F489306

General Info

Members Datasets Scaffolds Average Seq Length
1062 328 2124 247

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10063451|Ga0163161_100634513
Length 317
Sequence MTFTGFVGTVCMFPLRAIINASVALRIHPNMLTLIGVLINVGAAVALGAGGEHFVLAGIIMVVGNIFDFIDGKVALITNTVSRFGAFWDSTLDRFSDIALFLGLIYLYADLGRTGYVMVASLAMMFSIMTSYARARAESLIEKCKVGFMERPERIVLFLGLIFFYSKLGRSDYVMTAALALIFSVMTSYTRARAESVVQKCKVGFMERPERIVLFIIGAFTNRMAGVLWVILVLTILAFANRSYYTYLVLNQRPLPSRQGWRGFFSRVFFWTDERATLAYDLCVIAILAFVWLTPPEWIGDPRASDPGLIGLIASRF

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
238 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 3.67
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 9.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10063451 3300017792 Bacteria 2693
2 JGI24033J26618_1005491 3300002155 Bacteria 1399
3 JGI25406J46586_10000725 3300003203 Bacteria 15382
4 Ga0065714_10075471 3300005288 Bacteria 2904
5 Ga0065704_10193170 3300005289 Unclassified 1180
6 Ga0065712_10000342 3300005290 Bacteria 23229
7 Ga0065712_10070130 3300005290 Bacteria 6303
8 Ga0065712_10091011 3300005290 Unclassified 2395
9 Ga0065712_10091915 3300005290 Unclassified 2352
10 Ga0065715_10001215 3300005293 Bacteria 6741
11 Ga0065715_10021840 3300005293 Unclassified 2513
12 Ga0065715_10098703 3300005293 Bacteria 3510
13 Ga0065715_10106754 3300005293 Bacteria 2811
14 Ga0065715_10207929 3300005293 Bacteria 1328
15 Ga0065707_10013597 3300005295 Bacteria 2043
16 Ga0065707_10100488 3300005295 Bacteria 2926
17 Ga0065707_10173154 3300005295 Bacteria 1470
18 Ga0070658_10116810 3300005327 Bacteria 2214
19 Ga0070676_10040170 3300005328 Bacteria 2708
20 Ga0070676_10351169 3300005328 Bacteria 1014
21 Ga0070676_10371012 3300005328 Bacteria 989
22 Ga0070683_100000278 3300005329 Bacteria 35197
23 Ga0070683_100008117 3300005329 Bacteria 8916
24 Ga0070683_100061702 3300005329 Bacteria 3486
25 Ga0070683_100156931 3300005329 Unclassified 2158
26 Ga0070690_100025834 3300005330 Bacteria 3618
27 Ga0070690_100034072 3300005330 Bacteria 3190
28 Ga0070690_100068083 3300005330 Bacteria 2308
29 Ga0070690_100120551 3300005330 Bacteria 1760
30 Ga0070670_100010311 3300005331 Bacteria 7975
31 Ga0070670_100052238 3300005331 Bacteria 3510
32 Ga0070670_100073328 3300005331 Bacteria 2940
33 Ga0070670_100187063 3300005331 Bacteria 1798
34 Ga0070666_10002398 3300005335 Bacteria 11332
35 Ga0070666_10013063 3300005335 Bacteria 5260
36 Ga0070666_10098457 3300005335 Bacteria 2014
37 Ga0070666_10110964 3300005335 Bacteria 1896
38 Ga0070666_10381313 3300005335 Bacteria 1012
39 Ga0070680_100003994 3300005336 Bacteria 11041
40 Ga0070680_100021772 3300005336 Bacteria 5098
41 Ga0070680_100211120 3300005336 Bacteria 1638
42 Ga0068868_100004969 3300005338 Bacteria 9338
43 Ga0068868_100282713 3300005338 Bacteria 1405
44 Ga0068868_100316524 3300005338 Bacteria 1328
45 Ga0068868_100461697 3300005338 Bacteria 1106
46 Ga0068868_100526355 3300005338 Bacteria 1039
47 Ga0070660_100044431 3300005339 Bacteria 3398
48 Ga0070660_100401796 3300005339 Unclassified 1133
49 Ga0070689_100091953 3300005340 Bacteria 2392
50 Ga0070689_100241752 3300005340 Bacteria 1487
51 Ga0070689_100250383 3300005340 Bacteria 1462
52 Ga0070689_100510845 3300005340 Bacteria 1030
53 Ga0070691_10001080 3300005341 Bacteria 11296
54 Ga0070691_10001150 3300005341 Bacteria 11016
55 Ga0070687_100006349 3300005343 Bacteria 4840
56 Ga0070687_100106241 3300005343 Bacteria 1581
57 Ga0070661_100036178 3300005344 Bacteria 3589
58 Ga0070661_100140587 3300005344 Bacteria 1819
59 Ga0070661_100179731 3300005344 Bacteria 1609
60 Ga0070692_10152146 3300005345 Bacteria 1319
61 Ga0070668_100212202 3300005347 Bacteria 1593
62 Ga0070669_100015981 3300005353 Bacteria 5355
63 Ga0070669_100026479 3300005353 Bacteria 4172
64 Ga0070669_100047725 3300005353 Bacteria 3124
65 Ga0070669_100069745 3300005353 Bacteria 2597
66 Ga0070669_100487457 3300005353 Bacteria 1021
67 Ga0070675_100000959 3300005354 Bacteria 20600
68 Ga0070675_100001900 3300005354 Bacteria 15413
69 Ga0070675_100024152 3300005354 Bacteria 4868
70 Ga0070675_100055602 3300005354 Bacteria 3258
71 Ga0070675_100073773 3300005354 Bacteria 2833
72 Ga0070675_100151170 3300005354 Bacteria 1991
73 Ga0070675_100467513 3300005354 Bacteria 1133
74 Ga0070671_100022553 3300005355 Bacteria 5142
75 Ga0070671_100126940 3300005355 Bacteria 2148
76 Ga0070671_100253958 3300005355 Bacteria 1493
77 Ga0070674_100033584 3300005356 Bacteria 3417
78 Ga0070674_100065050 3300005356 Bacteria 2558
79 Ga0070673_100003230 3300005364 Bacteria 10114
80 Ga0070673_100037988 3300005364 Bacteria 3673
81 Ga0070673_100116471 3300005364 Bacteria 2223
82 Ga0070673_100141214 3300005364 Bacteria 2031
83 Ga0070673_100205116 3300005364 Bacteria 1699
84 Ga0070673_100208646 3300005364 Bacteria 1686
85 Ga0070688_100010419 3300005365 Bacteria 5124
86 Ga0070688_100040657 3300005365 Bacteria 2850
87 Ga0070688_100099972 3300005365 Bacteria 1910
88 Ga0070688_100129077 3300005365 Bacteria 1703
89 Ga0070688_100200464 3300005365 Bacteria 1396
90 Ga0070659_100039930 3300005366 Bacteria 3665
91 Ga0070659_100259308 3300005366 Unclassified 1442
92 Ga0070667_100037086 3300005367 Bacteria 4087
93 Ga0070667_100037642 3300005367 Bacteria 4056
94 Ga0070667_100066967 3300005367 Bacteria 3052
95 Ga0070667_100092993 3300005367 Unclassified 2596
96 Ga0070667_100199636 3300005367 Bacteria 1775
97 Ga0070667_100318635 3300005367 Bacteria 1403
98 Ga0070709_10308846 3300005434 Bacteria 1157
99 Ga0070714_100002119 3300005435 Bacteria 14569
100 Ga0070713_100050549 3300005436 Bacteria 3434
101 Ga0070713_100051778 3300005436 Bacteria 3397
102 Ga0070713_100080848 3300005436 Bacteria 2772
103 Ga0070710_10500673 3300005437 Unclassified 832
104 Ga0070701_10126886 3300005438 Bacteria 1445
105 Ga0070711_100134124 3300005439 Bacteria 1848
106 Ga0070705_100017998 3300005440 Bacteria 3696
107 Ga0070705_100126469 3300005440 Bacteria 1660
108 Ga0070705_100400170 3300005440 Bacteria 1017
109 Ga0070700_100009277 3300005441 Bacteria 5395
110 Ga0070700_100044778 3300005441 Bacteria 2727
111 Ga0070700_100452092 3300005441 Bacteria 978
112 Ga0070708_100113286 3300005445 Bacteria 2495
113 Ga0070662_100060968 3300005457 Bacteria 2753
114 Ga0070662_100196388 3300005457 Bacteria 1598
115 Ga0070662_100285393 3300005457 Bacteria 1337
116 Ga0070681_10005564 3300005458 Bacteria 12170
117 Ga0070681_10010716 3300005458 Bacteria 9059
118 Ga0070681_10018804 3300005458 Bacteria 6914
119 Ga0070681_10131414 3300005458 Unclassified 2436
120 Ga0070681_10452760 3300005458 Bacteria 1196
121 Ga0070681_10457193 3300005458 Bacteria 1189
122 Ga0068867_100012139 3300005459 Bacteria 6085
123 Ga0068867_100020584 3300005459 Bacteria 4700
124 Ga0070685_10015461 3300005466 Bacteria 4055
125 Ga0070685_10131789 3300005466 Bacteria 1564
126 Ga0070685_10156322 3300005466 Bacteria 1450
127 Ga0070685_10210763 3300005466 Bacteria 1268
128 Ga0070706_100504996 3300005467 Bacteria 1125
129 Ga0070707_100197361 3300005468 Bacteria 1962
130 Ga0070699_100110705 3300005518 Bacteria 2411
131 Ga0070699_100211878 3300005518 Bacteria 1725
132 Ga0070679_100002506 3300005530 Bacteria 16635
133 Ga0070679_100049371 3300005530 Bacteria 4191
134 Ga0070684_100007753 3300005535 Bacteria 8368
135 Ga0070684_100036127 3300005535 Bacteria 4234
136 Ga0070684_100091578 3300005535 Bacteria 2705
137 Ga0070684_100224944 3300005535 Bacteria 1712
138 Ga0070684_100258061 3300005535 Bacteria 1594
139 Ga0070684_100558079 3300005535 Bacteria 1063
140 Ga0068853_100017636 3300005539 Bacteria 5893
141 Ga0068853_100031026 3300005539 Bacteria 4518
142 Ga0068853_100086521 3300005539 Bacteria 2749
143 Ga0068853_100159581 3300005539 Bacteria 2034
144 Ga0070672_100008342 3300005543 Bacteria 7081
145 Ga0070672_100041283 3300005543 Bacteria 3546
146 Ga0070672_100059469 3300005543 Bacteria 3007
147 Ga0070672_100071745 3300005543 Bacteria 2756
148 Ga0070672_100131740 3300005543 Bacteria 2056
149 Ga0070672_100375143 3300005543 Unclassified 1216
150 Ga0070686_100001675 3300005544 Bacteria 12379
151 Ga0070686_100059723 3300005544 Bacteria 2458
152 Ga0070686_100239490 3300005544 Bacteria 1320
153 Ga0070686_100260650 3300005544 Unclassified 1270
154 Ga0070695_100008485 3300005545 Bacteria 6097
155 Ga0070695_100009406 3300005545 Bacteria 5818
156 Ga0070696_100003384 3300005546 Bacteria 10639
157 Ga0070665_100007069 3300005548 Bacteria 11406
158 Ga0070665_100010348 3300005548 Bacteria 9437
159 Ga0070665_100021222 3300005548 Bacteria 6530
160 Ga0070665_100029355 3300005548 Bacteria 5536
161 Ga0070665_100102541 3300005548 Bacteria 2865
162 Ga0070704_100006916 3300005549 Bacteria 6722
163 Ga0070704_100040203 3300005549 Bacteria 3217
164 Ga0070704_100544741 3300005549 Bacteria 1013
165 Ga0068855_100007793 3300005563 Bacteria 12935
166 Ga0068855_100012889 3300005563 Bacteria 10088
167 Ga0068855_100030751 3300005563 Bacteria 6420
168 Ga0068855_100044437 3300005563 Bacteria 5257
169 Ga0068855_100074228 3300005563 Bacteria 3951
170 Ga0068855_100335425 3300005563 Bacteria 1668
171 Ga0068855_100420699 3300005563 Bacteria 1461
172 Ga0068855_100532751 3300005563 Bacteria 1273
173 Ga0070664_100033375 3300005564 Bacteria 4311
174 Ga0070664_100076552 3300005564 Bacteria 2875
175 Ga0070664_100102732 3300005564 Bacteria 2487
176 Ga0070664_100275424 3300005564 Bacteria 1517
177 Ga0070664_100331499 3300005564 Bacteria 1381
178 Ga0068857_100000140 3300005577 Bacteria 44560
179 Ga0068857_100005615 3300005577 Bacteria 10721
180 Ga0068857_100058312 3300005577 Bacteria 3428
181 Ga0068857_100143048 3300005577 Bacteria 2163
182 Ga0068857_100178770 3300005577 Bacteria 1931
183 Ga0068857_100196014 3300005577 Unclassified 1840
184 Ga0068854_100007348 3300005578 Bacteria 7042
185 Ga0068854_101132198 3300005578 Bacteria 698
186 Ga0068856_100001686 3300005614 Bacteria 23098
187 Ga0068856_100007046 3300005614 Bacteria 10979
188 Ga0068856_100008482 3300005614 Bacteria 9998
189 Ga0068856_100027094 3300005614 Bacteria 5591
190 Ga0068856_100037209 3300005614 Bacteria 4775
191 Ga0070702_100049489 3300005615 Bacteria 2397
192 Ga0070702_100085703 3300005615 Bacteria 1898
193 Ga0068852_100019346 3300005616 Bacteria 5387
194 Ga0068852_100039063 3300005616 Bacteria 3994
195 Ga0068852_100051399 3300005616 Bacteria 3536
196 Ga0068852_100263544 3300005616 Bacteria 1656
197 Ga0068852_100350648 3300005616 Bacteria 1441
198 Ga0068859_100101925 3300005617 Bacteria 2928
199 Ga0068859_100144097 3300005617 Bacteria 2456
200 Ga0068859_100163942 3300005617 Bacteria 2302
201 Ga0068859_100165294 3300005617 Unclassified 2293
202 Ga0068859_100313512 3300005617 Bacteria 1662
203 Ga0068859_100387334 3300005617 Bacteria 1493
204 Ga0068859_100771503 3300005617 Bacteria 1050
205 Ga0068859_100878535 3300005617 Unclassified 982
206 Ga0068864_100001542 3300005618 Bacteria 18982
207 Ga0068864_100010274 3300005618 Bacteria 7730
208 Ga0068864_100036627 3300005618 Bacteria 4182
209 Ga0068864_100105908 3300005618 Bacteria 2500
210 Ga0068864_100118658 3300005618 Bacteria 2362
211 Ga0068864_100330916 3300005618 Bacteria 1433
212 Ga0068866_10049908 3300005718 Bacteria 2123
213 Ga0068866_10053303 3300005718 Bacteria 2068
214 Ga0068866_10186674 3300005718 Bacteria 1229
215 Ga0068861_100002259 3300005719 Bacteria 12518
216 Ga0068851_10104343 3300005834 Bacteria 1507
217 Ga0068870_10352117 3300005840 Unclassified 945
218 Ga0068863_100012751 3300005841 Bacteria 8106
219 Ga0068863_100185167 3300005841 Bacteria 2000
220 Ga0068863_100211499 3300005841 Bacteria 1868
221 Ga0068863_100218802 3300005841 Bacteria 1834
222 Ga0068863_100270463 3300005841 Bacteria 1645
223 Ga0068863_100609713 3300005841 Bacteria 1081
224 Ga0068858_100004349 3300005842 Bacteria 13898
225 Ga0068858_100011282 3300005842 Bacteria 8444
226 Ga0068858_100021863 3300005842 Bacteria 5975
227 Ga0068858_100038496 3300005842 Bacteria 4436
228 Ga0068858_100164305 3300005842 Bacteria 2091
229 Ga0068858_100472100 3300005842 Unclassified 1210
230 Ga0068858_100497379 3300005842 Bacteria 1178
231 Ga0068858_100517341 3300005842 Bacteria 1154
232 Ga0068860_100016894 3300005843 Bacteria 7113
233 Ga0068860_100034259 3300005843 Bacteria 4869
234 Ga0068860_100135286 3300005843 Bacteria 2366
235 Ga0068860_100307996 3300005843 Bacteria 1553
236 Ga0068860_100736475 3300005843 Bacteria 997
237 Ga0068862_100016562 3300005844 Bacteria 6138
238 Ga0081455_10038869 3300005937 Bacteria 4211
239 Ga0081539_10001115 3300005985 Bacteria 48750
240 Ga0070717_10310124 3300006028 Unclassified 1404
241 Ga0075432_10031491 3300006058 Bacteria 1836
242 Ga0070716_100103215 3300006173 Bacteria 1752
243 Ga0070712_100447262 3300006175 Unclassified 1075
244 Ga0097621_100004607 3300006237 Bacteria 9626
245 Ga0097621_100013094 3300006237 Bacteria 6169
246 Ga0097621_100023848 3300006237 Bacteria 4769
247 Ga0097621_100035520 3300006237 Bacteria 3984
248 Ga0097621_100060328 3300006237 Bacteria 3109
249 Ga0097621_100061343 3300006237 Bacteria 3084
250 Ga0097621_100063563 3300006237 Bacteria 3034
251 Ga0097621_100096644 3300006237 Bacteria 2479
252 Ga0097621_100130582 3300006237 Bacteria 2138
253 Ga0097621_100188471 3300006237 Bacteria 1785
254 Ga0097621_100215887 3300006237 Unclassified 1670
255 Ga0097621_100724865 3300006237 Bacteria 917
256 Ga0068871_100001350 3300006358 Bacteria 16430
257 Ga0068871_100007041 3300006358 Bacteria 8010
258 Ga0068871_100017256 3300006358 Bacteria 5458
259 Ga0068871_100025965 3300006358 Bacteria 4565
260 Ga0068871_100029917 3300006358 Bacteria 4283
261 Ga0068871_100053174 3300006358 Bacteria 3281
262 Ga0068871_100078682 3300006358 Bacteria 2727
263 Ga0068871_100185633 3300006358 Bacteria 1789
264 Ga0068871_100257787 3300006358 Bacteria 1520
265 Ga0068871_100284165 3300006358 Bacteria 1448
266 Ga0068871_100389282 3300006358 Bacteria 1240
267 Ga0068871_100422843 3300006358 Bacteria 1190
268 Ga0068871_100486896 3300006358 Unclassified 1110
269 Ga0068871_100553773 3300006358 Bacteria 1042
270 Ga0068871_100641512 3300006358 Bacteria 969
271 Ga0075428_100370104 3300006844 Bacteria 1537
272 Ga0075428_100418509 3300006844 Bacteria 1436
273 Ga0075430_100316901 3300006846 Bacteria 1289
274 Ga0075433_10010820 3300006852 Bacteria 7339
275 Ga0075433_10161770 3300006852 Bacteria 1993
276 Ga0075433_10254460 3300006852 Unclassified 1558
277 Ga0075434_100002366 3300006871 Bacteria 16529
278 Ga0075434_100019226 3300006871 Bacteria 6608
279 Ga0075434_100043081 3300006871 Bacteria 4475
280 Ga0075434_100105312 3300006871 Bacteria 2831
281 Ga0075434_100202206 3300006871 Bacteria 2007
282 Ga0075434_100204691 3300006871 Bacteria 1994
283 Ga0068865_100036588 3300006881 Bacteria 3310
284 Ga0068865_100161574 3300006881 Bacteria 1709
285 Ga0068865_100202453 3300006881 Bacteria 1542
286 Ga0068865_100312243 3300006881 Bacteria 1262
287 Ga0068865_100454629 3300006881 Bacteria 1060
288 Ga0075436_100000845 3300006914 Bacteria 20351
289 Ga0075436_100020389 3300006914 Bacteria 4550
290 Ga0097620_100101926 3300006931 Bacteria 2928
291 Ga0097620_100144096 3300006931 Bacteria 2456
292 Ga0097620_100163958 3300006931 Bacteria 2302
293 Ga0097620_100165304 3300006931 Unclassified 2293
294 Ga0097620_100313508 3300006931 Bacteria 1662
295 Ga0097620_100387314 3300006931 Bacteria 1493
296 Ga0097620_100771408 3300006931 Bacteria 1050
297 Ga0097620_100878636 3300006931 Unclassified 982
298 Ga0075435_100000049 3300007076 Bacteria 60558
299 Ga0075435_100034583 3300007076 Bacteria 4005
300 Ga0075435_100111517 3300007076 Bacteria 2275
301 Ga0099794_10094612 3300007265 Bacteria 1486
302 Ga0099794_10162469 3300007265 Bacteria 1136
303 Ga0105251_10036066 3300009011 Bacteria 2436
304 Ga0105240_10004847 3300009093 Bacteria 20272
305 Ga0105240_10007712 3300009093 Bacteria 15573
306 Ga0105240_10021843 3300009093 Bacteria 8503
307 Ga0105240_10110957 3300009093 Bacteria 3319
308 Ga0105240_10209777 3300009093 Bacteria 2277
309 Ga0105240_10482408 3300009093 Bacteria 1382
310 Ga0111539_10031279 3300009094 Bacteria 6466
311 Ga0111539_10036623 3300009094 Bacteria 5930
312 Ga0111539_10130234 3300009094 Bacteria 2946
313 Ga0105245_10007811 3300009098 Bacteria 9369
314 Ga0105245_10024868 3300009098 Bacteria 5263
315 Ga0105245_10029447 3300009098 Bacteria 4851
316 Ga0105245_10061394 3300009098 Unclassified 3388
317 Ga0105245_10065868 3300009098 Bacteria 3277
318 Ga0105245_10073044 3300009098 Bacteria 3118
319 Ga0105245_10094515 3300009098 Bacteria 2756
320 Ga0105245_10217847 3300009098 Bacteria 1840
321 Ga0105245_10924920 3300009098 Bacteria 914
322 Ga0105245_11525010 3300009098 Unclassified 719
323 Ga0105247_10037295 3300009101 Bacteria 2966
324 Ga0105247_10075715 3300009101 Bacteria 2112
325 Ga0105247_10076887 3300009101 Bacteria 2097
326 Ga0105247_10116754 3300009101 Bacteria 1724
327 Ga0114129_10000192 3300009147 Bacteria 68551
328 Ga0114129_10003382 3300009147 Bacteria 22409
329 Ga0114129_10010507 3300009147 Bacteria 13207
330 Ga0114129_10013092 3300009147 Bacteria 11816
331 Ga0114129_10014797 3300009147 Bacteria 11115
332 Ga0114129_10053098 3300009147 Bacteria 5684
333 Ga0114129_10152679 3300009147 Bacteria 3160
334 Ga0114129_10430983 3300009147 Bacteria 1732
335 Ga0114129_10732004 3300009147 Bacteria 1268
336 Ga0105241_10001620 3300009174 Bacteria 17161
337 Ga0105241_10017463 3300009174 Bacteria 5276
338 Ga0105241_10135675 3300009174 Bacteria 1998
339 Ga0105241_10191243 3300009174 Bacteria 1704
340 Ga0105241_10204145 3300009174 Bacteria 1652
341 Ga0105241_10255154 3300009174 Bacteria 1488
342 Ga0105241_10515283 3300009174 Bacteria 1069
343 Ga0105242_10008421 3300009176 Bacteria 7927
344 Ga0105242_10024145 3300009176 Bacteria 4799
345 Ga0105242_10027094 3300009176 Bacteria 4547
346 Ga0105242_10038927 3300009176 Bacteria 3827
347 Ga0105242_10041151 3300009176 Unclassified 3726
348 Ga0105242_10064466 3300009176 Bacteria 3021
349 Ga0105242_10066002 3300009176 Bacteria 2987
350 Ga0105242_10090102 3300009176 Bacteria 2579
351 Ga0105242_10094988 3300009176 Bacteria 2516
352 Ga0105242_10231228 3300009176 Bacteria 1657
353 Ga0105242_10371435 3300009176 Bacteria 1327
354 Ga0105242_10467149 3300009176 Bacteria 1193
355 Ga0105248_10008123 3300009177 Bacteria 11521
356 Ga0105248_10019058 3300009177 Bacteria 7587
357 Ga0105248_10023159 3300009177 Bacteria 6897
358 Ga0105248_10025953 3300009177 Bacteria 6516
359 Ga0105248_10034550 3300009177 Bacteria 5654
360 Ga0105248_10061700 3300009177 Bacteria 4210
361 Ga0105248_10099460 3300009177 Bacteria 3278
362 Ga0105248_10104301 3300009177 Bacteria 3196
363 Ga0105248_10106005 3300009177 Unclassified 3169
364 Ga0105248_10107375 3300009177 Bacteria 3148
365 Ga0105248_10144329 3300009177 Bacteria 2686
366 Ga0105248_10144410 3300009177 Bacteria 2685
367 Ga0105248_10149963 3300009177 Bacteria 2631
368 Ga0105248_10216135 3300009177 Bacteria 2159
369 Ga0105248_10432657 3300009177 Bacteria 1482
370 Ga0105248_10631121 3300009177 Unclassified 1209
371 Ga0105237_10007273 3300009545 Bacteria 12148
372 Ga0105237_10024541 3300009545 Bacteria 6166
373 Ga0105237_10025726 3300009545 Bacteria 6017
374 Ga0105237_10034903 3300009545 Bacteria 5090
375 Ga0105237_10112639 3300009545 Bacteria 2713
376 Ga0105237_10190872 3300009545 Bacteria 2049
377 Ga0105238_10002113 3300009551 Bacteria 20072
378 Ga0105238_10013430 3300009551 Bacteria 8268
379 Ga0105238_10020407 3300009551 Bacteria 6746
380 Ga0105238_10036354 3300009551 Bacteria 5006
381 Ga0105238_10037736 3300009551 Bacteria 4911
382 Ga0105238_10095132 3300009551 Unclassified 2966
383 Ga0105238_10115319 3300009551 Bacteria 2666
384 Ga0105238_10158723 3300009551 Bacteria 2237
385 Ga0105238_10537118 3300009551 Bacteria 1173
386 Ga0105238_10541319 3300009551 Bacteria 1168
387 Ga0105249_10622019 3300009553 Bacteria 1136
388 Ga0105239_10003025 3300010375 Bacteria 20951
389 Ga0105239_10003955 3300010375 Bacteria 17955
390 Ga0105239_10006171 3300010375 Bacteria 13947
391 Ga0105239_10017693 3300010375 Bacteria 7886
392 Ga0105239_10025750 3300010375 Bacteria 6479
393 Ga0105239_10026079 3300010375 Bacteria 6434
394 Ga0105239_10232058 3300010375 Unclassified 2070
395 Ga0105239_10307549 3300010375 Bacteria 1786
396 Ga0105239_10659135 3300010375 Unclassified 1196
397 Ga0105239_11154906 3300010375 Unclassified 892
398 Ga0105246_10034267 3300011119 Bacteria 3381
399 Ga0105246_10231297 3300011119 Bacteria 1456
400 Ga0105246_10251419 3300011119 Bacteria 1403
401 Ga0105246_10384882 3300011119 Unclassified 1160
402 Ga0157373_10045002 3300013100 Bacteria 3151
403 Ga0157373_10127677 3300013100 Unclassified 1788
404 Ga0157370_10004304 3300013104 Bacteria 16362
405 Ga0157370_10033774 3300013104 Bacteria 4986
406 Ga0157370_10087583 3300013104 Bacteria 2925
407 Ga0157370_10089626 3300013104 Bacteria 2889
408 Ga0157370_10094424 3300013104 Bacteria 2806
409 Ga0157370_10159570 3300013104 Bacteria 2099
410 Ga0157369_10002200 3300013105 Bacteria 23482
411 Ga0157369_10011678 3300013105 Bacteria 9974
412 Ga0157369_10028240 3300013105 Bacteria 6210
413 Ga0157369_10139287 3300013105 Bacteria 2568
414 Ga0157369_10334768 3300013105 Bacteria 1572
415 Ga0157369_10566498 3300013105 Unclassified 1173
416 Ga0157374_10016699 3300013296 Bacteria 6457
417 Ga0157374_10027745 3300013296 Bacteria 5112
418 Ga0157374_10054140 3300013296 Bacteria 3742
419 Ga0157374_10055562 3300013296 Bacteria 3695
420 Ga0157374_10243246 3300013296 Bacteria 1770
421 Ga0157374_10330078 3300013296 Bacteria 1513
422 Ga0157374_10479276 3300013296 Bacteria 1247
423 Ga0157374_10480094 3300013296 Bacteria 1246
424 Ga0157378_10043754 3300013297 Bacteria 3976
425 Ga0157378_10222943 3300013297 Bacteria 1793
426 Ga0157378_10258108 3300013297 Bacteria 1671
427 Ga0157378_10419759 3300013297 Bacteria 1322
428 Ga0157378_10584808 3300013297 Bacteria 1126
429 Ga0163162_10009499 3300013306 Bacteria 9459
430 Ga0163162_10065289 3300013306 Bacteria 3686
431 Ga0163162_10079451 3300013306 Unclassified 3347
432 Ga0163162_10150427 3300013306 Bacteria 2445
433 Ga0163162_10151980 3300013306 Bacteria 2433
434 Ga0163162_10516220 3300013306 Bacteria 1325
435 Ga0163162_10891659 3300013306 Unclassified 1003
436 Ga0163162_10936540 3300013306 Bacteria 978
437 Ga0157372_10039627 3300013307 Bacteria 5200
438 Ga0157372_10125659 3300013307 Bacteria 2949
439 Ga0157372_10168916 3300013307 Bacteria 2530
440 Ga0157372_10195057 3300013307 Bacteria 2346
441 Ga0157372_10351448 3300013307 Unclassified 1717
442 Ga0157372_10412866 3300013307 Bacteria 1573
443 Ga0157372_10614681 3300013307 Bacteria 1267
444 Ga0157375_10052063 3300013308 Bacteria 4023
445 Ga0157375_10076661 3300013308 Bacteria 3371
446 Ga0157375_10143279 3300013308 Bacteria 2518
447 Ga0157375_10186969 3300013308 Unclassified 2225
448 Ga0157375_10205552 3300013308 Bacteria 2125
449 Ga0157375_10454423 3300013308 Bacteria 1446
450 Ga0163163_10008779 3300014325 Bacteria 8996
451 Ga0163163_10026375 3300014325 Bacteria 5553
452 Ga0163163_10038709 3300014325 Bacteria 4648
453 Ga0163163_10157127 3300014325 Bacteria 2318
454 Ga0163163_10157701 3300014325 Bacteria 2314
455 Ga0163163_10198116 3300014325 Unclassified 2056
456 Ga0163163_10237487 3300014325 Bacteria 1872
457 Ga0163163_10270332 3300014325 Bacteria 1751
458 Ga0163163_10284719 3300014325 Bacteria 1705
459 Ga0163163_10336922 3300014325 Unclassified 1563
460 Ga0163163_10692323 3300014325 Bacteria 1083
461 Ga0157380_10048468 3300014326 Bacteria 3346
462 Ga0157380_10157829 3300014326 Bacteria 1968
463 Ga0157380_10180817 3300014326 Bacteria 1853
464 Ga0157380_10481777 3300014326 Bacteria 1200
465 Ga0157380_10556060 3300014326 Bacteria 1127
466 Ga0157377_10075853 3300014745 Bacteria 1954
467 Ga0157377_10130799 3300014745 Unclassified 1533
468 Ga0157377_10152001 3300014745 Bacteria 1432
469 Ga0157377_10256946 3300014745 Bacteria 1135
470 Ga0157379_10006149 3300014968 Bacteria 10336
471 Ga0157379_10030148 3300014968 Bacteria 4825
472 Ga0157379_10039036 3300014968 Bacteria 4236
473 Ga0157379_10044354 3300014968 Bacteria 3969
474 Ga0157379_10116210 3300014968 Bacteria 2406
475 Ga0157379_10196317 3300014968 Bacteria 1824
476 Ga0157379_10355793 3300014968 Unclassified 1341
477 Ga0157376_10031726 3300014969 Bacteria 4235
478 Ga0157376_10060945 3300014969 Bacteria 3171
479 Ga0157376_10089594 3300014969 Bacteria 2660
480 Ga0157376_10540897 3300014969 Bacteria 1151
481 Ga0157376_10691359 3300014969 Bacteria 1024
482 Ga0157376_10832203 3300014969 Unclassified 937
483 Ga0163161_10015750 3300017792 Bacteria 5273
484 Ga0163161_10122648 3300017792 Bacteria 1954
485 Ga0163161_10296662 3300017792 Bacteria 1272
486 Ga0197907_10262591 3300020069 Bacteria 922
487 Ga0197907_10535074 3300020069 Bacteria 1342
488 Ga0197907_10885219 3300020069 Unclassified 1432
489 Ga0206355_1158864 3300020076 Unclassified 847
490 Ga0206355_1228848 3300020076 Unclassified 1104
491 Ga0206351_11005059 3300020077 Unclassified 1126
492 Ga0206352_10772431 3300020078 Bacteria 1394
493 Ga0206350_10371091 3300020080 Bacteria 2715
494 Ga0206350_10759031 3300020080 Bacteria 3422
495 Ga0206354_11177288 3300020081 Bacteria 2415
496 Ga0154015_1650422 3300020610 Unclassified 1652
497 Ga0213873_10077771 3300021358 Unclassified 924
498 Ga0213872_10000098 3300021361 Bacteria 80168
499 Ga0213872_10052106 3300021361 Bacteria 1857
500 Ga0213876_10007922 3300021384 Bacteria 5765
501 Ga0213876_10023885 3300021384 Unclassified 3227
502 Ga0213875_10000004 3300021388 Bacteria 703388
503 Ga0213875_10003648 3300021388 Bacteria 8699
504 Ga0213875_10018084 3300021388 Bacteria 3401
505 Ga0213875_10045841 3300021388 Bacteria 2052
506 Ga0213875_10078637 3300021388 Bacteria 1538
507 Ga0213871_10010350 3300021441 Unclassified 2113
508 Ga0213871_10107163 3300021441 Unclassified 823
509 Ga0224712_10002723 3300022467 Bacteria 4436
510 Ga0224712_10011276 3300022467 Bacteria 2767
511 Ga0224712_10017575 3300022467 Bacteria 2374
512 Ga0224712_10073324 3300022467 Bacteria 1396
513 Ga0207697_10049223 3300025315 Bacteria 1739
514 Ga0207656_10109387 3300025321 Bacteria 1275
515 Ga0207713_1074928 3300025735 Bacteria 1236
516 Ga0207642_10034164 3300025899 Bacteria 2159
517 Ga0207642_10036209 3300025899 Bacteria 2116
518 Ga0207642_10133026 3300025899 Unclassified 1301
519 Ga0207642_10141525 3300025899 Bacteria 1269
520 Ga0207710_10008073 3300025900 Bacteria 4447
521 Ga0207710_10181472 3300025900 Unclassified 1033
522 Ga0207710_10242906 3300025900 Bacteria 899
523 Ga0207680_10005064 3300025903 Bacteria 6276
524 Ga0207680_10056770 3300025903 Bacteria 2366
525 Ga0207680_10129135 3300025903 Bacteria 1663
526 Ga0207680_10144715 3300025903 Bacteria 1579
527 Ga0207680_10363896 3300025903 Bacteria 1017
528 Ga0207647_10171237 3300025904 Bacteria 1264
529 Ga0207699_10033735 3300025906 Bacteria 2896
530 Ga0207699_10115310 3300025906 Bacteria 1728
531 Ga0207699_10132908 3300025906 Bacteria 1625
532 Ga0207645_10006889 3300025907 Bacteria 8105
533 Ga0207645_10082497 3300025907 Bacteria 2061
534 Ga0207645_10284243 3300025907 Bacteria 1099
535 Ga0207654_10024609 3300025911 Unclassified 3239
536 Ga0207654_10032844 3300025911 Bacteria 2872
537 Ga0207654_10176043 3300025911 Bacteria 1393
538 Ga0207654_10711013 3300025911 Bacteria 722
539 Ga0207707_10003371 3300025912 Bacteria 14182
540 Ga0207707_10082938 3300025912 Bacteria 2799
541 Ga0207707_10161821 3300025912 Bacteria 1957
542 Ga0207707_10241681 3300025912 Unclassified 1570
543 Ga0207707_10955689 3300025912 Bacteria 705
544 Ga0207695_10001831 3300025913 Bacteria 33414
545 Ga0207695_10016736 3300025913 Bacteria 8564
546 Ga0207695_10050165 3300025913 Bacteria 4393
547 Ga0207695_10310186 3300025913 Bacteria 1468
548 Ga0207695_10418306 3300025913 Bacteria 1224
549 Ga0207695_10522086 3300025913 Unclassified 1069
550 Ga0207671_10005457 3300025914 Bacteria 11704
551 Ga0207671_10064566 3300025914 Bacteria 2722
552 Ga0207671_10141844 3300025914 Bacteria 1851
553 Ga0207671_10161252 3300025914 Bacteria 1737
554 Ga0207671_10178827 3300025914 Bacteria 1650
555 Ga0207671_10557083 3300025914 Unclassified 914
556 Ga0207693_10312066 3300025915 Bacteria 1231
557 Ga0207693_10385798 3300025915 Unclassified 1095
558 Ga0207663_10101302 3300025916 Bacteria 1935
559 Ga0207663_10139732 3300025916 Bacteria 1685
560 Ga0207660_10218412 3300025917 Bacteria 1495
561 Ga0207660_10385438 3300025917 Unclassified 1127
562 Ga0207662_10009816 3300025918 Bacteria 5282
563 Ga0207662_10151540 3300025918 Bacteria 1475
564 Ga0207657_10003226 3300025919 Bacteria 17465
565 Ga0207657_10003464 3300025919 Bacteria 16835
566 Ga0207657_10034462 3300025919 Bacteria 4551
567 Ga0207657_10110107 3300025919 Bacteria 2275
568 Ga0207657_10132777 3300025919 Unclassified 2039
569 Ga0207657_10347574 3300025919 Unclassified 1170
570 Ga0207649_10058629 3300025920 Bacteria 2412
571 Ga0207649_10078412 3300025920 Bacteria 2131
572 Ga0207649_10142316 3300025920 Bacteria 1643
573 Ga0207649_10147786 3300025920 Bacteria 1615
574 Ga0207652_10220426 3300025921 Bacteria 1709
575 Ga0207652_10622320 3300025921 Bacteria 967
576 Ga0207646_10118398 3300025922 Bacteria 2379
577 Ga0207646_10179203 3300025922 Bacteria 1914
578 Ga0207646_10197631 3300025922 Bacteria 1816
579 Ga0207681_10002032 3300025923 Bacteria 13000
580 Ga0207681_10020141 3300025923 Bacteria 4223
581 Ga0207681_10028887 3300025923 Bacteria 3596
582 Ga0207681_10175423 3300025923 Bacteria 1628
583 Ga0207681_10418612 3300025923 Bacteria 1085
584 Ga0207694_10006985 3300025924 Bacteria 8570
585 Ga0207694_10026762 3300025924 Bacteria 4391
586 Ga0207694_10046060 3300025924 Bacteria 3370
587 Ga0207694_10146750 3300025924 Bacteria 1899
588 Ga0207694_10148879 3300025924 Bacteria 1885
589 Ga0207650_10085653 3300025925 Unclassified 2398
590 Ga0207650_10228674 3300025925 Bacteria 1499
591 Ga0207650_10365912 3300025925 Bacteria 1189
592 Ga0207659_10000830 3300025926 Bacteria 18334
593 Ga0207659_10009600 3300025926 Bacteria 6053
594 Ga0207659_10028750 3300025926 Bacteria 3780
595 Ga0207659_10047946 3300025926 Bacteria 3024
596 Ga0207659_10087574 3300025926 Unclassified 2318
597 Ga0207659_10220953 3300025926 Bacteria 1523
598 Ga0207659_10453692 3300025926 Unclassified 1080
599 Ga0207687_10007777 3300025927 Bacteria 7031
600 Ga0207687_10024436 3300025927 Bacteria 4038
601 Ga0207687_10057914 3300025927 Bacteria 2724
602 Ga0207687_10062351 3300025927 Unclassified 2636
603 Ga0207687_10105692 3300025927 Unclassified 2080
604 Ga0207687_10126711 3300025927 Bacteria 1918
605 Ga0207687_10191245 3300025927 Bacteria 1593
606 Ga0207700_10102628 3300025928 Bacteria 2285
607 Ga0207700_10155236 3300025928 Bacteria 1896
608 Ga0207700_10434554 3300025928 Bacteria 1155
609 Ga0207664_10089750 3300025929 Bacteria 2518
610 Ga0207644_10051779 3300025931 Bacteria 2948
611 Ga0207644_10277484 3300025931 Unclassified 1345
612 Ga0207644_10348326 3300025931 Unclassified 1202
613 Ga0207644_10396118 3300025931 Unclassified 1128
614 Ga0207690_10037356 3300025932 Unclassified 3153
615 Ga0207690_10151795 3300025932 Bacteria 1718
616 Ga0207690_10154250 3300025932 Bacteria 1705
617 Ga0207690_10185336 3300025932 Bacteria 1570
618 Ga0207706_10105500 3300025933 Bacteria 2480
619 Ga0207706_10113382 3300025933 Bacteria 2385
620 Ga0207706_10121411 3300025933 Bacteria 2298
621 Ga0207706_10194031 3300025933 Bacteria 1782
622 Ga0207686_10002438 3300025934 Bacteria 10117
623 Ga0207686_10010805 3300025934 Bacteria 4977
624 Ga0207686_10050742 3300025934 Bacteria 2581
625 Ga0207686_10056788 3300025934 Bacteria 2462
626 Ga0207686_10256878 3300025934 Unclassified 1279
627 Ga0207686_10406546 3300025934 Bacteria 1038
628 Ga0207709_10094432 3300025935 Bacteria 1963
629 Ga0207670_10037851 3300025936 Bacteria 3146
630 Ga0207670_10048792 3300025936 Bacteria 2828
631 Ga0207670_10131765 3300025936 Bacteria 1833
632 Ga0207670_10166202 3300025936 Bacteria 1651
633 Ga0207670_10235316 3300025936 Bacteria 1408
634 Ga0207670_10437555 3300025936 Bacteria 1052
635 Ga0207704_10024709 3300025938 Bacteria 3264
636 Ga0207704_10073292 3300025938 Bacteria 2180
637 Ga0207704_10149073 3300025938 Bacteria 1648
638 Ga0207704_10151426 3300025938 Bacteria 1637
639 Ga0207704_10172410 3300025938 Bacteria 1553
640 Ga0207704_10271712 3300025938 Bacteria 1284
641 Ga0207704_10537839 3300025938 Bacteria 948
642 Ga0207665_10048285 3300025939 Bacteria 2856
643 Ga0207691_10010517 3300025940 Bacteria 8880
644 Ga0207691_10035424 3300025940 Bacteria 4633
645 Ga0207691_10045852 3300025940 Bacteria 4018
646 Ga0207691_10094716 3300025940 Bacteria 2671
647 Ga0207691_10384860 3300025940 Bacteria 1197
648 Ga0207711_10005340 3300025941 Bacteria 10896
649 Ga0207711_10023491 3300025941 Bacteria 5162
650 Ga0207711_10024174 3300025941 Bacteria 5086
651 Ga0207711_10024413 3300025941 Bacteria 5065
652 Ga0207711_10029653 3300025941 Bacteria 4616
653 Ga0207711_10035334 3300025941 Bacteria 4235
654 Ga0207711_10075347 3300025941 Bacteria 2937
655 Ga0207711_10082059 3300025941 Bacteria 2818
656 Ga0207711_10156440 3300025941 Bacteria 2060
657 Ga0207711_10198697 3300025941 Bacteria 1829
658 Ga0207711_10232352 3300025941 Unclassified 1689
659 Ga0207711_10371248 3300025941 Bacteria 1327
660 Ga0207711_10660199 3300025941 Bacteria 975
661 Ga0207689_10008966 3300025942 Bacteria 8668
662 Ga0207689_10169652 3300025942 Bacteria 1798
663 Ga0207689_10262191 3300025942 Bacteria 1430
664 Ga0207689_10378796 3300025942 Unclassified 1178
665 Ga0207661_10009880 3300025944 Bacteria 6854
666 Ga0207661_10045841 3300025944 Unclassified 3464
667 Ga0207661_10049753 3300025944 Bacteria 3337
668 Ga0207661_10071017 3300025944 Bacteria 2844
669 Ga0207661_10214940 3300025944 Bacteria 1696
670 Ga0207661_10305818 3300025944 Bacteria 1426
671 Ga0207661_10330999 3300025944 Bacteria 1371
672 Ga0207679_10018773 3300025945 Bacteria 4639
673 Ga0207679_10161883 3300025945 Bacteria 1833
674 Ga0207679_10181760 3300025945 Unclassified 1740
675 Ga0207679_10219597 3300025945 Bacteria 1599
676 Ga0207679_10288736 3300025945 Bacteria 1409
677 Ga0207679_10404858 3300025945 Bacteria 1201
678 Ga0207679_10505588 3300025945 Bacteria 1079
679 Ga0207667_10014741 3300025949 Bacteria 8896
680 Ga0207667_10017139 3300025949 Bacteria 8166
681 Ga0207667_10025443 3300025949 Bacteria 6476
682 Ga0207667_10046637 3300025949 Bacteria 4589
683 Ga0207667_10060044 3300025949 Bacteria 3980
684 Ga0207667_10520415 3300025949 Bacteria 1205
685 Ga0207667_10767672 3300025949 Unclassified 962
686 Ga0207651_10058060 3300025960 Bacteria 2673
687 Ga0207651_10103263 3300025960 Bacteria 2121
688 Ga0207651_10116157 3300025960 Bacteria 2019
689 Ga0207651_10227188 3300025960 Bacteria 1513
690 Ga0207651_10261659 3300025960 Bacteria 1421
691 Ga0207651_10325704 3300025960 Bacteria 1286
692 Ga0207712_10142152 3300025961 Bacteria 1843
693 Ga0207712_10379942 3300025961 Bacteria 1182
694 Ga0207712_10382393 3300025961 Bacteria 1179
695 Ga0207668_10104956 3300025972 Bacteria 2108
696 Ga0207668_10187607 3300025972 Bacteria 1636
697 Ga0207668_10345098 3300025972 Bacteria 1243
698 Ga0207640_10002390 3300025981 Bacteria 10041
699 Ga0207640_10126542 3300025981 Bacteria 1840
700 Ga0207640_10461805 3300025981 Bacteria 1049
701 Ga0207658_10003889 3300025986 Bacteria 10510
702 Ga0207658_10073501 3300025986 Bacteria 2595
703 Ga0207658_10116923 3300025986 Bacteria 2119
704 Ga0207677_10012475 3300026023 Bacteria 4887
705 Ga0207677_10885422 3300026023 Bacteria 804
706 Ga0207703_10035156 3300026035 Bacteria 3981
707 Ga0207703_10040564 3300026035 Bacteria 3726
708 Ga0207703_10064337 3300026035 Bacteria 3010
709 Ga0207703_10259044 3300026035 Bacteria 1572
710 Ga0207703_10314466 3300026035 Bacteria 1432
711 Ga0207703_10353602 3300026035 Bacteria 1353
712 Ga0207703_10355469 3300026035 Bacteria 1350
713 Ga0207703_10521710 3300026035 Bacteria 1117
714 Ga0207639_10016444 3300026041 Bacteria 5235
715 Ga0207639_10073659 3300026041 Bacteria 2678
716 Ga0207639_10091473 3300026041 Bacteria 2436
717 Ga0207639_10093830 3300026041 Bacteria 2408
718 Ga0207639_10378869 3300026041 Unclassified 1270
719 Ga0207678_10011858 3300026067 Bacteria 7653
720 Ga0207708_10000797 3300026075 Bacteria 23784
721 Ga0207708_10055861 3300026075 Bacteria 3011
722 Ga0207708_10107678 3300026075 Bacteria 2161
723 Ga0207708_10166358 3300026075 Bacteria 1744
724 Ga0207702_10005238 3300026078 Bacteria 11385
725 Ga0207702_10096329 3300026078 Unclassified 2602
726 Ga0207702_10167331 3300026078 Bacteria 2012
727 Ga0207702_10220642 3300026078 Unclassified 1767
728 Ga0207702_10413274 3300026078 Bacteria 1303
729 Ga0207702_10492465 3300026078 Bacteria 1194
730 Ga0207641_10004288 3300026088 Bacteria 12393
731 Ga0207641_10017364 3300026088 Bacteria 5891
732 Ga0207641_10100013 3300026088 Bacteria 2553
733 Ga0207641_10184819 3300026088 Bacteria 1911
734 Ga0207641_10188875 3300026088 Bacteria 1892
735 Ga0207641_10292099 3300026088 Bacteria 1537
736 Ga0207641_10591679 3300026088 Bacteria 1085
737 Ga0207641_10634513 3300026088 Bacteria 1048
738 Ga0207648_10007685 3300026089 Bacteria 10549
739 Ga0207648_10025669 3300026089 Bacteria 5245
740 Ga0207648_10039476 3300026089 Bacteria 4150
741 Ga0207648_10044313 3300026089 Bacteria 3903
742 Ga0207648_10191703 3300026089 Bacteria 1811
743 Ga0207648_10591426 3300026089 Bacteria 1022
744 Ga0207676_10024041 3300026095 Bacteria 4504
745 Ga0207676_10032574 3300026095 Bacteria 3929
746 Ga0207676_10133671 3300026095 Bacteria 2113
747 Ga0207676_10364513 3300026095 Bacteria 1340
748 Ga0207674_10001211 3300026116 Bacteria 33626
749 Ga0207674_10007293 3300026116 Bacteria 12889
750 Ga0207674_10095167 3300026116 Bacteria 2965
751 Ga0207674_10140935 3300026116 Unclassified 2370
752 Ga0207674_10176180 3300026116 Bacteria 2091
753 Ga0207674_10486341 3300026116 Bacteria 1193
754 Ga0207675_100028134 3300026118 Bacteria 5233
755 Ga0207675_100087563 3300026118 Bacteria 2925
756 Ga0207675_100187158 3300026118 Bacteria 1985
757 Ga0207675_100188507 3300026118 Bacteria 1977
758 Ga0207675_100416514 3300026118 Bacteria 1326
759 Ga0207683_10002520 3300026121 Bacteria 15993
760 Ga0207683_10004271 3300026121 Bacteria 12335
761 Ga0207683_10107413 3300026121 Bacteria 2497
762 Ga0207683_10422326 3300026121 Bacteria 1228
763 Ga0207698_10363440 3300026142 Unclassified 1371
764 Ga0207698_10411457 3300026142 Bacteria 1295
765 Ga0207698_10462038 3300026142 Bacteria 1228
766 Ga0207428_10015888 3300027907 Bacteria 6494
767 Ga0207428_10016431 3300027907 Bacteria 6368
768 Ga0207428_10048271 3300027907 Bacteria 3416
769 Ga0207428_10458690 3300027907 Bacteria 929
770 Ga0268266_10002664 3300028379 Bacteria 18789
771 Ga0268266_10009440 3300028379 Bacteria 8588
772 Ga0268266_10014990 3300028379 Bacteria 6654
773 Ga0268266_10033575 3300028379 Bacteria 4362
774 Ga0268266_10143042 3300028379 Bacteria 2148
775 Ga0268266_10159568 3300028379 Bacteria 2039
776 Ga0268266_10689846 3300028379 Bacteria 984
777 Ga0268265_10019405 3300028380 Bacteria 4725
778 Ga0268265_10163292 3300028380 Bacteria 1895
779 Ga0268265_10216940 3300028380 Bacteria 1671
780 Ga0268265_10810562 3300028380 Bacteria 913
781 Ga0268264_10008480 3300028381 Bacteria 8548
782 Ga0268264_10021345 3300028381 Bacteria 5287
783 Ga0268264_10035414 3300028381 Bacteria 4110
784 Ga0268264_10678225 3300028381 Bacteria 1022
785 Ga0265332_10043963 3300031238 Bacteria 1928
786 Ga0265316_10028020 3300031344 Bacteria 4652
787 Ga0265316_10518153 3300031344 Bacteria 851
788 Ga0307408_100046668 3300031548 Bacteria 3099
789 Ga0265313_10000978 3300031595 Bacteria 28254
790 Ga0265314_10000542 3300031711 Bacteria 48535
791 Ga0265314_10064164 3300031711 Bacteria 2488
792 Ga0265314_10110478 3300031711 Bacteria 1748
793 Ga0307405_10066244 3300031731 Bacteria 2302
794 Ga0307413_10057539 3300031824 Bacteria 2378
795 Ga0307412_10090258 3300031911 Bacteria 2141
796 Ga0307409_100028667 3300031995 Bacteria 3971
797 Ga0307409_100218822 3300031995 Bacteria 1718
798 Ga0307416_100105838 3300032002 Bacteria 2464
799 Ga0307415_100036781 3300032126 Bacteria 3211
800 Ga0373930_0005530 3300034816 Bacteria 2107
801 Ga0373950_0000509 3300034818 Bacteria 4759
802 Ga0373938_0014194 3300034957 Unclassified 1525
803 Ga0373926_0018141 3300035083 Bacteria 2419
804 Ga0373929_0002238 3300035085 Bacteria 3578
805 Ga0373934_0000504 3300035086 Bacteria 13698
806 Ga0373934_0036203 3300035086 Bacteria 1944
807 Ga0373940_0008809 3300035088 Bacteria 2326
808 Ga0373949_0001582 3300035090 Bacteria 6417
809 Ga0373951_0001506 3300035091 Bacteria 6087
810 Ga0373932_0000705 3300035112 Bacteria 10093
811 Ga0373936_0110736 3300035113 Bacteria 1166
812 Ga0373939_0000674 3300035114 Bacteria 8478
813 Ga0373939_0129491 3300035114 Bacteria 899
814 Ga0373941_0000861 3300035115 Bacteria 6249
815 Ga0373953_0194875 3300035117 Bacteria 876
816 Ga0373957_0096854 3300035120 Bacteria 1178
817 Ga0373955_0075626 3300035172 Bacteria 1893
818 Ga0373955_0125183 3300035172 Bacteria 1497
819 Ga0373955_0189047 3300035172 Unclassified 1224
820 Ga0373942_0003169 3300035207 Bacteria 3893
821 Ga0373961_0025257 3300035241 Bacteria 1613
822 Ga0373962_0045019 3300035242 Unclassified 1255
823 Ga0373931_0007379 3300035691 Bacteria 5177
824 Ga0373933_0195387 3300035724 Bacteria 1294
825 Ga0373947_0045629 3300035725 Bacteria 2623
826 Ga0373937_0094534 3300036401 Unclassified 2772
827 Ga0373937_0100290 3300036401 Bacteria 2687
828 Ga0373937_0134282 3300036401 Bacteria 2313
829 Ga0373937_0515651 3300036401 Bacteria 1136
830 Ga0373925_0196494 3300037068 Bacteria 1603
831 Ga0436364_0017646 3300037853 Bacteria 5895
832 Ga0436364_0019305 3300037853 Bacteria 2969
833 Ga0436364_0069467 3300037853 Bacteria 1293
834 Ga0436364_0094240 3300037853 Bacteria 2641
835 Ga0436364_0449695 3300037853 Bacteria 85327
836 Ga0436364_0463517 3300037853 Bacteria 4319
837 Ga0436364_0491033 3300037853 Bacteria 22482
838 Ga0436364_0605122 3300037853 Bacteria 1189
839 Ga0436364_0748068 3300037853 Bacteria 528910
840 Ga0436364_0763039 3300037853 Bacteria 19428
841 Ga0436364_1356593 3300037853 Bacteria 7116
842 Ga0436364_1416970 3300037853 Bacteria 2069
843 Ga0436365_0610679 3300039437 Bacteria 2516
844 Ga0436365_0945465 3300039437 Bacteria 19680
845 Ga0436365_1696515 3300039437 Bacteria 3412
846 Ga0436361_0314405 3300039447 Bacteria 9023
847 Ga0436361_0511602 3300039447 Bacteria 24147
848 Ga0436361_0881798 3300039447 Bacteria 2234
849 Ga0436363_0691901 3300039450 Bacteria 1971
850 Ga0436363_0807582 3300039450 Unclassified 1251
851 Ga0436363_1364227 3300039450 Unclassified 1663
852 Ga0436363_1450594 3300039450 Unclassified 813
853 Ga0436362_0947914 3300039453 Bacteria 1041
854 Ga0451839_0499901 3300041496 Unclassified 893
855 Ga0439450_059025 3300042008 Bacteria 924
856 Ga0439457_017314 3300042014 Bacteria 1601
857 Ga0439462_0018876 3300042015 Bacteria 1793
858 Ga0439434_0032167 3300042435 Bacteria 1596
859 Ga0439464_0033468 3300042439 Unclassified 1447
860 Ga0450916_002929 3300042530 Bacteria 1848
861 Ga0466961_0080143 3300044693 Bacteria 2067
862 Ga0453684_0909713 3300044712 Bacteria 942
863 Ga0466959_0120927 3300045049 Unclassified 1862
864 Ga0451576_0035765 3300045051 Bacteria 5267
865 Ga0451576_0227006 3300045051 Bacteria 1950
866 Ga0451576_0286519 3300045051 Bacteria 1722
867 Ga0466967_0554080 3300045976 Bacteria 1132
868 Ga0495603_0093154 3300046455 Bacteria 1761
869 Ga0495629_0279726 3300046459 Bacteria 1145
870 Ga0495582_0062221 3300046473 Bacteria 2062
871 Ga0495639_0196206 3300046475 Bacteria 987
872 Ga0495594_0049725 3300046499 Bacteria 2305
873 Ga0495628_0100883 3300046516 Unclassified 2228
874 Ga0495628_0270396 3300046516 Bacteria 1264
875 Ga0495628_0595526 3300046516 Bacteria 790
876 Ga0495640_0129560 3300046533 Bacteria 1634
877 Ga0495586_0109220 3300046535 Bacteria 1539
878 Ga0495586_0131216 3300046535 Bacteria 1403
879 Ga0495645_0015063 3300046543 Bacteria 5494
880 Ga0495645_0034303 3300046543 Bacteria 3702
881 Ga0495656_0179078 3300046615 Unclassified 1041
882 Ga0495599_0181569 3300046678 Bacteria 1297
883 Ga0495647_0038186 3300046681 Bacteria 1815
884 Ga0495647_0078313 3300046681 Bacteria 1336
885 Ga0495658_0036374 3300046683 Bacteria 2716
886 Ga0495658_0092955 3300046683 Bacteria 1789
887 Ga0495669_0017811 3300046684 Bacteria 3050
888 Ga0495669_0042593 3300046684 Bacteria 2019
889 Ga0495669_0151424 3300046684 Bacteria 1098
890 Ga0495670_0085167 3300046691 Unclassified 1613
891 Ga0495600_0216400 3300046809 Bacteria 1226
892 Ga0495604_0108310 3300047317 Bacteria 2030
893 Ga0495604_0315178 3300047317 Bacteria 1047
894 Ga0495674_0012415 3300047319 Bacteria 8027
895 Ga0495674_0163845 3300047319 Unclassified 1859
896 Ga0495684_0134895 3300047471 Bacteria 1853
897 Ga0495593_0166647 3300047673 Unclassified 1111
898 Ga0496100_0001606 3300048903 Bacteria 11154
899 Ga0496101_0001080 3300048904 Bacteria 16146
900 Ga0496101_0282095 3300048904 Bacteria 1298
901 Ga0496102_0157568 3300048905 Bacteria 2135
902 Ga0496102_0176865 3300048905 Bacteria 2010
903 Ga0496102_0329902 3300048905 Bacteria 1437
904 Ga0496103_0096133 3300048906 Bacteria 1872
905 Ga0496104_0017733 3300048907 Bacteria 6489
906 Ga0496104_0068126 3300048907 Bacteria 3382
907 Ga0496104_0072447 3300048907 Bacteria 3276
908 Ga0496104_0079486 3300048907 Bacteria 3126
909 Ga0496104_0217861 3300048907 Bacteria 1821
910 Ga0496104_0322802 3300048907 Unclassified 1457
911 Ga0496105_0165337 3300048908 Bacteria 1815
912 Ga0496105_0385081 3300048908 Bacteria 1115
913 Ga0496106_0026452 3300048909 Bacteria 4321
914 Ga0496106_0083572 3300048909 Bacteria 2456
915 Ga0496106_0361951 3300048909 Bacteria 1165
916 Ga0496107_0013906 3300048910 Bacteria 5628
917 Ga0496107_0469017 3300048910 Bacteria 935
918 Ga0496108_0018047 3300048911 Bacteria 5771
919 Ga0496108_0022160 3300048911 Bacteria 5222
920 Ga0496109_0004045 3300048912 Bacteria 12248
921 Ga0496109_0043132 3300048912 Bacteria 4089
922 Ga0496110_0006669 3300048913 Bacteria 9174
923 Ga0496111_0401271 3300048914 Bacteria 1013
924 Ga0496112_0006973 3300048915 Bacteria 9974
925 Ga0496112_0230477 3300048915 Bacteria 1807
926 Ga0496112_0358392 3300048915 Bacteria 1401
927 Ga0496112_0528198 3300048915 Bacteria 1114
928 Ga0496113_0025522 3300048916 Bacteria 4213
929 Ga0496114_0000608 3300048917 Bacteria 26484
930 Ga0496114_0043245 3300048917 Bacteria 3735
931 Ga0496114_0087236 3300048917 Bacteria 2645
932 Ga0496114_0191588 3300048917 Bacteria 1789
933 Ga0496114_0201734 3300048917 Bacteria 1742
934 Ga0496114_0310887 3300048917 Unclassified 1392
935 Ga0496115_0030399 3300048918 Bacteria 4249
936 Ga0496115_0089131 3300048918 Bacteria 2519
937 Ga0501032_0015337 3300049569 Bacteria 5408
938 Ga0501033_0009149 3300049570 Bacteria 7635
939 Ga0501033_0017809 3300049570 Bacteria 5364
940 Ga0501034_0009674 3300049571 Bacteria 10084
941 Ga0501034_0022314 3300049571 Bacteria 6452
942 Ga0501034_0241943 3300049571 Bacteria 1750
943 Ga0501034_0448227 3300049571 Bacteria 1208
944 Ga0501036_0044215 3300049572 Bacteria 3772
945 Ga0501036_0175650 3300049572 Bacteria 1803
946 Ga0501036_0200631 3300049572 Bacteria 1678
947 Ga0501037_0015187 3300049573 Bacteria 5666
948 Ga0501037_0022034 3300049573 Bacteria 4716
949 Ga0501037_0037302 3300049573 Bacteria 3583
950 Ga0501037_0159874 3300049573 Bacteria 1606
951 Ga0501038_0007487 3300049574 Bacteria 10071
952 Ga0501038_0150124 3300049574 Bacteria 1900
953 Ga0501039_0004793 3300049575 Bacteria 10241
954 Ga0501041_0024338 3300049577 Bacteria 3634
955 Ga0501042_0014450 3300049578 Bacteria 5390
956 Ga0501042_0030122 3300049578 Bacteria 3832
957 Ga0501043_0018705 3300049579 Bacteria 5435
958 Ga0501043_0032499 3300049579 Bacteria 4103
959 Ga0501043_0048484 3300049579 Bacteria 3339
960 Ga0501043_0299674 3300049579 Unclassified 1228
961 Ga0501046_0007495 3300049580 Bacteria 9578
962 Ga0501046_0007937 3300049580 Bacteria 9288
963 Ga0501047_0001847 3300049581 Bacteria 20412
964 Ga0501047_0051962 3300049581 Bacteria 3961
965 Ga0501047_0116499 3300049581 Bacteria 2553
966 Ga0501047_0148148 3300049581 Bacteria 2223
967 Ga0501048_0049639 3300049582 Bacteria 2990
968 Ga0501048_0126359 3300049582 Bacteria 1808
969 Ga0501048_0223447 3300049582 Bacteria 1336
970 Ga0501068_0003344 3300049584 Bacteria 8606
971 Ga0501069_0011932 3300049585 Bacteria 4610
972 Ga0501069_0109055 3300049585 Bacteria 1575
973 Ga0501070_0011902 3300049586 Bacteria 7347
974 Ga0501070_0013841 3300049586 Bacteria 6794
975 Ga0501070_0087039 3300049586 Bacteria 2586
976 Ga0501071_0192362 3300049587 Bacteria 1530
977 Ga0501072_0055609 3300049588 Bacteria 3119
978 Ga0501072_0436577 3300049588 Unclassified 1037
979 Ga0501073_0020874 3300049589 Bacteria 4723
980 Ga0501073_0039566 3300049589 Bacteria 3339
981 Ga0501073_0077727 3300049589 Bacteria 2309
982 Ga0501073_0113019 3300049589 Bacteria 1883
983 Ga0501074_0001487 3300049590 Bacteria 15771
984 Ga0501074_0086423 3300049590 Bacteria 2246
985 Ga0501075_0404069 3300049591 Bacteria 1041
986 Ga0501076_0005798 3300049592 Bacteria 8911
987 Ga0501249_008502 3300049679 Bacteria 2130
988 Ga0501079_0005839 3300049741 Bacteria 9204
989 Ga0501079_0281299 3300049741 Bacteria 1301
990 Ga0501080_0136948 3300049742 Bacteria 2265
991 Ga0501080_0211560 3300049742 Bacteria 1777
992 Ga0501080_0226487 3300049742 Bacteria 1709
993 Ga0501080_0497549 3300049742 Bacteria 1090
994 Ga0501083_0180720 3300049744 Bacteria 1377
995 Ga0501035_0007020 3300049822 Bacteria 10522
996 Ga0501035_0018527 3300049822 Bacteria 6413
997 Ga0501035_0032873 3300049822 Bacteria 4717
998 Ga0501044_0025658 3300049823 Bacteria 6248
999 Ga0501045_0044761 3300049824 Bacteria 3224
1000 Ga0501045_0063895 3300049824 Bacteria 2702
1001 Ga0501045_0088307 3300049824 Bacteria 2290
1002 nmdc:mga05p37_13907_c1 3300050507 Bacteria 9645
1003 nmdc:mga05p37_16061_c1 3300050507 Bacteria 9010
1004 nmdc:mga05p37_175586_c1 3300050507 Bacteria 2610
1005 nmdc:mga05p37_220856_c1 3300050507 Bacteria 2287
1006 nmdc:mga05p37_5090_c2 3300050507 Bacteria 9376
1007 nmdc:mga05p37_60646_c1 3300050507 Bacteria 4657
1008 nmdc:mga05p37_62494_c1 3300050507 Bacteria 4583
1009 nmdc:mga05p37_6904_c1 3300050507 Bacteria 13380
1010 nmdc:mga05p37_8417_c1 3300050507 Bacteria 12196
1011 nmdc:mga0qj67_309867_c1 3300050509 Bacteria 1278
1012 nmdc:mga06r32_160485_c1 3300050510 Bacteria 2230
1013 nmdc:mga06r32_658016_c1 3300050510 Bacteria 1015
1014 nmdc:mga08y16_165953_c1 3300050511 Bacteria 2294
1015 nmdc:mga08y16_20531_c1 3300050511 Bacteria 4077
1016 nmdc:mga08y16_4191_c1 3300050511 Bacteria 15068
1017 nmdc:mga08y16_458079_c1 3300050511 Bacteria 1300
1018 nmdc:mga08y16_49772_c1 3300050511 Bacteria 4385
1019 nmdc:mga08y16_590020_c1 3300050511 Bacteria 1121
1020 nmdc:mga08y16_603474_c1 3300050511 Bacteria 1106
1021 nmdc:mga08y16_74827_c1 3300050511 Bacteria 3530
1022 nmdc:mga0n895_192586_c1 3300050512 Bacteria 2070
1023 nmdc:mga0n895_21468_c1 3300050512 Bacteria 6038
1024 nmdc:mga0n895_260845_c1 3300050512 Bacteria 1759
1025 nmdc:mga0n895_30_c1 3300050512 Bacteria 84416
1026 nmdc:mga0n895_40784_c1 3300050512 Bacteria 4511
1027 nmdc:mga0n895_679151_c1 3300050512 Bacteria 1027
1028 nmdc:mga0n895_83529_c1 3300050512 Bacteria 3186
1029 nmdc:mga0rr50_159893_c1 3300050513 Bacteria 1828
1030 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
1031 nmdc:mga0rr50_67605_c1 3300050513 Bacteria 2715
1032 nmdc:mga0rr50_750_c1 3300050513 Bacteria 17480
1033 nmdc:mga08x19_145335_c1 3300050514 Bacteria 1604
1034 nmdc:mga08x19_180090_c1 3300050514 Bacteria 1442
1035 nmdc:mga08x19_231400_c1 3300050514 Bacteria 1272
1036 nmdc:mga08x19_39694_c1 3300050514 Bacteria 2993
1037 nmdc:mga08x19_76_c1 3300050514 Bacteria 92204
1038 nmdc:mga0a205_119416_c1 3300050515 Bacteria 2535
1039 nmdc:mga0a205_134556_c1 3300050515 Bacteria 2372
1040 nmdc:mga0a205_14486_c1 3300050515 Bacteria 7356
1041 nmdc:mga0a205_273393_c1 3300050515 Bacteria 1566
1042 nmdc:mga0a205_303480_c1 3300050515 Unclassified 1469
1043 nmdc:mga0a205_325774_c1 3300050515 Bacteria 1407
1044 nmdc:mga0a205_61167_c1 3300050515 Bacteria 3637
1045 Ga0495595_0140190 3300053084 Unclassified 1186
1046 Ga0495619_0010909 3300053085 Bacteria 5719
1047 Ga0495619_0116747 3300053085 Bacteria 1827
1048 Ga0495619_0132889 3300053085 Unclassified 1711
1049 Ga0495619_0318384 3300053085 Bacteria 1077
1050 Ga0500568_0000885 3300053139 Bacteria 20942
1051 Ga0501084_0000668 3300054114 Bacteria 26166
1052 Ga0501084_0019052 3300054114 Bacteria 5715
1053 Ga0501084_0477863 3300054114 Bacteria 1053
1054 Ga0590071_007470 3300059421 Bacteria 2584
1055 Ga0590075_037852 3300059424 Bacteria 1230
1056 Ga0587128_013038 3300059630 Bacteria 1166
1057 Ga0501082_0006692 3300060353 Bacteria 9970
1058 Ga0501082_0007117 3300060353 Bacteria 9652
1059 Ga0501082_0097858 3300060353 Bacteria 2537
1060 Ga0530510_0041329 3300061734 Bacteria 3329
1061 Ga0530510_0045136 3300061734 Bacteria 3184
1062 Ga0530510_0301573 3300061734 Bacteria 1199
1063 Ga0163161_10063451
1064 JGI24033J26618_1005491
1065 JGI25406J46586_10000725
1066 Ga0065714_10075471
1067 Ga0065704_10193170
1068 Ga0065712_10000342
1069 Ga0065712_10070130
1070 Ga0065712_10091011
1071 Ga0065712_10091915
1072 Ga0065715_10001215
1073 Ga0065715_10021840
1074 Ga0065715_10098703
1075 Ga0065715_10106754
1076 Ga0065715_10207929
1077 Ga0065707_10013597
1078 Ga0065707_10100488
1079 Ga0065707_10173154
1080 Ga0070658_10116810
1081 Ga0070676_10040170
1082 Ga0070676_10351169
1083 Ga0070676_10371012
1084 Ga0070683_100000278
1085 Ga0070683_100008117
1086 Ga0070683_100061702
1087 Ga0070683_100156931
1088 Ga0070690_100025834
1089 Ga0070690_100034072
1090 Ga0070690_100068083
1091 Ga0070690_100120551
1092 Ga0070670_100010311
1093 Ga0070670_100052238
1094 Ga0070670_100073328
1095 Ga0070670_100187063
1096 Ga0070666_10002398
1097 Ga0070666_10013063
1098 Ga0070666_10098457
1099 Ga0070666_10110964
1100 Ga0070666_10381313
1101 Ga0070680_100003994
1102 Ga0070680_100021772
1103 Ga0070680_100211120
1104 Ga0068868_100004969
1105 Ga0068868_100282713
1106 Ga0068868_100316524
1107 Ga0068868_100461697
1108 Ga0068868_100526355
1109 Ga0070660_100044431
1110 Ga0070660_100401796
1111 Ga0070689_100091953
1112 Ga0070689_100241752
1113 Ga0070689_100250383
1114 Ga0070689_100510845
1115 Ga0070691_10001080
1116 Ga0070691_10001150
1117 Ga0070687_100006349
1118 Ga0070687_100106241
1119 Ga0070661_100036178
1120 Ga0070661_100140587
1121 Ga0070661_100179731
1122 Ga0070692_10152146
1123 Ga0070668_100212202
1124 Ga0070669_100015981
1125 Ga0070669_100026479
1126 Ga0070669_100047725
1127 Ga0070669_100069745
1128 Ga0070669_100487457
1129 Ga0070675_100000959
1130 Ga0070675_100001900
1131 Ga0070675_100024152
1132 Ga0070675_100055602
1133 Ga0070675_100073773
1134 Ga0070675_100151170
1135 Ga0070675_100467513
1136 Ga0070671_100022553
1137 Ga0070671_100126940
1138 Ga0070671_100253958
1139 Ga0070674_100033584
1140 Ga0070674_100065050
1141 Ga0070673_100003230
1142 Ga0070673_100037988
1143 Ga0070673_100116471
1144 Ga0070673_100141214
1145 Ga0070673_100205116
1146 Ga0070673_100208646
1147 Ga0070688_100010419
1148 Ga0070688_100040657
1149 Ga0070688_100099972
1150 Ga0070688_100129077
1151 Ga0070688_100200464
1152 Ga0070659_100039930
1153 Ga0070659_100259308
1154 Ga0070667_100037086
1155 Ga0070667_100037642
1156 Ga0070667_100066967
1157 Ga0070667_100092993
1158 Ga0070667_100199636
1159 Ga0070667_100318635
1160 Ga0070709_10308846
1161 Ga0070714_100002119
1162 Ga0070713_100050549
1163 Ga0070713_100051778
1164 Ga0070713_100080848
1165 Ga0070710_10500673
1166 Ga0070701_10126886
1167 Ga0070711_100134124
1168 Ga0070705_100017998
1169 Ga0070705_100126469
1170 Ga0070705_100400170
1171 Ga0070700_100009277
1172 Ga0070700_100044778
1173 Ga0070700_100452092
1174 Ga0070708_100113286
1175 Ga0070662_100060968
1176 Ga0070662_100196388
1177 Ga0070662_100285393
1178 Ga0070681_10005564
1179 Ga0070681_10010716
1180 Ga0070681_10018804
1181 Ga0070681_10131414
1182 Ga0070681_10452760
1183 Ga0070681_10457193
1184 Ga0068867_100012139
1185 Ga0068867_100020584
1186 Ga0070685_10015461
1187 Ga0070685_10131789
1188 Ga0070685_10156322
1189 Ga0070685_10210763
1190 Ga0070706_100504996
1191 Ga0070707_100197361
1192 Ga0070699_100110705
1193 Ga0070699_100211878
1194 Ga0070679_100002506
1195 Ga0070679_100049371
1196 Ga0070684_100007753
1197 Ga0070684_100036127
1198 Ga0070684_100091578
1199 Ga0070684_100224944
1200 Ga0070684_100258061
1201 Ga0070684_100558079
1202 Ga0068853_100017636
1203 Ga0068853_100031026
1204 Ga0068853_100086521
1205 Ga0068853_100159581
1206 Ga0070672_100008342
1207 Ga0070672_100041283
1208 Ga0070672_100059469
1209 Ga0070672_100071745
1210 Ga0070672_100131740
1211 Ga0070672_100375143
1212 Ga0070686_100001675
1213 Ga0070686_100059723
1214 Ga0070686_100239490
1215 Ga0070686_100260650
1216 Ga0070695_100008485
1217 Ga0070695_100009406
1218 Ga0070696_100003384
1219 Ga0070665_100007069
1220 Ga0070665_100010348
1221 Ga0070665_100021222
1222 Ga0070665_100029355
1223 Ga0070665_100102541
1224 Ga0070704_100006916
1225 Ga0070704_100040203
1226 Ga0070704_100544741
1227 Ga0068855_100007793
1228 Ga0068855_100012889
1229 Ga0068855_100030751
1230 Ga0068855_100044437
1231 Ga0068855_100074228
1232 Ga0068855_100335425
1233 Ga0068855_100420699
1234 Ga0068855_100532751
1235 Ga0070664_100033375
1236 Ga0070664_100076552
1237 Ga0070664_100102732
1238 Ga0070664_100275424
1239 Ga0070664_100331499
1240 Ga0068857_100000140
1241 Ga0068857_100005615
1242 Ga0068857_100058312
1243 Ga0068857_100143048
1244 Ga0068857_100178770
1245 Ga0068857_100196014
1246 Ga0068854_100007348
1247 Ga0068854_101132198
1248 Ga0068856_100001686
1249 Ga0068856_100007046
1250 Ga0068856_100008482
1251 Ga0068856_100027094
1252 Ga0068856_100037209
1253 Ga0070702_100049489
1254 Ga0070702_100085703
1255 Ga0068852_100019346
1256 Ga0068852_100039063
1257 Ga0068852_100051399
1258 Ga0068852_100263544
1259 Ga0068852_100350648
1260 Ga0068859_100101925
1261 Ga0068859_100144097
1262 Ga0068859_100163942
1263 Ga0068859_100165294
1264 Ga0068859_100313512
1265 Ga0068859_100387334
1266 Ga0068859_100771503
1267 Ga0068859_100878535
1268 Ga0068864_100001542
1269 Ga0068864_100010274
1270 Ga0068864_100036627
1271 Ga0068864_100105908
1272 Ga0068864_100118658
1273 Ga0068864_100330916
1274 Ga0068866_10049908
1275 Ga0068866_10053303
1276 Ga0068866_10186674
1277 Ga0068861_100002259
1278 Ga0068851_10104343
1279 Ga0068870_10352117
1280 Ga0068863_100012751
1281 Ga0068863_100185167
1282 Ga0068863_100211499
1283 Ga0068863_100218802
1284 Ga0068863_100270463
1285 Ga0068863_100609713
1286 Ga0068858_100004349
1287 Ga0068858_100011282
1288 Ga0068858_100021863
1289 Ga0068858_100038496
1290 Ga0068858_100164305
1291 Ga0068858_100472100
1292 Ga0068858_100497379
1293 Ga0068858_100517341
1294 Ga0068860_100016894
1295 Ga0068860_100034259
1296 Ga0068860_100135286
1297 Ga0068860_100307996
1298 Ga0068860_100736475
1299 Ga0068862_100016562
1300 Ga0081455_10038869
1301 Ga0081539_10001115
1302 Ga0070717_10310124
1303 Ga0075432_10031491
1304 Ga0070716_100103215
1305 Ga0070712_100447262
1306 Ga0097621_100004607
1307 Ga0097621_100013094
1308 Ga0097621_100023848
1309 Ga0097621_100035520
1310 Ga0097621_100060328
1311 Ga0097621_100061343
1312 Ga0097621_100063563
1313 Ga0097621_100096644
1314 Ga0097621_100130582
1315 Ga0097621_100188471
1316 Ga0097621_100215887
1317 Ga0097621_100724865
1318 Ga0068871_100001350
1319 Ga0068871_100007041
1320 Ga0068871_100017256
1321 Ga0068871_100025965
1322 Ga0068871_100029917
1323 Ga0068871_100053174
1324 Ga0068871_100078682
1325 Ga0068871_100185633
1326 Ga0068871_100257787
1327 Ga0068871_100284165
1328 Ga0068871_100389282
1329 Ga0068871_100422843
1330 Ga0068871_100486896
1331 Ga0068871_100553773
1332 Ga0068871_100641512
1333 Ga0075428_100370104
1334 Ga0075428_100418509
1335 Ga0075430_100316901
1336 Ga0075433_10010820
1337 Ga0075433_10161770
1338 Ga0075433_10254460
1339 Ga0075434_100002366
1340 Ga0075434_100019226
1341 Ga0075434_100043081
1342 Ga0075434_100105312
1343 Ga0075434_100202206
1344 Ga0075434_100204691
1345 Ga0068865_100036588
1346 Ga0068865_100161574
1347 Ga0068865_100202453
1348 Ga0068865_100312243
1349 Ga0068865_100454629
1350 Ga0075436_100000845
1351 Ga0075436_100020389
1352 Ga0097620_100101926
1353 Ga0097620_100144096
1354 Ga0097620_100163958
1355 Ga0097620_100165304
1356 Ga0097620_100313508
1357 Ga0097620_100387314
1358 Ga0097620_100771408
1359 Ga0097620_100878636
1360 Ga0075435_100000049
1361 Ga0075435_100034583
1362 Ga0075435_100111517
1363 Ga0099794_10094612
1364 Ga0099794_10162469
1365 Ga0105251_10036066
1366 Ga0105240_10004847
1367 Ga0105240_10007712
1368 Ga0105240_10021843
1369 Ga0105240_10110957
1370 Ga0105240_10209777
1371 Ga0105240_10482408
1372 Ga0111539_10031279
1373 Ga0111539_10036623
1374 Ga0111539_10130234
1375 Ga0105245_10007811
1376 Ga0105245_10024868
1377 Ga0105245_10029447
1378 Ga0105245_10061394
1379 Ga0105245_10065868
1380 Ga0105245_10073044
1381 Ga0105245_10094515
1382 Ga0105245_10217847
1383 Ga0105245_10924920
1384 Ga0105245_11525010
1385 Ga0105247_10037295
1386 Ga0105247_10075715
1387 Ga0105247_10076887
1388 Ga0105247_10116754
1389 Ga0114129_10000192
1390 Ga0114129_10003382
1391 Ga0114129_10010507
1392 Ga0114129_10013092
1393 Ga0114129_10014797
1394 Ga0114129_10053098
1395 Ga0114129_10152679
1396 Ga0114129_10430983
1397 Ga0114129_10732004
1398 Ga0105241_10001620
1399 Ga0105241_10017463
1400 Ga0105241_10135675
1401 Ga0105241_10191243
1402 Ga0105241_10204145
1403 Ga0105241_10255154
1404 Ga0105241_10515283
1405 Ga0105242_10008421
1406 Ga0105242_10024145
1407 Ga0105242_10027094
1408 Ga0105242_10038927
1409 Ga0105242_10041151
1410 Ga0105242_10064466
1411 Ga0105242_10066002
1412 Ga0105242_10090102
1413 Ga0105242_10094988
1414 Ga0105242_10231228
1415 Ga0105242_10371435
1416 Ga0105242_10467149
1417 Ga0105248_10008123
1418 Ga0105248_10019058
1419 Ga0105248_10023159
1420 Ga0105248_10025953
1421 Ga0105248_10034550
1422 Ga0105248_10061700
1423 Ga0105248_10099460
1424 Ga0105248_10104301
1425 Ga0105248_10106005
1426 Ga0105248_10107375
1427 Ga0105248_10144329
1428 Ga0105248_10144410
1429 Ga0105248_10149963
1430 Ga0105248_10216135
1431 Ga0105248_10432657
1432 Ga0105248_10631121
1433 Ga0105237_10007273
1434 Ga0105237_10024541
1435 Ga0105237_10025726
1436 Ga0105237_10034903
1437 Ga0105237_10112639
1438 Ga0105237_10190872
1439 Ga0105238_10002113
1440 Ga0105238_10013430
1441 Ga0105238_10020407
1442 Ga0105238_10036354
1443 Ga0105238_10037736
1444 Ga0105238_10095132
1445 Ga0105238_10115319
1446 Ga0105238_10158723
1447 Ga0105238_10537118
1448 Ga0105238_10541319
1449 Ga0105249_10622019
1450 Ga0105239_10003025
1451 Ga0105239_10003955
1452 Ga0105239_10006171
1453 Ga0105239_10017693
1454 Ga0105239_10025750
1455 Ga0105239_10026079
1456 Ga0105239_10232058
1457 Ga0105239_10307549
1458 Ga0105239_10659135
1459 Ga0105239_11154906
1460 Ga0105246_10034267
1461 Ga0105246_10231297
1462 Ga0105246_10251419
1463 Ga0105246_10384882
1464 Ga0157373_10045002
1465 Ga0157373_10127677
1466 Ga0157370_10004304
1467 Ga0157370_10033774
1468 Ga0157370_10087583
1469 Ga0157370_10089626
1470 Ga0157370_10094424
1471 Ga0157370_10159570
1472 Ga0157369_10002200
1473 Ga0157369_10011678
1474 Ga0157369_10028240
1475 Ga0157369_10139287
1476 Ga0157369_10334768
1477 Ga0157369_10566498
1478 Ga0157374_10016699
1479 Ga0157374_10027745
1480 Ga0157374_10054140
1481 Ga0157374_10055562
1482 Ga0157374_10243246
1483 Ga0157374_10330078
1484 Ga0157374_10479276
1485 Ga0157374_10480094
1486 Ga0157378_10043754
1487 Ga0157378_10222943
1488 Ga0157378_10258108
1489 Ga0157378_10419759
1490 Ga0157378_10584808
1491 Ga0163162_10009499
1492 Ga0163162_10065289
1493 Ga0163162_10079451
1494 Ga0163162_10150427
1495 Ga0163162_10151980
1496 Ga0163162_10516220
1497 Ga0163162_10891659
1498 Ga0163162_10936540
1499 Ga0157372_10039627
1500 Ga0157372_10125659
1501 Ga0157372_10168916
1502 Ga0157372_10195057
1503 Ga0157372_10351448
1504 Ga0157372_10412866
1505 Ga0157372_10614681
1506 Ga0157375_10052063
1507 Ga0157375_10076661
1508 Ga0157375_10143279
1509 Ga0157375_10186969
1510 Ga0157375_10205552
1511 Ga0157375_10454423
1512 Ga0163163_10008779
1513 Ga0163163_10026375
1514 Ga0163163_10038709
1515 Ga0163163_10157127
1516 Ga0163163_10157701
1517 Ga0163163_10198116
1518 Ga0163163_10237487
1519 Ga0163163_10270332
1520 Ga0163163_10284719
1521 Ga0163163_10336922
1522 Ga0163163_10692323
1523 Ga0157380_10048468
1524 Ga0157380_10157829
1525 Ga0157380_10180817
1526 Ga0157380_10481777
1527 Ga0157380_10556060
1528 Ga0157377_10075853
1529 Ga0157377_10130799
1530 Ga0157377_10152001
1531 Ga0157377_10256946
1532 Ga0157379_10006149
1533 Ga0157379_10030148
1534 Ga0157379_10039036
1535 Ga0157379_10044354
1536 Ga0157379_10116210
1537 Ga0157379_10196317
1538 Ga0157379_10355793
1539 Ga0157376_10031726
1540 Ga0157376_10060945
1541 Ga0157376_10089594
1542 Ga0157376_10540897
1543 Ga0157376_10691359
1544 Ga0157376_10832203
1545 Ga0163161_10015750
1546 Ga0163161_10122648
1547 Ga0163161_10296662
1548 Ga0197907_10262591
1549 Ga0197907_10535074
1550 Ga0197907_10885219
1551 Ga0206355_1158864
1552 Ga0206355_1228848
1553 Ga0206351_11005059
1554 Ga0206352_10772431
1555 Ga0206350_10371091
1556 Ga0206350_10759031
1557 Ga0206354_11177288
1558 Ga0154015_1650422
1559 Ga0213873_10077771
1560 Ga0213872_10000098
1561 Ga0213872_10052106
1562 Ga0213876_10007922
1563 Ga0213876_10023885
1564 Ga0213875_10000004
1565 Ga0213875_10003648
1566 Ga0213875_10018084
1567 Ga0213875_10045841
1568 Ga0213875_10078637
1569 Ga0213871_10010350
1570 Ga0213871_10107163
1571 Ga0224712_10002723
1572 Ga0224712_10011276
1573 Ga0224712_10017575
1574 Ga0224712_10073324
1575 Ga0207697_10049223
1576 Ga0207656_10109387
1577 Ga0207713_1074928
1578 Ga0207642_10034164
1579 Ga0207642_10036209
1580 Ga0207642_10133026
1581 Ga0207642_10141525
1582 Ga0207710_10008073
1583 Ga0207710_10181472
1584 Ga0207710_10242906
1585 Ga0207680_10005064
1586 Ga0207680_10056770
1587 Ga0207680_10129135
1588 Ga0207680_10144715
1589 Ga0207680_10363896
1590 Ga0207647_10171237
1591 Ga0207699_10033735
1592 Ga0207699_10115310
1593 Ga0207699_10132908
1594 Ga0207645_10006889
1595 Ga0207645_10082497
1596 Ga0207645_10284243
1597 Ga0207654_10024609
1598 Ga0207654_10032844
1599 Ga0207654_10176043
1600 Ga0207654_10711013
1601 Ga0207707_10003371
1602 Ga0207707_10082938
1603 Ga0207707_10161821
1604 Ga0207707_10241681
1605 Ga0207707_10955689
1606 Ga0207695_10001831
1607 Ga0207695_10016736
1608 Ga0207695_10050165
1609 Ga0207695_10310186
1610 Ga0207695_10418306
1611 Ga0207695_10522086
1612 Ga0207671_10005457
1613 Ga0207671_10064566
1614 Ga0207671_10141844
1615 Ga0207671_10161252
1616 Ga0207671_10178827
1617 Ga0207671_10557083
1618 Ga0207693_10312066
1619 Ga0207693_10385798
1620 Ga0207663_10101302
1621 Ga0207663_10139732
1622 Ga0207660_10218412
1623 Ga0207660_10385438
1624 Ga0207662_10009816
1625 Ga0207662_10151540
1626 Ga0207657_10003226
1627 Ga0207657_10003464
1628 Ga0207657_10034462
1629 Ga0207657_10110107
1630 Ga0207657_10132777
1631 Ga0207657_10347574
1632 Ga0207649_10058629
1633 Ga0207649_10078412
1634 Ga0207649_10142316
1635 Ga0207649_10147786
1636 Ga0207652_10220426
1637 Ga0207652_10622320
1638 Ga0207646_10118398
1639 Ga0207646_10179203
1640 Ga0207646_10197631
1641 Ga0207681_10002032
1642 Ga0207681_10020141
1643 Ga0207681_10028887
1644 Ga0207681_10175423
1645 Ga0207681_10418612
1646 Ga0207694_10006985
1647 Ga0207694_10026762
1648 Ga0207694_10046060
1649 Ga0207694_10146750
1650 Ga0207694_10148879
1651 Ga0207650_10085653
1652 Ga0207650_10228674
1653 Ga0207650_10365912
1654 Ga0207659_10000830
1655 Ga0207659_10009600
1656 Ga0207659_10028750
1657 Ga0207659_10047946
1658 Ga0207659_10087574
1659 Ga0207659_10220953
1660 Ga0207659_10453692
1661 Ga0207687_10007777
1662 Ga0207687_10024436
1663 Ga0207687_10057914
1664 Ga0207687_10062351
1665 Ga0207687_10105692
1666 Ga0207687_10126711
1667 Ga0207687_10191245
1668 Ga0207700_10102628
1669 Ga0207700_10155236
1670 Ga0207700_10434554
1671 Ga0207664_10089750
1672 Ga0207644_10051779
1673 Ga0207644_10277484
1674 Ga0207644_10348326
1675 Ga0207644_10396118
1676 Ga0207690_10037356
1677 Ga0207690_10151795
1678 Ga0207690_10154250
1679 Ga0207690_10185336
1680 Ga0207706_10105500
1681 Ga0207706_10113382
1682 Ga0207706_10121411
1683 Ga0207706_10194031
1684 Ga0207686_10002438
1685 Ga0207686_10010805
1686 Ga0207686_10050742
1687 Ga0207686_10056788
1688 Ga0207686_10256878
1689 Ga0207686_10406546
1690 Ga0207709_10094432
1691 Ga0207670_10037851
1692 Ga0207670_10048792
1693 Ga0207670_10131765
1694 Ga0207670_10166202
1695 Ga0207670_10235316
1696 Ga0207670_10437555
1697 Ga0207704_10024709
1698 Ga0207704_10073292
1699 Ga0207704_10149073
1700 Ga0207704_10151426
1701 Ga0207704_10172410
1702 Ga0207704_10271712
1703 Ga0207704_10537839
1704 Ga0207665_10048285
1705 Ga0207691_10010517
1706 Ga0207691_10035424
1707 Ga0207691_10045852
1708 Ga0207691_10094716
1709 Ga0207691_10384860
1710 Ga0207711_10005340
1711 Ga0207711_10023491
1712 Ga0207711_10024174
1713 Ga0207711_10024413
1714 Ga0207711_10029653
1715 Ga0207711_10035334
1716 Ga0207711_10075347
1717 Ga0207711_10082059
1718 Ga0207711_10156440
1719 Ga0207711_10198697
1720 Ga0207711_10232352
1721 Ga0207711_10371248
1722 Ga0207711_10660199
1723 Ga0207689_10008966
1724 Ga0207689_10169652
1725 Ga0207689_10262191
1726 Ga0207689_10378796
1727 Ga0207661_10009880
1728 Ga0207661_10045841
1729 Ga0207661_10049753
1730 Ga0207661_10071017
1731 Ga0207661_10214940
1732 Ga0207661_10305818
1733 Ga0207661_10330999
1734 Ga0207679_10018773
1735 Ga0207679_10161883
1736 Ga0207679_10181760
1737 Ga0207679_10219597
1738 Ga0207679_10288736
1739 Ga0207679_10404858
1740 Ga0207679_10505588
1741 Ga0207667_10014741
1742 Ga0207667_10017139
1743 Ga0207667_10025443
1744 Ga0207667_10046637
1745 Ga0207667_10060044
1746 Ga0207667_10520415
1747 Ga0207667_10767672
1748 Ga0207651_10058060
1749 Ga0207651_10103263
1750 Ga0207651_10116157
1751 Ga0207651_10227188
1752 Ga0207651_10261659
1753 Ga0207651_10325704
1754 Ga0207712_10142152
1755 Ga0207712_10379942
1756 Ga0207712_10382393
1757 Ga0207668_10104956
1758 Ga0207668_10187607
1759 Ga0207668_10345098
1760 Ga0207640_10002390
1761 Ga0207640_10126542
1762 Ga0207640_10461805
1763 Ga0207658_10003889
1764 Ga0207658_10073501
1765 Ga0207658_10116923
1766 Ga0207677_10012475
1767 Ga0207677_10885422
1768 Ga0207703_10035156
1769 Ga0207703_10040564
1770 Ga0207703_10064337
1771 Ga0207703_10259044
1772 Ga0207703_10314466
1773 Ga0207703_10353602
1774 Ga0207703_10355469
1775 Ga0207703_10521710
1776 Ga0207639_10016444
1777 Ga0207639_10073659
1778 Ga0207639_10091473
1779 Ga0207639_10093830
1780 Ga0207639_10378869
1781 Ga0207678_10011858
1782 Ga0207708_10000797
1783 Ga0207708_10055861
1784 Ga0207708_10107678
1785 Ga0207708_10166358
1786 Ga0207702_10005238
1787 Ga0207702_10096329
1788 Ga0207702_10167331
1789 Ga0207702_10220642
1790 Ga0207702_10413274
1791 Ga0207702_10492465
1792 Ga0207641_10004288
1793 Ga0207641_10017364
1794 Ga0207641_10100013
1795 Ga0207641_10184819
1796 Ga0207641_10188875
1797 Ga0207641_10292099
1798 Ga0207641_10591679
1799 Ga0207641_10634513
1800 Ga0207648_10007685
1801 Ga0207648_10025669
1802 Ga0207648_10039476
1803 Ga0207648_10044313
1804 Ga0207648_10191703
1805 Ga0207648_10591426
1806 Ga0207676_10024041
1807 Ga0207676_10032574
1808 Ga0207676_10133671
1809 Ga0207676_10364513
1810 Ga0207674_10001211
1811 Ga0207674_10007293
1812 Ga0207674_10095167
1813 Ga0207674_10140935
1814 Ga0207674_10176180
1815 Ga0207674_10486341
1816 Ga0207675_100028134
1817 Ga0207675_100087563
1818 Ga0207675_100187158
1819 Ga0207675_100188507
1820 Ga0207675_100416514
1821 Ga0207683_10002520
1822 Ga0207683_10004271
1823 Ga0207683_10107413
1824 Ga0207683_10422326
1825 Ga0207698_10363440
1826 Ga0207698_10411457
1827 Ga0207698_10462038
1828 Ga0207428_10015888
1829 Ga0207428_10016431
1830 Ga0207428_10048271
1831 Ga0207428_10458690
1832 Ga0268266_10002664
1833 Ga0268266_10009440
1834 Ga0268266_10014990
1835 Ga0268266_10033575
1836 Ga0268266_10143042
1837 Ga0268266_10159568
1838 Ga0268266_10689846
1839 Ga0268265_10019405
1840 Ga0268265_10163292
1841 Ga0268265_10216940
1842 Ga0268265_10810562
1843 Ga0268264_10008480
1844 Ga0268264_10021345
1845 Ga0268264_10035414
1846 Ga0268264_10678225
1847 Ga0265332_10043963
1848 Ga0265316_10028020
1849 Ga0265316_10518153
1850 Ga0307408_100046668
1851 Ga0265313_10000978
1852 Ga0265314_10000542
1853 Ga0265314_10064164
1854 Ga0265314_10110478
1855 Ga0307405_10066244
1856 Ga0307413_10057539
1857 Ga0307412_10090258
1858 Ga0307409_100028667
1859 Ga0307409_100218822
1860 Ga0307416_100105838
1861 Ga0307415_100036781
1862 Ga0373930_0005530
1863 Ga0373950_0000509
1864 Ga0373938_0014194
1865 Ga0373926_0018141
1866 Ga0373929_0002238
1867 Ga0373934_0000504
1868 Ga0373934_0036203
1869 Ga0373940_0008809
1870 Ga0373949_0001582
1871 Ga0373951_0001506
1872 Ga0373932_0000705
1873 Ga0373936_0110736
1874 Ga0373939_0000674
1875 Ga0373939_0129491
1876 Ga0373941_0000861
1877 Ga0373953_0194875
1878 Ga0373957_0096854
1879 Ga0373955_0075626
1880 Ga0373955_0125183
1881 Ga0373955_0189047
1882 Ga0373942_0003169
1883 Ga0373961_0025257
1884 Ga0373962_0045019
1885 Ga0373931_0007379
1886 Ga0373933_0195387
1887 Ga0373947_0045629
1888 Ga0373937_0094534
1889 Ga0373937_0100290
1890 Ga0373937_0134282
1891 Ga0373937_0515651
1892 Ga0373925_0196494
1893 Ga0436364_0017646
1894 Ga0436364_0019305
1895 Ga0436364_0069467
1896 Ga0436364_0094240
1897 Ga0436364_0449695
1898 Ga0436364_0463517
1899 Ga0436364_0491033
1900 Ga0436364_0605122
1901 Ga0436364_0748068
1902 Ga0436364_0763039
1903 Ga0436364_1356593
1904 Ga0436364_1416970
1905 Ga0436365_0610679
1906 Ga0436365_0945465
1907 Ga0436365_1696515
1908 Ga0436361_0314405
1909 Ga0436361_0511602
1910 Ga0436361_0881798
1911 Ga0436363_0691901
1912 Ga0436363_0807582
1913 Ga0436363_1364227
1914 Ga0436363_1450594
1915 Ga0436362_0947914
1916 Ga0451839_0499901
1917 Ga0439450_059025
1918 Ga0439457_017314
1919 Ga0439462_0018876
1920 Ga0439434_0032167
1921 Ga0439464_0033468
1922 Ga0450916_002929
1923 Ga0466961_0080143
1924 Ga0453684_0909713
1925 Ga0466959_0120927
1926 Ga0451576_0035765
1927 Ga0451576_0227006
1928 Ga0451576_0286519
1929 Ga0466967_0554080
1930 Ga0495603_0093154
1931 Ga0495629_0279726
1932 Ga0495582_0062221
1933 Ga0495639_0196206
1934 Ga0495594_0049725
1935 Ga0495628_0100883
1936 Ga0495628_0270396
1937 Ga0495628_0595526
1938 Ga0495640_0129560
1939 Ga0495586_0109220
1940 Ga0495586_0131216
1941 Ga0495645_0015063
1942 Ga0495645_0034303
1943 Ga0495656_0179078
1944 Ga0495599_0181569
1945 Ga0495647_0038186
1946 Ga0495647_0078313
1947 Ga0495658_0036374
1948 Ga0495658_0092955
1949 Ga0495669_0017811
1950 Ga0495669_0042593
1951 Ga0495669_0151424
1952 Ga0495670_0085167
1953 Ga0495600_0216400
1954 Ga0495604_0108310
1955 Ga0495604_0315178
1956 Ga0495674_0012415
1957 Ga0495674_0163845
1958 Ga0495684_0134895
1959 Ga0495593_0166647
1960 Ga0496100_0001606
1961 Ga0496101_0001080
1962 Ga0496101_0282095
1963 Ga0496102_0157568
1964 Ga0496102_0176865
1965 Ga0496102_0329902
1966 Ga0496103_0096133
1967 Ga0496104_0017733
1968 Ga0496104_0068126
1969 Ga0496104_0072447
1970 Ga0496104_0079486
1971 Ga0496104_0217861
1972 Ga0496104_0322802
1973 Ga0496105_0165337
1974 Ga0496105_0385081
1975 Ga0496106_0026452
1976 Ga0496106_0083572
1977 Ga0496106_0361951
1978 Ga0496107_0013906
1979 Ga0496107_0469017
1980 Ga0496108_0018047
1981 Ga0496108_0022160
1982 Ga0496109_0004045
1983 Ga0496109_0043132
1984 Ga0496110_0006669
1985 Ga0496111_0401271
1986 Ga0496112_0006973
1987 Ga0496112_0230477
1988 Ga0496112_0358392
1989 Ga0496112_0528198
1990 Ga0496113_0025522
1991 Ga0496114_0000608
1992 Ga0496114_0043245
1993 Ga0496114_0087236
1994 Ga0496114_0191588
1995 Ga0496114_0201734
1996 Ga0496114_0310887
1997 Ga0496115_0030399
1998 Ga0496115_0089131
1999 Ga0501032_0015337
2000 Ga0501033_0009149
2001 Ga0501033_0017809
2002 Ga0501034_0009674
2003 Ga0501034_0022314
2004 Ga0501034_0241943
2005 Ga0501034_0448227
2006 Ga0501036_0044215
2007 Ga0501036_0175650
2008 Ga0501036_0200631
2009 Ga0501037_0015187
2010 Ga0501037_0022034
2011 Ga0501037_0037302
2012 Ga0501037_0159874
2013 Ga0501038_0007487
2014 Ga0501038_0150124
2015 Ga0501039_0004793
2016 Ga0501041_0024338
2017 Ga0501042_0014450
2018 Ga0501042_0030122
2019 Ga0501043_0018705
2020 Ga0501043_0032499
2021 Ga0501043_0048484
2022 Ga0501043_0299674
2023 Ga0501046_0007495
2024 Ga0501046_0007937
2025 Ga0501047_0001847
2026 Ga0501047_0051962
2027 Ga0501047_0116499
2028 Ga0501047_0148148
2029 Ga0501048_0049639
2030 Ga0501048_0126359
2031 Ga0501048_0223447
2032 Ga0501068_0003344
2033 Ga0501069_0011932
2034 Ga0501069_0109055
2035 Ga0501070_0011902
2036 Ga0501070_0013841
2037 Ga0501070_0087039
2038 Ga0501071_0192362
2039 Ga0501072_0055609
2040 Ga0501072_0436577
2041 Ga0501073_0020874
2042 Ga0501073_0039566
2043 Ga0501073_0077727
2044 Ga0501073_0113019
2045 Ga0501074_0001487
2046 Ga0501074_0086423
2047 Ga0501075_0404069
2048 Ga0501076_0005798
2049 Ga0501249_008502
2050 Ga0501079_0005839
2051 Ga0501079_0281299
2052 Ga0501080_0136948
2053 Ga0501080_0211560
2054 Ga0501080_0226487
2055 Ga0501080_0497549
2056 Ga0501083_0180720
2057 Ga0501035_0007020
2058 Ga0501035_0018527
2059 Ga0501035_0032873
2060 Ga0501044_0025658
2061 Ga0501045_0044761
2062 Ga0501045_0063895
2063 Ga0501045_0088307
2064 nmdc:mga05p37_13907_c1
2065 nmdc:mga05p37_16061_c1
2066 nmdc:mga05p37_175586_c1
2067 nmdc:mga05p37_220856_c1
2068 nmdc:mga05p37_5090_c2
2069 nmdc:mga05p37_60646_c1
2070 nmdc:mga05p37_62494_c1
2071 nmdc:mga05p37_6904_c1
2072 nmdc:mga05p37_8417_c1
2073 nmdc:mga0qj67_309867_c1
2074 nmdc:mga06r32_160485_c1
2075 nmdc:mga06r32_658016_c1
2076 nmdc:mga08y16_165953_c1
2077 nmdc:mga08y16_20531_c1
2078 nmdc:mga08y16_4191_c1
2079 nmdc:mga08y16_458079_c1
2080 nmdc:mga08y16_49772_c1
2081 nmdc:mga08y16_590020_c1
2082 nmdc:mga08y16_603474_c1
2083 nmdc:mga08y16_74827_c1
2084 nmdc:mga0n895_192586_c1
2085 nmdc:mga0n895_21468_c1
2086 nmdc:mga0n895_260845_c1
2087 nmdc:mga0n895_30_c1
2088 nmdc:mga0n895_40784_c1
2089 nmdc:mga0n895_679151_c1
2090 nmdc:mga0n895_83529_c1
2091 nmdc:mga0rr50_159893_c1
2092 nmdc:mga0rr50_2_c1
2093 nmdc:mga0rr50_67605_c1
2094 nmdc:mga0rr50_750_c1
2095 nmdc:mga08x19_145335_c1
2096 nmdc:mga08x19_180090_c1
2097 nmdc:mga08x19_231400_c1
2098 nmdc:mga08x19_39694_c1
2099 nmdc:mga08x19_76_c1
2100 nmdc:mga0a205_119416_c1
2101 nmdc:mga0a205_134556_c1
2102 nmdc:mga0a205_14486_c1
2103 nmdc:mga0a205_273393_c1
2104 nmdc:mga0a205_303480_c1
2105 nmdc:mga0a205_325774_c1
2106 nmdc:mga0a205_61167_c1
2107 Ga0495595_0140190
2108 Ga0495619_0010909
2109 Ga0495619_0116747
2110 Ga0495619_0132889
2111 Ga0495619_0318384
2112 Ga0500568_0000885
2113 Ga0501084_0000668
2114 Ga0501084_0019052
2115 Ga0501084_0477863
2116 Ga0590071_007470
2117 Ga0590075_037852
2118 Ga0587128_013038
2119 Ga0501082_0006692
2120 Ga0501082_0007117
2121 Ga0501082_0097858
2122 Ga0530510_0041329
2123 Ga0530510_0045136
2124 Ga0530510_0301573

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

26

190

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h59-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound 0.909 15 195
6wmv-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.8903 8 195
6wm5-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.8845 9 192
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.883 21 200
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.8781 21 200
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9062 15 195 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8648 5 200 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8402 15 195 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8329 5 200 1.20.120.1760
af_P76226_9_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8261 15 199 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A143PRP5-F1-model_v4 CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) 0.9753 1 200 GO:0003881
GO:0008654
GO:0016020
AF-A0A257UJB8-F1-model_v4 CDP-alcohol phosphatidyltransferase 0.9746 18 183 GO:0008654
GO:0016020
GO:0016780
AF-A0A2V8DIS4-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.964 1 175 GO:0008654
GO:0016020
GO:0016780
AF-A0A7W0LCC3-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.958 1 130 GO:0008654
GO:0016020
GO:0016780
AF-A0A7Z9TA81-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9579 1 200 GO:0008654
GO:0016020
GO:0016780

Map