 135 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 136 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 137 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 138 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 139 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 140 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 141 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 142 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 143 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 144 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 145 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 146 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 147 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 148 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 149 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 150 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 151 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 152 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 153 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 154 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 155 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 156 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 157 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 158 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 159 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 160 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 161 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 162 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 163 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 164 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 165 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 166 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 167 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 168 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 169 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 170 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 171 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 172 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 173 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 174 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 175 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 176 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 177 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 178 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 179 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 180 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 181 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 182 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 183 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 184 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 185 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 186 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 187 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 188 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 189 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 190 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 191 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 192 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 193 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 194 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 195 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 196 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 197 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 198 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 199 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 200 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 201 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 202 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 203 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 204 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 205 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 206 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 207 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 208 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 209 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 210 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 211 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 212 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 213 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 214 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 215 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 216 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 217 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 218 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 219 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 220 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 221 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 222 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 223 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 224 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 225 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 226 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 227 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 228 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 229 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 230 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 231 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 232 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 233 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 234 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 235 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 236 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 237 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 238 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 239 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 240 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 241 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 242 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 243 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 244 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 245 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 246 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 247 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 248 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 249 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 250 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 251 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 252 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 253 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 254 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 255 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 256 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 257 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 258 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 259 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 260 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 261 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 262 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 263 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 264 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 265 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 266 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 267 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 268 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 269 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 270 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 271 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 272 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 273 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 274 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 275 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 276 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 277 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 278 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 279 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 280 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 281 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 282 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 283 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 284 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 285 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 286 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 287 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 288 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 289 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 290 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 291 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 292 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 293 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 294 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 295 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 296 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 297 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 298 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 299 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 300 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 301 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 302 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 303 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 304 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 305 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 306 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 307 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 308 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 309 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 310 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 311 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 312 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 313 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 314 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 315 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 316 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 317 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 318 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 319 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 320 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 321 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 322 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 323 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 324 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 325 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 326 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 327 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 328 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 329 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 330 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 331 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 332 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 333 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 334 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 335 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 336 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 337 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 338 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 339 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 340 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 341 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 342 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 343 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 344 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 345 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 346 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 347 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 348 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 349 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 350 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 351 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 352 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 353 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 354 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 355 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 356 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 357 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 358 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 359 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 360 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 361 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 362 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 363 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 364 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 365 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 366 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 367 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 368 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 369 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 370 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 371 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 372 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 373 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 374 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 375 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 376 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 377 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 378 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 379 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 380 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 381 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 382 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 383 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 384 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 385 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 386 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 387 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 388 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 389 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 390 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 391 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 392 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 393 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 394 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 395 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 396 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 397 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 398 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 399 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 400 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 401 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 402 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 403 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 404 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 405 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 406 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 407 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 408 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 409 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 410 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 411 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 412 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 413 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 414 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 415 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 416 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 417 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 418 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 419 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 420 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 421 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 422 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 423 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 424 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 425 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 426 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 427 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 428 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 429 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 430 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 431 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 432 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 433 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 434 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 435 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 436 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 437 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 438 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 439 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 440 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 441 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 442 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 443 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 444 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 445 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 446 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 447 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 448 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 449 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 450 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 451 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 452 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 453 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 454 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 455 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 456 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 457 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 458 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 459 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 460 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 461 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 462 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 463 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 464 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 465 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 466 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 467 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 468 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 469 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 470 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 471 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 472 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 473 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 474 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 475 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 476 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 477 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 478 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 479 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 480 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 481 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 482 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 483 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 484 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 485 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 486 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 487 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 488 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 489 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 490 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 491 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 492 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 493 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 494 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 495 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 496 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 497 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 498 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 499 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 500 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 501 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 502 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 503 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 504 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 505 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 506 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 507 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 508 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 509 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 510 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 511 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 512 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 513 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 514 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 515 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 516 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 517 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 518 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 519 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 520 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 521 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 522 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 523 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 524 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 525 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 526 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 527 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 528 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 529 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 532 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 533 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 534 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 535 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 536 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 537 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 538 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 539 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 541 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 542 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 543 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 544 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 548 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 549 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 550 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 551 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 552 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 553 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 554 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 555 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 556 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 557 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 558 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 560 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 561 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 563 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 564 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 565 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 566 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 567 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 570 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 571 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 574 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 584 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 586 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 587 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 588 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 589 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 590 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 591 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 592 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 593 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 594 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 595 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 596 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 597 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 598 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 599 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 600 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 601 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 602 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 603 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 604 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 605 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 606 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 638 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 639 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 640 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 641 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 642 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 643 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 644 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 645 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 646 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 647 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 648 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 649 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 650 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 651 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 652 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 653 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 654 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 655 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 656 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 658 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 660 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 664 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 667 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 669 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 670 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 671 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 672 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 674 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 675 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 676 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 677 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 678 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 679 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 680 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 681 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 682 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 683 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 684 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 685 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 686 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 687 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 688 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 689 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 690 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 691 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 692 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 693 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 694 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 695 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 696 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 697 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 698 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 699 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 700 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 701 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 702 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 703 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 704 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 705 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 706 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 707 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 708 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 709 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 710 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 711 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 712 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 713 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 714 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 715 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 716 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 717 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 718 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 719 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 720 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 721 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 722 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 723 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 724 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 725 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 726 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 727 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 728 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 729 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 730 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 731 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 732 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 733 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 734 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 735 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 736 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 737 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 738 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 739 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 740 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.08 |
| Metatranscriptomes | 0 |
| Isolates | 55.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 20.11 |
| Nodule | 41.17 |
| Rhizoplane | 1.79 |
| Rhizosphere | 18.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000015 | 3300001979 | Bacteria | 58951 |
| 2 | JGI24740J21852_10000464 | 3300001979 | Bacteria | 17398 |
| 3 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 4 | JGI25155J39150_1000195 | 3300002704 | Bacteria | 25809 |
| 5 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 6 | JGI25156J39149_1000433 | 3300002705 | Bacteria | 25809 |
| 7 | JGI25162J39368_1000366 | 3300002737 | Bacteria | 38535 |
| 8 | JGI25162J39368_1000368 | 3300002737 | Bacteria | 38495 |
| 9 | JGI25162J39368_1000477 | 3300002737 | Bacteria | 30773 |
| 10 | JGI25162J39368_1000802 | 3300002737 | Bacteria | 20890 |
| 11 | JGI25154J39366_1000122 | 3300002738 | Bacteria | 61892 |
| 12 | JGI25154J39366_1000360 | 3300002738 | Bacteria | 25809 |
| 13 | JGI25158J39367_1000038 | 3300002739 | Bacteria | 30017 |
| 14 | JGI25158J39367_1000694 | 3300002739 | Bacteria | 6532 |
| 15 | JGI25158J39367_1004417 | 3300002739 | Bacteria | 2112 |
| 16 | JGI25157J39369_1000044 | 3300002741 | Bacteria | 122466 |
| 17 | JGI25157J39369_1000458 | 3300002741 | Bacteria | 25809 |
| 18 | JGI25152J39213_1000636 | 3300002773 | Bacteria | 18557 |
| 19 | JGI25152J39213_1001023 | 3300002773 | Bacteria | 13396 |
| 20 | JGI25152J39213_1005336 | 3300002773 | Bacteria | 3780 |
| 21 | JGI25152J39213_1011099 | 3300002773 | Bacteria | 2013 |
| 22 | JGI25152J39213_1011145 | 3300002773 | Bacteria | 2007 |
| 23 | JGI25150J39212_1000026 | 3300002774 | Bacteria | 107804 |
| 24 | JGI25150J39212_1000107 | 3300002774 | Bacteria | 48306 |
| 25 | JGI25150J39212_1005870 | 3300002774 | Bacteria | 2582 |
| 26 | JGI25159J45721_1000014 | 3300002987 | Bacteria | 147809 |
| 27 | JGI25159J45721_1000424 | 3300002987 | Bacteria | 19457 |
| 28 | JGI25159J45721_1000493 | 3300002987 | Bacteria | 18075 |
| 29 | JGI25151J46595_10000053 | 3300003187 | Bacteria | 156841 |
| 30 | JGI25151J46595_10000374 | 3300003187 | Bacteria | 46807 |
| 31 | JGI25151J46595_10000839 | 3300003187 | Bacteria | 24488 |
| 32 | JGI25151J46595_10003886 | 3300003187 | Bacteria | 8064 |
| 33 | JGI25151J46595_10008401 | 3300003187 | Bacteria | 4969 |
| 34 | JGI25151J46595_10033516 | 3300003187 | Bacteria | 1978 |
| 35 | JGI25165J46597_1000516 | 3300003214 | Bacteria | 36635 |
| 36 | JGI25165J46597_1000603 | 3300003214 | Bacteria | 30773 |
| 37 | JGI25165J46597_1001042 | 3300003214 | Bacteria | 18102 |
| 38 | JGI25165J46597_1001132 | 3300003214 | Bacteria | 16749 |
| 39 | JGI25165J46597_1002650 | 3300003214 | Bacteria | 5382 |
| 40 | JGI25153J46596_10000696 | 3300003215 | Bacteria | 20557 |
| 41 | JGI25153J46596_10005690 | 3300003215 | Bacteria | 6503 |
| 42 | JGI25153J46596_10009242 | 3300003215 | Bacteria | 4611 |
| 43 | JGI25153J46596_10012015 | 3300003215 | Bacteria | 3781 |
| 44 | JGI25153J46596_10027126 | 3300003215 | Bacteria | 2013 |
| 45 | JGI25153J46596_10027232 | 3300003215 | Bacteria | 2007 |
| 46 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 47 | JGI25160J50197_1000020 | 3300003354 | Bacteria | 232739 |
| 48 | JGI25160J50197_1002863 | 3300003354 | Bacteria | 7895 |
| 49 | JGI25160J50197_1018252 | 3300003354 | Bacteria | 2192 |
| 50 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 51 | JGI25161J50226_1000010 | 3300003374 | Bacteria | 214823 |
| 52 | JGI25161J50226_1000174 | 3300003374 | Bacteria | 43080 |
| 53 | JGI25161J50226_1001138 | 3300003374 | Bacteria | 8895 |
| 54 | JGI25161J50226_1003445 | 3300003374 | Bacteria | 3611 |
| 55 | Ga0055526_1001490 | 3300003771 | Bacteria | 16607 |
| 56 | Ga0055526_1003506 | 3300003771 | Bacteria | 9921 |
| 57 | Ga0055526_1003741 | 3300003771 | Bacteria | 9498 |
| 58 | Ga0055524_1002170 | 3300003775 | Bacteria | 10327 |
| 59 | Ga0055524_1004376 | 3300003775 | Bacteria | 6520 |
| 60 | Ga0055524_1007091 | 3300003775 | Bacteria | 4805 |
| 61 | Ga0055536_1001187 | 3300003781 | Bacteria | 16224 |
| 62 | Ga0055536_1002960 | 3300003781 | Bacteria | 9313 |
| 63 | Ga0055528_1000584 | 3300003790 | Bacteria | 27492 |
| 64 | Ga0055528_1001199 | 3300003790 | Bacteria | 16717 |
| 65 | Ga0055528_1001734 | 3300003790 | Bacteria | 12611 |
| 66 | Ga0055528_1002830 | 3300003790 | Bacteria | 9076 |
| 67 | Ga0055528_1008190 | 3300003790 | Bacteria | 4519 |
| 68 | Ga0055528_1021493 | 3300003790 | Bacteria | 2046 |
| 69 | Ga0055530_10016062 | 3300003791 | Bacteria | 2410 |
| 70 | Ga0055540_1000929 | 3300003792 | Bacteria | 19079 |
| 71 | Ga0055540_1005992 | 3300003792 | Bacteria | 4928 |
| 72 | Ga0055540_1007010 | 3300003792 | Bacteria | 4345 |
| 73 | Ga0055540_1009093 | 3300003792 | Bacteria | 3482 |
| 74 | Ga0055540_1015257 | 3300003792 | Bacteria | 2247 |
| 75 | Ga0055531_10004794 | 3300003794 | Bacteria | 8079 |
| 76 | Ga0055531_10007721 | 3300003794 | Bacteria | 5807 |
| 77 | Ga0058692_1008129 | 3300003856 | Bacteria | 2720 |
| 78 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 79 | Ga0055543_1000047 | 3300004625 | Bacteria | 111073 |
| 80 | Ga0055543_1000353 | 3300004625 | Bacteria | 31219 |
| 81 | Ga0055543_1000500 | 3300004625 | Bacteria | 22620 |
| 82 | Ga0055543_1001281 | 3300004625 | Bacteria | 10341 |
| 83 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 84 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 85 | Ga0065165_1008678 | 3300005262 | Bacteria | 4705 |
| 86 | Ga0065165_1009678 | 3300005262 | Bacteria | 4277 |
| 87 | Ga0070670_100000515 | 3300005331 | Bacteria | 30924 |
| 88 | Ga0070670_100002993 | 3300005331 | Bacteria | 13983 |
| 89 | Ga0070665_100040748 | 3300005548 | Bacteria | 4668 |
| 90 | Ga0068856_100007936 | 3300005614 | Bacteria | 10367 |
| 91 | Ga0075365_10005814 | 3300006038 | Bacteria | 6702 |
| 92 | Ga0075363_100027951 | 3300006048 | Bacteria | 2897 |
| 93 | Ga0075364_10012850 | 3300006051 | Bacteria | 5136 |
| 94 | Ga0075367_10063647 | 3300006178 | Bacteria | 2205 |
| 95 | Ga0075369_10013843 | 3300006186 | Bacteria | 3211 |
| 96 | Ga0075370_10010432 | 3300006353 | Bacteria | 4858 |
| 97 | Ga0075370_10010686 | 3300006353 | Bacteria | 4811 |
| 98 | Ga0079104_1001253 | 3300006946 | Bacteria | 17716 |
| 99 | Ga0079104_1006084 | 3300006946 | Bacteria | 4665 |
| 100 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 101 | Ga0105240_10000201 | 3300009093 | Bacteria | 121112 |
| 102 | Ga0105248_10077623 | 3300009177 | Bacteria | 3734 |
| 103 | Ga0105237_10000226 | 3300009545 | Bacteria | 79798 |
| 104 | Ga0105237_10010705 | 3300009545 | Bacteria | 9734 |
| 105 | Ga0123341_1000007 | 3300009765 | Bacteria | 147072 |
| 106 | Ga0123342_1004784 | 3300009766 | Bacteria | 20320 |
| 107 | Ga0123342_1013992 | 3300009766 | Bacteria | 7821 |
| 108 | Ga0105239_10000641 | 3300010375 | Bacteria | 49765 |
| 109 | Ga0105239_10009932 | 3300010375 | Bacteria | 10687 |
| 110 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 111 | Ga0157370_10000455 | 3300013104 | Bacteria | 51231 |
| 112 | Ga0157370_10000461 | 3300013104 | Bacteria | 50850 |
| 113 | Ga0157370_10005282 | 3300013104 | Bacteria | 14508 |
| 114 | Ga0157369_10016027 | 3300013105 | Bacteria | 8433 |
| 115 | Ga0157369_10039605 | 3300013105 | Bacteria | 5149 |
| 116 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 117 | Ga0182007_10000314 | 3300015262 | Bacteria | 30873 |
| 118 | Ga0182007_10004384 | 3300015262 | Bacteria | 6406 |
| 119 | Ga0182005_1001330 | 3300015265 | Bacteria | 10088 |
| 120 | Ga0182005_1003578 | 3300015265 | Bacteria | 5231 |
| 121 | Ga0183363_1156 | 3300015690 | Bacteria | 16690 |
| 122 | Ga0214544_1001800 | 3300021320 | Bacteria | 45046 |
| 123 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 124 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 125 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 126 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 127 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 128 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 129 | Ga0209435_100122 | 3300025206 | Bacteria | 28422 |
| 130 | Ga0209436_100025 | 3300025208 | Bacteria | 93575 |
| 131 | Ga0209436_100150 | 3300025208 | Bacteria | 33510 |
| 132 | Ga0209436_101065 | 3300025208 | Bacteria | 10387 |
| 133 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 134 | Ga0209437_100064 | 3300025233 | Bacteria | 334360 |
| 135 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 136 | Ga0209437_100469 | 3300025233 | Bacteria | 30961 |
| 137 | Ga0207425_1000075 | 3300025245 | Bacteria | 107452 |
| 138 | Ga0207425_1000113 | 3300025245 | Bacteria | 77236 |
| 139 | Ga0207425_1005180 | 3300025245 | Bacteria | 3756 |
| 140 | Ga0207425_1006502 | 3300025245 | Bacteria | 3190 |
| 141 | Ga0207425_1009350 | 3300025245 | Bacteria | 2441 |
| 142 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 143 | Ga0209646_1000385 | 3300025246 | Bacteria | 28422 |
| 144 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 145 | Ga0209026_1000501 | 3300025250 | Bacteria | 28422 |
| 146 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 147 | Ga0209759_1000743 | 3300025256 | Bacteria | 28422 |
| 148 | Ga0209129_1000156 | 3300025258 | Bacteria | 107484 |
| 149 | Ga0209129_1000181 | 3300025258 | Bacteria | 89982 |
| 150 | Ga0209129_1000218 | 3300025258 | Bacteria | 66076 |
| 151 | Ga0209129_1000348 | 3300025258 | Bacteria | 39224 |
| 152 | Ga0209129_1001767 | 3300025258 | Bacteria | 11565 |
| 153 | Ga0209129_1005932 | 3300025258 | Bacteria | 4125 |
| 154 | Ga0209129_1006736 | 3300025258 | Bacteria | 3622 |
| 155 | Ga0209129_1007796 | 3300025258 | Bacteria | 3100 |
| 156 | Ga0209129_1008863 | 3300025258 | Bacteria | 2734 |
| 157 | Ga0209233_1000081 | 3300025261 | Bacteria | 336832 |
| 158 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 159 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 160 | Ga0209233_1000217 | 3300025261 | Bacteria | 106187 |
| 161 | Ga0209233_1000375 | 3300025261 | Bacteria | 39219 |
| 162 | Ga0209233_1000427 | 3300025261 | Bacteria | 30799 |
| 163 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 164 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 165 | Ga0209673_1000151 | 3300025273 | Bacteria | 148103 |
| 166 | Ga0209673_1000863 | 3300025273 | Bacteria | 39346 |
| 167 | Ga0209673_1001685 | 3300025273 | Bacteria | 18869 |
| 168 | Ga0209673_1002134 | 3300025273 | Bacteria | 14747 |
| 169 | Ga0209673_1009188 | 3300025273 | Bacteria | 4312 |
| 170 | Ga0209673_1009281 | 3300025273 | Bacteria | 4285 |
| 171 | Ga0209673_1021742 | 3300025273 | Bacteria | 2234 |
| 172 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 173 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 174 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 175 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 176 | Ga0209676_1000482 | 3300025292 | Bacteria | 65372 |
| 177 | Ga0209676_1010300 | 3300025292 | Bacteria | 3917 |
| 178 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 179 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 180 | Ga0209025_1000181 | 3300025294 | Bacteria | 156894 |
| 181 | Ga0209025_1000314 | 3300025294 | Bacteria | 107720 |
| 182 | Ga0209025_1000506 | 3300025294 | Bacteria | 74798 |
| 183 | Ga0209025_1001813 | 3300025294 | Bacteria | 25245 |
| 184 | Ga0209025_1001869 | 3300025294 | Bacteria | 24674 |
| 185 | Ga0209025_1004380 | 3300025294 | Bacteria | 12294 |
| 186 | Ga0209025_1005193 | 3300025294 | Bacteria | 10759 |
| 187 | Ga0209025_1008432 | 3300025294 | Bacteria | 7420 |
| 188 | Ga0209025_1015317 | 3300025294 | Bacteria | 4635 |
| 189 | Ga0209025_1016060 | 3300025294 | Bacteria | 4456 |
| 190 | Ga0209025_1022888 | 3300025294 | Bacteria | 3293 |
| 191 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 192 | Ga0209564_1000647 | 3300025295 | Bacteria | 52658 |
| 193 | Ga0209564_1001131 | 3300025295 | Bacteria | 31317 |
| 194 | Ga0209564_1001780 | 3300025295 | Bacteria | 19956 |
| 195 | Ga0209564_1004823 | 3300025295 | Bacteria | 8030 |
| 196 | Ga0209758_1000156 | 3300025297 | Bacteria | 156894 |
| 197 | Ga0209758_1000405 | 3300025297 | Bacteria | 73971 |
| 198 | Ga0209758_1000413 | 3300025297 | Bacteria | 72744 |
| 199 | Ga0209758_1000655 | 3300025297 | Bacteria | 52188 |
| 200 | Ga0209758_1000758 | 3300025297 | Bacteria | 46817 |
| 201 | Ga0209758_1001882 | 3300025297 | Bacteria | 22974 |
| 202 | Ga0209758_1002154 | 3300025297 | Bacteria | 20718 |
| 203 | Ga0209758_1002252 | 3300025297 | Bacteria | 20026 |
| 204 | Ga0209758_1004734 | 3300025297 | Bacteria | 11072 |
| 205 | Ga0209758_1006389 | 3300025297 | Bacteria | 8497 |
| 206 | Ga0209758_1014125 | 3300025297 | Bacteria | 4279 |
| 207 | Ga0209050_1000646 | 3300025298 | Bacteria | 54050 |
| 208 | Ga0209050_1008819 | 3300025298 | Bacteria | 5293 |
| 209 | Ga0209256_1000396 | 3300025299 | Bacteria | 69216 |
| 210 | Ga0209256_1001653 | 3300025299 | Bacteria | 21690 |
| 211 | Ga0209256_1001736 | 3300025299 | Bacteria | 20844 |
| 212 | Ga0209256_1002721 | 3300025299 | Bacteria | 13712 |
| 213 | Ga0209256_1005804 | 3300025299 | Bacteria | 6883 |
| 214 | Ga0209256_1006650 | 3300025299 | Bacteria | 6025 |
| 215 | Ga0209256_1012329 | 3300025299 | Bacteria | 3293 |
| 216 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 217 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 218 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 219 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 220 | Ga0207426_1000221 | 3300025302 | Bacteria | 134756 |
| 221 | Ga0207426_1000869 | 3300025302 | Bacteria | 31530 |
| 222 | Ga0209051_1000097 | 3300025303 | Bacteria | 167378 |
| 223 | Ga0209051_1000314 | 3300025303 | Bacteria | 74316 |
| 224 | Ga0209051_1001414 | 3300025303 | Bacteria | 20618 |
| 225 | Ga0209051_1003927 | 3300025303 | Bacteria | 9473 |
| 226 | Ga0209051_1007515 | 3300025303 | Bacteria | 5940 |
| 227 | Ga0209051_1013189 | 3300025303 | Bacteria | 3948 |
| 228 | Ga0209257_1001142 | 3300025304 | Bacteria | 33931 |
| 229 | Ga0209257_1002070 | 3300025304 | Bacteria | 21158 |
| 230 | Ga0209257_1003315 | 3300025304 | Bacteria | 13958 |
| 231 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 232 | Ga0207695_10000118 | 3300025913 | Bacteria | 237085 |
| 233 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 234 | Ga0207671_10000175 | 3300025914 | Bacteria | 98920 |
| 235 | Ga0207650_10000837 | 3300025925 | Bacteria | 23356 |
| 236 | Ga0207650_10002272 | 3300025925 | Bacteria | 13416 |
| 237 | Ga0207711_10075060 | 3300025941 | Bacteria | 2942 |
| 238 | Ga0207668_10107108 | 3300025972 | Bacteria | 2090 |
| 239 | Ga0207702_10044361 | 3300026078 | Bacteria | 3737 |
| 240 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 241 | Ga0209281_1000318 | 3300027111 | Bacteria | 85039 |
| 242 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 243 | Ga0209371_1002282 | 3300027312 | Bacteria | 10948 |
| 244 | Ga0209371_1006788 | 3300027312 | Bacteria | 4150 |
| 245 | Ga0209371_1007555 | 3300027312 | Bacteria | 3763 |
| 246 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 247 | Ga0209282_1004803 | 3300027666 | Bacteria | 8196 |
| 248 | Ga0307515_10001559 | 3300028794 | Bacteria | 51153 |
| 249 | Ga0307515_10007368 | 3300028794 | Bacteria | 21770 |
| 250 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 251 | Ga0268256_1004953 | 3300030500 | Bacteria | 5374 |
| 252 | Ga0268256_1006891 | 3300030500 | Bacteria | 4150 |
| 253 | Ga0268256_1007789 | 3300030500 | Bacteria | 3763 |
| 254 | Ga0265325_10016256 | 3300031241 | Bacteria | 4162 |
| 255 | Ga0307513_10119150 | 3300031456 | Bacteria | 2612 |
| 256 | Ga0307405_10000857 | 3300031731 | Bacteria | 11991 |
| 257 | Ga0307405_10002833 | 3300031731 | Bacteria | 7789 |
| 258 | Ga0307412_10000493 | 3300031911 | Bacteria | 23544 |
| 259 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 260 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 261 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 262 | Ga0373927_0000350 | 3300035695 | Bacteria | 36173 |
| 263 | Ga0373925_0052624 | 3300037068 | Bacteria | 3042 |
| 264 | Ga0395900_0010176 | 3300037418 | Bacteria | 9621 |
| 265 | Ga0395905_0000867 | 3300037471 | Bacteria | 39452 |
| 266 | Ga0395905_0005044 | 3300037471 | Bacteria | 13597 |
| 267 | Ga0395901_0154081 | 3300038443 | Bacteria | 2414 |
| 268 | Ga0439465_0003817 | 3300041413 | Bacteria | 4914 |
| 269 | Ga0439465_0007101 | 3300041413 | Bacteria | 3560 |
| 270 | Ga0439465_0013037 | 3300041413 | Bacteria | 2597 |
| 271 | Ga0451853_2433547 | 3300041512 | Bacteria | 2216 |
| 272 | Ga0466963_0037894 | 3300044694 | Bacteria | 3151 |
| 273 | Ga0466970_0000026 | 3300044765 | Bacteria | 56864 |
| 274 | Ga0466957_0010513 | 3300044842 | Bacteria | 5319 |
| 275 | Ga0466957_0021187 | 3300044842 | Bacteria | 3829 |
| 276 | Ga0466958_0062046 | 3300045836 | Bacteria | 2278 |
| 277 | Ga0495638_0001181 | 3300046460 | Bacteria | 25058 |
| 278 | Ga0495638_0024145 | 3300046460 | Bacteria | 3967 |
| 279 | Ga0495605_0001952 | 3300046474 | Bacteria | 13095 |
| 280 | Ga0495607_0022946 | 3300046501 | Bacteria | 3912 |
| 281 | Ga0495583_0013196 | 3300046506 | Bacteria | 4623 |
| 282 | Ga0495583_0019889 | 3300046506 | Bacteria | 3494 |
| 283 | Ga0495606_0001601 | 3300046507 | Bacteria | 29530 |
| 284 | Ga0495606_0002324 | 3300046507 | Bacteria | 22407 |
| 285 | Ga0495606_0007174 | 3300046507 | Bacteria | 10058 |
| 286 | Ga0495606_0025623 | 3300046507 | Bacteria | 4220 |
| 287 | Ga0495606_0038135 | 3300046507 | Bacteria | 3254 |
| 288 | Ga0495610_0000770 | 3300046512 | Bacteria | 30242 |
| 289 | Ga0495610_0001969 | 3300046512 | Bacteria | 17628 |
| 290 | Ga0495610_0002191 | 3300046512 | Bacteria | 16560 |
| 291 | Ga0495610_0003825 | 3300046512 | Bacteria | 11469 |
| 292 | Ga0495610_0027406 | 3300046512 | Bacteria | 3028 |
| 293 | Ga0495616_0008906 | 3300046513 | Bacteria | 5898 |
| 294 | Ga0495620_0012690 | 3300046515 | Bacteria | 4338 |
| 295 | Ga0495631_0003360 | 3300046518 | Bacteria | 8775 |
| 296 | Ga0495632_0001278 | 3300046519 | Bacteria | 21310 |
| 297 | Ga0495632_0005104 | 3300046519 | Bacteria | 8775 |
| 298 | Ga0495632_0007228 | 3300046519 | Bacteria | 7009 |
| 299 | Ga0495632_0050993 | 3300046519 | Bacteria | 2038 |
| 300 | Ga0495643_0002802 | 3300046522 | Bacteria | 13314 |
| 301 | Ga0495643_0012570 | 3300046522 | Bacteria | 5102 |
| 302 | Ga0495643_0027634 | 3300046522 | Bacteria | 3186 |
| 303 | Ga0495648_0013780 | 3300046524 | Bacteria | 5956 |
| 304 | Ga0495663_0014361 | 3300046525 | Bacteria | 2220 |
| 305 | Ga0495654_0000045 | 3300046530 | Bacteria | 150593 |
| 306 | Ga0495654_0035169 | 3300046530 | Bacteria | 2525 |
| 307 | Ga0495609_0013320 | 3300046538 | Bacteria | 3888 |
| 308 | Ga0495597_0014741 | 3300046542 | Bacteria | 3717 |
| 309 | Ga0495622_0006123 | 3300046557 | Bacteria | 5589 |
| 310 | Ga0495633_0026822 | 3300046558 | Bacteria | 2822 |
| 311 | Ga0495668_0008091 | 3300046616 | Bacteria | 6621 |
| 312 | Ga0495625_0001387 | 3300046660 | Bacteria | 29722 |
| 313 | Ga0495625_0051086 | 3300046660 | Bacteria | 2965 |
| 314 | Ga0495588_0000895 | 3300046674 | Bacteria | 13095 |
| 315 | Ga0495657_0013648 | 3300046675 | Bacteria | 5986 |
| 316 | Ga0495670_0007690 | 3300046691 | Bacteria | 5299 |
| 317 | Ga0495649_0035998 | 3300046694 | Bacteria | 2721 |
| 318 | Ga0495600_0044740 | 3300046809 | Bacteria | 2887 |
| 319 | Ga0495660_0013338 | 3300046810 | Bacteria | 4763 |
| 320 | Ga0495604_0029637 | 3300047317 | Bacteria | 4354 |
| 321 | Ga0495672_0011266 | 3300047320 | Bacteria | 6319 |
| 322 | Ga0495683_0009820 | 3300047323 | Bacteria | 5086 |
| 323 | Ga0495681_0004658 | 3300047470 | Bacteria | 9301 |
| 324 | Ga0495686_0001455 | 3300047472 | Bacteria | 25795 |
| 325 | Ga0495686_0004688 | 3300047472 | Bacteria | 11089 |
| 326 | Ga0495686_0006538 | 3300047472 | Bacteria | 8896 |
| 327 | Ga0495686_0013660 | 3300047472 | Bacteria | 5627 |
| 328 | Ga0495686_0062023 | 3300047472 | Bacteria | 2319 |
| 329 | Ga0496100_0006892 | 3300048903 | Bacteria | 6221 |
| 330 | Ga0496101_0009796 | 3300048904 | Bacteria | 6310 |
| 331 | Ga0496102_0008153 | 3300048905 | Bacteria | 8964 |
| 332 | Ga0496102_0017086 | 3300048905 | Bacteria | 6351 |
| 333 | Ga0496103_0008310 | 3300048906 | Bacteria | 6166 |
| 334 | Ga0496106_0000957 | 3300048909 | Bacteria | 21015 |
| 335 | Ga0496106_0000982 | 3300048909 | Bacteria | 20805 |
| 336 | Ga0496111_0001270 | 3300048914 | Bacteria | 14143 |
| 337 | Ga0496113_0010326 | 3300048916 | Bacteria | 6171 |
| 338 | Ga0496116_0000142 | 3300048919 | Bacteria | 150342 |
| 339 | Ga0496116_0009760 | 3300048919 | Bacteria | 8146 |
| 340 | Ga0496116_0013505 | 3300048919 | Bacteria | 6578 |
| 341 | Ga0496116_0015034 | 3300048919 | Bacteria | 6137 |
| 342 | Ga0496116_0015182 | 3300048919 | Bacteria | 6101 |
| 343 | Ga0496116_0021260 | 3300048919 | Bacteria | 4899 |
| 344 | Ga0496116_0022090 | 3300048919 | Bacteria | 4782 |
| 345 | Ga0496116_0052557 | 3300048919 | Bacteria | 2698 |
| 346 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 347 | Ga0496117_0001574 | 3300048920 | Bacteria | 32408 |
| 348 | Ga0496117_0002367 | 3300048920 | Bacteria | 24048 |
| 349 | Ga0496117_0004520 | 3300048920 | Bacteria | 15278 |
| 350 | Ga0496117_0006762 | 3300048920 | Bacteria | 11452 |
| 351 | Ga0496117_0018869 | 3300048920 | Bacteria | 5691 |
| 352 | Ga0496117_0019692 | 3300048920 | Bacteria | 5532 |
| 353 | Ga0496117_0023835 | 3300048920 | Bacteria | 4860 |
| 354 | Ga0496117_0024641 | 3300048920 | Bacteria | 4750 |
| 355 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 356 | Ga0496118_0003357 | 3300048921 | Bacteria | 20255 |
| 357 | Ga0496118_0004297 | 3300048921 | Bacteria | 17031 |
| 358 | Ga0496118_0005314 | 3300048921 | Bacteria | 14681 |
| 359 | Ga0496118_0017417 | 3300048921 | Bacteria | 6541 |
| 360 | Ga0496118_0024847 | 3300048921 | Bacteria | 5158 |
| 361 | Ga0496118_0025539 | 3300048921 | Bacteria | 5060 |
| 362 | Ga0496119_0005947 | 3300048922 | Bacteria | 11472 |
| 363 | Ga0496119_0011615 | 3300048922 | Bacteria | 7265 |
| 364 | Ga0496119_0015392 | 3300048922 | Bacteria | 5893 |
| 365 | Ga0496119_0040522 | 3300048922 | Bacteria | 2977 |
| 366 | Ga0496120_0000413 | 3300048923 | Bacteria | 68125 |
| 367 | Ga0496120_0004953 | 3300048923 | Bacteria | 10819 |
| 368 | Ga0496120_0006147 | 3300048923 | Bacteria | 9309 |
| 369 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 370 | Ga0496121_0002536 | 3300048924 | Bacteria | 27686 |
| 371 | Ga0496121_0010503 | 3300048924 | Bacteria | 10430 |
| 372 | Ga0496121_0015847 | 3300048924 | Bacteria | 7837 |
| 373 | Ga0496121_0020370 | 3300048924 | Bacteria | 6572 |
| 374 | Ga0496121_0023681 | 3300048924 | Bacteria | 5902 |
| 375 | Ga0496121_0036685 | 3300048924 | Bacteria | 4364 |
| 376 | Ga0496121_0039518 | 3300048924 | Bacteria | 4155 |
| 377 | Ga0496121_0039603 | 3300048924 | Bacteria | 4148 |
| 378 | Ga0496121_0106562 | 3300048924 | Bacteria | 2148 |
| 379 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 380 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 381 | Ga0496122_0005980 | 3300048925 | Bacteria | 14236 |
| 382 | Ga0496122_0008521 | 3300048925 | Bacteria | 11037 |
| 383 | Ga0496122_0008959 | 3300048925 | Bacteria | 10641 |
| 384 | Ga0496122_0010294 | 3300048925 | Bacteria | 9677 |
| 385 | Ga0496122_0017023 | 3300048925 | Bacteria | 6825 |
| 386 | Ga0496122_0018314 | 3300048925 | Bacteria | 6481 |
| 387 | Ga0496122_0042821 | 3300048925 | Bacteria | 3556 |
| 388 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 389 | Ga0496123_0000336 | 3300048926 | Bacteria | 89161 |
| 390 | Ga0496123_0010318 | 3300048926 | Bacteria | 8280 |
| 391 | Ga0496123_0012104 | 3300048926 | Bacteria | 7391 |
| 392 | Ga0496123_0033840 | 3300048926 | Bacteria | 3671 |
| 393 | Ga0496124_0000285 | 3300048927 | Bacteria | 95893 |
| 394 | Ga0496124_0001040 | 3300048927 | Bacteria | 43813 |
| 395 | Ga0496124_0014720 | 3300048927 | Bacteria | 7549 |
| 396 | Ga0496124_0026382 | 3300048927 | Bacteria | 5240 |
| 397 | Ga0496124_0050763 | 3300048927 | Bacteria | 3532 |
| 398 | Ga0496124_0090675 | 3300048927 | Bacteria | 2492 |
| 399 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 400 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 401 | Ga0496125_0004925 | 3300048928 | Bacteria | 15116 |
| 402 | Ga0496125_0016232 | 3300048928 | Bacteria | 7158 |
| 403 | Ga0496125_0017415 | 3300048928 | Bacteria | 6850 |
| 404 | Ga0496125_0018773 | 3300048928 | Bacteria | 6553 |
| 405 | Ga0496125_0019671 | 3300048928 | Bacteria | 6358 |
| 406 | Ga0496125_0027607 | 3300048928 | Bacteria | 5142 |
| 407 | Ga0496126_0000866 | 3300048929 | Bacteria | 53241 |
| 408 | Ga0496126_0001294 | 3300048929 | Bacteria | 39967 |
| 409 | Ga0496126_0017426 | 3300048929 | Bacteria | 7157 |
| 410 | Ga0496126_0047995 | 3300048929 | Bacteria | 3907 |
| 411 | Ga0496126_0085604 | 3300048929 | Bacteria | 2778 |
| 412 | Ga0496126_0144505 | 3300048929 | Bacteria | 2044 |
| 413 | Ga0501031_0035722 | 3300049568 | Bacteria | 3242 |
| 414 | Ga0501032_0036811 | 3300049569 | Bacteria | 3339 |
| 415 | Ga0501033_0027473 | 3300049570 | Bacteria | 4277 |
| 416 | Ga0501034_0097012 | 3300049571 | Bacteria | 2943 |
| 417 | Ga0501036_0020924 | 3300049572 | Bacteria | 5494 |
| 418 | Ga0501036_0070972 | 3300049572 | Bacteria | 2945 |
| 419 | Ga0501037_0041769 | 3300049573 | Bacteria | 3371 |
| 420 | Ga0501037_0075558 | 3300049573 | Bacteria | 2447 |
| 421 | Ga0501043_0104581 | 3300049579 | Bacteria | 2225 |
| 422 | Ga0501047_0198606 | 3300049581 | Bacteria | 1867 |
| 423 | Ga0501068_0030071 | 3300049584 | Bacteria | 3220 |
| 424 | Ga0501080_0055887 | 3300049742 | Bacteria | 3676 |
| 425 | Ga0501080_0148226 | 3300049742 | Bacteria | 2169 |
| 426 | Ga0501083_0017170 | 3300049744 | Bacteria | 5047 |
| 427 | Ga0501083_0028925 | 3300049744 | Bacteria | 3816 |
| 428 | Ga0501280_002144 | 3300049776 | Bacteria | 3393 |
| 429 | Ga0501035_0071346 | 3300049822 | Bacteria | 3075 |
| 430 | Ga0501044_0020289 | 3300049823 | Bacteria | 7093 |
| 431 | Ga0501044_0077051 | 3300049823 | Bacteria | 3382 |
| 432 | Ga0501044_0132993 | 3300049823 | Bacteria | 2480 |
| 433 | nmdc:mga03683_4496_c1 | 3300050489 | Bacteria | 4636 |
| 434 | nmdc:mga00v17_12_c1 | 3300050491 | Bacteria | 129050 |
| 435 | nmdc:mga0yw44_291_c1 | 3300050492 | Bacteria | 17253 |
| 436 | nmdc:mga0yw44_3456_c1 | 3300050492 | Bacteria | 6517 |
| 437 | nmdc:mga07m45_36619_c1 | 3300050496 | Bacteria | 2734 |
| 438 | nmdc:mga0sz30_23498_c1 | 3300050516 | Bacteria | 2509 |
| 439 | nmdc:mga0sz30_3736_c1 | 3300050516 | Bacteria | 5488 |
| 440 | nmdc:mga0sz30_7957_c1 | 3300050516 | Bacteria | 3989 |
| 441 | Ga0500578_0046899 | 3300053086 | Bacteria | 2772 |
| 442 | Ga0500560_002077 | 3300053107 | Bacteria | 3723 |
| 443 | Ga0500569_012298 | 3300053109 | Bacteria | 2066 |
| 444 | Ga0500618_000184 | 3300053125 | Bacteria | 51349 |
| 445 | Ga0500618_000453 | 3300053125 | Bacteria | 26803 |
| 446 | Ga0500618_000677 | 3300053125 | Bacteria | 20060 |
| 447 | Ga0500618_001080 | 3300053125 | Bacteria | 13415 |
| 448 | Ga0500618_001232 | 3300053125 | Bacteria | 11994 |
| 449 | Ga0500618_008674 | 3300053125 | Bacteria | 2821 |
| 450 | Ga0500658_0000526 | 3300053134 | Bacteria | 16212 |
| 451 | Ga0500658_0002581 | 3300053134 | Bacteria | 6999 |
| 452 | Ga0500658_0015165 | 3300053134 | Bacteria | 2858 |
| 453 | Ga0500561_0000098 | 3300053137 | Bacteria | 16671 |
| 454 | Ga0500568_0000076 | 3300053139 | Bacteria | 94411 |
| 455 | Ga0500568_0004818 | 3300053139 | Bacteria | 7132 |
| 456 | Ga0500573_0003980 | 3300053140 | Bacteria | 7714 |
| 457 | Ga0500573_0005041 | 3300053140 | Bacteria | 7024 |
| 458 | Ga0500590_003631 | 3300053148 | Bacteria | 7157 |
| 459 | Ga0500616_0001018 | 3300053153 | Bacteria | 29841 |
| 460 | Ga0500616_0005682 | 3300053153 | Bacteria | 8405 |
| 461 | Ga0500622_0000215 | 3300053156 | Bacteria | 61272 |
| 462 | Ga0500622_0000458 | 3300053156 | Bacteria | 38693 |
| 463 | Ga0500624_000768 | 3300053157 | Bacteria | 7677 |
| 464 | Ga0500633_0000082 | 3300053160 | Bacteria | 14067 |
| 465 | Ga0500634_0000261 | 3300053161 | Bacteria | 16846 |
| 466 | Ga0500634_0011617 | 3300053161 | Bacteria | 4553 |
| 467 | Ga0500636_0000180 | 3300053177 | Bacteria | 33813 |
| 468 | Ga0500636_0006724 | 3300053177 | Bacteria | 6616 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0026382 | Ga0496124_0026382_3776_5191 | 467 |
| 2 | 3300049579 | Ga0501043_0104581 | Ga0501043_0104581_698_2191 | 487 |
| 3 | 3300049744 | Ga0501083_0028925 | Ga0501083_0028925_2314_3801 | 491 |
| 4 | 3300046513 | Ga0495616_0008906 | Ga0495616_0008906_3001_4542 | 513 |
| 5 | 3300050496 | nmdc:mga07m45_36619_c1 | nmdc:mga07m45_36619_c1_1168_2715 | 513 |
| 6 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010303 | 515 |
| 7 | 3300005262 | Ga0065165_1009678 | Ga0065165_10096784 | 520 |
| 8 | 3300046512 | Ga0495610_0002191 | Ga0495610_0002191_13388_14980 | 526 |
| 9 | 3300002704 | JGI25155J39150_1000195 | JGI25155J39150_10001956 | 527 |
| 10 | 3300002705 | JGI25156J39149_1000433 | JGI25156J39149_100043319 | 527 |
| 11 | 3300002738 | JGI25154J39366_1000360 | JGI25154J39366_10003606 | 527 |
| 12 | 3300002741 | JGI25157J39369_1000458 | JGI25157J39369_10004586 | 527 |
| 13 | 3300049573 | Ga0501037_0075558 | Ga0501037_0075558_295_2004 | 539 |
| 14 | 3300049742 | Ga0501080_0148226 | Ga0501080_0148226_362_2071 | 539 |
| 15 | 3300053125 | Ga0500618_000184 | Ga0500618_000184_5685_7322 | 540 |
| 16 | iso_pu_bacteria | 2582581304 | 2585257697 | 540 |
| 17 | iso_pu_bacteria | 8054563764 | 8054568608 | 543 |
| 18 | 3300035695 | Ga0373927_0000350 | Ga0373927_0000350_22156_23916 | 549 |
| 19 | 3300037068 | Ga0373925_0052624 | Ga0373925_0052624_1257_3017 | 549 |
| 20 | 3300003775 | Ga0055524_1002170 | Ga0055524_10021701 | 551 |
| 21 | 3300003790 | Ga0055528_1000584 | Ga0055528_100058437 | 551 |
| 22 | 3300025294 | Ga0209025_1008432 | Ga0209025_10084327 | 551 |
| 23 | iso_pu_bacteria | 2510917022 | 2511131327 | 551 |
| 24 | iso_pu_bacteria | 2582581307 | 2585274460 | 551 |
| 25 | iso_pu_bacteria | 2585427531 | 2585561819 | 551 |
| 26 | iso_pu_bacteria | 2585427609 | 2585907551 | 551 |
| 27 | iso_pu_bacteria | 2585428125 | 2587982972 | 551 |
| 28 | iso_pu_bacteria | 2957422303 | 2957427172 | 552 |
| 29 | 3300025245 | Ga0207425_1005180 | Ga0207425_10051801 | 556 |
| 30 | 3300053139 | Ga0500568_0000076 | Ga0500568_0000076_65481_67163 | 556 |
| 31 | 3300046530 | Ga0495654_0000045 | Ga0495654_0000045_80852_82594 | 558 |
| 32 | 3300053125 | Ga0500618_001080 | Ga0500618_001080_7911_9653 | 558 |
| 33 | 3300053125 | Ga0500618_001232 | Ga0500618_001232_8447_10189 | 558 |
| 34 | 3300031241 | Ga0265325_10016256 | Ga0265325_100162563 | 559 |
| 35 | iso_pu_bacteria | 2585427608 | 2585902426 | 559 |
| 36 | iso_pu_bacteria | 2615840698 | 2616557383 | 559 |
| 37 | iso_pu_bacteria | 2667528174 | 2671117062 | 559 |
| 38 | iso_pu_bacteria | 2838029111 | 2838034861 | 559 |
| 39 | iso_pu_bacteria | 2842475841 | 2842481645 | 559 |
| 40 | iso_pu_bacteria | 2842502639 | 2842508004 | 559 |
| 41 | iso_pu_bacteria | 2919408235 | 2919413875 | 559 |
| 42 | iso_pu_bacteria | 8005682033 | 8005686926 | 559 |
| 43 | iso_pu_bacteria | 2582581308 | 2585280869 | 560 |
| 44 | iso_pu_bacteria | 2582581315 | 2585324390 | 560 |
| 45 | iso_pu_bacteria | 2582581316 | 2585335929 | 560 |
| 46 | iso_pu_bacteria | 2585427527 | 2585530573 | 560 |
| 47 | iso_pu_bacteria | 2585427530 | 2585554748 | 560 |
| 48 | iso_pu_bacteria | 2615840626 | 2616310748 | 560 |
| 49 | iso_pu_bacteria | 2617270742 | 2617382085 | 560 |
| 50 | iso_pu_bacteria | 2738541317 | 2738945523 | 560 |
| 51 | iso_pu_bacteria | 2775507266 | 2778173558 | 560 |
| 52 | iso_pu_bacteria | 2818991453 | 2819641125 | 560 |
| 53 | iso_pu_bacteria | 2842482326 | 2842484432 | 560 |
| 54 | iso_pu_bacteria | 2913308742 | 2913310229 | 560 |
| 55 | iso_pu_bacteria | 2919100787 | 2919107458 | 560 |
| 56 | iso_pu_bacteria | 3005416602 | 3005419807 | 560 |
| 57 | iso_pu_bacteria | 3005445848 | 3005451110 | 560 |
| 58 | iso_pu_bacteria | 8005314921 | 8005316373 | 560 |
| 59 | iso_pu_bacteria | 8005658619 | 8005660062 | 560 |
| 60 | iso_pu_bacteria | 8046767195 | 8046773323 | 560 |
| 61 | iso_pu_bacteria | 2585427594 | 2585842893 | 561 |
| 62 | iso_pu_bacteria | 2643221634 | 2644191573 | 561 |
| 63 | iso_pu_bacteria | 2738541293 | 2738801503 | 561 |
| 64 | 3300001979 | JGI24740J21852_10000464 | JGI24740J21852_100004648 | 562 |
| 65 | 3300002737 | JGI25162J39368_1000477 | JGI25162J39368_100047725 | 562 |
| 66 | 3300003214 | JGI25165J46597_1000603 | JGI25165J46597_100060325 | 562 |
| 67 | 3300005331 | Ga0070670_100000515 | Ga0070670_1000005152 | 562 |
| 68 | 3300005614 | Ga0068856_100007936 | Ga0068856_10000793610 | 562 |
| 69 | 3300006353 | Ga0075370_10010686 | Ga0075370_100106862 | 562 |
| 70 | 3300025206 | Ga0209435_100122 | Ga0209435_10012218 | 562 |
| 71 | 3300025233 | Ga0209437_100469 | Ga0209437_1004694 | 562 |
| 72 | 3300025246 | Ga0209646_1000385 | Ga0209646_100038518 | 562 |
| 73 | 3300025250 | Ga0209026_1000501 | Ga0209026_100050118 | 562 |
| 74 | 3300025256 | Ga0209759_1000743 | Ga0209759_100074318 | 562 |
| 75 | 3300025261 | Ga0209233_1000375 | Ga0209233_100037527 | 562 |
| 76 | 3300025925 | Ga0207650_10002272 | Ga0207650_100022722 | 562 |
| 77 | 3300026078 | Ga0207702_10044361 | Ga0207702_100443613 | 562 |
| 78 | 3300027312 | Ga0209371_1006788 | Ga0209371_10067881 | 562 |
| 79 | 3300030500 | Ga0268256_1006891 | Ga0268256_10068911 | 562 |
| 80 | 3300044694 | Ga0466963_0037894 | Ga0466963_0037894_124_1845 | 562 |
| 81 | 3300044765 | Ga0466970_0000026 | Ga0466970_0000026_9552_11273 | 562 |
| 82 | 3300044842 | Ga0466957_0010513 | Ga0466957_0010513_2434_4155 | 562 |
| 83 | 3300045836 | Ga0466958_0062046 | Ga0466958_0062046_495_2216 | 562 |
| 84 | 3300046507 | Ga0495606_0001601 | Ga0495606_0001601_4595_6319 | 562 |
| 85 | 3300046660 | Ga0495625_0051086 | Ga0495625_0051086_609_2354 | 562 |
| 86 | 3300047472 | Ga0495686_0062023 | Ga0495686_0062023_481_2205 | 562 |
| 87 | 3300048924 | Ga0496121_0039518 | Ga0496121_0039518_2112_3836 | 562 |
| 88 | 3300048925 | Ga0496122_0005980 | Ga0496122_0005980_10805_12526 | 562 |
| 89 | 3300053140 | Ga0500573_0003980 | Ga0500573_0003980_3462_5183 | 562 |
| 90 | 3300053140 | Ga0500573_0005041 | Ga0500573_0005041_5142_6863 | 562 |
| 91 | 3300002737 | JGI25162J39368_1000802 | JGI25162J39368_10008022 | 563 |
| 92 | 3300002739 | JGI25158J39367_1000694 | JGI25158J39367_10006944 | 563 |
| 93 | 3300002773 | JGI25152J39213_1001023 | JGI25152J39213_10010237 | 563 |
| 94 | 3300002987 | JGI25159J45721_1000493 | JGI25159J45721_100049315 | 563 |
| 95 | 3300003187 | JGI25151J46595_10003886 | JGI25151J46595_100038864 | 563 |
| 96 | 3300003214 | JGI25165J46597_1001132 | JGI25165J46597_100113216 | 563 |
| 97 | 3300003214 | JGI25165J46597_1002650 | JGI25165J46597_10026504 | 563 |
| 98 | 3300003354 | JGI25160J50197_1018252 | JGI25160J50197_10182521 | 563 |
| 99 | 3300003374 | JGI25161J50226_1000010 | JGI25161J50226_1000010195 | 563 |
| 100 | 3300004625 | Ga0055543_1000353 | Ga0055543_100035324 | 563 |
| 101 | 3300005262 | Ga0065165_1008678 | Ga0065165_10086783 | 563 |
| 102 | 3300005548 | Ga0070665_100040748 | Ga0070665_1000407482 | 563 |
| 103 | 3300009093 | Ga0105240_10000201 | Ga0105240_1000020172 | 563 |
| 104 | 3300009545 | Ga0105237_10010705 | Ga0105237_100107055 | 563 |
| 105 | 3300010375 | Ga0105239_10009932 | Ga0105239_1000993210 | 563 |
| 106 | 3300013104 | Ga0157370_10005282 | Ga0157370_100052825 | 563 |
| 107 | 3300015262 | Ga0182007_10000314 | Ga0182007_1000031416 | 563 |
| 108 | 3300015265 | Ga0182005_1001330 | Ga0182005_10013305 | 563 |
| 109 | 3300025208 | Ga0209436_100025 | Ga0209436_10002524 | 563 |
| 110 | 3300025233 | Ga0209437_100064 | Ga0209437_100064285 | 563 |
| 111 | 3300025258 | Ga0209129_1000348 | Ga0209129_100034815 | 563 |
| 112 | 3300025258 | Ga0209129_1007796 | Ga0209129_10077962 | 563 |
| 113 | 3300025261 | Ga0209233_1000081 | Ga0209233_100008115 | 563 |
| 114 | 3300025261 | Ga0209233_1000217 | Ga0209233_100021736 | 563 |
| 115 | 3300025273 | Ga0209673_1021742 | Ga0209673_10217421 | 563 |
| 116 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001612 | 563 |
| 117 | 3300025294 | Ga0209025_1001813 | Ga0209025_100181311 | 563 |
| 118 | 3300025294 | Ga0209025_1004380 | Ga0209025_10043804 | 563 |
| 119 | 3300025295 | Ga0209564_1001131 | Ga0209564_100113123 | 563 |
| 120 | 3300025297 | Ga0209758_1002252 | Ga0209758_100225212 | 563 |
| 121 | 3300025297 | Ga0209758_1006389 | Ga0209758_10063897 | 563 |
| 122 | 3300025297 | Ga0209758_1014125 | Ga0209758_10141253 | 563 |
| 123 | 3300025299 | Ga0209256_1002721 | Ga0209256_100272110 | 563 |
| 124 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045221 | 563 |
| 125 | 3300025913 | Ga0207695_10000118 | Ga0207695_10000118190 | 563 |
| 126 | 3300025914 | Ga0207671_10000175 | Ga0207671_1000017511 | 563 |
| 127 | 3300041413 | Ga0439465_0013037 | Ga0439465_0013037_262_1986 | 563 |
| 128 | 3300046522 | Ga0495643_0012570 | Ga0495643_0012570_1519_3243 | 563 |
| 129 | 3300047472 | Ga0495686_0001455 | Ga0495686_0001455_9135_10859 | 563 |
| 130 | 3300048905 | Ga0496102_0008153 | Ga0496102_0008153_1567_3291 | 563 |
| 131 | 3300048909 | Ga0496106_0000957 | Ga0496106_0000957_15573_17297 | 563 |
| 132 | 3300048916 | Ga0496113_0010326 | Ga0496113_0010326_584_2308 | 563 |
| 133 | 3300048919 | Ga0496116_0052557 | Ga0496116_0052557_228_1952 | 563 |
| 134 | 3300048920 | Ga0496117_0002367 | Ga0496117_0002367_8440_10164 | 563 |
| 135 | 3300048920 | Ga0496117_0024641 | Ga0496117_0024641_169_1893 | 563 |
| 136 | 3300048921 | Ga0496118_0004297 | Ga0496118_0004297_8440_10164 | 563 |
| 137 | 3300048921 | Ga0496118_0005314 | Ga0496118_0005314_3860_5584 | 563 |
| 138 | 3300048923 | Ga0496120_0006147 | Ga0496120_0006147_4335_6059 | 563 |
| 139 | 3300048924 | Ga0496121_0010503 | Ga0496121_0010503_5456_7180 | 563 |
| 140 | 3300048924 | Ga0496121_0015847 | Ga0496121_0015847_3739_5463 | 563 |
| 141 | 3300048928 | Ga0496125_0004925 | Ga0496125_0004925_10071_11795 | 563 |
| 142 | 3300048928 | Ga0496125_0016232 | Ga0496125_0016232_4695_6419 | 563 |
| 143 | 3300048929 | Ga0496126_0085604 | Ga0496126_0085604_537_2261 | 563 |
| 144 | 3300049572 | Ga0501036_0070972 | Ga0501036_0070972_280_2004 | 563 |
| 145 | 3300049581 | Ga0501047_0198606 | Ga0501047_0198606_122_1846 | 563 |
| 146 | 3300049742 | Ga0501080_0055887 | Ga0501080_0055887_507_2231 | 563 |
| 147 | 3300049823 | Ga0501044_0020289 | Ga0501044_0020289_1441_3165 | 563 |
| 148 | 3300050516 | nmdc:mga0sz30_7957_c1 | nmdc:mga0sz30_7957_c1_28_1752 | 563 |
| 149 | 3300053125 | Ga0500618_000453 | Ga0500618_000453_861_2585 | 563 |
| 150 | 3300053125 | Ga0500618_008674 | Ga0500618_008674_465_2189 | 563 |
| 151 | 3300053134 | Ga0500658_0015165 | Ga0500658_0015165_177_1901 | 563 |
| 152 | 3300053156 | Ga0500622_0000215 | Ga0500622_0000215_37324_39048 | 563 |
| 153 | 3300053160 | Ga0500633_0000082 | Ga0500633_0000082_8988_10712 | 563 |
| 154 | iso_pu_bacteria | 2510917030 | 2511193907 | 563 |
| 155 | iso_pu_bacteria | 2582581298 | 2585226996 | 563 |
| 156 | iso_pu_bacteria | 2585427529 | 2585550411 | 563 |
| 157 | 3300002774 | JGI25150J39212_1000026 | JGI25150J39212_100002695 | 564 |
| 158 | 3300003187 | JGI25151J46595_10000053 | JGI25151J46595_1000005339 | 564 |
| 159 | 3300025245 | Ga0207425_1000113 | Ga0207425_100011340 | 564 |
| 160 | 3300025258 | Ga0209129_1000181 | Ga0209129_100018140 | 564 |
| 161 | 3300025294 | Ga0209025_1000181 | Ga0209025_1000181107 | 564 |
| 162 | 3300025297 | Ga0209758_1000156 | Ga0209758_1000156107 | 564 |
| 163 | 3300031731 | Ga0307405_10002833 | Ga0307405_100028334 | 564 |
| 164 | 3300046519 | Ga0495632_0001278 | Ga0495632_0001278_11265_12992 | 564 |
| 165 | 3300048904 | Ga0496101_0009796 | Ga0496101_0009796_3977_5704 | 564 |
| 166 | 3300048919 | Ga0496116_0013505 | Ga0496116_0013505_2021_3748 | 564 |
| 167 | 3300048919 | Ga0496116_0015034 | Ga0496116_0015034_662_2389 | 564 |
| 168 | 3300048920 | Ga0496117_0006762 | Ga0496117_0006762_1011_2738 | 564 |
| 169 | 3300048920 | Ga0496117_0023835 | Ga0496117_0023835_555_2282 | 564 |
| 170 | 3300048921 | Ga0496118_0025539 | Ga0496118_0025539_440_2167 | 564 |
| 171 | 3300048922 | Ga0496119_0015392 | Ga0496119_0015392_161_1888 | 564 |
| 172 | 3300048924 | Ga0496121_0023681 | Ga0496121_0023681_288_2015 | 564 |
| 173 | 3300048925 | Ga0496122_0008521 | Ga0496122_0008521_7192_8919 | 564 |
| 174 | 3300048926 | Ga0496123_0010318 | Ga0496123_0010318_3825_5552 | 564 |
| 175 | 3300048927 | Ga0496124_0000285 | Ga0496124_0000285_3805_5532 | 564 |
| 176 | 3300046512 | Ga0495610_0000770 | Ga0495610_0000770_20372_22162 | 565 |
| 177 | 3300046515 | Ga0495620_0012690 | Ga0495620_0012690_521_2311 | 565 |
| 178 | 3300047472 | Ga0495686_0004688 | Ga0495686_0004688_3768_5558 | 565 |
| 179 | 3300028794 | Ga0307515_10001559 | Ga0307515_1000155933 | 569 |
| 180 | 3300048919 | Ga0496116_0000142 | Ga0496116_0000142_92881_94599 | 571 |
| 181 | 3300048929 | Ga0496126_0001294 | Ga0496126_0001294_16115_17833 | 571 |
| 182 | 3300053177 | Ga0500636_0000180 | Ga0500636_0000180_11557_13275 | 571 |
| 183 | 3300048922 | Ga0496119_0005947 | Ga0496119_0005947_7295_9016 | 572 |
| 184 | 3300048928 | Ga0496125_0019671 | Ga0496125_0019671_2148_3869 | 572 |
| 185 | 3300049776 | Ga0501280_002144 | Ga0501280_002144_1101_2846 | 572 |
| 186 | 3300006946 | Ga0079104_1001253 | Ga0079104_100125313 | 573 |
| 187 | 3300022739 | Ga0228711_1000008 | Ga0228711_100000838 | 573 |
| 188 | 3300022740 | Ga0228710_1000009 | Ga0228710_100000937 | 573 |
| 189 | 3300027111 | Ga0209281_1000106 | Ga0209281_1000106194 | 573 |
| 190 | 3300027666 | Ga0209282_1000024 | Ga0209282_1000024125 | 573 |
| 191 | 3300031967 | Ga0315914_1000012 | Ga0315914_100001238 | 573 |
| 192 | 3300033430 | Ga0315913_1000006 | Ga0315913_100000638 | 573 |
| 193 | 3300033464 | Ga0315915_1000010 | Ga0315915_1000010227 | 573 |
| 194 | 3300048914 | Ga0496111_0001270 | Ga0496111_0001270_9026_10753 | 573 |
| 195 | 3300048926 | Ga0496123_0033840 | Ga0496123_0033840_315_2096 | 573 |
| 196 | 3300048927 | Ga0496124_0001040 | Ga0496124_0001040_15882_17606 | 573 |
| 197 | 3300048929 | Ga0496126_0000866 | Ga0496126_0000866_16623_18365 | 573 |
| 198 | iso_pu_bacteria | 2551306087 | 2551698979 | 573 |
| 199 | 3300046507 | Ga0495606_0002324 | Ga0495606_0002324_3865_5589 | 574 |
| 200 | 3300048924 | Ga0496121_0020370 | Ga0496121_0020370_4004_5728 | 574 |
| 201 | iso_pu_bacteria | 2643221568 | 2643856772 | 574 |
| 202 | iso_pu_bacteria | 2854896431 | 2854899587 | 574 |
| 203 | iso_pu_bacteria | 2854916844 | 2854918412 | 574 |
| 204 | iso_pu_bacteria | 2891373044 | 2891373346 | 574 |
| 205 | iso_pu_bacteria | 2919166419 | 2919169241 | 574 |
| 206 | iso_pu_bacteria | 2929138655 | 2929140869 | 574 |
| 207 | iso_pu_bacteria | 2978969890 | 2978974617 | 574 |
| 208 | iso_pu_bacteria | 8054460903 | 8054462973 | 574 |
| 209 | iso_pu_bacteria | 8054558443 | 8054558649 | 574 |
| 210 | 3300046557 | Ga0495622_0006123 | Ga0495622_0006123_670_2418 | 575 |
| 211 | 3300047317 | Ga0495604_0029637 | Ga0495604_0029637_1692_3425 | 575 |
| 212 | iso_pu_bacteria | 2510917026 | 2511174423 | 575 |
| 213 | iso_pu_bacteria | 2510917028 | 2511187053 | 575 |
| 214 | iso_pu_bacteria | 2513237088 | 2513596473 | 575 |
| 215 | iso_pu_bacteria | 2513237159 | 2514001504 | 575 |
| 216 | iso_pu_bacteria | 2534681796 | 2535516864 | 575 |
| 217 | iso_pu_bacteria | 2537561587 | 2537875435 | 575 |
| 218 | iso_pu_bacteria | 2551306090 | 2551715881 | 575 |
| 219 | iso_pu_bacteria | 2554235003 | 2554248231 | 575 |
| 220 | iso_pu_bacteria | 2558860242 | 2559295347 | 575 |
| 221 | iso_pu_bacteria | 2582581283 | 2585166347 | 575 |
| 222 | iso_pu_bacteria | 2582581306 | 2585267425 | 575 |
| 223 | iso_pu_bacteria | 2582581865 | 2585386493 | 575 |
| 224 | iso_pu_bacteria | 2582581866 | 2585393255 | 575 |
| 225 | iso_pu_bacteria | 2585427633 | 2585996202 | 575 |
| 226 | iso_pu_bacteria | 2585427634 | 2586000812 | 575 |
| 227 | iso_pu_bacteria | 2599185210 | 2599601659 | 575 |
| 228 | iso_pu_bacteria | 2600255279 | 2601610081 | 575 |
| 229 | iso_pu_bacteria | 2600255308 | 2601746856 | 575 |
| 230 | iso_pu_bacteria | 2643221558 | 2643811533 | 575 |
| 231 | iso_pu_bacteria | 2643221582 | 2643920345 | 575 |
| 232 | iso_pu_bacteria | 2643221607 | 2644050520 | 575 |
| 233 | iso_pu_bacteria | 2643221636 | 2644205748 | 575 |
| 234 | iso_pu_bacteria | 2643221686 | 2644483438 | 575 |
| 235 | iso_pu_bacteria | 2643221688 | 2644492029 | 575 |
| 236 | iso_pu_bacteria | 2643221689 | 2644499649 | 575 |
| 237 | iso_pu_bacteria | 2643221693 | 2644521959 | 575 |
| 238 | iso_pu_bacteria | 2808606387 | 2808987919 | 575 |
| 239 | iso_pu_bacteria | 2818991439 | 2819559060 | 575 |
| 240 | iso_pu_bacteria | 2838074704 | 2838076860 | 575 |
| 241 | iso_pu_bacteria | 2838675328 | 2838675778 | 575 |
| 242 | iso_pu_bacteria | 2838714209 | 2838714660 | 575 |
| 243 | iso_pu_bacteria | 2838719591 | 2838721539 | 575 |
| 244 | iso_pu_bacteria | 2838724970 | 2838725420 | 575 |
| 245 | iso_pu_bacteria | 2841846520 | 2841848491 | 575 |
| 246 | iso_pu_bacteria | 2841859092 | 2841862122 | 575 |
| 247 | iso_pu_bacteria | 2842124991 | 2842125478 | 575 |
| 248 | iso_pu_bacteria | 2842130223 | 2842130673 | 575 |
| 249 | iso_pu_bacteria | 2842152218 | 2842154157 | 575 |
| 250 | iso_pu_bacteria | 2842170452 | 2842170904 | 575 |
| 251 | iso_pu_bacteria | 2842175837 | 2842177777 | 575 |
| 252 | iso_pu_bacteria | 2842187318 | 2842187769 | 575 |
| 253 | iso_pu_bacteria | 2842211629 | 2842212080 | 575 |
| 254 | iso_pu_bacteria | 2842224351 | 2842226301 | 575 |
| 255 | iso_pu_bacteria | 2842515876 | 2842518906 | 575 |
| 256 | iso_pu_bacteria | 2842521101 | 2842521813 | 575 |
| 257 | iso_pu_bacteria | 2896384573 | 2896389027 | 575 |
| 258 | iso_pu_bacteria | 2899792073 | 2899796054 | 575 |
| 259 | iso_pu_bacteria | 2899845264 | 2899850632 | 575 |
| 260 | iso_pu_bacteria | 2919114240 | 2919114698 | 575 |
| 261 | iso_pu_bacteria | 2919171160 | 2919174712 | 575 |
| 262 | iso_pu_bacteria | 2920760137 | 2920761521 | 575 |
| 263 | iso_pu_bacteria | 2926754445 | 2926755714 | 575 |
| 264 | iso_pu_bacteria | 2926760298 | 2926762829 | 575 |
| 265 | iso_pu_bacteria | 2933006813 | 2933008802 | 575 |
| 266 | iso_pu_bacteria | 2933011516 | 2933014920 | 575 |
| 267 | iso_pu_bacteria | 2933594066 | 2933596597 | 575 |
| 268 | iso_pu_bacteria | 2979089926 | 2979094678 | 575 |
| 269 | iso_pu_bacteria | 2979095461 | 2979100757 | 575 |
| 270 | iso_pu_bacteria | 2979100975 | 2979103913 | 575 |
| 271 | iso_pu_bacteria | 2984509177 | 2984511520 | 575 |
| 272 | iso_pu_bacteria | 2984518228 | 2984522120 | 575 |
| 273 | iso_pu_bacteria | 2984537506 | 2984541418 | 575 |
| 274 | iso_pu_bacteria | 2984601300 | 2984603695 | 575 |
| 275 | iso_pu_bacteria | 2996887358 | 2996889040 | 575 |
| 276 | iso_pu_bacteria | 650716007 | 650740557 | 575 |
| 277 | iso_pu_bacteria | 8003570095 | 8003571622 | 575 |
| 278 | iso_pu_bacteria | 8005258706 | 8005260303 | 575 |
| 279 | iso_pu_bacteria | 8005321885 | 8005323567 | 575 |
| 280 | iso_pu_bacteria | 8005542996 | 8005545616 | 575 |
| 281 | iso_pu_bacteria | 2508501122 | 2509108397 | 576 |
| 282 | iso_pu_bacteria | 2509276019 | 2509376470 | 576 |
| 283 | iso_pu_bacteria | 2510065057 | 2510306454 | 576 |
| 284 | iso_pu_bacteria | 2511231052 | 2511502244 | 576 |
| 285 | iso_pu_bacteria | 2512047086 | 2512533617 | 576 |
| 286 | iso_pu_bacteria | 2512875026 | 2512970694 | 576 |
| 287 | iso_pu_bacteria | 2513237086 | 2513584384 | 576 |
| 288 | iso_pu_bacteria | 2513237089 | 2513604262 | 576 |
| 289 | iso_pu_bacteria | 2513237091 | 2513618804 | 576 |
| 290 | iso_pu_bacteria | 2513237140 | 2513884405 | 576 |
| 291 | iso_pu_bacteria | 2513237143 | 2513905009 | 576 |
| 292 | iso_pu_bacteria | 2513237156 | 2513986825 | 576 |
| 293 | iso_pu_bacteria | 2513237160 | 2514006389 | 576 |
| 294 | iso_pu_bacteria | 2515154107 | 2515609020 | 576 |
| 295 | iso_pu_bacteria | 2516143018 | 2516204144 | 576 |
| 296 | iso_pu_bacteria | 2516653046 | 2516893623 | 576 |
| 297 | iso_pu_bacteria | 2517487022 | 2517570335 | 576 |
| 298 | iso_pu_bacteria | 2524023207 | 2524448556 | 576 |
| 299 | iso_pu_bacteria | 2551306084 | 2551674544 | 576 |
| 300 | iso_pu_bacteria | 2551306084 | 2551677925 | 576 |
| 301 | iso_pu_bacteria | 2551306085 | 2551687738 | 576 |
| 302 | iso_pu_bacteria | 2551306089 | 2551715576 | 576 |
| 303 | iso_pu_bacteria | 2551306093 | 2551744428 | 576 |
| 304 | iso_pu_bacteria | 2558860100 | 2558864463 | 576 |
| 305 | iso_pu_bacteria | 2582581294 | 2585202272 | 576 |
| 306 | iso_pu_bacteria | 2599185156 | 2599331750 | 576 |
| 307 | iso_pu_bacteria | 2599185236 | 2599721913 | 576 |
| 308 | iso_pu_bacteria | 2599185352 | 2600194392 | 576 |
| 309 | iso_pu_bacteria | 2600254933 | 2600374360 | 576 |
| 310 | iso_pu_bacteria | 2643221557 | 2643803089 | 576 |
| 311 | iso_pu_bacteria | 2643221610 | 2644063451 | 576 |
| 312 | iso_pu_bacteria | 2643221618 | 2644107280 | 576 |
| 313 | iso_pu_bacteria | 2643221626 | 2644150846 | 576 |
| 314 | iso_pu_bacteria | 2643221655 | 2644308675 | 576 |
| 315 | iso_pu_bacteria | 2643221659 | 2644335493 | 576 |
| 316 | iso_pu_bacteria | 2643221668 | 2644374734 | 576 |
| 317 | iso_pu_bacteria | 2643221675 | 2644414214 | 576 |
| 318 | iso_pu_bacteria | 2643221680 | 2644447742 | 576 |
| 319 | iso_pu_bacteria | 2643221698 | 2644539898 | 576 |
| 320 | iso_pu_bacteria | 2643221712 | 2644614616 | 576 |
| 321 | iso_pu_bacteria | 2643221723 | 2644676080 | 576 |
| 322 | iso_pu_bacteria | 2643221726 | 2644690215 | 576 |
| 323 | iso_pu_bacteria | 2657244999 | 2657681560 | 576 |
| 324 | iso_pu_bacteria | 2690316117 | 2692315542 | 576 |
| 325 | iso_pu_bacteria | 2738541317 | 2738947336 | 576 |
| 326 | iso_pu_bacteria | 2751185821 | 2753462027 | 576 |
| 327 | iso_pu_bacteria | 2791355082 | 2792585128 | 576 |
| 328 | iso_pu_bacteria | 2791355091 | 2792620772 | 576 |
| 329 | iso_pu_bacteria | 2791355092 | 2792626131 | 576 |
| 330 | iso_pu_bacteria | 2791355094 | 2792639067 | 576 |
| 331 | iso_pu_bacteria | 2791355253 | 2793280305 | 576 |
| 332 | iso_pu_bacteria | 2802428858 | 2802720030 | 576 |
| 333 | iso_pu_bacteria | 2802428859 | 2802727037 | 576 |
| 334 | iso_pu_bacteria | 2802428860 | 2802731960 | 576 |
| 335 | iso_pu_bacteria | 2802428861 | 2802739291 | 576 |
| 336 | iso_pu_bacteria | 2802428862 | 2802745728 | 576 |
| 337 | iso_pu_bacteria | 2802428863 | 2802752329 | 576 |
| 338 | iso_pu_bacteria | 2802429268 | 2804752751 | 576 |
| 339 | iso_pu_bacteria | 2842922631 | 2842924155 | 576 |
| 340 | iso_pu_bacteria | 2844163670 | 2844164572 | 576 |
| 341 | iso_pu_bacteria | 2847417321 | 2847419396 | 576 |
| 342 | iso_pu_bacteria | 2848992105 | 2848994423 | 576 |
| 343 | iso_pu_bacteria | 2850079185 | 2850081466 | 576 |
| 344 | iso_pu_bacteria | 2855825444 | 2855826343 | 576 |
| 345 | iso_pu_bacteria | 2855839649 | 2855841733 | 576 |
| 346 | iso_pu_bacteria | 2855872281 | 2855872522 | 576 |
| 347 | iso_pu_bacteria | 2858800743 | 2858802518 | 576 |
| 348 | iso_pu_bacteria | 2899803654 | 2899807270 | 576 |
| 349 | iso_pu_bacteria | 2913295892 | 2913299312 | 576 |
| 350 | iso_pu_bacteria | 2913308742 | 2913312566 | 576 |
| 351 | iso_pu_bacteria | 2915980308 | 2915981442 | 576 |
| 352 | iso_pu_bacteria | 2915986958 | 2915991446 | 576 |
| 353 | iso_pu_bacteria | 2915993759 | 2915998703 | 576 |
| 354 | iso_pu_bacteria | 2916000859 | 2916003483 | 576 |
| 355 | iso_pu_bacteria | 2916007675 | 2916011654 | 576 |
| 356 | iso_pu_bacteria | 2916014648 | 2916020780 | 576 |
| 357 | iso_pu_bacteria | 2916021584 | 2916024955 | 576 |
| 358 | iso_pu_bacteria | 2916028427 | 2916033768 | 576 |
| 359 | iso_pu_bacteria | 2916035215 | 2916037869 | 576 |
| 360 | iso_pu_bacteria | 2916041962 | 2916045331 | 576 |
| 361 | iso_pu_bacteria | 2916048683 | 2916049045 | 576 |
| 362 | iso_pu_bacteria | 2916055098 | 2916055717 | 576 |
| 363 | iso_pu_bacteria | 2916061851 | 2916064901 | 576 |
| 364 | iso_pu_bacteria | 2916076590 | 2916083200 | 576 |
| 365 | iso_pu_bacteria | 2920822456 | 2920825213 | 576 |
| 366 | iso_pu_bacteria | 2921201388 | 2921201867 | 576 |
| 367 | iso_pu_bacteria | 2921208531 | 2921211109 | 576 |
| 368 | iso_pu_bacteria | 2921237296 | 2921240927 | 576 |
| 369 | iso_pu_bacteria | 2921244191 | 2921246771 | 576 |
| 370 | iso_pu_bacteria | 2921250672 | 2921252089 | 576 |
| 371 | iso_pu_bacteria | 2921257292 | 2921263768 | 576 |
| 372 | iso_pu_bacteria | 2921263974 | 2921266212 | 576 |
| 373 | iso_pu_bacteria | 2921282425 | 2921287978 | 576 |
| 374 | iso_pu_bacteria | 2921289301 | 2921290953 | 576 |
| 375 | iso_pu_bacteria | 2921296804 | 2921299040 | 576 |
| 376 | iso_pu_bacteria | 2924144063 | 2924146751 | 576 |
| 377 | iso_pu_bacteria | 2924150972 | 2924157989 | 576 |
| 378 | iso_pu_bacteria | 2924158325 | 2924159277 | 576 |
| 379 | iso_pu_bacteria | 2924165586 | 2924169157 | 576 |
| 380 | iso_pu_bacteria | 2924172951 | 2924174566 | 576 |
| 381 | iso_pu_bacteria | 2924179722 | 2924182997 | 576 |
| 382 | iso_pu_bacteria | 2924186466 | 2924192708 | 576 |
| 383 | iso_pu_bacteria | 2924193448 | 2924195387 | 576 |
| 384 | iso_pu_bacteria | 2924200457 | 2924203322 | 576 |
| 385 | iso_pu_bacteria | 2924207177 | 2924210741 | 576 |
| 386 | iso_pu_bacteria | 2924214083 | 2924217126 | 576 |
| 387 | iso_pu_bacteria | 2924221636 | 2924223291 | 576 |
| 388 | iso_pu_bacteria | 2924228884 | 2924230523 | 576 |
| 389 | iso_pu_bacteria | 2936996657 | 2937000707 | 576 |
| 390 | iso_pu_bacteria | 2937002841 | 2937004557 | 576 |
| 391 | iso_pu_bacteria | 2937009748 | 2937011199 | 576 |
| 392 | iso_pu_bacteria | 2937016420 | 2937019822 | 576 |
| 393 | iso_pu_bacteria | 2937023124 | 2937024585 | 576 |
| 394 | iso_pu_bacteria | 2937029754 | 2937030288 | 576 |
| 395 | iso_pu_bacteria | 2937036028 | 2937042670 | 576 |
| 396 | iso_pu_bacteria | 2937042894 | 2937045541 | 576 |
| 397 | iso_pu_bacteria | 2937049772 | 2937056155 | 576 |
| 398 | iso_pu_bacteria | 2937056579 | 2937063569 | 576 |
| 399 | iso_pu_bacteria | 2937063883 | 2937067775 | 576 |
| 400 | iso_pu_bacteria | 2937071275 | 2937074392 | 576 |
| 401 | iso_pu_bacteria | 2937078374 | 2937080274 | 576 |
| 402 | iso_pu_bacteria | 2937084907 | 2937086027 | 576 |
| 403 | iso_pu_bacteria | 2937091812 | 2937097222 | 576 |
| 404 | iso_pu_bacteria | 2937098957 | 2937103034 | 576 |
| 405 | iso_pu_bacteria | 2937106411 | 2937111258 | 576 |
| 406 | iso_pu_bacteria | 2937113482 | 2937116143 | 576 |
| 407 | iso_pu_bacteria | 2937119839 | 2937121986 | 576 |
| 408 | iso_pu_bacteria | 2937126314 | 2937128827 | 576 |
| 409 | iso_pu_bacteria | 2941499720 | 2941502138 | 576 |
| 410 | iso_pu_bacteria | 2957375807 | 2957376383 | 576 |
| 411 | iso_pu_bacteria | 2957382221 | 2957384276 | 576 |
| 412 | iso_pu_bacteria | 2957388812 | 2957390739 | 576 |
| 413 | iso_pu_bacteria | 2957395598 | 2957395895 | 576 |
| 414 | iso_pu_bacteria | 2957402308 | 2957404501 | 576 |
| 415 | iso_pu_bacteria | 2957408893 | 2957412088 | 576 |
| 416 | iso_pu_bacteria | 2957415311 | 2957421210 | 576 |
| 417 | iso_pu_bacteria | 2957430029 | 2957431717 | 576 |
| 418 | iso_pu_bacteria | 2957437181 | 2957438169 | 576 |
| 419 | iso_pu_bacteria | 2957443900 | 2957446907 | 576 |
| 420 | iso_pu_bacteria | 2957450854 | 2957453749 | 576 |
| 421 | iso_pu_bacteria | 2957457609 | 2957461945 | 576 |
| 422 | iso_pu_bacteria | 2957464669 | 2957467043 | 576 |
| 423 | iso_pu_bacteria | 2957471148 | 2957476387 | 576 |
| 424 | iso_pu_bacteria | 2957478035 | 2957479603 | 576 |
| 425 | iso_pu_bacteria | 2957484790 | 2957490461 | 576 |
| 426 | iso_pu_bacteria | 2957491536 | 2957494108 | 576 |
| 427 | iso_pu_bacteria | 2957498199 | 2957503311 | 576 |
| 428 | iso_pu_bacteria | 2957505466 | 2957510615 | 576 |
| 429 | iso_pu_bacteria | 2960584000 | 2960587488 | 576 |
| 430 | iso_pu_bacteria | 2960591022 | 2960592088 | 576 |
| 431 | iso_pu_bacteria | 2960597568 | 2960599992 | 576 |
| 432 | iso_pu_bacteria | 2960603979 | 2960610590 | 576 |
| 433 | iso_pu_bacteria | 2960610863 | 2960612315 | 576 |
| 434 | iso_pu_bacteria | 2960617483 | 2960620465 | 576 |
| 435 | iso_pu_bacteria | 2960624210 | 2960624480 | 576 |
| 436 | iso_pu_bacteria | 2960631154 | 2960632048 | 576 |
| 437 | iso_pu_bacteria | 2960637947 | 2960644123 | 576 |
| 438 | iso_pu_bacteria | 2960645483 | 2960648414 | 576 |
| 439 | iso_pu_bacteria | 2960652885 | 2960656525 | 576 |
| 440 | iso_pu_bacteria | 2960660292 | 2960665566 | 576 |
| 441 | iso_pu_bacteria | 2960667422 | 2960669659 | 576 |
| 442 | iso_pu_bacteria | 2960674078 | 2960675159 | 576 |
| 443 | iso_pu_bacteria | 2960680706 | 2960681623 | 576 |
| 444 | iso_pu_bacteria | 2960687367 | 2960691467 | 576 |
| 445 | iso_pu_bacteria | 2960693952 | 2960694801 | 576 |
| 446 | iso_pu_bacteria | 2964607997 | 2964614126 | 576 |
| 447 | iso_pu_bacteria | 2964615318 | 2964617747 | 576 |
| 448 | iso_pu_bacteria | 2964621998 | 2964623632 | 576 |
| 449 | iso_pu_bacteria | 2964628898 | 2964632587 | 576 |
| 450 | iso_pu_bacteria | 2964636051 | 2964640818 | 576 |
| 451 | iso_pu_bacteria | 2964643177 | 2964645685 | 576 |
| 452 | iso_pu_bacteria | 2964649959 | 2964651556 | 576 |
| 453 | iso_pu_bacteria | 2964656573 | 2964660526 | 576 |
| 454 | iso_pu_bacteria | 2964663802 | 2964666922 | 576 |
| 455 | iso_pu_bacteria | 2964670856 | 2964675343 | 576 |
| 456 | iso_pu_bacteria | 2964678106 | 2964682875 | 576 |
| 457 | iso_pu_bacteria | 2964685014 | 2964688483 | 576 |
| 458 | iso_pu_bacteria | 2964691889 | 2964692480 | 576 |
| 459 | iso_pu_bacteria | 2964698721 | 2964701642 | 576 |
| 460 | iso_pu_bacteria | 2964705432 | 2964711092 | 576 |
| 461 | iso_pu_bacteria | 2964712639 | 2964715159 | 576 |
| 462 | iso_pu_bacteria | 2964719344 | 2964720679 | 576 |
| 463 | iso_pu_bacteria | 2967664464 | 2967665124 | 576 |
| 464 | iso_pu_bacteria | 2967671571 | 2967678413 | 576 |
| 465 | iso_pu_bacteria | 2967678726 | 2967684425 | 576 |
| 466 | iso_pu_bacteria | 2967686174 | 2967689715 | 576 |
| 467 | iso_pu_bacteria | 2967693043 | 2967694644 | 576 |
| 468 | iso_pu_bacteria | 2967699805 | 2967706464 | 576 |
| 469 | iso_pu_bacteria | 2967706974 | 2967708622 | 576 |
| 470 | iso_pu_bacteria | 2967714385 | 2967714875 | 576 |
| 471 | iso_pu_bacteria | 2967721400 | 2967726123 | 576 |
| 472 | iso_pu_bacteria | 2967728569 | 2967728993 | 576 |
| 473 | iso_pu_bacteria | 2967735183 | 2967737148 | 576 |
| 474 | iso_pu_bacteria | 2967742019 | 2967742555 | 576 |
| 475 | iso_pu_bacteria | 2967748971 | 2967751602 | 576 |
| 476 | iso_pu_bacteria | 2967755722 | 2967760018 | 576 |
| 477 | iso_pu_bacteria | 2967762386 | 2967767515 | 576 |
| 478 | iso_pu_bacteria | 2967769361 | 2967772120 | 576 |
| 479 | iso_pu_bacteria | 2967775926 | 2967778981 | 576 |
| 480 | iso_pu_bacteria | 2970019648 | 2970021061 | 576 |
| 481 | iso_pu_bacteria | 2970026789 | 2970028343 | 576 |
| 482 | iso_pu_bacteria | 2970033650 | 2970040290 | 576 |
| 483 | iso_pu_bacteria | 2970040964 | 2970042640 | 576 |
| 484 | iso_pu_bacteria | 2970047711 | 2970050971 | 576 |
| 485 | iso_pu_bacteria | 2970054988 | 2970056701 | 576 |
| 486 | iso_pu_bacteria | 2970061556 | 2970067143 | 576 |
| 487 | iso_pu_bacteria | 2970068827 | 2970071587 | 576 |
| 488 | iso_pu_bacteria | 2970076120 | 2970078263 | 576 |
| 489 | iso_pu_bacteria | 2970082768 | 2970085245 | 576 |
| 490 | iso_pu_bacteria | 2970088815 | 2970092547 | 576 |
| 491 | iso_pu_bacteria | 2970095765 | 2970102155 | 576 |
| 492 | iso_pu_bacteria | 2970102677 | 2970107998 | 576 |
| 493 | iso_pu_bacteria | 2970109326 | 2970110709 | 576 |
| 494 | iso_pu_bacteria | 2970116247 | 2970117355 | 576 |
| 495 | iso_pu_bacteria | 2970122695 | 2970125822 | 576 |
| 496 | iso_pu_bacteria | 2970129317 | 2970131165 | 576 |
| 497 | iso_pu_bacteria | 2970136068 | 2970136293 | 576 |
| 498 | iso_pu_bacteria | 2970143518 | 2970146728 | 576 |
| 499 | iso_pu_bacteria | 2970149975 | 2970151615 | 576 |
| 500 | iso_pu_bacteria | 2970156795 | 2970159568 | 576 |
| 501 | iso_pu_bacteria | 2970164137 | 2970166977 | 576 |
| 502 | iso_pu_bacteria | 2970170962 | 2970174243 | 576 |
| 503 | iso_pu_bacteria | 2970177841 | 2970180825 | 576 |
| 504 | iso_pu_bacteria | 2970184632 | 2970189170 | 576 |
| 505 | iso_pu_bacteria | 2970191845 | 2970193600 | 576 |
| 506 | iso_pu_bacteria | 2977516862 | 2977519116 | 576 |
| 507 | iso_pu_bacteria | 2977523885 | 2977526329 | 576 |
| 508 | iso_pu_bacteria | 2977530762 | 2977534055 | 576 |
| 509 | iso_pu_bacteria | 2977537788 | 2977539626 | 576 |
| 510 | iso_pu_bacteria | 2977544691 | 2977546360 | 576 |
| 511 | iso_pu_bacteria | 2977551784 | 2977558432 | 576 |
| 512 | iso_pu_bacteria | 2977558990 | 2977563173 | 576 |
| 513 | iso_pu_bacteria | 2977565890 | 2977567665 | 576 |
| 514 | iso_pu_bacteria | 2977572785 | 2977575746 | 576 |
| 515 | iso_pu_bacteria | 2977579622 | 2977581997 | 576 |
| 516 | iso_pu_bacteria | 2989349275 | 2989349670 | 576 |
| 517 | iso_pu_bacteria | 2989771324 | 2989774285 | 576 |
| 518 | iso_pu_bacteria | 3003930520 | 3003934064 | 576 |
| 519 | iso_pu_bacteria | 643692032 | 643826312 | 576 |
| 520 | iso_pu_bacteria | 648276728 | 648739212 | 576 |
| 521 | iso_pu_bacteria | 8003992118 | 8003994166 | 576 |
| 522 | iso_pu_bacteria | 8003999396 | 8004001798 | 576 |
| 523 | iso_pu_bacteria | 8005658619 | 8005659031 | 576 |
| 524 | iso_pu_bacteria | 8049293176 | 8049295320 | 576 |
| 525 | iso_pu_bacteria | 8055431914 | 8055432762 | 576 |
| 526 | iso_pu_bacteria | 2510917030 | 2511199027 | 577 |
| 527 | iso_pu_bacteria | 2558860983 | 2561468372 | 577 |
| 528 | iso_pu_bacteria | 2582581298 | 2585222830 | 577 |
| 529 | iso_pu_bacteria | 2585427529 | 2585545413 | 577 |
| 530 | iso_pu_bacteria | 2775507049 | 2776913923 | 577 |
| 531 | iso_pu_bacteria | 2919100787 | 2919107659 | 577 |
| 532 | iso_pu_bacteria | 3005445848 | 3005448444 | 577 |
| 533 | iso_pu_bacteria | 3005452660 | 3005454634 | 577 |
| 534 | iso_pu_bacteria | 8018150411 | 8018153226 | 577 |
| 535 | 3300006038 | Ga0075365_10005814 | Ga0075365_100058145 | 578 |
| 536 | 3300006051 | Ga0075364_10012850 | Ga0075364_100128505 | 578 |
| 537 | 3300025294 | Ga0209025_1000140 | Ga0209025_100014071 | 578 |
| 538 | 3300037418 | Ga0395900_0010176 | Ga0395900_0010176_4282_6039 | 578 |
| 539 | 3300038443 | Ga0395901_0154081 | Ga0395901_0154081_558_2315 | 578 |
| 540 | 3300048920 | Ga0496117_0004520 | Ga0496117_0004520_6158_7897 | 578 |
| 541 | 3300048920 | Ga0496117_0018869 | Ga0496117_0018869_1244_2983 | 578 |
| 542 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_390528_392267 | 578 |
| 543 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_132594_134333 | 578 |
| 544 | 3300048925 | Ga0496122_0008959 | Ga0496122_0008959_2606_4345 | 578 |
| 545 | 3300048926 | Ga0496123_0000336 | Ga0496123_0000336_16590_18329 | 578 |
| 546 | 3300048927 | Ga0496124_0090675 | Ga0496124_0090675_149_1888 | 578 |
| 547 | 3300048928 | Ga0496125_0000039 | Ga0496125_0000039_169166_170905 | 578 |
| 548 | 3300048928 | Ga0496125_0000248 | Ga0496125_0000248_92358_94097 | 578 |
| 549 | 3300050492 | nmdc:mga0yw44_3456_c1 | nmdc:mga0yw44_3456_c1_4041_5783 | 578 |
| 550 | 3300053161 | Ga0500634_0000261 | Ga0500634_0000261_7474_9213 | 578 |
| 551 | iso_pu_bacteria | 2513237138 | 2513865598 | 578 |
| 552 | iso_pu_bacteria | 2513237144 | 2513909003 | 578 |
| 553 | iso_pu_bacteria | 2513237146 | 2513925385 | 578 |
| 554 | iso_pu_bacteria | 2524023209 | 2524459587 | 578 |
| 555 | iso_pu_bacteria | 2582581299 | 2585231741 | 578 |
| 556 | iso_pu_bacteria | 2582581304 | 2585255082 | 578 |
| 557 | iso_pu_bacteria | 2582581867 | 2585402399 | 578 |
| 558 | iso_pu_bacteria | 2585427590 | 2585822914 | 578 |
| 559 | iso_pu_bacteria | 2585427594 | 2585843225 | 578 |
| 560 | iso_pu_bacteria | 2585427608 | 2585898243 | 578 |
| 561 | iso_pu_bacteria | 2599185170 | 2599417301 | 578 |
| 562 | iso_pu_bacteria | 2643221599 | 2644003159 | 578 |
| 563 | iso_pu_bacteria | 2643221634 | 2644193507 | 578 |
| 564 | iso_pu_bacteria | 2643221643 | 2644238681 | 578 |
| 565 | iso_pu_bacteria | 2738541293 | 2738800083 | 578 |
| 566 | iso_pu_bacteria | 2838035591 | 2838038499 | 578 |
| 567 | iso_pu_bacteria | 2838661181 | 2838661590 | 578 |
| 568 | iso_pu_bacteria | 2842298080 | 2842301368 | 578 |
| 569 | iso_pu_bacteria | 2842357229 | 2842357905 | 578 |
| 570 | iso_pu_bacteria | 2923556063 | 2923558571 | 578 |
| 571 | iso_pu_bacteria | 2933016740 | 2933022323 | 578 |
| 572 | iso_pu_bacteria | 3005409236 | 3005414602 | 578 |
| 573 | iso_pu_bacteria | 8024486573 | 8024488025 | 578 |
| 574 | 3300003187 | JGI25151J46595_10033516 | JGI25151J46595_100335161 | 579 |
| 575 | 3300003781 | Ga0055536_1002960 | Ga0055536_10029603 | 579 |
| 576 | 3300003792 | Ga0055540_1005992 | Ga0055540_10059925 | 579 |
| 577 | 3300003794 | Ga0055531_10007721 | Ga0055531_100077215 | 579 |
| 578 | 3300003856 | Ga0058692_1008129 | Ga0058692_10081293 | 579 |
| 579 | 3300006178 | Ga0075367_10063647 | Ga0075367_100636471 | 579 |
| 580 | 3300006186 | Ga0075369_10013843 | Ga0075369_100138432 | 579 |
| 581 | 3300009766 | Ga0123342_1004784 | Ga0123342_100478410 | 579 |
| 582 | 3300013102 | Ga0157371_10000017 | Ga0157371_1000001756 | 579 |
| 583 | 3300013104 | Ga0157370_10000461 | Ga0157370_1000046124 | 579 |
| 584 | 3300025273 | Ga0209673_1002134 | Ga0209673_10021344 | 579 |
| 585 | 3300025294 | Ga0209025_1001869 | Ga0209025_100186920 | 579 |
| 586 | 3300025294 | Ga0209025_1016060 | Ga0209025_10160604 | 579 |
| 587 | 3300025297 | Ga0209758_1000413 | Ga0209758_100041333 | 579 |
| 588 | 3300025299 | Ga0209256_1006650 | Ga0209256_10066503 | 579 |
| 589 | 3300025302 | Ga0207426_1000869 | Ga0207426_100086911 | 579 |
| 590 | 3300025303 | Ga0209051_1000314 | Ga0209051_100031429 | 579 |
| 591 | 3300025304 | Ga0209257_1002070 | Ga0209257_10020705 | 579 |
| 592 | 3300025972 | Ga0207668_10107108 | Ga0207668_101071081 | 579 |
| 593 | 3300027312 | Ga0209371_1000022 | Ga0209371_100002284 | 579 |
| 594 | 3300027312 | Ga0209371_1002282 | Ga0209371_10022822 | 579 |
| 595 | 3300027666 | Ga0209282_1004803 | Ga0209282_10048033 | 579 |
| 596 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019436 | 579 |
| 597 | 3300030500 | Ga0268256_1004953 | Ga0268256_10049534 | 579 |
| 598 | 3300037471 | Ga0395905_0000867 | Ga0395905_0000867_588_2348 | 579 |
| 599 | 3300037471 | Ga0395905_0005044 | Ga0395905_0005044_5206_6969 | 579 |
| 600 | 3300041413 | Ga0439465_0007101 | Ga0439465_0007101_1260_3005 | 579 |
| 601 | 3300046558 | Ga0495633_0026822 | Ga0495633_0026822_195_1937 | 579 |
| 602 | 3300046674 | Ga0495588_0000895 | Ga0495588_0000895_8145_9887 | 579 |
| 603 | 3300047470 | Ga0495681_0004658 | Ga0495681_0004658_913_2655 | 579 |
| 604 | 3300048919 | Ga0496116_0021260 | Ga0496116_0021260_2001_3743 | 579 |
| 605 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_470251_471993 | 579 |
| 606 | 3300048921 | Ga0496118_0000087 | Ga0496118_0000087_81810_83552 | 579 |
| 607 | 3300048922 | Ga0496119_0040522 | Ga0496119_0040522_62_1804 | 579 |
| 608 | 3300048923 | Ga0496120_0000413 | Ga0496120_0000413_13968_15710 | 579 |
| 609 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_117865_119607 | 579 |
| 610 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_117865_119607 | 579 |
| 611 | 3300048927 | Ga0496124_0014720 | Ga0496124_0014720_3600_5342 | 579 |
| 612 | 3300048929 | Ga0496126_0047995 | Ga0496126_0047995_593_2338 | 579 |
| 613 | 3300048929 | Ga0496126_0144505 | Ga0496126_0144505_180_1922 | 579 |
| 614 | 3300050489 | nmdc:mga03683_4496_c1 | nmdc:mga03683_4496_c1_597_2339 | 579 |
| 615 | 3300050491 | nmdc:mga00v17_12_c1 | nmdc:mga00v17_12_c1_18102_19844 | 579 |
| 616 | 3300050492 | nmdc:mga0yw44_291_c1 | nmdc:mga0yw44_291_c1_4982_6724 | 579 |
| 617 | 3300050516 | nmdc:mga0sz30_23498_c1 | nmdc:mga0sz30_23498_c1_624_2366 | 579 |
| 618 | 3300050516 | nmdc:mga0sz30_3736_c1 | nmdc:mga0sz30_3736_c1_1887_3629 | 579 |
| 619 | 3300053107 | Ga0500560_002077 | Ga0500560_002077_544_2286 | 579 |
| 620 | 3300053137 | Ga0500561_0000098 | Ga0500561_0000098_14034_15776 | 579 |
| 621 | 3300053157 | Ga0500624_000768 | Ga0500624_000768_5096_6838 | 579 |
| 622 | 3300053161 | Ga0500634_0011617 | Ga0500634_0011617_2102_3844 | 579 |
| 623 | 3300053177 | Ga0500636_0006724 | Ga0500636_0006724_2746_4488 | 579 |
| 624 | iso_pu_bacteria | 2509276021 | 2509392057 | 579 |
| 625 | iso_pu_bacteria | 2509276033 | 2509445648 | 579 |
| 626 | iso_pu_bacteria | 2509276033 | 2509447051 | 579 |
| 627 | iso_pu_bacteria | 2510065019 | 2510133953 | 579 |
| 628 | iso_pu_bacteria | 2510461076 | 2510895371 | 579 |
| 629 | iso_pu_bacteria | 2510917022 | 2511135400 | 579 |
| 630 | iso_pu_bacteria | 2513237084 | 2513567974 | 579 |
| 631 | iso_pu_bacteria | 2513237085 | 2513576940 | 579 |
| 632 | iso_pu_bacteria | 2513237093 | 2513633388 | 579 |
| 633 | iso_pu_bacteria | 2513237103 | 2513708050 | 579 |
| 634 | iso_pu_bacteria | 2513237162 | 2514020009 | 579 |
| 635 | iso_pu_bacteria | 2515075009 | 2515113002 | 579 |
| 636 | iso_pu_bacteria | 2515154113 | 2515638512 | 579 |
| 637 | iso_pu_bacteria | 2515154114 | 2515640961 | 579 |
| 638 | iso_pu_bacteria | 2515154116 | 2515655357 | 579 |
| 639 | iso_pu_bacteria | 2515154134 | 2515739480 | 579 |
| 640 | iso_pu_bacteria | 2516653077 | 2517036702 | 579 |
| 641 | iso_pu_bacteria | 2516653085 | 2517077061 | 579 |
| 642 | iso_pu_bacteria | 2517093000 | 2517095829 | 579 |
| 643 | iso_pu_bacteria | 2517287029 | 2517407401 | 579 |
| 644 | iso_pu_bacteria | 2519899620 | 2520377194 | 579 |
| 645 | iso_pu_bacteria | 2529292951 | 2530645955 | 579 |
| 646 | iso_pu_bacteria | 2582581307 | 2585271137 | 579 |
| 647 | iso_pu_bacteria | 2585427526 | 2585527441 | 579 |
| 648 | iso_pu_bacteria | 2585427528 | 2585538182 | 579 |
| 649 | iso_pu_bacteria | 2585427531 | 2585558861 | 579 |
| 650 | iso_pu_bacteria | 2585427593 | 2585836131 | 579 |
| 651 | iso_pu_bacteria | 2585427609 | 2585904169 | 579 |
| 652 | iso_pu_bacteria | 2585428125 | 2587980714 | 579 |
| 653 | iso_pu_bacteria | 2615840624 | 2616293366 | 579 |
| 654 | iso_pu_bacteria | 2718217882 | 2719181804 | 579 |
| 655 | iso_pu_bacteria | 2718217927 | 2719386407 | 579 |
| 656 | iso_pu_bacteria | 2718217997 | 2719666155 | 579 |
| 657 | iso_pu_bacteria | 2718218009 | 2719732468 | 579 |
| 658 | iso_pu_bacteria | 2718218199 | 2720492575 | 579 |
| 659 | iso_pu_bacteria | 2718218232 | 2720614010 | 579 |
| 660 | iso_pu_bacteria | 2718218233 | 2720620815 | 579 |
| 661 | iso_pu_bacteria | 2718218235 | 2720632140 | 579 |
| 662 | iso_pu_bacteria | 2718218269 | 2720775868 | 579 |
| 663 | iso_pu_bacteria | 2718218363 | 2721147895 | 579 |
| 664 | iso_pu_bacteria | 2718218365 | 2721159346 | 579 |
| 665 | iso_pu_bacteria | 2718218366 | 2721164731 | 579 |
| 666 | iso_pu_bacteria | 2718218423 | 2721400111 | 579 |
| 667 | iso_pu_bacteria | 2721755514 | 2722840901 | 579 |
| 668 | iso_pu_bacteria | 2721755556 | 2723027472 | 579 |
| 669 | iso_pu_bacteria | 2721755684 | 2723561091 | 579 |
| 670 | iso_pu_bacteria | 2721755685 | 2723567687 | 579 |
| 671 | iso_pu_bacteria | 2721755809 | 2724038924 | 579 |
| 672 | iso_pu_bacteria | 2721755810 | 2724045224 | 579 |
| 673 | iso_pu_bacteria | 2721755819 | 2724090475 | 579 |
| 674 | iso_pu_bacteria | 2721755822 | 2724104952 | 579 |
| 675 | iso_pu_bacteria | 2721755823 | 2724110811 | 579 |
| 676 | iso_pu_bacteria | 2724679232 | 2725952563 | 579 |
| 677 | iso_pu_bacteria | 2728369352 | 2730108408 | 579 |
| 678 | iso_pu_bacteria | 2728369365 | 2730165039 | 579 |
| 679 | iso_pu_bacteria | 2728369397 | 2730298978 | 579 |
| 680 | iso_pu_bacteria | 2738541333 | 2739032839 | 579 |
| 681 | iso_pu_bacteria | 2765235942 | 2766065867 | 579 |
| 682 | iso_pu_bacteria | 2791355256 | 2793294439 | 579 |
| 683 | iso_pu_bacteria | 2791355259 | 2793314545 | 579 |
| 684 | iso_pu_bacteria | 2791355260 | 2793320373 | 579 |
| 685 | iso_pu_bacteria | 2791355261 | 2793329542 | 579 |
| 686 | iso_pu_bacteria | 2791355262 | 2793334488 | 579 |
| 687 | iso_pu_bacteria | 2791355263 | 2793339205 | 579 |
| 688 | iso_pu_bacteria | 2791355264 | 2793348878 | 579 |
| 689 | iso_pu_bacteria | 2791355265 | 2793351834 | 579 |
| 690 | iso_pu_bacteria | 2791355266 | 2793362586 | 579 |
| 691 | iso_pu_bacteria | 2791355267 | 2793368876 | 579 |
| 692 | iso_pu_bacteria | 2802429605 | 2805928803 | 579 |
| 693 | iso_pu_bacteria | 2802429606 | 2805935085 | 579 |
| 694 | iso_pu_bacteria | 2802429633 | 2806043819 | 579 |
| 695 | iso_pu_bacteria | 2802429634 | 2806050250 | 579 |
| 696 | iso_pu_bacteria | 2802429635 | 2806057066 | 579 |
| 697 | iso_pu_bacteria | 2802429636 | 2806064448 | 579 |
| 698 | iso_pu_bacteria | 2802429637 | 2806071715 | 579 |
| 699 | iso_pu_bacteria | 2818991448 | 2819609147 | 579 |
| 700 | iso_pu_bacteria | 2838016132 | 2838017655 | 579 |
| 701 | iso_pu_bacteria | 2838022645 | 2838027544 | 579 |
| 702 | iso_pu_bacteria | 2838042994 | 2838043966 | 579 |
| 703 | iso_pu_bacteria | 2838048938 | 2838054388 | 579 |
| 704 | iso_pu_bacteria | 2838061910 | 2838068017 | 579 |
| 705 | iso_pu_bacteria | 2838068647 | 2838070145 | 579 |
| 706 | iso_pu_bacteria | 2838668709 | 2838670358 | 579 |
| 707 | iso_pu_bacteria | 2838680041 | 2838683470 | 579 |
| 708 | iso_pu_bacteria | 2838686498 | 2838687057 | 579 |
| 709 | iso_pu_bacteria | 2838694306 | 2838697587 | 579 |
| 710 | iso_pu_bacteria | 2838701080 | 2838702729 | 579 |
| 711 | iso_pu_bacteria | 2838707686 | 2838710703 | 579 |
| 712 | iso_pu_bacteria | 2838729681 | 2838729970 | 579 |
| 713 | iso_pu_bacteria | 2838742623 | 2838743015 | 579 |
| 714 | iso_pu_bacteria | 2841851746 | 2841852501 | 579 |
| 715 | iso_pu_bacteria | 2841864319 | 2841870780 | 579 |
| 716 | iso_pu_bacteria | 2842077413 | 2842078876 | 579 |
| 717 | iso_pu_bacteria | 2842110456 | 2842113272 | 579 |
| 718 | iso_pu_bacteria | 2842118031 | 2842118614 | 579 |
| 719 | iso_pu_bacteria | 2842146304 | 2842148013 | 579 |
| 720 | iso_pu_bacteria | 2842156927 | 2842158039 | 579 |
| 721 | iso_pu_bacteria | 2842163707 | 2842168797 | 579 |
| 722 | iso_pu_bacteria | 2842180545 | 2842181658 | 579 |
| 723 | iso_pu_bacteria | 2842192696 | 2842197355 | 579 |
| 724 | iso_pu_bacteria | 2842198810 | 2842203554 | 579 |
| 725 | iso_pu_bacteria | 2842205361 | 2842205482 | 579 |
| 726 | iso_pu_bacteria | 2842217011 | 2842217934 | 579 |
| 727 | iso_pu_bacteria | 2842229732 | 2842230291 | 579 |
| 728 | iso_pu_bacteria | 2842237096 | 2842240526 | 579 |
| 729 | iso_pu_bacteria | 2842243621 | 2842244193 | 579 |
| 730 | iso_pu_bacteria | 2842250916 | 2842253079 | 579 |
| 731 | iso_pu_bacteria | 2842257432 | 2842257721 | 579 |
| 732 | iso_pu_bacteria | 2842264693 | 2842266264 | 579 |
| 733 | iso_pu_bacteria | 2842271015 | 2842271405 | 579 |
| 734 | iso_pu_bacteria | 2842278818 | 2842278939 | 579 |
| 735 | iso_pu_bacteria | 2842285085 | 2842285603 | 579 |
| 736 | iso_pu_bacteria | 2842291075 | 2842292538 | 579 |
| 737 | iso_pu_bacteria | 2842304105 | 2842305033 | 579 |
| 738 | iso_pu_bacteria | 2842311132 | 2842314915 | 579 |
| 739 | iso_pu_bacteria | 2842317721 | 2842320707 | 579 |
| 740 | iso_pu_bacteria | 2842341865 | 2842346456 | 579 |
| 741 | iso_pu_bacteria | 2842363717 | 2842368965 | 579 |
| 742 | iso_pu_bacteria | 2842370503 | 2842374101 | 579 |
| 743 | iso_pu_bacteria | 2842377471 | 2842378936 | 579 |
| 744 | iso_pu_bacteria | 2842384541 | 2842385125 | 579 |
| 745 | iso_pu_bacteria | 2842395702 | 2842399886 | 579 |
| 746 | iso_pu_bacteria | 2842402390 | 2842402963 | 579 |
| 747 | iso_pu_bacteria | 2842409023 | 2842409665 | 579 |
| 748 | iso_pu_bacteria | 2842415677 | 2842416316 | 579 |
| 749 | iso_pu_bacteria | 2842422224 | 2842423759 | 579 |
| 750 | iso_pu_bacteria | 2842428310 | 2842430727 | 579 |
| 751 | iso_pu_bacteria | 2842434925 | 2842437286 | 579 |
| 752 | iso_pu_bacteria | 2842441272 | 2842443656 | 579 |
| 753 | iso_pu_bacteria | 2842447887 | 2842454049 | 579 |
| 754 | iso_pu_bacteria | 2842462802 | 2842464870 | 579 |
| 755 | iso_pu_bacteria | 2842469257 | 2842471904 | 579 |
| 756 | iso_pu_bacteria | 2842489311 | 2842491975 | 579 |
| 757 | iso_pu_bacteria | 2842495871 | 2842496829 | 579 |
| 758 | iso_pu_bacteria | 2842509118 | 2842511131 | 579 |
| 759 | iso_pu_bacteria | 2844454524 | 2844458424 | 579 |
| 760 | iso_pu_bacteria | 2852387548 | 2852390223 | 579 |
| 761 | iso_pu_bacteria | 2857516855 | 2857517436 | 579 |
| 762 | iso_pu_bacteria | 2933570622 | 2933570841 | 579 |
| 763 | iso_pu_bacteria | 2933586486 | 2933588672 | 579 |
| 764 | iso_pu_bacteria | 2933599457 | 2933600951 | 579 |
| 765 | iso_pu_bacteria | 2935894831 | 2935897028 | 579 |
| 766 | iso_pu_bacteria | 2935901341 | 2935901961 | 579 |
| 767 | iso_pu_bacteria | 2936367885 | 2936372040 | 579 |
| 768 | iso_pu_bacteria | 2936375103 | 2936379903 | 579 |
| 769 | iso_pu_bacteria | 2936381700 | 2936382807 | 579 |
| 770 | iso_pu_bacteria | 2996893221 | 2996894333 | 579 |
| 771 | iso_pu_bacteria | 3005416602 | 3005419472 | 579 |
| 772 | iso_pu_bacteria | 639633055 | 639649186 | 579 |
| 773 | iso_pu_bacteria | 8005275841 | 8005281204 | 579 |
| 774 | iso_pu_bacteria | 8005282627 | 8005283260 | 579 |
| 775 | iso_pu_bacteria | 8005289223 | 8005293634 | 579 |
| 776 | iso_pu_bacteria | 8005301065 | 8005303119 | 579 |
| 777 | iso_pu_bacteria | 8005307578 | 8005312828 | 579 |
| 778 | iso_pu_bacteria | 8005314921 | 8005316763 | 579 |
| 779 | iso_pu_bacteria | 8005376324 | 8005380922 | 579 |
| 780 | iso_pu_bacteria | 8005382845 | 8005389128 | 579 |
| 781 | iso_pu_bacteria | 8005395548 | 8005396108 | 579 |
| 782 | iso_pu_bacteria | 8005430974 | 8005435151 | 579 |
| 783 | iso_pu_bacteria | 8005460587 | 8005463681 | 579 |
| 784 | iso_pu_bacteria | 8005484373 | 8005489189 | 579 |
| 785 | iso_pu_bacteria | 8005497431 | 8005500893 | 579 |
| 786 | iso_pu_bacteria | 8005556819 | 8005557021 | 579 |
| 787 | iso_pu_bacteria | 8005563573 | 8005567987 | 579 |
| 788 | iso_pu_bacteria | 8005570704 | 8005573468 | 579 |
| 789 | iso_pu_bacteria | 8005619151 | 8005622266 | 579 |
| 790 | iso_pu_bacteria | 8005626139 | 8005632254 | 579 |
| 791 | iso_pu_bacteria | 8005645114 | 8005648135 | 579 |
| 792 | iso_pu_bacteria | 8005668836 | 8005672311 | 579 |
| 793 | iso_pu_bacteria | 8005688590 | 8005692113 | 579 |
| 794 | iso_pu_bacteria | 8005695170 | 8005697394 | 579 |
| 795 | iso_pu_bacteria | 8018127388 | 8018134088 | 579 |
| 796 | iso_pu_bacteria | 8018163183 | 8018164632 | 579 |
| 797 | iso_pu_bacteria | 8018176218 | 8018181331 | 579 |
| 798 | iso_pu_bacteria | 8023680758 | 8023683174 | 579 |
| 799 | iso_pu_bacteria | 8024479707 | 8024482869 | 579 |
| 800 | iso_pu_bacteria | 8024501048 | 8024504417 | 579 |
| 801 | iso_pu_bacteria | 8046767195 | 8046771931 | 579 |
| 802 | iso_pu_bacteria | 8056375014 | 8056375928 | 579 |
| 803 | iso_pu_bacteria | 8056382006 | 8056386719 | 579 |
| 804 | iso_pu_bacteria | 8057575449 | 8057575739 | 579 |
| 805 | iso_pu_bacteria | 8057874678 | 8057877680 | 579 |
| 806 | 3300002739 | JGI25158J39367_1004417 | JGI25158J39367_10044171 | 580 |
| 807 | 3300002987 | JGI25159J45721_1000014 | JGI25159J45721_100001456 | 580 |
| 808 | 3300003354 | JGI25160J50197_1000020 | JGI25160J50197_100002056 | 580 |
| 809 | 3300003374 | JGI25161J50226_1001138 | JGI25161J50226_10011388 | 580 |
| 810 | 3300003771 | Ga0055526_1001490 | Ga0055526_100149010 | 580 |
| 811 | 3300003781 | Ga0055536_1001187 | Ga0055536_10011879 | 580 |
| 812 | 3300003791 | Ga0055530_10016062 | Ga0055530_100160622 | 580 |
| 813 | 3300003794 | Ga0055531_10004794 | Ga0055531_100047944 | 580 |
| 814 | 3300004625 | Ga0055543_1000047 | Ga0055543_100004742 | 580 |
| 815 | 3300005262 | Ga0065165_1000013 | Ga0065165_1000013164 | 580 |
| 816 | 3300006946 | Ga0079104_1006084 | Ga0079104_10060842 | 580 |
| 817 | 3300013105 | Ga0157369_10016027 | Ga0157369_100160274 | 580 |
| 818 | 3300013249 | Ga0171463_1003 | Ga0171463_1003165 | 580 |
| 819 | 3300015690 | Ga0183363_1156 | Ga0183363_115614 | 580 |
| 820 | 3300021320 | Ga0214544_1001800 | Ga0214544_100180016 | 580 |
| 821 | 3300021321 | Ga0214542_1000012 | Ga0214542_100001288 | 580 |
| 822 | 3300021327 | Ga0214543_1000024 | Ga0214543_100002489 | 580 |
| 823 | 3300021327 | Ga0214543_1000038 | Ga0214543_100003867 | 580 |
| 824 | 3300025208 | Ga0209436_101065 | Ga0209436_1010653 | 580 |
| 825 | 3300025284 | Ga0209130_1000034 | Ga0209130_1000034159 | 580 |
| 826 | 3300025292 | Ga0209676_1000482 | Ga0209676_100048244 | 580 |
| 827 | 3300025294 | Ga0209025_1000314 | Ga0209025_100031421 | 580 |
| 828 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013158 | 580 |
| 829 | 3300025298 | Ga0209050_1000646 | Ga0209050_100064631 | 580 |
| 830 | 3300025299 | Ga0209256_1000396 | Ga0209256_10003962 | 580 |
| 831 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006532 | 580 |
| 832 | 3300025303 | Ga0209051_1001414 | Ga0209051_10014143 | 580 |
| 833 | 3300025304 | Ga0209257_1003315 | Ga0209257_10033155 | 580 |
| 834 | 3300027111 | Ga0209281_1000318 | Ga0209281_100031825 | 580 |
| 835 | 3300048929 | Ga0496126_0017426 | Ga0496126_0017426_1396_3144 | 580 |
| 836 | 3300049568 | Ga0501031_0035722 | Ga0501031_0035722_1186_2934 | 580 |
| 837 | 3300049569 | Ga0501032_0036811 | Ga0501032_0036811_645_2393 | 580 |
| 838 | 3300049570 | Ga0501033_0027473 | Ga0501033_0027473_2222_3970 | 580 |
| 839 | 3300049572 | Ga0501036_0020924 | Ga0501036_0020924_2468_4216 | 580 |
| 840 | 3300049573 | Ga0501037_0041769 | Ga0501037_0041769_647_2395 | 580 |
| 841 | 3300049822 | Ga0501035_0071346 | Ga0501035_0071346_233_1981 | 580 |
| 842 | 3300049823 | Ga0501044_0132993 | Ga0501044_0132993_675_2423 | 580 |
| 843 | 3300053125 | Ga0500618_000677 | Ga0500618_000677_2243_3988 | 580 |
| 844 | iso_pu_bacteria | 2582581308 | 2585277481 | 580 |
| 845 | iso_pu_bacteria | 2582581315 | 2585323335 | 580 |
| 846 | iso_pu_bacteria | 2582581316 | 2585331477 | 580 |
| 847 | iso_pu_bacteria | 2585427527 | 2585535108 | 580 |
| 848 | iso_pu_bacteria | 2585427530 | 2585555958 | 580 |
| 849 | iso_pu_bacteria | 2615840626 | 2616308956 | 580 |
| 850 | iso_pu_bacteria | 2615840698 | 2616554227 | 580 |
| 851 | iso_pu_bacteria | 2617270742 | 2617384719 | 580 |
| 852 | iso_pu_bacteria | 2667528174 | 2671111431 | 580 |
| 853 | iso_pu_bacteria | 2775507266 | 2778175414 | 580 |
| 854 | iso_pu_bacteria | 2818991453 | 2819637625 | 580 |
| 855 | iso_pu_bacteria | 2838029111 | 2838029807 | 580 |
| 856 | iso_pu_bacteria | 2842475841 | 2842476908 | 580 |
| 857 | iso_pu_bacteria | 2842482326 | 2842484562 | 580 |
| 858 | iso_pu_bacteria | 2842502639 | 2842503335 | 580 |
| 859 | iso_pu_bacteria | 2919408235 | 2919409978 | 580 |
| 860 | iso_pu_bacteria | 8005682033 | 8005682891 | 580 |
| 861 | 3300002739 | JGI25158J39367_1000038 | JGI25158J39367_100003815 | 581 |
| 862 | 3300002773 | JGI25152J39213_1005336 | JGI25152J39213_10053365 | 581 |
| 863 | 3300002773 | JGI25152J39213_1011145 | JGI25152J39213_10111452 | 581 |
| 864 | 3300002774 | JGI25150J39212_1005870 | JGI25150J39212_10058702 | 581 |
| 865 | 3300002987 | JGI25159J45721_1000424 | JGI25159J45721_100042421 | 581 |
| 866 | 3300003215 | JGI25153J46596_10012015 | JGI25153J46596_100120154 | 581 |
| 867 | 3300003215 | JGI25153J46596_10027232 | JGI25153J46596_100272322 | 581 |
| 868 | 3300003354 | JGI25160J50197_1002863 | JGI25160J50197_10028635 | 581 |
| 869 | 3300003374 | JGI25161J50226_1000174 | JGI25161J50226_100017437 | 581 |
| 870 | 3300003790 | Ga0055528_1002830 | Ga0055528_10028305 | 581 |
| 871 | 3300003792 | Ga0055540_1007010 | Ga0055540_10070102 | 581 |
| 872 | 3300004625 | Ga0055543_1001281 | Ga0055543_10012814 | 581 |
| 873 | 3300025208 | Ga0209436_100150 | Ga0209436_10015021 | 581 |
| 874 | 3300025245 | Ga0207425_1006502 | Ga0207425_10065022 | 581 |
| 875 | 3300025245 | Ga0207425_1009350 | Ga0207425_10093502 | 581 |
| 876 | 3300025258 | Ga0209129_1005932 | Ga0209129_10059324 | 581 |
| 877 | 3300025258 | Ga0209129_1008863 | Ga0209129_10088632 | 581 |
| 878 | 3300025273 | Ga0209673_1009281 | Ga0209673_10092812 | 581 |
| 879 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020253 | 581 |
| 880 | 3300025295 | Ga0209564_1000647 | Ga0209564_100064713 | 581 |
| 881 | 3300025297 | Ga0209758_1001882 | Ga0209758_100188216 | 581 |
| 882 | 3300025297 | Ga0209758_1004734 | Ga0209758_10047347 | 581 |
| 883 | 3300025299 | Ga0209256_1001653 | Ga0209256_100165310 | 581 |
| 884 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008321 | 581 |
| 885 | 3300025303 | Ga0209051_1003927 | Ga0209051_10039272 | 581 |
| 886 | 3300041413 | Ga0439465_0003817 | Ga0439465_0003817_1448_3196 | 581 |
| 887 | 3300046460 | Ga0495638_0024145 | Ga0495638_0024145_1126_2889 | 581 |
| 888 | 3300046507 | Ga0495606_0025623 | Ga0495606_0025623_2383_4131 | 581 |
| 889 | 3300046512 | Ga0495610_0027406 | Ga0495610_0027406_1218_2966 | 581 |
| 890 | 3300046522 | Ga0495643_0002802 | Ga0495643_0002802_7354_9102 | 581 |
| 891 | 3300047472 | Ga0495686_0013660 | Ga0495686_0013660_975_2720 | 581 |
| 892 | 3300048909 | Ga0496106_0000982 | Ga0496106_0000982_17416_19164 | 581 |
| 893 | 3300048920 | Ga0496117_0019692 | Ga0496117_0019692_2329_4077 | 581 |
| 894 | 3300048921 | Ga0496118_0017417 | Ga0496118_0017417_3199_4947 | 581 |
| 895 | 3300048924 | Ga0496121_0039603 | Ga0496121_0039603_854_2602 | 581 |
| 896 | 3300048928 | Ga0496125_0017415 | Ga0496125_0017415_1751_3499 | 581 |
| 897 | 3300049571 | Ga0501034_0097012 | Ga0501034_0097012_616_2367 | 581 |
| 898 | 3300049584 | Ga0501068_0030071 | Ga0501068_0030071_563_2311 | 581 |
| 899 | 3300049744 | Ga0501083_0017170 | Ga0501083_0017170_1955_3703 | 581 |
| 900 | 3300049823 | Ga0501044_0077051 | Ga0501044_0077051_256_2007 | 581 |
| 901 | 3300053134 | Ga0500658_0002581 | Ga0500658_0002581_1455_3203 | 581 |
| 902 | 3300053156 | Ga0500622_0000458 | Ga0500622_0000458_19657_21405 | 581 |
| 903 | 3300002773 | JGI25152J39213_1000636 | JGI25152J39213_10006365 | 582 |
| 904 | 3300002773 | JGI25152J39213_1011099 | JGI25152J39213_10110992 | 582 |
| 905 | 3300002774 | JGI25150J39212_1000107 | JGI25150J39212_10001077 | 582 |
| 906 | 3300003187 | JGI25151J46595_10000374 | JGI25151J46595_1000037439 | 582 |
| 907 | 3300003187 | JGI25151J46595_10008401 | JGI25151J46595_100084013 | 582 |
| 908 | 3300003215 | JGI25153J46596_10000696 | JGI25153J46596_100006963 | 582 |
| 909 | 3300003215 | JGI25153J46596_10027126 | JGI25153J46596_100271262 | 582 |
| 910 | 3300003775 | Ga0055524_1007091 | Ga0055524_10070913 | 582 |
| 911 | 3300003790 | Ga0055528_1001734 | Ga0055528_10017347 | 582 |
| 912 | 3300025245 | Ga0207425_1000075 | Ga0207425_100007559 | 582 |
| 913 | 3300025258 | Ga0209129_1000156 | Ga0209129_100015639 | 582 |
| 914 | 3300025258 | Ga0209129_1000218 | Ga0209129_10002185 | 582 |
| 915 | 3300025258 | Ga0209129_1006736 | Ga0209129_10067362 | 582 |
| 916 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010213 | 582 |
| 917 | 3300025294 | Ga0209025_1000070 | Ga0209025_1000070238 | 582 |
| 918 | 3300025294 | Ga0209025_1005193 | Ga0209025_10051937 | 582 |
| 919 | 3300025294 | Ga0209025_1015317 | Ga0209025_10153174 | 582 |
| 920 | 3300025294 | Ga0209025_1022888 | Ga0209025_10228883 | 582 |
| 921 | 3300025295 | Ga0209564_1004823 | Ga0209564_10048236 | 582 |
| 922 | 3300025297 | Ga0209758_1000758 | Ga0209758_10007584 | 582 |
| 923 | 3300025297 | Ga0209758_1002154 | Ga0209758_10021544 | 582 |
| 924 | 3300025299 | Ga0209256_1001736 | Ga0209256_100173610 | 582 |
| 925 | 3300031731 | Ga0307405_10000857 | Ga0307405_100008576 | 582 |
| 926 | 3300031911 | Ga0307412_10000493 | Ga0307412_100004935 | 582 |
| 927 | 3300046460 | Ga0495638_0001181 | Ga0495638_0001181_17762_19513 | 582 |
| 928 | 3300046474 | Ga0495605_0001952 | Ga0495605_0001952_1833_3584 | 582 |
| 929 | 3300046506 | Ga0495583_0013196 | Ga0495583_0013196_1496_3247 | 582 |
| 930 | 3300046506 | Ga0495583_0019889 | Ga0495583_0019889_417_2168 | 582 |
| 931 | 3300046512 | Ga0495610_0003825 | Ga0495610_0003825_3144_4895 | 582 |
| 932 | 3300046518 | Ga0495631_0003360 | Ga0495631_0003360_5508_7259 | 582 |
| 933 | 3300046519 | Ga0495632_0005104 | Ga0495632_0005104_5492_7243 | 582 |
| 934 | 3300046519 | Ga0495632_0007228 | Ga0495632_0007228_4357_6108 | 582 |
| 935 | 3300046538 | Ga0495609_0013320 | Ga0495609_0013320_380_2131 | 582 |
| 936 | 3300046616 | Ga0495668_0008091 | Ga0495668_0008091_1758_3509 | 582 |
| 937 | 3300046660 | Ga0495625_0001387 | Ga0495625_0001387_19968_21719 | 582 |
| 938 | 3300046675 | Ga0495657_0013648 | Ga0495657_0013648_3507_5261 | 582 |
| 939 | 3300046691 | Ga0495670_0007690 | Ga0495670_0007690_2000_3751 | 582 |
| 940 | 3300046809 | Ga0495600_0044740 | Ga0495600_0044740_609_2363 | 582 |
| 941 | 3300046810 | Ga0495660_0013338 | Ga0495660_0013338_294_2045 | 582 |
| 942 | 3300047320 | Ga0495672_0011266 | Ga0495672_0011266_3027_4778 | 582 |
| 943 | 3300048919 | Ga0496116_0015182 | Ga0496116_0015182_439_2190 | 582 |
| 944 | 3300048919 | Ga0496116_0022090 | Ga0496116_0022090_1484_3235 | 582 |
| 945 | 3300048921 | Ga0496118_0024847 | Ga0496118_0024847_2969_4720 | 582 |
| 946 | 3300048924 | Ga0496121_0036685 | Ga0496121_0036685_1235_2986 | 582 |
| 947 | 3300048924 | Ga0496121_0106562 | Ga0496121_0106562_172_1923 | 582 |
| 948 | 3300048925 | Ga0496122_0017023 | Ga0496122_0017023_1986_3737 | 582 |
| 949 | 3300048925 | Ga0496122_0042821 | Ga0496122_0042821_1758_3509 | 582 |
| 950 | 3300048927 | Ga0496124_0050763 | Ga0496124_0050763_649_2400 | 582 |
| 951 | 3300048928 | Ga0496125_0027607 | Ga0496125_0027607_3220_4971 | 582 |
| 952 | 3300053139 | Ga0500568_0004818 | Ga0500568_0004818_3850_5601 | 582 |
| 953 | 3300053148 | Ga0500590_003631 | Ga0500590_003631_751_2505 | 582 |
| 954 | 3300053153 | Ga0500616_0001018 | Ga0500616_0001018_22581_24332 | 582 |
| 955 | 3300003187 | JGI25151J46595_10000839 | JGI25151J46595_100008395 | 583 |
| 956 | 3300003215 | JGI25153J46596_10005690 | JGI25153J46596_100056904 | 583 |
| 957 | 3300003215 | JGI25153J46596_10009242 | JGI25153J46596_100092422 | 583 |
| 958 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001654 | 583 |
| 959 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_100000199 | 583 |
| 960 | 3300003374 | JGI25161J50226_1003445 | JGI25161J50226_10034452 | 583 |
| 961 | 3300003771 | Ga0055526_1003506 | Ga0055526_10035065 | 583 |
| 962 | 3300003771 | Ga0055526_1003741 | Ga0055526_10037414 | 583 |
| 963 | 3300003775 | Ga0055524_1004376 | Ga0055524_10043763 | 583 |
| 964 | 3300003790 | Ga0055528_1001199 | Ga0055528_100119911 | 583 |
| 965 | 3300003790 | Ga0055528_1008190 | Ga0055528_10081905 | 583 |
| 966 | 3300003790 | Ga0055528_1021493 | Ga0055528_10214932 | 583 |
| 967 | 3300003792 | Ga0055540_1000929 | Ga0055540_100092914 | 583 |
| 968 | 3300003792 | Ga0055540_1009093 | Ga0055540_10090932 | 583 |
| 969 | 3300003792 | Ga0055540_1015257 | Ga0055540_10152572 | 583 |
| 970 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003115 | 583 |
| 971 | 3300004625 | Ga0055543_1000500 | Ga0055543_10005005 | 583 |
| 972 | 3300005262 | Ga0065165_1000068 | Ga0065165_100006854 | 583 |
| 973 | 3300005331 | Ga0070670_100002993 | Ga0070670_1000029938 | 583 |
| 974 | 3300006048 | Ga0075363_100027951 | Ga0075363_1000279512 | 583 |
| 975 | 3300006353 | Ga0075370_10010432 | Ga0075370_100104323 | 583 |
| 976 | 3300009765 | Ga0123341_1000007 | Ga0123341_100000784 | 583 |
| 977 | 3300009766 | Ga0123342_1013992 | Ga0123342_10139925 | 583 |
| 978 | 3300025258 | Ga0209129_1001767 | Ga0209129_10017677 | 583 |
| 979 | 3300025273 | Ga0209673_1000117 | Ga0209673_100011781 | 583 |
| 980 | 3300025273 | Ga0209673_1000151 | Ga0209673_100015170 | 583 |
| 981 | 3300025273 | Ga0209673_1000863 | Ga0209673_100086329 | 583 |
| 982 | 3300025273 | Ga0209673_1001685 | Ga0209673_10016854 | 583 |
| 983 | 3300025273 | Ga0209673_1009188 | Ga0209673_10091883 | 583 |
| 984 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003123 | 583 |
| 985 | 3300025292 | Ga0209676_1010300 | Ga0209676_10103004 | 583 |
| 986 | 3300025294 | Ga0209025_1000506 | Ga0209025_10005064 | 583 |
| 987 | 3300025295 | Ga0209564_1001780 | Ga0209564_100178014 | 583 |
| 988 | 3300025297 | Ga0209758_1000405 | Ga0209758_10004054 | 583 |
| 989 | 3300025297 | Ga0209758_1000655 | Ga0209758_10006554 | 583 |
| 990 | 3300025298 | Ga0209050_1008819 | Ga0209050_10088194 | 583 |
| 991 | 3300025299 | Ga0209256_1005804 | Ga0209256_10058045 | 583 |
| 992 | 3300025299 | Ga0209256_1012329 | Ga0209256_10123292 | 583 |
| 993 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011656 | 583 |
| 994 | 3300025302 | Ga0207426_1000221 | Ga0207426_1000221126 | 583 |
| 995 | 3300025303 | Ga0209051_1000097 | Ga0209051_100009761 | 583 |
| 996 | 3300025303 | Ga0209051_1007515 | Ga0209051_10075152 | 583 |
| 997 | 3300025303 | Ga0209051_1013189 | Ga0209051_10131894 | 583 |
| 998 | 3300025304 | Ga0209257_1001142 | Ga0209257_100114225 | 583 |
| 999 | 3300025925 | Ga0207650_10000837 | Ga0207650_100008377 | 583 |
| 1000 | 3300028794 | Ga0307515_10007368 | Ga0307515_1000736816 | 583 |
| 1001 | 3300031456 | Ga0307513_10119150 | Ga0307513_101191502 | 583 |
| 1002 | 3300041512 | Ga0451853_2433547 | Ga0451853_2433547_378_2138 | 583 |
| 1003 | 3300046501 | Ga0495607_0022946 | Ga0495607_0022946_1054_2814 | 583 |
| 1004 | 3300046507 | Ga0495606_0007174 | Ga0495606_0007174_4489_6249 | 583 |
| 1005 | 3300046507 | Ga0495606_0038135 | Ga0495606_0038135_332_2083 | 583 |
| 1006 | 3300046512 | Ga0495610_0001969 | Ga0495610_0001969_9096_10856 | 583 |
| 1007 | 3300046519 | Ga0495632_0050993 | Ga0495632_0050993_188_1948 | 583 |
| 1008 | 3300046522 | Ga0495643_0027634 | Ga0495643_0027634_122_1882 | 583 |
| 1009 | 3300046524 | Ga0495648_0013780 | Ga0495648_0013780_3907_5667 | 583 |
| 1010 | 3300046525 | Ga0495663_0014361 | Ga0495663_0014361_194_1954 | 583 |
| 1011 | 3300046530 | Ga0495654_0035169 | Ga0495654_0035169_707_2467 | 583 |
| 1012 | 3300046542 | Ga0495597_0014741 | Ga0495597_0014741_1238_2998 | 583 |
| 1013 | 3300046694 | Ga0495649_0035998 | Ga0495649_0035998_563_2323 | 583 |
| 1014 | 3300047323 | Ga0495683_0009820 | Ga0495683_0009820_2701_4461 | 583 |
| 1015 | 3300047472 | Ga0495686_0006538 | Ga0495686_0006538_441_2201 | 583 |
| 1016 | 3300053086 | Ga0500578_0046899 | Ga0500578_0046899_891_2651 | 583 |
| 1017 | 3300053109 | Ga0500569_012298 | Ga0500569_012298_62_1822 | 583 |
| 1018 | 3300053134 | Ga0500658_0000526 | Ga0500658_0000526_5382_7142 | 583 |
| 1019 | 3300053153 | Ga0500616_0005682 | Ga0500616_0005682_4401_6161 | 583 |
| 1020 | 3300001979 | JGI24740J21852_10000015 | JGI24740J21852_1000001542 | 584 |
| 1021 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001292 | 584 |
| 1022 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_100000141 | 584 |
| 1023 | 3300002737 | JGI25162J39368_1000366 | JGI25162J39368_100036623 | 584 |
| 1024 | 3300002737 | JGI25162J39368_1000368 | JGI25162J39368_100036821 | 584 |
| 1025 | 3300002738 | JGI25154J39366_1000122 | JGI25154J39366_100012216 | 584 |
| 1026 | 3300002741 | JGI25157J39369_1000044 | JGI25157J39369_100004440 | 584 |
| 1027 | 3300003214 | JGI25165J46597_1000516 | JGI25165J46597_100051613 | 584 |
| 1028 | 3300003214 | JGI25165J46597_1001042 | JGI25165J46597_100104214 | 584 |
| 1029 | 3300009093 | Ga0105240_10000076 | Ga0105240_10000076161 | 584 |
| 1030 | 3300009177 | Ga0105248_10077623 | Ga0105248_100776233 | 584 |
| 1031 | 3300009545 | Ga0105237_10000226 | Ga0105237_1000022634 | 584 |
| 1032 | 3300010375 | Ga0105239_10000641 | Ga0105239_100006416 | 584 |
| 1033 | 3300013104 | Ga0157370_10000455 | Ga0157370_1000045542 | 584 |
| 1034 | 3300013105 | Ga0157369_10039605 | Ga0157369_100396054 | 584 |
| 1035 | 3300015262 | Ga0182007_10004384 | Ga0182007_100043844 | 584 |
| 1036 | 3300015265 | Ga0182005_1003578 | Ga0182005_10035782 | 584 |
| 1037 | 3300025206 | Ga0209435_100012 | Ga0209435_100012343 | 584 |
| 1038 | 3300025233 | Ga0209437_100051 | Ga0209437_100051328 | 584 |
| 1039 | 3300025233 | Ga0209437_100098 | Ga0209437_100098168 | 584 |
| 1040 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026343 | 584 |
| 1041 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014343 | 584 |
| 1042 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012343 | 584 |
| 1043 | 3300025261 | Ga0209233_1000095 | Ga0209233_1000095285 | 584 |
| 1044 | 3300025261 | Ga0209233_1000113 | Ga0209233_100011315 | 584 |
| 1045 | 3300025261 | Ga0209233_1000427 | Ga0209233_10004274 | 584 |
| 1046 | 3300025913 | Ga0207695_10000011 | Ga0207695_1000001140 | 584 |
| 1047 | 3300025914 | Ga0207671_10000093 | Ga0207671_1000009392 | 584 |
| 1048 | 3300025941 | Ga0207711_10075060 | Ga0207711_100750602 | 584 |
| 1049 | 3300027312 | Ga0209371_1007555 | Ga0209371_10075552 | 584 |
| 1050 | 3300030500 | Ga0268256_1007789 | Ga0268256_10077892 | 584 |
| 1051 | 3300044842 | Ga0466957_0021187 | Ga0466957_0021187_581_2335 | 584 |
| 1052 | 3300048903 | Ga0496100_0006892 | Ga0496100_0006892_1691_3445 | 584 |
| 1053 | 3300048905 | Ga0496102_0017086 | Ga0496102_0017086_1846_3600 | 584 |
| 1054 | 3300048906 | Ga0496103_0008310 | Ga0496103_0008310_1654_3408 | 584 |
| 1055 | 3300048919 | Ga0496116_0009760 | Ga0496116_0009760_5606_7360 | 584 |
| 1056 | 3300048920 | Ga0496117_0001574 | Ga0496117_0001574_16860_18614 | 584 |
| 1057 | 3300048921 | Ga0496118_0003357 | Ga0496118_0003357_5473_7227 | 584 |
| 1058 | 3300048922 | Ga0496119_0011615 | Ga0496119_0011615_4355_6109 | 584 |
| 1059 | 3300048923 | Ga0496120_0004953 | Ga0496120_0004953_6626_8380 | 584 |
| 1060 | 3300048924 | Ga0496121_0002536 | Ga0496121_0002536_19904_21658 | 584 |
| 1061 | 3300048925 | Ga0496122_0010294 | Ga0496122_0010294_6306_8060 | 584 |
| 1062 | 3300048925 | Ga0496122_0018314 | Ga0496122_0018314_1837_3591 | 584 |
| 1063 | 3300048926 | Ga0496123_0012104 | Ga0496123_0012104_1672_3426 | 584 |
| 1064 | 3300048928 | Ga0496125_0018773 | Ga0496125_0018773_3003_4757 | 584 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xqx-assembly1.cif.gz_A | crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae with the h514a mutation at ph 7.5 | 0.9513 | 234 | 572 |
| 6xqz-assembly1.cif.gz_A | crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 7.5 | 0.9497 | 234 | 572 |
| 6xqy-assembly1.cif.gz_A | crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 9.5 | 0.9492 | 234 | 572 |
| 6p54-assembly2.cif.gz_B | crystal structure of transpeptidase domain of pbp2 from neisseria gonorrhoeae acylated by ceftriaxone | 0.9463 | 234 | 576 |
| 6p56-assembly1.cif.gz_A | crystal structure of the transpeptidase domain of a t498a mutant of pbp2 from neisseria gonorrhoeae | 0.9431 | 234 | 571 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ue3A03 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9259 | 296 | 477 | 3.40.710.10 |
| 5uy7A00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9238 | 234 | 572 | 3.40.710.10 |
| 5df7A02 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9207 | 235 | 572 | 3.40.710.10 |
| 4u3tA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9174 | 234 | 572 | 3.40.710.10 |
| 3ue3A03 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9114 | 296 | 477 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3H5U8-F1-model_v4 | Penicillin-binding protein 2 | 0.9552 | 321 | 578 |
GO:0005886
GO:0008658 GO:0071555 |
| AF-A0A836QQU9-F1-model_v4 | Penicillin-binding protein 2 | 0.9546 | 229 | 562 |
GO:0005886
GO:0008658 GO:0071555 |
| AF-A0A522SM81-F1-model_v4 | Penicillin-binding protein 2 | 0.9526 | 162 | 584 |
GO:0005886
GO:0008658 GO:0071555 |
| AF-A0A1G3IIE1-F1-model_v4 | Penicillin-binding protein transpeptidase domain-containing protein | 0.9493 | 317 | 576 |
GO:0005886
GO:0008658 GO:0071555 |
| AF-I5BQZ1-F1-model_v4 | Penicillin-binding protein, transpeptidase | 0.9492 | 317 | 584 |
GO:0005886
GO:0008658 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar