F489306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1062 | 328 | 2124 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10063451|Ga0163161_100634513 |
| Length | 317 |
| Sequence | MTFTGFVGTVCMFPLRAIINASVALRIHPNMLTLIGVLINVGAAVALGAGGEHFVLAGIIMVVGNIFDFIDGKVALITNTVSRFGAFWDSTLDRFSDIALFLGLIYLYADLGRTGYVMVASLAMMFSIMTSYARARAESLIEKCKVGFMERPERIVLFLGLIFFYSKLGRSDYVMTAALALIFSVMTSYTRARAESVVQKCKVGFMERPERIVLFIIGAFTNRMAGVLWVILVLTILAFANRSYYTYLVLNQRPLPSRQGWRGFFSRVFFWTDERATLAYDLCVIAILAFVWLTPPEWIGDPRASDPGLIGLIASRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 235 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 236 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 237 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 238 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 3.67 |
| Rhizosphere | 93.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163161_10063451 | 3300017792 | Bacteria | 2693 |
| 2 | JGI24033J26618_1005491 | 3300002155 | Bacteria | 1399 |
| 3 | JGI25406J46586_10000725 | 3300003203 | Bacteria | 15382 |
| 4 | Ga0065714_10075471 | 3300005288 | Bacteria | 2904 |
| 5 | Ga0065704_10193170 | 3300005289 | Unclassified | 1180 |
| 6 | Ga0065712_10000342 | 3300005290 | Bacteria | 23229 |
| 7 | Ga0065712_10070130 | 3300005290 | Bacteria | 6303 |
| 8 | Ga0065712_10091011 | 3300005290 | Unclassified | 2395 |
| 9 | Ga0065712_10091915 | 3300005290 | Unclassified | 2352 |
| 10 | Ga0065715_10001215 | 3300005293 | Bacteria | 6741 |
| 11 | Ga0065715_10021840 | 3300005293 | Unclassified | 2513 |
| 12 | Ga0065715_10098703 | 3300005293 | Bacteria | 3510 |
| 13 | Ga0065715_10106754 | 3300005293 | Bacteria | 2811 |
| 14 | Ga0065715_10207929 | 3300005293 | Bacteria | 1328 |
| 15 | Ga0065707_10013597 | 3300005295 | Bacteria | 2043 |
| 16 | Ga0065707_10100488 | 3300005295 | Bacteria | 2926 |
| 17 | Ga0065707_10173154 | 3300005295 | Bacteria | 1470 |
| 18 | Ga0070658_10116810 | 3300005327 | Bacteria | 2214 |
| 19 | Ga0070676_10040170 | 3300005328 | Bacteria | 2708 |
| 20 | Ga0070676_10351169 | 3300005328 | Bacteria | 1014 |
| 21 | Ga0070676_10371012 | 3300005328 | Bacteria | 989 |
| 22 | Ga0070683_100000278 | 3300005329 | Bacteria | 35197 |
| 23 | Ga0070683_100008117 | 3300005329 | Bacteria | 8916 |
| 24 | Ga0070683_100061702 | 3300005329 | Bacteria | 3486 |
| 25 | Ga0070683_100156931 | 3300005329 | Unclassified | 2158 |
| 26 | Ga0070690_100025834 | 3300005330 | Bacteria | 3618 |
| 27 | Ga0070690_100034072 | 3300005330 | Bacteria | 3190 |
| 28 | Ga0070690_100068083 | 3300005330 | Bacteria | 2308 |
| 29 | Ga0070690_100120551 | 3300005330 | Bacteria | 1760 |
| 30 | Ga0070670_100010311 | 3300005331 | Bacteria | 7975 |
| 31 | Ga0070670_100052238 | 3300005331 | Bacteria | 3510 |
| 32 | Ga0070670_100073328 | 3300005331 | Bacteria | 2940 |
| 33 | Ga0070670_100187063 | 3300005331 | Bacteria | 1798 |
| 34 | Ga0070666_10002398 | 3300005335 | Bacteria | 11332 |
| 35 | Ga0070666_10013063 | 3300005335 | Bacteria | 5260 |
| 36 | Ga0070666_10098457 | 3300005335 | Bacteria | 2014 |
| 37 | Ga0070666_10110964 | 3300005335 | Bacteria | 1896 |
| 38 | Ga0070666_10381313 | 3300005335 | Bacteria | 1012 |
| 39 | Ga0070680_100003994 | 3300005336 | Bacteria | 11041 |
| 40 | Ga0070680_100021772 | 3300005336 | Bacteria | 5098 |
| 41 | Ga0070680_100211120 | 3300005336 | Bacteria | 1638 |
| 42 | Ga0068868_100004969 | 3300005338 | Bacteria | 9338 |
| 43 | Ga0068868_100282713 | 3300005338 | Bacteria | 1405 |
| 44 | Ga0068868_100316524 | 3300005338 | Bacteria | 1328 |
| 45 | Ga0068868_100461697 | 3300005338 | Bacteria | 1106 |
| 46 | Ga0068868_100526355 | 3300005338 | Bacteria | 1039 |
| 47 | Ga0070660_100044431 | 3300005339 | Bacteria | 3398 |
| 48 | Ga0070660_100401796 | 3300005339 | Unclassified | 1133 |
| 49 | Ga0070689_100091953 | 3300005340 | Bacteria | 2392 |
| 50 | Ga0070689_100241752 | 3300005340 | Bacteria | 1487 |
| 51 | Ga0070689_100250383 | 3300005340 | Bacteria | 1462 |
| 52 | Ga0070689_100510845 | 3300005340 | Bacteria | 1030 |
| 53 | Ga0070691_10001080 | 3300005341 | Bacteria | 11296 |
| 54 | Ga0070691_10001150 | 3300005341 | Bacteria | 11016 |
| 55 | Ga0070687_100006349 | 3300005343 | Bacteria | 4840 |
| 56 | Ga0070687_100106241 | 3300005343 | Bacteria | 1581 |
| 57 | Ga0070661_100036178 | 3300005344 | Bacteria | 3589 |
| 58 | Ga0070661_100140587 | 3300005344 | Bacteria | 1819 |
| 59 | Ga0070661_100179731 | 3300005344 | Bacteria | 1609 |
| 60 | Ga0070692_10152146 | 3300005345 | Bacteria | 1319 |
| 61 | Ga0070668_100212202 | 3300005347 | Bacteria | 1593 |
| 62 | Ga0070669_100015981 | 3300005353 | Bacteria | 5355 |
| 63 | Ga0070669_100026479 | 3300005353 | Bacteria | 4172 |
| 64 | Ga0070669_100047725 | 3300005353 | Bacteria | 3124 |
| 65 | Ga0070669_100069745 | 3300005353 | Bacteria | 2597 |
| 66 | Ga0070669_100487457 | 3300005353 | Bacteria | 1021 |
| 67 | Ga0070675_100000959 | 3300005354 | Bacteria | 20600 |
| 68 | Ga0070675_100001900 | 3300005354 | Bacteria | 15413 |
| 69 | Ga0070675_100024152 | 3300005354 | Bacteria | 4868 |
| 70 | Ga0070675_100055602 | 3300005354 | Bacteria | 3258 |
| 71 | Ga0070675_100073773 | 3300005354 | Bacteria | 2833 |
| 72 | Ga0070675_100151170 | 3300005354 | Bacteria | 1991 |
| 73 | Ga0070675_100467513 | 3300005354 | Bacteria | 1133 |
| 74 | Ga0070671_100022553 | 3300005355 | Bacteria | 5142 |
| 75 | Ga0070671_100126940 | 3300005355 | Bacteria | 2148 |
| 76 | Ga0070671_100253958 | 3300005355 | Bacteria | 1493 |
| 77 | Ga0070674_100033584 | 3300005356 | Bacteria | 3417 |
| 78 | Ga0070674_100065050 | 3300005356 | Bacteria | 2558 |
| 79 | Ga0070673_100003230 | 3300005364 | Bacteria | 10114 |
| 80 | Ga0070673_100037988 | 3300005364 | Bacteria | 3673 |
| 81 | Ga0070673_100116471 | 3300005364 | Bacteria | 2223 |
| 82 | Ga0070673_100141214 | 3300005364 | Bacteria | 2031 |
| 83 | Ga0070673_100205116 | 3300005364 | Bacteria | 1699 |
| 84 | Ga0070673_100208646 | 3300005364 | Bacteria | 1686 |
| 85 | Ga0070688_100010419 | 3300005365 | Bacteria | 5124 |
| 86 | Ga0070688_100040657 | 3300005365 | Bacteria | 2850 |
| 87 | Ga0070688_100099972 | 3300005365 | Bacteria | 1910 |
| 88 | Ga0070688_100129077 | 3300005365 | Bacteria | 1703 |
| 89 | Ga0070688_100200464 | 3300005365 | Bacteria | 1396 |
| 90 | Ga0070659_100039930 | 3300005366 | Bacteria | 3665 |
| 91 | Ga0070659_100259308 | 3300005366 | Unclassified | 1442 |
| 92 | Ga0070667_100037086 | 3300005367 | Bacteria | 4087 |
| 93 | Ga0070667_100037642 | 3300005367 | Bacteria | 4056 |
| 94 | Ga0070667_100066967 | 3300005367 | Bacteria | 3052 |
| 95 | Ga0070667_100092993 | 3300005367 | Unclassified | 2596 |
| 96 | Ga0070667_100199636 | 3300005367 | Bacteria | 1775 |
| 97 | Ga0070667_100318635 | 3300005367 | Bacteria | 1403 |
| 98 | Ga0070709_10308846 | 3300005434 | Bacteria | 1157 |
| 99 | Ga0070714_100002119 | 3300005435 | Bacteria | 14569 |
| 100 | Ga0070713_100050549 | 3300005436 | Bacteria | 3434 |
| 101 | Ga0070713_100051778 | 3300005436 | Bacteria | 3397 |
| 102 | Ga0070713_100080848 | 3300005436 | Bacteria | 2772 |
| 103 | Ga0070710_10500673 | 3300005437 | Unclassified | 832 |
| 104 | Ga0070701_10126886 | 3300005438 | Bacteria | 1445 |
| 105 | Ga0070711_100134124 | 3300005439 | Bacteria | 1848 |
| 106 | Ga0070705_100017998 | 3300005440 | Bacteria | 3696 |
| 107 | Ga0070705_100126469 | 3300005440 | Bacteria | 1660 |
| 108 | Ga0070705_100400170 | 3300005440 | Bacteria | 1017 |
| 109 | Ga0070700_100009277 | 3300005441 | Bacteria | 5395 |
| 110 | Ga0070700_100044778 | 3300005441 | Bacteria | 2727 |
| 111 | Ga0070700_100452092 | 3300005441 | Bacteria | 978 |
| 112 | Ga0070708_100113286 | 3300005445 | Bacteria | 2495 |
| 113 | Ga0070662_100060968 | 3300005457 | Bacteria | 2753 |
| 114 | Ga0070662_100196388 | 3300005457 | Bacteria | 1598 |
| 115 | Ga0070662_100285393 | 3300005457 | Bacteria | 1337 |
| 116 | Ga0070681_10005564 | 3300005458 | Bacteria | 12170 |
| 117 | Ga0070681_10010716 | 3300005458 | Bacteria | 9059 |
| 118 | Ga0070681_10018804 | 3300005458 | Bacteria | 6914 |
| 119 | Ga0070681_10131414 | 3300005458 | Unclassified | 2436 |
| 120 | Ga0070681_10452760 | 3300005458 | Bacteria | 1196 |
| 121 | Ga0070681_10457193 | 3300005458 | Bacteria | 1189 |
| 122 | Ga0068867_100012139 | 3300005459 | Bacteria | 6085 |
| 123 | Ga0068867_100020584 | 3300005459 | Bacteria | 4700 |
| 124 | Ga0070685_10015461 | 3300005466 | Bacteria | 4055 |
| 125 | Ga0070685_10131789 | 3300005466 | Bacteria | 1564 |
| 126 | Ga0070685_10156322 | 3300005466 | Bacteria | 1450 |
| 127 | Ga0070685_10210763 | 3300005466 | Bacteria | 1268 |
| 128 | Ga0070706_100504996 | 3300005467 | Bacteria | 1125 |
| 129 | Ga0070707_100197361 | 3300005468 | Bacteria | 1962 |
| 130 | Ga0070699_100110705 | 3300005518 | Bacteria | 2411 |
| 131 | Ga0070699_100211878 | 3300005518 | Bacteria | 1725 |
| 132 | Ga0070679_100002506 | 3300005530 | Bacteria | 16635 |
| 133 | Ga0070679_100049371 | 3300005530 | Bacteria | 4191 |
| 134 | Ga0070684_100007753 | 3300005535 | Bacteria | 8368 |
| 135 | Ga0070684_100036127 | 3300005535 | Bacteria | 4234 |
| 136 | Ga0070684_100091578 | 3300005535 | Bacteria | 2705 |
| 137 | Ga0070684_100224944 | 3300005535 | Bacteria | 1712 |
| 138 | Ga0070684_100258061 | 3300005535 | Bacteria | 1594 |
| 139 | Ga0070684_100558079 | 3300005535 | Bacteria | 1063 |
| 140 | Ga0068853_100017636 | 3300005539 | Bacteria | 5893 |
| 141 | Ga0068853_100031026 | 3300005539 | Bacteria | 4518 |
| 142 | Ga0068853_100086521 | 3300005539 | Bacteria | 2749 |
| 143 | Ga0068853_100159581 | 3300005539 | Bacteria | 2034 |
| 144 | Ga0070672_100008342 | 3300005543 | Bacteria | 7081 |
| 145 | Ga0070672_100041283 | 3300005543 | Bacteria | 3546 |
| 146 | Ga0070672_100059469 | 3300005543 | Bacteria | 3007 |
| 147 | Ga0070672_100071745 | 3300005543 | Bacteria | 2756 |
| 148 | Ga0070672_100131740 | 3300005543 | Bacteria | 2056 |
| 149 | Ga0070672_100375143 | 3300005543 | Unclassified | 1216 |
| 150 | Ga0070686_100001675 | 3300005544 | Bacteria | 12379 |
| 151 | Ga0070686_100059723 | 3300005544 | Bacteria | 2458 |
| 152 | Ga0070686_100239490 | 3300005544 | Bacteria | 1320 |
| 153 | Ga0070686_100260650 | 3300005544 | Unclassified | 1270 |
| 154 | Ga0070695_100008485 | 3300005545 | Bacteria | 6097 |
| 155 | Ga0070695_100009406 | 3300005545 | Bacteria | 5818 |
| 156 | Ga0070696_100003384 | 3300005546 | Bacteria | 10639 |
| 157 | Ga0070665_100007069 | 3300005548 | Bacteria | 11406 |
| 158 | Ga0070665_100010348 | 3300005548 | Bacteria | 9437 |
| 159 | Ga0070665_100021222 | 3300005548 | Bacteria | 6530 |
| 160 | Ga0070665_100029355 | 3300005548 | Bacteria | 5536 |
| 161 | Ga0070665_100102541 | 3300005548 | Bacteria | 2865 |
| 162 | Ga0070704_100006916 | 3300005549 | Bacteria | 6722 |
| 163 | Ga0070704_100040203 | 3300005549 | Bacteria | 3217 |
| 164 | Ga0070704_100544741 | 3300005549 | Bacteria | 1013 |
| 165 | Ga0068855_100007793 | 3300005563 | Bacteria | 12935 |
| 166 | Ga0068855_100012889 | 3300005563 | Bacteria | 10088 |
| 167 | Ga0068855_100030751 | 3300005563 | Bacteria | 6420 |
| 168 | Ga0068855_100044437 | 3300005563 | Bacteria | 5257 |
| 169 | Ga0068855_100074228 | 3300005563 | Bacteria | 3951 |
| 170 | Ga0068855_100335425 | 3300005563 | Bacteria | 1668 |
| 171 | Ga0068855_100420699 | 3300005563 | Bacteria | 1461 |
| 172 | Ga0068855_100532751 | 3300005563 | Bacteria | 1273 |
| 173 | Ga0070664_100033375 | 3300005564 | Bacteria | 4311 |
| 174 | Ga0070664_100076552 | 3300005564 | Bacteria | 2875 |
| 175 | Ga0070664_100102732 | 3300005564 | Bacteria | 2487 |
| 176 | Ga0070664_100275424 | 3300005564 | Bacteria | 1517 |
| 177 | Ga0070664_100331499 | 3300005564 | Bacteria | 1381 |
| 178 | Ga0068857_100000140 | 3300005577 | Bacteria | 44560 |
| 179 | Ga0068857_100005615 | 3300005577 | Bacteria | 10721 |
| 180 | Ga0068857_100058312 | 3300005577 | Bacteria | 3428 |
| 181 | Ga0068857_100143048 | 3300005577 | Bacteria | 2163 |
| 182 | Ga0068857_100178770 | 3300005577 | Bacteria | 1931 |
| 183 | Ga0068857_100196014 | 3300005577 | Unclassified | 1840 |
| 184 | Ga0068854_100007348 | 3300005578 | Bacteria | 7042 |
| 185 | Ga0068854_101132198 | 3300005578 | Bacteria | 698 |
| 186 | Ga0068856_100001686 | 3300005614 | Bacteria | 23098 |
| 187 | Ga0068856_100007046 | 3300005614 | Bacteria | 10979 |
| 188 | Ga0068856_100008482 | 3300005614 | Bacteria | 9998 |
| 189 | Ga0068856_100027094 | 3300005614 | Bacteria | 5591 |
| 190 | Ga0068856_100037209 | 3300005614 | Bacteria | 4775 |
| 191 | Ga0070702_100049489 | 3300005615 | Bacteria | 2397 |
| 192 | Ga0070702_100085703 | 3300005615 | Bacteria | 1898 |
| 193 | Ga0068852_100019346 | 3300005616 | Bacteria | 5387 |
| 194 | Ga0068852_100039063 | 3300005616 | Bacteria | 3994 |
| 195 | Ga0068852_100051399 | 3300005616 | Bacteria | 3536 |
| 196 | Ga0068852_100263544 | 3300005616 | Bacteria | 1656 |
| 197 | Ga0068852_100350648 | 3300005616 | Bacteria | 1441 |
| 198 | Ga0068859_100101925 | 3300005617 | Bacteria | 2928 |
| 199 | Ga0068859_100144097 | 3300005617 | Bacteria | 2456 |
| 200 | Ga0068859_100163942 | 3300005617 | Bacteria | 2302 |
| 201 | Ga0068859_100165294 | 3300005617 | Unclassified | 2293 |
| 202 | Ga0068859_100313512 | 3300005617 | Bacteria | 1662 |
| 203 | Ga0068859_100387334 | 3300005617 | Bacteria | 1493 |
| 204 | Ga0068859_100771503 | 3300005617 | Bacteria | 1050 |
| 205 | Ga0068859_100878535 | 3300005617 | Unclassified | 982 |
| 206 | Ga0068864_100001542 | 3300005618 | Bacteria | 18982 |
| 207 | Ga0068864_100010274 | 3300005618 | Bacteria | 7730 |
| 208 | Ga0068864_100036627 | 3300005618 | Bacteria | 4182 |
| 209 | Ga0068864_100105908 | 3300005618 | Bacteria | 2500 |
| 210 | Ga0068864_100118658 | 3300005618 | Bacteria | 2362 |
| 211 | Ga0068864_100330916 | 3300005618 | Bacteria | 1433 |
| 212 | Ga0068866_10049908 | 3300005718 | Bacteria | 2123 |
| 213 | Ga0068866_10053303 | 3300005718 | Bacteria | 2068 |
| 214 | Ga0068866_10186674 | 3300005718 | Bacteria | 1229 |
| 215 | Ga0068861_100002259 | 3300005719 | Bacteria | 12518 |
| 216 | Ga0068851_10104343 | 3300005834 | Bacteria | 1507 |
| 217 | Ga0068870_10352117 | 3300005840 | Unclassified | 945 |
| 218 | Ga0068863_100012751 | 3300005841 | Bacteria | 8106 |
| 219 | Ga0068863_100185167 | 3300005841 | Bacteria | 2000 |
| 220 | Ga0068863_100211499 | 3300005841 | Bacteria | 1868 |
| 221 | Ga0068863_100218802 | 3300005841 | Bacteria | 1834 |
| 222 | Ga0068863_100270463 | 3300005841 | Bacteria | 1645 |
| 223 | Ga0068863_100609713 | 3300005841 | Bacteria | 1081 |
| 224 | Ga0068858_100004349 | 3300005842 | Bacteria | 13898 |
| 225 | Ga0068858_100011282 | 3300005842 | Bacteria | 8444 |
| 226 | Ga0068858_100021863 | 3300005842 | Bacteria | 5975 |
| 227 | Ga0068858_100038496 | 3300005842 | Bacteria | 4436 |
| 228 | Ga0068858_100164305 | 3300005842 | Bacteria | 2091 |
| 229 | Ga0068858_100472100 | 3300005842 | Unclassified | 1210 |
| 230 | Ga0068858_100497379 | 3300005842 | Bacteria | 1178 |
| 231 | Ga0068858_100517341 | 3300005842 | Bacteria | 1154 |
| 232 | Ga0068860_100016894 | 3300005843 | Bacteria | 7113 |
| 233 | Ga0068860_100034259 | 3300005843 | Bacteria | 4869 |
| 234 | Ga0068860_100135286 | 3300005843 | Bacteria | 2366 |
| 235 | Ga0068860_100307996 | 3300005843 | Bacteria | 1553 |
| 236 | Ga0068860_100736475 | 3300005843 | Bacteria | 997 |
| 237 | Ga0068862_100016562 | 3300005844 | Bacteria | 6138 |
| 238 | Ga0081455_10038869 | 3300005937 | Bacteria | 4211 |
| 239 | Ga0081539_10001115 | 3300005985 | Bacteria | 48750 |
| 240 | Ga0070717_10310124 | 3300006028 | Unclassified | 1404 |
| 241 | Ga0075432_10031491 | 3300006058 | Bacteria | 1836 |
| 242 | Ga0070716_100103215 | 3300006173 | Bacteria | 1752 |
| 243 | Ga0070712_100447262 | 3300006175 | Unclassified | 1075 |
| 244 | Ga0097621_100004607 | 3300006237 | Bacteria | 9626 |
| 245 | Ga0097621_100013094 | 3300006237 | Bacteria | 6169 |
| 246 | Ga0097621_100023848 | 3300006237 | Bacteria | 4769 |
| 247 | Ga0097621_100035520 | 3300006237 | Bacteria | 3984 |
| 248 | Ga0097621_100060328 | 3300006237 | Bacteria | 3109 |
| 249 | Ga0097621_100061343 | 3300006237 | Bacteria | 3084 |
| 250 | Ga0097621_100063563 | 3300006237 | Bacteria | 3034 |
| 251 | Ga0097621_100096644 | 3300006237 | Bacteria | 2479 |
| 252 | Ga0097621_100130582 | 3300006237 | Bacteria | 2138 |
| 253 | Ga0097621_100188471 | 3300006237 | Bacteria | 1785 |
| 254 | Ga0097621_100215887 | 3300006237 | Unclassified | 1670 |
| 255 | Ga0097621_100724865 | 3300006237 | Bacteria | 917 |
| 256 | Ga0068871_100001350 | 3300006358 | Bacteria | 16430 |
| 257 | Ga0068871_100007041 | 3300006358 | Bacteria | 8010 |
| 258 | Ga0068871_100017256 | 3300006358 | Bacteria | 5458 |
| 259 | Ga0068871_100025965 | 3300006358 | Bacteria | 4565 |
| 260 | Ga0068871_100029917 | 3300006358 | Bacteria | 4283 |
| 261 | Ga0068871_100053174 | 3300006358 | Bacteria | 3281 |
| 262 | Ga0068871_100078682 | 3300006358 | Bacteria | 2727 |
| 263 | Ga0068871_100185633 | 3300006358 | Bacteria | 1789 |
| 264 | Ga0068871_100257787 | 3300006358 | Bacteria | 1520 |
| 265 | Ga0068871_100284165 | 3300006358 | Bacteria | 1448 |
| 266 | Ga0068871_100389282 | 3300006358 | Bacteria | 1240 |
| 267 | Ga0068871_100422843 | 3300006358 | Bacteria | 1190 |
| 268 | Ga0068871_100486896 | 3300006358 | Unclassified | 1110 |
| 269 | Ga0068871_100553773 | 3300006358 | Bacteria | 1042 |
| 270 | Ga0068871_100641512 | 3300006358 | Bacteria | 969 |
| 271 | Ga0075428_100370104 | 3300006844 | Bacteria | 1537 |
| 272 | Ga0075428_100418509 | 3300006844 | Bacteria | 1436 |
| 273 | Ga0075430_100316901 | 3300006846 | Bacteria | 1289 |
| 274 | Ga0075433_10010820 | 3300006852 | Bacteria | 7339 |
| 275 | Ga0075433_10161770 | 3300006852 | Bacteria | 1993 |
| 276 | Ga0075433_10254460 | 3300006852 | Unclassified | 1558 |
| 277 | Ga0075434_100002366 | 3300006871 | Bacteria | 16529 |
| 278 | Ga0075434_100019226 | 3300006871 | Bacteria | 6608 |
| 279 | Ga0075434_100043081 | 3300006871 | Bacteria | 4475 |
| 280 | Ga0075434_100105312 | 3300006871 | Bacteria | 2831 |
| 281 | Ga0075434_100202206 | 3300006871 | Bacteria | 2007 |
| 282 | Ga0075434_100204691 | 3300006871 | Bacteria | 1994 |
| 283 | Ga0068865_100036588 | 3300006881 | Bacteria | 3310 |
| 284 | Ga0068865_100161574 | 3300006881 | Bacteria | 1709 |
| 285 | Ga0068865_100202453 | 3300006881 | Bacteria | 1542 |
| 286 | Ga0068865_100312243 | 3300006881 | Bacteria | 1262 |
| 287 | Ga0068865_100454629 | 3300006881 | Bacteria | 1060 |
| 288 | Ga0075436_100000845 | 3300006914 | Bacteria | 20351 |
| 289 | Ga0075436_100020389 | 3300006914 | Bacteria | 4550 |
| 290 | Ga0097620_100101926 | 3300006931 | Bacteria | 2928 |
| 291 | Ga0097620_100144096 | 3300006931 | Bacteria | 2456 |
| 292 | Ga0097620_100163958 | 3300006931 | Bacteria | 2302 |
| 293 | Ga0097620_100165304 | 3300006931 | Unclassified | 2293 |
| 294 | Ga0097620_100313508 | 3300006931 | Bacteria | 1662 |
| 295 | Ga0097620_100387314 | 3300006931 | Bacteria | 1493 |
| 296 | Ga0097620_100771408 | 3300006931 | Bacteria | 1050 |
| 297 | Ga0097620_100878636 | 3300006931 | Unclassified | 982 |
| 298 | Ga0075435_100000049 | 3300007076 | Bacteria | 60558 |
| 299 | Ga0075435_100034583 | 3300007076 | Bacteria | 4005 |
| 300 | Ga0075435_100111517 | 3300007076 | Bacteria | 2275 |
| 301 | Ga0099794_10094612 | 3300007265 | Bacteria | 1486 |
| 302 | Ga0099794_10162469 | 3300007265 | Bacteria | 1136 |
| 303 | Ga0105251_10036066 | 3300009011 | Bacteria | 2436 |
| 304 | Ga0105240_10004847 | 3300009093 | Bacteria | 20272 |
| 305 | Ga0105240_10007712 | 3300009093 | Bacteria | 15573 |
| 306 | Ga0105240_10021843 | 3300009093 | Bacteria | 8503 |
| 307 | Ga0105240_10110957 | 3300009093 | Bacteria | 3319 |
| 308 | Ga0105240_10209777 | 3300009093 | Bacteria | 2277 |
| 309 | Ga0105240_10482408 | 3300009093 | Bacteria | 1382 |
| 310 | Ga0111539_10031279 | 3300009094 | Bacteria | 6466 |
| 311 | Ga0111539_10036623 | 3300009094 | Bacteria | 5930 |
| 312 | Ga0111539_10130234 | 3300009094 | Bacteria | 2946 |
| 313 | Ga0105245_10007811 | 3300009098 | Bacteria | 9369 |
| 314 | Ga0105245_10024868 | 3300009098 | Bacteria | 5263 |
| 315 | Ga0105245_10029447 | 3300009098 | Bacteria | 4851 |
| 316 | Ga0105245_10061394 | 3300009098 | Unclassified | 3388 |
| 317 | Ga0105245_10065868 | 3300009098 | Bacteria | 3277 |
| 318 | Ga0105245_10073044 | 3300009098 | Bacteria | 3118 |
| 319 | Ga0105245_10094515 | 3300009098 | Bacteria | 2756 |
| 320 | Ga0105245_10217847 | 3300009098 | Bacteria | 1840 |
| 321 | Ga0105245_10924920 | 3300009098 | Bacteria | 914 |
| 322 | Ga0105245_11525010 | 3300009098 | Unclassified | 719 |
| 323 | Ga0105247_10037295 | 3300009101 | Bacteria | 2966 |
| 324 | Ga0105247_10075715 | 3300009101 | Bacteria | 2112 |
| 325 | Ga0105247_10076887 | 3300009101 | Bacteria | 2097 |
| 326 | Ga0105247_10116754 | 3300009101 | Bacteria | 1724 |
| 327 | Ga0114129_10000192 | 3300009147 | Bacteria | 68551 |
| 328 | Ga0114129_10003382 | 3300009147 | Bacteria | 22409 |
| 329 | Ga0114129_10010507 | 3300009147 | Bacteria | 13207 |
| 330 | Ga0114129_10013092 | 3300009147 | Bacteria | 11816 |
| 331 | Ga0114129_10014797 | 3300009147 | Bacteria | 11115 |
| 332 | Ga0114129_10053098 | 3300009147 | Bacteria | 5684 |
| 333 | Ga0114129_10152679 | 3300009147 | Bacteria | 3160 |
| 334 | Ga0114129_10430983 | 3300009147 | Bacteria | 1732 |
| 335 | Ga0114129_10732004 | 3300009147 | Bacteria | 1268 |
| 336 | Ga0105241_10001620 | 3300009174 | Bacteria | 17161 |
| 337 | Ga0105241_10017463 | 3300009174 | Bacteria | 5276 |
| 338 | Ga0105241_10135675 | 3300009174 | Bacteria | 1998 |
| 339 | Ga0105241_10191243 | 3300009174 | Bacteria | 1704 |
| 340 | Ga0105241_10204145 | 3300009174 | Bacteria | 1652 |
| 341 | Ga0105241_10255154 | 3300009174 | Bacteria | 1488 |
| 342 | Ga0105241_10515283 | 3300009174 | Bacteria | 1069 |
| 343 | Ga0105242_10008421 | 3300009176 | Bacteria | 7927 |
| 344 | Ga0105242_10024145 | 3300009176 | Bacteria | 4799 |
| 345 | Ga0105242_10027094 | 3300009176 | Bacteria | 4547 |
| 346 | Ga0105242_10038927 | 3300009176 | Bacteria | 3827 |
| 347 | Ga0105242_10041151 | 3300009176 | Unclassified | 3726 |
| 348 | Ga0105242_10064466 | 3300009176 | Bacteria | 3021 |
| 349 | Ga0105242_10066002 | 3300009176 | Bacteria | 2987 |
| 350 | Ga0105242_10090102 | 3300009176 | Bacteria | 2579 |
| 351 | Ga0105242_10094988 | 3300009176 | Bacteria | 2516 |
| 352 | Ga0105242_10231228 | 3300009176 | Bacteria | 1657 |
| 353 | Ga0105242_10371435 | 3300009176 | Bacteria | 1327 |
| 354 | Ga0105242_10467149 | 3300009176 | Bacteria | 1193 |
| 355 | Ga0105248_10008123 | 3300009177 | Bacteria | 11521 |
| 356 | Ga0105248_10019058 | 3300009177 | Bacteria | 7587 |
| 357 | Ga0105248_10023159 | 3300009177 | Bacteria | 6897 |
| 358 | Ga0105248_10025953 | 3300009177 | Bacteria | 6516 |
| 359 | Ga0105248_10034550 | 3300009177 | Bacteria | 5654 |
| 360 | Ga0105248_10061700 | 3300009177 | Bacteria | 4210 |
| 361 | Ga0105248_10099460 | 3300009177 | Bacteria | 3278 |
| 362 | Ga0105248_10104301 | 3300009177 | Bacteria | 3196 |
| 363 | Ga0105248_10106005 | 3300009177 | Unclassified | 3169 |
| 364 | Ga0105248_10107375 | 3300009177 | Bacteria | 3148 |
| 365 | Ga0105248_10144329 | 3300009177 | Bacteria | 2686 |
| 366 | Ga0105248_10144410 | 3300009177 | Bacteria | 2685 |
| 367 | Ga0105248_10149963 | 3300009177 | Bacteria | 2631 |
| 368 | Ga0105248_10216135 | 3300009177 | Bacteria | 2159 |
| 369 | Ga0105248_10432657 | 3300009177 | Bacteria | 1482 |
| 370 | Ga0105248_10631121 | 3300009177 | Unclassified | 1209 |
| 371 | Ga0105237_10007273 | 3300009545 | Bacteria | 12148 |
| 372 | Ga0105237_10024541 | 3300009545 | Bacteria | 6166 |
| 373 | Ga0105237_10025726 | 3300009545 | Bacteria | 6017 |
| 374 | Ga0105237_10034903 | 3300009545 | Bacteria | 5090 |
| 375 | Ga0105237_10112639 | 3300009545 | Bacteria | 2713 |
| 376 | Ga0105237_10190872 | 3300009545 | Bacteria | 2049 |
| 377 | Ga0105238_10002113 | 3300009551 | Bacteria | 20072 |
| 378 | Ga0105238_10013430 | 3300009551 | Bacteria | 8268 |
| 379 | Ga0105238_10020407 | 3300009551 | Bacteria | 6746 |
| 380 | Ga0105238_10036354 | 3300009551 | Bacteria | 5006 |
| 381 | Ga0105238_10037736 | 3300009551 | Bacteria | 4911 |
| 382 | Ga0105238_10095132 | 3300009551 | Unclassified | 2966 |
| 383 | Ga0105238_10115319 | 3300009551 | Bacteria | 2666 |
| 384 | Ga0105238_10158723 | 3300009551 | Bacteria | 2237 |
| 385 | Ga0105238_10537118 | 3300009551 | Bacteria | 1173 |
| 386 | Ga0105238_10541319 | 3300009551 | Bacteria | 1168 |
| 387 | Ga0105249_10622019 | 3300009553 | Bacteria | 1136 |
| 388 | Ga0105239_10003025 | 3300010375 | Bacteria | 20951 |
| 389 | Ga0105239_10003955 | 3300010375 | Bacteria | 17955 |
| 390 | Ga0105239_10006171 | 3300010375 | Bacteria | 13947 |
| 391 | Ga0105239_10017693 | 3300010375 | Bacteria | 7886 |
| 392 | Ga0105239_10025750 | 3300010375 | Bacteria | 6479 |
| 393 | Ga0105239_10026079 | 3300010375 | Bacteria | 6434 |
| 394 | Ga0105239_10232058 | 3300010375 | Unclassified | 2070 |
| 395 | Ga0105239_10307549 | 3300010375 | Bacteria | 1786 |
| 396 | Ga0105239_10659135 | 3300010375 | Unclassified | 1196 |
| 397 | Ga0105239_11154906 | 3300010375 | Unclassified | 892 |
| 398 | Ga0105246_10034267 | 3300011119 | Bacteria | 3381 |
| 399 | Ga0105246_10231297 | 3300011119 | Bacteria | 1456 |
| 400 | Ga0105246_10251419 | 3300011119 | Bacteria | 1403 |
| 401 | Ga0105246_10384882 | 3300011119 | Unclassified | 1160 |
| 402 | Ga0157373_10045002 | 3300013100 | Bacteria | 3151 |
| 403 | Ga0157373_10127677 | 3300013100 | Unclassified | 1788 |
| 404 | Ga0157370_10004304 | 3300013104 | Bacteria | 16362 |
| 405 | Ga0157370_10033774 | 3300013104 | Bacteria | 4986 |
| 406 | Ga0157370_10087583 | 3300013104 | Bacteria | 2925 |
| 407 | Ga0157370_10089626 | 3300013104 | Bacteria | 2889 |
| 408 | Ga0157370_10094424 | 3300013104 | Bacteria | 2806 |
| 409 | Ga0157370_10159570 | 3300013104 | Bacteria | 2099 |
| 410 | Ga0157369_10002200 | 3300013105 | Bacteria | 23482 |
| 411 | Ga0157369_10011678 | 3300013105 | Bacteria | 9974 |
| 412 | Ga0157369_10028240 | 3300013105 | Bacteria | 6210 |
| 413 | Ga0157369_10139287 | 3300013105 | Bacteria | 2568 |
| 414 | Ga0157369_10334768 | 3300013105 | Bacteria | 1572 |
| 415 | Ga0157369_10566498 | 3300013105 | Unclassified | 1173 |
| 416 | Ga0157374_10016699 | 3300013296 | Bacteria | 6457 |
| 417 | Ga0157374_10027745 | 3300013296 | Bacteria | 5112 |
| 418 | Ga0157374_10054140 | 3300013296 | Bacteria | 3742 |
| 419 | Ga0157374_10055562 | 3300013296 | Bacteria | 3695 |
| 420 | Ga0157374_10243246 | 3300013296 | Bacteria | 1770 |
| 421 | Ga0157374_10330078 | 3300013296 | Bacteria | 1513 |
| 422 | Ga0157374_10479276 | 3300013296 | Bacteria | 1247 |
| 423 | Ga0157374_10480094 | 3300013296 | Bacteria | 1246 |
| 424 | Ga0157378_10043754 | 3300013297 | Bacteria | 3976 |
| 425 | Ga0157378_10222943 | 3300013297 | Bacteria | 1793 |
| 426 | Ga0157378_10258108 | 3300013297 | Bacteria | 1671 |
| 427 | Ga0157378_10419759 | 3300013297 | Bacteria | 1322 |
| 428 | Ga0157378_10584808 | 3300013297 | Bacteria | 1126 |
| 429 | Ga0163162_10009499 | 3300013306 | Bacteria | 9459 |
| 430 | Ga0163162_10065289 | 3300013306 | Bacteria | 3686 |
| 431 | Ga0163162_10079451 | 3300013306 | Unclassified | 3347 |
| 432 | Ga0163162_10150427 | 3300013306 | Bacteria | 2445 |
| 433 | Ga0163162_10151980 | 3300013306 | Bacteria | 2433 |
| 434 | Ga0163162_10516220 | 3300013306 | Bacteria | 1325 |
| 435 | Ga0163162_10891659 | 3300013306 | Unclassified | 1003 |
| 436 | Ga0163162_10936540 | 3300013306 | Bacteria | 978 |
| 437 | Ga0157372_10039627 | 3300013307 | Bacteria | 5200 |
| 438 | Ga0157372_10125659 | 3300013307 | Bacteria | 2949 |
| 439 | Ga0157372_10168916 | 3300013307 | Bacteria | 2530 |
| 440 | Ga0157372_10195057 | 3300013307 | Bacteria | 2346 |
| 441 | Ga0157372_10351448 | 3300013307 | Unclassified | 1717 |
| 442 | Ga0157372_10412866 | 3300013307 | Bacteria | 1573 |
| 443 | Ga0157372_10614681 | 3300013307 | Bacteria | 1267 |
| 444 | Ga0157375_10052063 | 3300013308 | Bacteria | 4023 |
| 445 | Ga0157375_10076661 | 3300013308 | Bacteria | 3371 |
| 446 | Ga0157375_10143279 | 3300013308 | Bacteria | 2518 |
| 447 | Ga0157375_10186969 | 3300013308 | Unclassified | 2225 |
| 448 | Ga0157375_10205552 | 3300013308 | Bacteria | 2125 |
| 449 | Ga0157375_10454423 | 3300013308 | Bacteria | 1446 |
| 450 | Ga0163163_10008779 | 3300014325 | Bacteria | 8996 |
| 451 | Ga0163163_10026375 | 3300014325 | Bacteria | 5553 |
| 452 | Ga0163163_10038709 | 3300014325 | Bacteria | 4648 |
| 453 | Ga0163163_10157127 | 3300014325 | Bacteria | 2318 |
| 454 | Ga0163163_10157701 | 3300014325 | Bacteria | 2314 |
| 455 | Ga0163163_10198116 | 3300014325 | Unclassified | 2056 |
| 456 | Ga0163163_10237487 | 3300014325 | Bacteria | 1872 |
| 457 | Ga0163163_10270332 | 3300014325 | Bacteria | 1751 |
| 458 | Ga0163163_10284719 | 3300014325 | Bacteria | 1705 |
| 459 | Ga0163163_10336922 | 3300014325 | Unclassified | 1563 |
| 460 | Ga0163163_10692323 | 3300014325 | Bacteria | 1083 |
| 461 | Ga0157380_10048468 | 3300014326 | Bacteria | 3346 |
| 462 | Ga0157380_10157829 | 3300014326 | Bacteria | 1968 |
| 463 | Ga0157380_10180817 | 3300014326 | Bacteria | 1853 |
| 464 | Ga0157380_10481777 | 3300014326 | Bacteria | 1200 |
| 465 | Ga0157380_10556060 | 3300014326 | Bacteria | 1127 |
| 466 | Ga0157377_10075853 | 3300014745 | Bacteria | 1954 |
| 467 | Ga0157377_10130799 | 3300014745 | Unclassified | 1533 |
| 468 | Ga0157377_10152001 | 3300014745 | Bacteria | 1432 |
| 469 | Ga0157377_10256946 | 3300014745 | Bacteria | 1135 |
| 470 | Ga0157379_10006149 | 3300014968 | Bacteria | 10336 |
| 471 | Ga0157379_10030148 | 3300014968 | Bacteria | 4825 |
| 472 | Ga0157379_10039036 | 3300014968 | Bacteria | 4236 |
| 473 | Ga0157379_10044354 | 3300014968 | Bacteria | 3969 |
| 474 | Ga0157379_10116210 | 3300014968 | Bacteria | 2406 |
| 475 | Ga0157379_10196317 | 3300014968 | Bacteria | 1824 |
| 476 | Ga0157379_10355793 | 3300014968 | Unclassified | 1341 |
| 477 | Ga0157376_10031726 | 3300014969 | Bacteria | 4235 |
| 478 | Ga0157376_10060945 | 3300014969 | Bacteria | 3171 |
| 479 | Ga0157376_10089594 | 3300014969 | Bacteria | 2660 |
| 480 | Ga0157376_10540897 | 3300014969 | Bacteria | 1151 |
| 481 | Ga0157376_10691359 | 3300014969 | Bacteria | 1024 |
| 482 | Ga0157376_10832203 | 3300014969 | Unclassified | 937 |
| 483 | Ga0163161_10015750 | 3300017792 | Bacteria | 5273 |
| 484 | Ga0163161_10122648 | 3300017792 | Bacteria | 1954 |
| 485 | Ga0163161_10296662 | 3300017792 | Bacteria | 1272 |
| 486 | Ga0197907_10262591 | 3300020069 | Bacteria | 922 |
| 487 | Ga0197907_10535074 | 3300020069 | Bacteria | 1342 |
| 488 | Ga0197907_10885219 | 3300020069 | Unclassified | 1432 |
| 489 | Ga0206355_1158864 | 3300020076 | Unclassified | 847 |
| 490 | Ga0206355_1228848 | 3300020076 | Unclassified | 1104 |
| 491 | Ga0206351_11005059 | 3300020077 | Unclassified | 1126 |
| 492 | Ga0206352_10772431 | 3300020078 | Bacteria | 1394 |
| 493 | Ga0206350_10371091 | 3300020080 | Bacteria | 2715 |
| 494 | Ga0206350_10759031 | 3300020080 | Bacteria | 3422 |
| 495 | Ga0206354_11177288 | 3300020081 | Bacteria | 2415 |
| 496 | Ga0154015_1650422 | 3300020610 | Unclassified | 1652 |
| 497 | Ga0213873_10077771 | 3300021358 | Unclassified | 924 |
| 498 | Ga0213872_10000098 | 3300021361 | Bacteria | 80168 |
| 499 | Ga0213872_10052106 | 3300021361 | Bacteria | 1857 |
| 500 | Ga0213876_10007922 | 3300021384 | Bacteria | 5765 |
| 501 | Ga0213876_10023885 | 3300021384 | Unclassified | 3227 |
| 502 | Ga0213875_10000004 | 3300021388 | Bacteria | 703388 |
| 503 | Ga0213875_10003648 | 3300021388 | Bacteria | 8699 |
| 504 | Ga0213875_10018084 | 3300021388 | Bacteria | 3401 |
| 505 | Ga0213875_10045841 | 3300021388 | Bacteria | 2052 |
| 506 | Ga0213875_10078637 | 3300021388 | Bacteria | 1538 |
| 507 | Ga0213871_10010350 | 3300021441 | Unclassified | 2113 |
| 508 | Ga0213871_10107163 | 3300021441 | Unclassified | 823 |
| 509 | Ga0224712_10002723 | 3300022467 | Bacteria | 4436 |
| 510 | Ga0224712_10011276 | 3300022467 | Bacteria | 2767 |
| 511 | Ga0224712_10017575 | 3300022467 | Bacteria | 2374 |
| 512 | Ga0224712_10073324 | 3300022467 | Bacteria | 1396 |
| 513 | Ga0207697_10049223 | 3300025315 | Bacteria | 1739 |
| 514 | Ga0207656_10109387 | 3300025321 | Bacteria | 1275 |
| 515 | Ga0207713_1074928 | 3300025735 | Bacteria | 1236 |
| 516 | Ga0207642_10034164 | 3300025899 | Bacteria | 2159 |
| 517 | Ga0207642_10036209 | 3300025899 | Bacteria | 2116 |
| 518 | Ga0207642_10133026 | 3300025899 | Unclassified | 1301 |
| 519 | Ga0207642_10141525 | 3300025899 | Bacteria | 1269 |
| 520 | Ga0207710_10008073 | 3300025900 | Bacteria | 4447 |
| 521 | Ga0207710_10181472 | 3300025900 | Unclassified | 1033 |
| 522 | Ga0207710_10242906 | 3300025900 | Bacteria | 899 |
| 523 | Ga0207680_10005064 | 3300025903 | Bacteria | 6276 |
| 524 | Ga0207680_10056770 | 3300025903 | Bacteria | 2366 |
| 525 | Ga0207680_10129135 | 3300025903 | Bacteria | 1663 |
| 526 | Ga0207680_10144715 | 3300025903 | Bacteria | 1579 |
| 527 | Ga0207680_10363896 | 3300025903 | Bacteria | 1017 |
| 528 | Ga0207647_10171237 | 3300025904 | Bacteria | 1264 |
| 529 | Ga0207699_10033735 | 3300025906 | Bacteria | 2896 |
| 530 | Ga0207699_10115310 | 3300025906 | Bacteria | 1728 |
| 531 | Ga0207699_10132908 | 3300025906 | Bacteria | 1625 |
| 532 | Ga0207645_10006889 | 3300025907 | Bacteria | 8105 |
| 533 | Ga0207645_10082497 | 3300025907 | Bacteria | 2061 |
| 534 | Ga0207645_10284243 | 3300025907 | Bacteria | 1099 |
| 535 | Ga0207654_10024609 | 3300025911 | Unclassified | 3239 |
| 536 | Ga0207654_10032844 | 3300025911 | Bacteria | 2872 |
| 537 | Ga0207654_10176043 | 3300025911 | Bacteria | 1393 |
| 538 | Ga0207654_10711013 | 3300025911 | Bacteria | 722 |
| 539 | Ga0207707_10003371 | 3300025912 | Bacteria | 14182 |
| 540 | Ga0207707_10082938 | 3300025912 | Bacteria | 2799 |
| 541 | Ga0207707_10161821 | 3300025912 | Bacteria | 1957 |
| 542 | Ga0207707_10241681 | 3300025912 | Unclassified | 1570 |
| 543 | Ga0207707_10955689 | 3300025912 | Bacteria | 705 |
| 544 | Ga0207695_10001831 | 3300025913 | Bacteria | 33414 |
| 545 | Ga0207695_10016736 | 3300025913 | Bacteria | 8564 |
| 546 | Ga0207695_10050165 | 3300025913 | Bacteria | 4393 |
| 547 | Ga0207695_10310186 | 3300025913 | Bacteria | 1468 |
| 548 | Ga0207695_10418306 | 3300025913 | Bacteria | 1224 |
| 549 | Ga0207695_10522086 | 3300025913 | Unclassified | 1069 |
| 550 | Ga0207671_10005457 | 3300025914 | Bacteria | 11704 |
| 551 | Ga0207671_10064566 | 3300025914 | Bacteria | 2722 |
| 552 | Ga0207671_10141844 | 3300025914 | Bacteria | 1851 |
| 553 | Ga0207671_10161252 | 3300025914 | Bacteria | 1737 |
| 554 | Ga0207671_10178827 | 3300025914 | Bacteria | 1650 |
| 555 | Ga0207671_10557083 | 3300025914 | Unclassified | 914 |
| 556 | Ga0207693_10312066 | 3300025915 | Bacteria | 1231 |
| 557 | Ga0207693_10385798 | 3300025915 | Unclassified | 1095 |
| 558 | Ga0207663_10101302 | 3300025916 | Bacteria | 1935 |
| 559 | Ga0207663_10139732 | 3300025916 | Bacteria | 1685 |
| 560 | Ga0207660_10218412 | 3300025917 | Bacteria | 1495 |
| 561 | Ga0207660_10385438 | 3300025917 | Unclassified | 1127 |
| 562 | Ga0207662_10009816 | 3300025918 | Bacteria | 5282 |
| 563 | Ga0207662_10151540 | 3300025918 | Bacteria | 1475 |
| 564 | Ga0207657_10003226 | 3300025919 | Bacteria | 17465 |
| 565 | Ga0207657_10003464 | 3300025919 | Bacteria | 16835 |
| 566 | Ga0207657_10034462 | 3300025919 | Bacteria | 4551 |
| 567 | Ga0207657_10110107 | 3300025919 | Bacteria | 2275 |
| 568 | Ga0207657_10132777 | 3300025919 | Unclassified | 2039 |
| 569 | Ga0207657_10347574 | 3300025919 | Unclassified | 1170 |
| 570 | Ga0207649_10058629 | 3300025920 | Bacteria | 2412 |
| 571 | Ga0207649_10078412 | 3300025920 | Bacteria | 2131 |
| 572 | Ga0207649_10142316 | 3300025920 | Bacteria | 1643 |
| 573 | Ga0207649_10147786 | 3300025920 | Bacteria | 1615 |
| 574 | Ga0207652_10220426 | 3300025921 | Bacteria | 1709 |
| 575 | Ga0207652_10622320 | 3300025921 | Bacteria | 967 |
| 576 | Ga0207646_10118398 | 3300025922 | Bacteria | 2379 |
| 577 | Ga0207646_10179203 | 3300025922 | Bacteria | 1914 |
| 578 | Ga0207646_10197631 | 3300025922 | Bacteria | 1816 |
| 579 | Ga0207681_10002032 | 3300025923 | Bacteria | 13000 |
| 580 | Ga0207681_10020141 | 3300025923 | Bacteria | 4223 |
| 581 | Ga0207681_10028887 | 3300025923 | Bacteria | 3596 |
| 582 | Ga0207681_10175423 | 3300025923 | Bacteria | 1628 |
| 583 | Ga0207681_10418612 | 3300025923 | Bacteria | 1085 |
| 584 | Ga0207694_10006985 | 3300025924 | Bacteria | 8570 |
| 585 | Ga0207694_10026762 | 3300025924 | Bacteria | 4391 |
| 586 | Ga0207694_10046060 | 3300025924 | Bacteria | 3370 |
| 587 | Ga0207694_10146750 | 3300025924 | Bacteria | 1899 |
| 588 | Ga0207694_10148879 | 3300025924 | Bacteria | 1885 |
| 589 | Ga0207650_10085653 | 3300025925 | Unclassified | 2398 |
| 590 | Ga0207650_10228674 | 3300025925 | Bacteria | 1499 |
| 591 | Ga0207650_10365912 | 3300025925 | Bacteria | 1189 |
| 592 | Ga0207659_10000830 | 3300025926 | Bacteria | 18334 |
| 593 | Ga0207659_10009600 | 3300025926 | Bacteria | 6053 |
| 594 | Ga0207659_10028750 | 3300025926 | Bacteria | 3780 |
| 595 | Ga0207659_10047946 | 3300025926 | Bacteria | 3024 |
| 596 | Ga0207659_10087574 | 3300025926 | Unclassified | 2318 |
| 597 | Ga0207659_10220953 | 3300025926 | Bacteria | 1523 |
| 598 | Ga0207659_10453692 | 3300025926 | Unclassified | 1080 |
| 599 | Ga0207687_10007777 | 3300025927 | Bacteria | 7031 |
| 600 | Ga0207687_10024436 | 3300025927 | Bacteria | 4038 |
| 601 | Ga0207687_10057914 | 3300025927 | Bacteria | 2724 |
| 602 | Ga0207687_10062351 | 3300025927 | Unclassified | 2636 |
| 603 | Ga0207687_10105692 | 3300025927 | Unclassified | 2080 |
| 604 | Ga0207687_10126711 | 3300025927 | Bacteria | 1918 |
| 605 | Ga0207687_10191245 | 3300025927 | Bacteria | 1593 |
| 606 | Ga0207700_10102628 | 3300025928 | Bacteria | 2285 |
| 607 | Ga0207700_10155236 | 3300025928 | Bacteria | 1896 |
| 608 | Ga0207700_10434554 | 3300025928 | Bacteria | 1155 |
| 609 | Ga0207664_10089750 | 3300025929 | Bacteria | 2518 |
| 610 | Ga0207644_10051779 | 3300025931 | Bacteria | 2948 |
| 611 | Ga0207644_10277484 | 3300025931 | Unclassified | 1345 |
| 612 | Ga0207644_10348326 | 3300025931 | Unclassified | 1202 |
| 613 | Ga0207644_10396118 | 3300025931 | Unclassified | 1128 |
| 614 | Ga0207690_10037356 | 3300025932 | Unclassified | 3153 |
| 615 | Ga0207690_10151795 | 3300025932 | Bacteria | 1718 |
| 616 | Ga0207690_10154250 | 3300025932 | Bacteria | 1705 |
| 617 | Ga0207690_10185336 | 3300025932 | Bacteria | 1570 |
| 618 | Ga0207706_10105500 | 3300025933 | Bacteria | 2480 |
| 619 | Ga0207706_10113382 | 3300025933 | Bacteria | 2385 |
| 620 | Ga0207706_10121411 | 3300025933 | Bacteria | 2298 |
| 621 | Ga0207706_10194031 | 3300025933 | Bacteria | 1782 |
| 622 | Ga0207686_10002438 | 3300025934 | Bacteria | 10117 |
| 623 | Ga0207686_10010805 | 3300025934 | Bacteria | 4977 |
| 624 | Ga0207686_10050742 | 3300025934 | Bacteria | 2581 |
| 625 | Ga0207686_10056788 | 3300025934 | Bacteria | 2462 |
| 626 | Ga0207686_10256878 | 3300025934 | Unclassified | 1279 |
| 627 | Ga0207686_10406546 | 3300025934 | Bacteria | 1038 |
| 628 | Ga0207709_10094432 | 3300025935 | Bacteria | 1963 |
| 629 | Ga0207670_10037851 | 3300025936 | Bacteria | 3146 |
| 630 | Ga0207670_10048792 | 3300025936 | Bacteria | 2828 |
| 631 | Ga0207670_10131765 | 3300025936 | Bacteria | 1833 |
| 632 | Ga0207670_10166202 | 3300025936 | Bacteria | 1651 |
| 633 | Ga0207670_10235316 | 3300025936 | Bacteria | 1408 |
| 634 | Ga0207670_10437555 | 3300025936 | Bacteria | 1052 |
| 635 | Ga0207704_10024709 | 3300025938 | Bacteria | 3264 |
| 636 | Ga0207704_10073292 | 3300025938 | Bacteria | 2180 |
| 637 | Ga0207704_10149073 | 3300025938 | Bacteria | 1648 |
| 638 | Ga0207704_10151426 | 3300025938 | Bacteria | 1637 |
| 639 | Ga0207704_10172410 | 3300025938 | Bacteria | 1553 |
| 640 | Ga0207704_10271712 | 3300025938 | Bacteria | 1284 |
| 641 | Ga0207704_10537839 | 3300025938 | Bacteria | 948 |
| 642 | Ga0207665_10048285 | 3300025939 | Bacteria | 2856 |
| 643 | Ga0207691_10010517 | 3300025940 | Bacteria | 8880 |
| 644 | Ga0207691_10035424 | 3300025940 | Bacteria | 4633 |
| 645 | Ga0207691_10045852 | 3300025940 | Bacteria | 4018 |
| 646 | Ga0207691_10094716 | 3300025940 | Bacteria | 2671 |
| 647 | Ga0207691_10384860 | 3300025940 | Bacteria | 1197 |
| 648 | Ga0207711_10005340 | 3300025941 | Bacteria | 10896 |
| 649 | Ga0207711_10023491 | 3300025941 | Bacteria | 5162 |
| 650 | Ga0207711_10024174 | 3300025941 | Bacteria | 5086 |
| 651 | Ga0207711_10024413 | 3300025941 | Bacteria | 5065 |
| 652 | Ga0207711_10029653 | 3300025941 | Bacteria | 4616 |
| 653 | Ga0207711_10035334 | 3300025941 | Bacteria | 4235 |
| 654 | Ga0207711_10075347 | 3300025941 | Bacteria | 2937 |
| 655 | Ga0207711_10082059 | 3300025941 | Bacteria | 2818 |
| 656 | Ga0207711_10156440 | 3300025941 | Bacteria | 2060 |
| 657 | Ga0207711_10198697 | 3300025941 | Bacteria | 1829 |
| 658 | Ga0207711_10232352 | 3300025941 | Unclassified | 1689 |
| 659 | Ga0207711_10371248 | 3300025941 | Bacteria | 1327 |
| 660 | Ga0207711_10660199 | 3300025941 | Bacteria | 975 |
| 661 | Ga0207689_10008966 | 3300025942 | Bacteria | 8668 |
| 662 | Ga0207689_10169652 | 3300025942 | Bacteria | 1798 |
| 663 | Ga0207689_10262191 | 3300025942 | Bacteria | 1430 |
| 664 | Ga0207689_10378796 | 3300025942 | Unclassified | 1178 |
| 665 | Ga0207661_10009880 | 3300025944 | Bacteria | 6854 |
| 666 | Ga0207661_10045841 | 3300025944 | Unclassified | 3464 |
| 667 | Ga0207661_10049753 | 3300025944 | Bacteria | 3337 |
| 668 | Ga0207661_10071017 | 3300025944 | Bacteria | 2844 |
| 669 | Ga0207661_10214940 | 3300025944 | Bacteria | 1696 |
| 670 | Ga0207661_10305818 | 3300025944 | Bacteria | 1426 |
| 671 | Ga0207661_10330999 | 3300025944 | Bacteria | 1371 |
| 672 | Ga0207679_10018773 | 3300025945 | Bacteria | 4639 |
| 673 | Ga0207679_10161883 | 3300025945 | Bacteria | 1833 |
| 674 | Ga0207679_10181760 | 3300025945 | Unclassified | 1740 |
| 675 | Ga0207679_10219597 | 3300025945 | Bacteria | 1599 |
| 676 | Ga0207679_10288736 | 3300025945 | Bacteria | 1409 |
| 677 | Ga0207679_10404858 | 3300025945 | Bacteria | 1201 |
| 678 | Ga0207679_10505588 | 3300025945 | Bacteria | 1079 |
| 679 | Ga0207667_10014741 | 3300025949 | Bacteria | 8896 |
| 680 | Ga0207667_10017139 | 3300025949 | Bacteria | 8166 |
| 681 | Ga0207667_10025443 | 3300025949 | Bacteria | 6476 |
| 682 | Ga0207667_10046637 | 3300025949 | Bacteria | 4589 |
| 683 | Ga0207667_10060044 | 3300025949 | Bacteria | 3980 |
| 684 | Ga0207667_10520415 | 3300025949 | Bacteria | 1205 |
| 685 | Ga0207667_10767672 | 3300025949 | Unclassified | 962 |
| 686 | Ga0207651_10058060 | 3300025960 | Bacteria | 2673 |
| 687 | Ga0207651_10103263 | 3300025960 | Bacteria | 2121 |
| 688 | Ga0207651_10116157 | 3300025960 | Bacteria | 2019 |
| 689 | Ga0207651_10227188 | 3300025960 | Bacteria | 1513 |
| 690 | Ga0207651_10261659 | 3300025960 | Bacteria | 1421 |
| 691 | Ga0207651_10325704 | 3300025960 | Bacteria | 1286 |
| 692 | Ga0207712_10142152 | 3300025961 | Bacteria | 1843 |
| 693 | Ga0207712_10379942 | 3300025961 | Bacteria | 1182 |
| 694 | Ga0207712_10382393 | 3300025961 | Bacteria | 1179 |
| 695 | Ga0207668_10104956 | 3300025972 | Bacteria | 2108 |
| 696 | Ga0207668_10187607 | 3300025972 | Bacteria | 1636 |
| 697 | Ga0207668_10345098 | 3300025972 | Bacteria | 1243 |
| 698 | Ga0207640_10002390 | 3300025981 | Bacteria | 10041 |
| 699 | Ga0207640_10126542 | 3300025981 | Bacteria | 1840 |
| 700 | Ga0207640_10461805 | 3300025981 | Bacteria | 1049 |
| 701 | Ga0207658_10003889 | 3300025986 | Bacteria | 10510 |
| 702 | Ga0207658_10073501 | 3300025986 | Bacteria | 2595 |
| 703 | Ga0207658_10116923 | 3300025986 | Bacteria | 2119 |
| 704 | Ga0207677_10012475 | 3300026023 | Bacteria | 4887 |
| 705 | Ga0207677_10885422 | 3300026023 | Bacteria | 804 |
| 706 | Ga0207703_10035156 | 3300026035 | Bacteria | 3981 |
| 707 | Ga0207703_10040564 | 3300026035 | Bacteria | 3726 |
| 708 | Ga0207703_10064337 | 3300026035 | Bacteria | 3010 |
| 709 | Ga0207703_10259044 | 3300026035 | Bacteria | 1572 |
| 710 | Ga0207703_10314466 | 3300026035 | Bacteria | 1432 |
| 711 | Ga0207703_10353602 | 3300026035 | Bacteria | 1353 |
| 712 | Ga0207703_10355469 | 3300026035 | Bacteria | 1350 |
| 713 | Ga0207703_10521710 | 3300026035 | Bacteria | 1117 |
| 714 | Ga0207639_10016444 | 3300026041 | Bacteria | 5235 |
| 715 | Ga0207639_10073659 | 3300026041 | Bacteria | 2678 |
| 716 | Ga0207639_10091473 | 3300026041 | Bacteria | 2436 |
| 717 | Ga0207639_10093830 | 3300026041 | Bacteria | 2408 |
| 718 | Ga0207639_10378869 | 3300026041 | Unclassified | 1270 |
| 719 | Ga0207678_10011858 | 3300026067 | Bacteria | 7653 |
| 720 | Ga0207708_10000797 | 3300026075 | Bacteria | 23784 |
| 721 | Ga0207708_10055861 | 3300026075 | Bacteria | 3011 |
| 722 | Ga0207708_10107678 | 3300026075 | Bacteria | 2161 |
| 723 | Ga0207708_10166358 | 3300026075 | Bacteria | 1744 |
| 724 | Ga0207702_10005238 | 3300026078 | Bacteria | 11385 |
| 725 | Ga0207702_10096329 | 3300026078 | Unclassified | 2602 |
| 726 | Ga0207702_10167331 | 3300026078 | Bacteria | 2012 |
| 727 | Ga0207702_10220642 | 3300026078 | Unclassified | 1767 |
| 728 | Ga0207702_10413274 | 3300026078 | Bacteria | 1303 |
| 729 | Ga0207702_10492465 | 3300026078 | Bacteria | 1194 |
| 730 | Ga0207641_10004288 | 3300026088 | Bacteria | 12393 |
| 731 | Ga0207641_10017364 | 3300026088 | Bacteria | 5891 |
| 732 | Ga0207641_10100013 | 3300026088 | Bacteria | 2553 |
| 733 | Ga0207641_10184819 | 3300026088 | Bacteria | 1911 |
| 734 | Ga0207641_10188875 | 3300026088 | Bacteria | 1892 |
| 735 | Ga0207641_10292099 | 3300026088 | Bacteria | 1537 |
| 736 | Ga0207641_10591679 | 3300026088 | Bacteria | 1085 |
| 737 | Ga0207641_10634513 | 3300026088 | Bacteria | 1048 |
| 738 | Ga0207648_10007685 | 3300026089 | Bacteria | 10549 |
| 739 | Ga0207648_10025669 | 3300026089 | Bacteria | 5245 |
| 740 | Ga0207648_10039476 | 3300026089 | Bacteria | 4150 |
| 741 | Ga0207648_10044313 | 3300026089 | Bacteria | 3903 |
| 742 | Ga0207648_10191703 | 3300026089 | Bacteria | 1811 |
| 743 | Ga0207648_10591426 | 3300026089 | Bacteria | 1022 |
| 744 | Ga0207676_10024041 | 3300026095 | Bacteria | 4504 |
| 745 | Ga0207676_10032574 | 3300026095 | Bacteria | 3929 |
| 746 | Ga0207676_10133671 | 3300026095 | Bacteria | 2113 |
| 747 | Ga0207676_10364513 | 3300026095 | Bacteria | 1340 |
| 748 | Ga0207674_10001211 | 3300026116 | Bacteria | 33626 |
| 749 | Ga0207674_10007293 | 3300026116 | Bacteria | 12889 |
| 750 | Ga0207674_10095167 | 3300026116 | Bacteria | 2965 |
| 751 | Ga0207674_10140935 | 3300026116 | Unclassified | 2370 |
| 752 | Ga0207674_10176180 | 3300026116 | Bacteria | 2091 |
| 753 | Ga0207674_10486341 | 3300026116 | Bacteria | 1193 |
| 754 | Ga0207675_100028134 | 3300026118 | Bacteria | 5233 |
| 755 | Ga0207675_100087563 | 3300026118 | Bacteria | 2925 |
| 756 | Ga0207675_100187158 | 3300026118 | Bacteria | 1985 |
| 757 | Ga0207675_100188507 | 3300026118 | Bacteria | 1977 |
| 758 | Ga0207675_100416514 | 3300026118 | Bacteria | 1326 |
| 759 | Ga0207683_10002520 | 3300026121 | Bacteria | 15993 |
| 760 | Ga0207683_10004271 | 3300026121 | Bacteria | 12335 |
| 761 | Ga0207683_10107413 | 3300026121 | Bacteria | 2497 |
| 762 | Ga0207683_10422326 | 3300026121 | Bacteria | 1228 |
| 763 | Ga0207698_10363440 | 3300026142 | Unclassified | 1371 |
| 764 | Ga0207698_10411457 | 3300026142 | Bacteria | 1295 |
| 765 | Ga0207698_10462038 | 3300026142 | Bacteria | 1228 |
| 766 | Ga0207428_10015888 | 3300027907 | Bacteria | 6494 |
| 767 | Ga0207428_10016431 | 3300027907 | Bacteria | 6368 |
| 768 | Ga0207428_10048271 | 3300027907 | Bacteria | 3416 |
| 769 | Ga0207428_10458690 | 3300027907 | Bacteria | 929 |
| 770 | Ga0268266_10002664 | 3300028379 | Bacteria | 18789 |
| 771 | Ga0268266_10009440 | 3300028379 | Bacteria | 8588 |
| 772 | Ga0268266_10014990 | 3300028379 | Bacteria | 6654 |
| 773 | Ga0268266_10033575 | 3300028379 | Bacteria | 4362 |
| 774 | Ga0268266_10143042 | 3300028379 | Bacteria | 2148 |
| 775 | Ga0268266_10159568 | 3300028379 | Bacteria | 2039 |
| 776 | Ga0268266_10689846 | 3300028379 | Bacteria | 984 |
| 777 | Ga0268265_10019405 | 3300028380 | Bacteria | 4725 |
| 778 | Ga0268265_10163292 | 3300028380 | Bacteria | 1895 |
| 779 | Ga0268265_10216940 | 3300028380 | Bacteria | 1671 |
| 780 | Ga0268265_10810562 | 3300028380 | Bacteria | 913 |
| 781 | Ga0268264_10008480 | 3300028381 | Bacteria | 8548 |
| 782 | Ga0268264_10021345 | 3300028381 | Bacteria | 5287 |
| 783 | Ga0268264_10035414 | 3300028381 | Bacteria | 4110 |
| 784 | Ga0268264_10678225 | 3300028381 | Bacteria | 1022 |
| 785 | Ga0265332_10043963 | 3300031238 | Bacteria | 1928 |
| 786 | Ga0265316_10028020 | 3300031344 | Bacteria | 4652 |
| 787 | Ga0265316_10518153 | 3300031344 | Bacteria | 851 |
| 788 | Ga0307408_100046668 | 3300031548 | Bacteria | 3099 |
| 789 | Ga0265313_10000978 | 3300031595 | Bacteria | 28254 |
| 790 | Ga0265314_10000542 | 3300031711 | Bacteria | 48535 |
| 791 | Ga0265314_10064164 | 3300031711 | Bacteria | 2488 |
| 792 | Ga0265314_10110478 | 3300031711 | Bacteria | 1748 |
| 793 | Ga0307405_10066244 | 3300031731 | Bacteria | 2302 |
| 794 | Ga0307413_10057539 | 3300031824 | Bacteria | 2378 |
| 795 | Ga0307412_10090258 | 3300031911 | Bacteria | 2141 |
| 796 | Ga0307409_100028667 | 3300031995 | Bacteria | 3971 |
| 797 | Ga0307409_100218822 | 3300031995 | Bacteria | 1718 |
| 798 | Ga0307416_100105838 | 3300032002 | Bacteria | 2464 |
| 799 | Ga0307415_100036781 | 3300032126 | Bacteria | 3211 |
| 800 | Ga0373930_0005530 | 3300034816 | Bacteria | 2107 |
| 801 | Ga0373950_0000509 | 3300034818 | Bacteria | 4759 |
| 802 | Ga0373938_0014194 | 3300034957 | Unclassified | 1525 |
| 803 | Ga0373926_0018141 | 3300035083 | Bacteria | 2419 |
| 804 | Ga0373929_0002238 | 3300035085 | Bacteria | 3578 |
| 805 | Ga0373934_0000504 | 3300035086 | Bacteria | 13698 |
| 806 | Ga0373934_0036203 | 3300035086 | Bacteria | 1944 |
| 807 | Ga0373940_0008809 | 3300035088 | Bacteria | 2326 |
| 808 | Ga0373949_0001582 | 3300035090 | Bacteria | 6417 |
| 809 | Ga0373951_0001506 | 3300035091 | Bacteria | 6087 |
| 810 | Ga0373932_0000705 | 3300035112 | Bacteria | 10093 |
| 811 | Ga0373936_0110736 | 3300035113 | Bacteria | 1166 |
| 812 | Ga0373939_0000674 | 3300035114 | Bacteria | 8478 |
| 813 | Ga0373939_0129491 | 3300035114 | Bacteria | 899 |
| 814 | Ga0373941_0000861 | 3300035115 | Bacteria | 6249 |
| 815 | Ga0373953_0194875 | 3300035117 | Bacteria | 876 |
| 816 | Ga0373957_0096854 | 3300035120 | Bacteria | 1178 |
| 817 | Ga0373955_0075626 | 3300035172 | Bacteria | 1893 |
| 818 | Ga0373955_0125183 | 3300035172 | Bacteria | 1497 |
| 819 | Ga0373955_0189047 | 3300035172 | Unclassified | 1224 |
| 820 | Ga0373942_0003169 | 3300035207 | Bacteria | 3893 |
| 821 | Ga0373961_0025257 | 3300035241 | Bacteria | 1613 |
| 822 | Ga0373962_0045019 | 3300035242 | Unclassified | 1255 |
| 823 | Ga0373931_0007379 | 3300035691 | Bacteria | 5177 |
| 824 | Ga0373933_0195387 | 3300035724 | Bacteria | 1294 |
| 825 | Ga0373947_0045629 | 3300035725 | Bacteria | 2623 |
| 826 | Ga0373937_0094534 | 3300036401 | Unclassified | 2772 |
| 827 | Ga0373937_0100290 | 3300036401 | Bacteria | 2687 |
| 828 | Ga0373937_0134282 | 3300036401 | Bacteria | 2313 |
| 829 | Ga0373937_0515651 | 3300036401 | Bacteria | 1136 |
| 830 | Ga0373925_0196494 | 3300037068 | Bacteria | 1603 |
| 831 | Ga0436364_0017646 | 3300037853 | Bacteria | 5895 |
| 832 | Ga0436364_0019305 | 3300037853 | Bacteria | 2969 |
| 833 | Ga0436364_0069467 | 3300037853 | Bacteria | 1293 |
| 834 | Ga0436364_0094240 | 3300037853 | Bacteria | 2641 |
| 835 | Ga0436364_0449695 | 3300037853 | Bacteria | 85327 |
| 836 | Ga0436364_0463517 | 3300037853 | Bacteria | 4319 |
| 837 | Ga0436364_0491033 | 3300037853 | Bacteria | 22482 |
| 838 | Ga0436364_0605122 | 3300037853 | Bacteria | 1189 |
| 839 | Ga0436364_0748068 | 3300037853 | Bacteria | 528910 |
| 840 | Ga0436364_0763039 | 3300037853 | Bacteria | 19428 |
| 841 | Ga0436364_1356593 | 3300037853 | Bacteria | 7116 |
| 842 | Ga0436364_1416970 | 3300037853 | Bacteria | 2069 |
| 843 | Ga0436365_0610679 | 3300039437 | Bacteria | 2516 |
| 844 | Ga0436365_0945465 | 3300039437 | Bacteria | 19680 |
| 845 | Ga0436365_1696515 | 3300039437 | Bacteria | 3412 |
| 846 | Ga0436361_0314405 | 3300039447 | Bacteria | 9023 |
| 847 | Ga0436361_0511602 | 3300039447 | Bacteria | 24147 |
| 848 | Ga0436361_0881798 | 3300039447 | Bacteria | 2234 |
| 849 | Ga0436363_0691901 | 3300039450 | Bacteria | 1971 |
| 850 | Ga0436363_0807582 | 3300039450 | Unclassified | 1251 |
| 851 | Ga0436363_1364227 | 3300039450 | Unclassified | 1663 |
| 852 | Ga0436363_1450594 | 3300039450 | Unclassified | 813 |
| 853 | Ga0436362_0947914 | 3300039453 | Bacteria | 1041 |
| 854 | Ga0451839_0499901 | 3300041496 | Unclassified | 893 |
| 855 | Ga0439450_059025 | 3300042008 | Bacteria | 924 |
| 856 | Ga0439457_017314 | 3300042014 | Bacteria | 1601 |
| 857 | Ga0439462_0018876 | 3300042015 | Bacteria | 1793 |
| 858 | Ga0439434_0032167 | 3300042435 | Bacteria | 1596 |
| 859 | Ga0439464_0033468 | 3300042439 | Unclassified | 1447 |
| 860 | Ga0450916_002929 | 3300042530 | Bacteria | 1848 |
| 861 | Ga0466961_0080143 | 3300044693 | Bacteria | 2067 |
| 862 | Ga0453684_0909713 | 3300044712 | Bacteria | 942 |
| 863 | Ga0466959_0120927 | 3300045049 | Unclassified | 1862 |
| 864 | Ga0451576_0035765 | 3300045051 | Bacteria | 5267 |
| 865 | Ga0451576_0227006 | 3300045051 | Bacteria | 1950 |
| 866 | Ga0451576_0286519 | 3300045051 | Bacteria | 1722 |
| 867 | Ga0466967_0554080 | 3300045976 | Bacteria | 1132 |
| 868 | Ga0495603_0093154 | 3300046455 | Bacteria | 1761 |
| 869 | Ga0495629_0279726 | 3300046459 | Bacteria | 1145 |
| 870 | Ga0495582_0062221 | 3300046473 | Bacteria | 2062 |
| 871 | Ga0495639_0196206 | 3300046475 | Bacteria | 987 |
| 872 | Ga0495594_0049725 | 3300046499 | Bacteria | 2305 |
| 873 | Ga0495628_0100883 | 3300046516 | Unclassified | 2228 |
| 874 | Ga0495628_0270396 | 3300046516 | Bacteria | 1264 |
| 875 | Ga0495628_0595526 | 3300046516 | Bacteria | 790 |
| 876 | Ga0495640_0129560 | 3300046533 | Bacteria | 1634 |
| 877 | Ga0495586_0109220 | 3300046535 | Bacteria | 1539 |
| 878 | Ga0495586_0131216 | 3300046535 | Bacteria | 1403 |
| 879 | Ga0495645_0015063 | 3300046543 | Bacteria | 5494 |
| 880 | Ga0495645_0034303 | 3300046543 | Bacteria | 3702 |
| 881 | Ga0495656_0179078 | 3300046615 | Unclassified | 1041 |
| 882 | Ga0495599_0181569 | 3300046678 | Bacteria | 1297 |
| 883 | Ga0495647_0038186 | 3300046681 | Bacteria | 1815 |
| 884 | Ga0495647_0078313 | 3300046681 | Bacteria | 1336 |
| 885 | Ga0495658_0036374 | 3300046683 | Bacteria | 2716 |
| 886 | Ga0495658_0092955 | 3300046683 | Bacteria | 1789 |
| 887 | Ga0495669_0017811 | 3300046684 | Bacteria | 3050 |
| 888 | Ga0495669_0042593 | 3300046684 | Bacteria | 2019 |
| 889 | Ga0495669_0151424 | 3300046684 | Bacteria | 1098 |
| 890 | Ga0495670_0085167 | 3300046691 | Unclassified | 1613 |
| 891 | Ga0495600_0216400 | 3300046809 | Bacteria | 1226 |
| 892 | Ga0495604_0108310 | 3300047317 | Bacteria | 2030 |
| 893 | Ga0495604_0315178 | 3300047317 | Bacteria | 1047 |
| 894 | Ga0495674_0012415 | 3300047319 | Bacteria | 8027 |
| 895 | Ga0495674_0163845 | 3300047319 | Unclassified | 1859 |
| 896 | Ga0495684_0134895 | 3300047471 | Bacteria | 1853 |
| 897 | Ga0495593_0166647 | 3300047673 | Unclassified | 1111 |
| 898 | Ga0496100_0001606 | 3300048903 | Bacteria | 11154 |
| 899 | Ga0496101_0001080 | 3300048904 | Bacteria | 16146 |
| 900 | Ga0496101_0282095 | 3300048904 | Bacteria | 1298 |
| 901 | Ga0496102_0157568 | 3300048905 | Bacteria | 2135 |
| 902 | Ga0496102_0176865 | 3300048905 | Bacteria | 2010 |
| 903 | Ga0496102_0329902 | 3300048905 | Bacteria | 1437 |
| 904 | Ga0496103_0096133 | 3300048906 | Bacteria | 1872 |
| 905 | Ga0496104_0017733 | 3300048907 | Bacteria | 6489 |
| 906 | Ga0496104_0068126 | 3300048907 | Bacteria | 3382 |
| 907 | Ga0496104_0072447 | 3300048907 | Bacteria | 3276 |
| 908 | Ga0496104_0079486 | 3300048907 | Bacteria | 3126 |
| 909 | Ga0496104_0217861 | 3300048907 | Bacteria | 1821 |
| 910 | Ga0496104_0322802 | 3300048907 | Unclassified | 1457 |
| 911 | Ga0496105_0165337 | 3300048908 | Bacteria | 1815 |
| 912 | Ga0496105_0385081 | 3300048908 | Bacteria | 1115 |
| 913 | Ga0496106_0026452 | 3300048909 | Bacteria | 4321 |
| 914 | Ga0496106_0083572 | 3300048909 | Bacteria | 2456 |
| 915 | Ga0496106_0361951 | 3300048909 | Bacteria | 1165 |
| 916 | Ga0496107_0013906 | 3300048910 | Bacteria | 5628 |
| 917 | Ga0496107_0469017 | 3300048910 | Bacteria | 935 |
| 918 | Ga0496108_0018047 | 3300048911 | Bacteria | 5771 |
| 919 | Ga0496108_0022160 | 3300048911 | Bacteria | 5222 |
| 920 | Ga0496109_0004045 | 3300048912 | Bacteria | 12248 |
| 921 | Ga0496109_0043132 | 3300048912 | Bacteria | 4089 |
| 922 | Ga0496110_0006669 | 3300048913 | Bacteria | 9174 |
| 923 | Ga0496111_0401271 | 3300048914 | Bacteria | 1013 |
| 924 | Ga0496112_0006973 | 3300048915 | Bacteria | 9974 |
| 925 | Ga0496112_0230477 | 3300048915 | Bacteria | 1807 |
| 926 | Ga0496112_0358392 | 3300048915 | Bacteria | 1401 |
| 927 | Ga0496112_0528198 | 3300048915 | Bacteria | 1114 |
| 928 | Ga0496113_0025522 | 3300048916 | Bacteria | 4213 |
| 929 | Ga0496114_0000608 | 3300048917 | Bacteria | 26484 |
| 930 | Ga0496114_0043245 | 3300048917 | Bacteria | 3735 |
| 931 | Ga0496114_0087236 | 3300048917 | Bacteria | 2645 |
| 932 | Ga0496114_0191588 | 3300048917 | Bacteria | 1789 |
| 933 | Ga0496114_0201734 | 3300048917 | Bacteria | 1742 |
| 934 | Ga0496114_0310887 | 3300048917 | Unclassified | 1392 |
| 935 | Ga0496115_0030399 | 3300048918 | Bacteria | 4249 |
| 936 | Ga0496115_0089131 | 3300048918 | Bacteria | 2519 |
| 937 | Ga0501032_0015337 | 3300049569 | Bacteria | 5408 |
| 938 | Ga0501033_0009149 | 3300049570 | Bacteria | 7635 |
| 939 | Ga0501033_0017809 | 3300049570 | Bacteria | 5364 |
| 940 | Ga0501034_0009674 | 3300049571 | Bacteria | 10084 |
| 941 | Ga0501034_0022314 | 3300049571 | Bacteria | 6452 |
| 942 | Ga0501034_0241943 | 3300049571 | Bacteria | 1750 |
| 943 | Ga0501034_0448227 | 3300049571 | Bacteria | 1208 |
| 944 | Ga0501036_0044215 | 3300049572 | Bacteria | 3772 |
| 945 | Ga0501036_0175650 | 3300049572 | Bacteria | 1803 |
| 946 | Ga0501036_0200631 | 3300049572 | Bacteria | 1678 |
| 947 | Ga0501037_0015187 | 3300049573 | Bacteria | 5666 |
| 948 | Ga0501037_0022034 | 3300049573 | Bacteria | 4716 |
| 949 | Ga0501037_0037302 | 3300049573 | Bacteria | 3583 |
| 950 | Ga0501037_0159874 | 3300049573 | Bacteria | 1606 |
| 951 | Ga0501038_0007487 | 3300049574 | Bacteria | 10071 |
| 952 | Ga0501038_0150124 | 3300049574 | Bacteria | 1900 |
| 953 | Ga0501039_0004793 | 3300049575 | Bacteria | 10241 |
| 954 | Ga0501041_0024338 | 3300049577 | Bacteria | 3634 |
| 955 | Ga0501042_0014450 | 3300049578 | Bacteria | 5390 |
| 956 | Ga0501042_0030122 | 3300049578 | Bacteria | 3832 |
| 957 | Ga0501043_0018705 | 3300049579 | Bacteria | 5435 |
| 958 | Ga0501043_0032499 | 3300049579 | Bacteria | 4103 |
| 959 | Ga0501043_0048484 | 3300049579 | Bacteria | 3339 |
| 960 | Ga0501043_0299674 | 3300049579 | Unclassified | 1228 |
| 961 | Ga0501046_0007495 | 3300049580 | Bacteria | 9578 |
| 962 | Ga0501046_0007937 | 3300049580 | Bacteria | 9288 |
| 963 | Ga0501047_0001847 | 3300049581 | Bacteria | 20412 |
| 964 | Ga0501047_0051962 | 3300049581 | Bacteria | 3961 |
| 965 | Ga0501047_0116499 | 3300049581 | Bacteria | 2553 |
| 966 | Ga0501047_0148148 | 3300049581 | Bacteria | 2223 |
| 967 | Ga0501048_0049639 | 3300049582 | Bacteria | 2990 |
| 968 | Ga0501048_0126359 | 3300049582 | Bacteria | 1808 |
| 969 | Ga0501048_0223447 | 3300049582 | Bacteria | 1336 |
| 970 | Ga0501068_0003344 | 3300049584 | Bacteria | 8606 |
| 971 | Ga0501069_0011932 | 3300049585 | Bacteria | 4610 |
| 972 | Ga0501069_0109055 | 3300049585 | Bacteria | 1575 |
| 973 | Ga0501070_0011902 | 3300049586 | Bacteria | 7347 |
| 974 | Ga0501070_0013841 | 3300049586 | Bacteria | 6794 |
| 975 | Ga0501070_0087039 | 3300049586 | Bacteria | 2586 |
| 976 | Ga0501071_0192362 | 3300049587 | Bacteria | 1530 |
| 977 | Ga0501072_0055609 | 3300049588 | Bacteria | 3119 |
| 978 | Ga0501072_0436577 | 3300049588 | Unclassified | 1037 |
| 979 | Ga0501073_0020874 | 3300049589 | Bacteria | 4723 |
| 980 | Ga0501073_0039566 | 3300049589 | Bacteria | 3339 |
| 981 | Ga0501073_0077727 | 3300049589 | Bacteria | 2309 |
| 982 | Ga0501073_0113019 | 3300049589 | Bacteria | 1883 |
| 983 | Ga0501074_0001487 | 3300049590 | Bacteria | 15771 |
| 984 | Ga0501074_0086423 | 3300049590 | Bacteria | 2246 |
| 985 | Ga0501075_0404069 | 3300049591 | Bacteria | 1041 |
| 986 | Ga0501076_0005798 | 3300049592 | Bacteria | 8911 |
| 987 | Ga0501249_008502 | 3300049679 | Bacteria | 2130 |
| 988 | Ga0501079_0005839 | 3300049741 | Bacteria | 9204 |
| 989 | Ga0501079_0281299 | 3300049741 | Bacteria | 1301 |
| 990 | Ga0501080_0136948 | 3300049742 | Bacteria | 2265 |
| 991 | Ga0501080_0211560 | 3300049742 | Bacteria | 1777 |
| 992 | Ga0501080_0226487 | 3300049742 | Bacteria | 1709 |
| 993 | Ga0501080_0497549 | 3300049742 | Bacteria | 1090 |
| 994 | Ga0501083_0180720 | 3300049744 | Bacteria | 1377 |
| 995 | Ga0501035_0007020 | 3300049822 | Bacteria | 10522 |
| 996 | Ga0501035_0018527 | 3300049822 | Bacteria | 6413 |
| 997 | Ga0501035_0032873 | 3300049822 | Bacteria | 4717 |
| 998 | Ga0501044_0025658 | 3300049823 | Bacteria | 6248 |
| 999 | Ga0501045_0044761 | 3300049824 | Bacteria | 3224 |
| 1000 | Ga0501045_0063895 | 3300049824 | Bacteria | 2702 |
| 1001 | Ga0501045_0088307 | 3300049824 | Bacteria | 2290 |
| 1002 | nmdc:mga05p37_13907_c1 | 3300050507 | Bacteria | 9645 |
| 1003 | nmdc:mga05p37_16061_c1 | 3300050507 | Bacteria | 9010 |
| 1004 | nmdc:mga05p37_175586_c1 | 3300050507 | Bacteria | 2610 |
| 1005 | nmdc:mga05p37_220856_c1 | 3300050507 | Bacteria | 2287 |
| 1006 | nmdc:mga05p37_5090_c2 | 3300050507 | Bacteria | 9376 |
| 1007 | nmdc:mga05p37_60646_c1 | 3300050507 | Bacteria | 4657 |
| 1008 | nmdc:mga05p37_62494_c1 | 3300050507 | Bacteria | 4583 |
| 1009 | nmdc:mga05p37_6904_c1 | 3300050507 | Bacteria | 13380 |
| 1010 | nmdc:mga05p37_8417_c1 | 3300050507 | Bacteria | 12196 |
| 1011 | nmdc:mga0qj67_309867_c1 | 3300050509 | Bacteria | 1278 |
| 1012 | nmdc:mga06r32_160485_c1 | 3300050510 | Bacteria | 2230 |
| 1013 | nmdc:mga06r32_658016_c1 | 3300050510 | Bacteria | 1015 |
| 1014 | nmdc:mga08y16_165953_c1 | 3300050511 | Bacteria | 2294 |
| 1015 | nmdc:mga08y16_20531_c1 | 3300050511 | Bacteria | 4077 |
| 1016 | nmdc:mga08y16_4191_c1 | 3300050511 | Bacteria | 15068 |
| 1017 | nmdc:mga08y16_458079_c1 | 3300050511 | Bacteria | 1300 |
| 1018 | nmdc:mga08y16_49772_c1 | 3300050511 | Bacteria | 4385 |
| 1019 | nmdc:mga08y16_590020_c1 | 3300050511 | Bacteria | 1121 |
| 1020 | nmdc:mga08y16_603474_c1 | 3300050511 | Bacteria | 1106 |
| 1021 | nmdc:mga08y16_74827_c1 | 3300050511 | Bacteria | 3530 |
| 1022 | nmdc:mga0n895_192586_c1 | 3300050512 | Bacteria | 2070 |
| 1023 | nmdc:mga0n895_21468_c1 | 3300050512 | Bacteria | 6038 |
| 1024 | nmdc:mga0n895_260845_c1 | 3300050512 | Bacteria | 1759 |
| 1025 | nmdc:mga0n895_30_c1 | 3300050512 | Bacteria | 84416 |
| 1026 | nmdc:mga0n895_40784_c1 | 3300050512 | Bacteria | 4511 |
| 1027 | nmdc:mga0n895_679151_c1 | 3300050512 | Bacteria | 1027 |
| 1028 | nmdc:mga0n895_83529_c1 | 3300050512 | Bacteria | 3186 |
| 1029 | nmdc:mga0rr50_159893_c1 | 3300050513 | Bacteria | 1828 |
| 1030 | nmdc:mga0rr50_2_c1 | 3300050513 | Bacteria | 373938 |
| 1031 | nmdc:mga0rr50_67605_c1 | 3300050513 | Bacteria | 2715 |
| 1032 | nmdc:mga0rr50_750_c1 | 3300050513 | Bacteria | 17480 |
| 1033 | nmdc:mga08x19_145335_c1 | 3300050514 | Bacteria | 1604 |
| 1034 | nmdc:mga08x19_180090_c1 | 3300050514 | Bacteria | 1442 |
| 1035 | nmdc:mga08x19_231400_c1 | 3300050514 | Bacteria | 1272 |
| 1036 | nmdc:mga08x19_39694_c1 | 3300050514 | Bacteria | 2993 |
| 1037 | nmdc:mga08x19_76_c1 | 3300050514 | Bacteria | 92204 |
| 1038 | nmdc:mga0a205_119416_c1 | 3300050515 | Bacteria | 2535 |
| 1039 | nmdc:mga0a205_134556_c1 | 3300050515 | Bacteria | 2372 |
| 1040 | nmdc:mga0a205_14486_c1 | 3300050515 | Bacteria | 7356 |
| 1041 | nmdc:mga0a205_273393_c1 | 3300050515 | Bacteria | 1566 |
| 1042 | nmdc:mga0a205_303480_c1 | 3300050515 | Unclassified | 1469 |
| 1043 | nmdc:mga0a205_325774_c1 | 3300050515 | Bacteria | 1407 |
| 1044 | nmdc:mga0a205_61167_c1 | 3300050515 | Bacteria | 3637 |
| 1045 | Ga0495595_0140190 | 3300053084 | Unclassified | 1186 |
| 1046 | Ga0495619_0010909 | 3300053085 | Bacteria | 5719 |
| 1047 | Ga0495619_0116747 | 3300053085 | Bacteria | 1827 |
| 1048 | Ga0495619_0132889 | 3300053085 | Unclassified | 1711 |
| 1049 | Ga0495619_0318384 | 3300053085 | Bacteria | 1077 |
| 1050 | Ga0500568_0000885 | 3300053139 | Bacteria | 20942 |
| 1051 | Ga0501084_0000668 | 3300054114 | Bacteria | 26166 |
| 1052 | Ga0501084_0019052 | 3300054114 | Bacteria | 5715 |
| 1053 | Ga0501084_0477863 | 3300054114 | Bacteria | 1053 |
| 1054 | Ga0590071_007470 | 3300059421 | Bacteria | 2584 |
| 1055 | Ga0590075_037852 | 3300059424 | Bacteria | 1230 |
| 1056 | Ga0587128_013038 | 3300059630 | Bacteria | 1166 |
| 1057 | Ga0501082_0006692 | 3300060353 | Bacteria | 9970 |
| 1058 | Ga0501082_0007117 | 3300060353 | Bacteria | 9652 |
| 1059 | Ga0501082_0097858 | 3300060353 | Bacteria | 2537 |
| 1060 | Ga0530510_0041329 | 3300061734 | Bacteria | 3329 |
| 1061 | Ga0530510_0045136 | 3300061734 | Bacteria | 3184 |
| 1062 | Ga0530510_0301573 | 3300061734 | Bacteria | 1199 |
| 1063 | Ga0163161_10063451 | |||
| 1064 | JGI24033J26618_1005491 | |||
| 1065 | JGI25406J46586_10000725 | |||
| 1066 | Ga0065714_10075471 | |||
| 1067 | Ga0065704_10193170 | |||
| 1068 | Ga0065712_10000342 | |||
| 1069 | Ga0065712_10070130 | |||
| 1070 | Ga0065712_10091011 | |||
| 1071 | Ga0065712_10091915 | |||
| 1072 | Ga0065715_10001215 | |||
| 1073 | Ga0065715_10021840 | |||
| 1074 | Ga0065715_10098703 | |||
| 1075 | Ga0065715_10106754 | |||
| 1076 | Ga0065715_10207929 | |||
| 1077 | Ga0065707_10013597 | |||
| 1078 | Ga0065707_10100488 | |||
| 1079 | Ga0065707_10173154 | |||
| 1080 | Ga0070658_10116810 | |||
| 1081 | Ga0070676_10040170 | |||
| 1082 | Ga0070676_10351169 | |||
| 1083 | Ga0070676_10371012 | |||
| 1084 | Ga0070683_100000278 | |||
| 1085 | Ga0070683_100008117 | |||
| 1086 | Ga0070683_100061702 | |||
| 1087 | Ga0070683_100156931 | |||
| 1088 | Ga0070690_100025834 | |||
| 1089 | Ga0070690_100034072 | |||
| 1090 | Ga0070690_100068083 | |||
| 1091 | Ga0070690_100120551 | |||
| 1092 | Ga0070670_100010311 | |||
| 1093 | Ga0070670_100052238 | |||
| 1094 | Ga0070670_100073328 | |||
| 1095 | Ga0070670_100187063 | |||
| 1096 | Ga0070666_10002398 | |||
| 1097 | Ga0070666_10013063 | |||
| 1098 | Ga0070666_10098457 | |||
| 1099 | Ga0070666_10110964 | |||
| 1100 | Ga0070666_10381313 | |||
| 1101 | Ga0070680_100003994 | |||
| 1102 | Ga0070680_100021772 | |||
| 1103 | Ga0070680_100211120 | |||
| 1104 | Ga0068868_100004969 | |||
| 1105 | Ga0068868_100282713 | |||
| 1106 | Ga0068868_100316524 | |||
| 1107 | Ga0068868_100461697 | |||
| 1108 | Ga0068868_100526355 | |||
| 1109 | Ga0070660_100044431 | |||
| 1110 | Ga0070660_100401796 | |||
| 1111 | Ga0070689_100091953 | |||
| 1112 | Ga0070689_100241752 | |||
| 1113 | Ga0070689_100250383 | |||
| 1114 | Ga0070689_100510845 | |||
| 1115 | Ga0070691_10001080 | |||
| 1116 | Ga0070691_10001150 | |||
| 1117 | Ga0070687_100006349 | |||
| 1118 | Ga0070687_100106241 | |||
| 1119 | Ga0070661_100036178 | |||
| 1120 | Ga0070661_100140587 | |||
| 1121 | Ga0070661_100179731 | |||
| 1122 | Ga0070692_10152146 | |||
| 1123 | Ga0070668_100212202 | |||
| 1124 | Ga0070669_100015981 | |||
| 1125 | Ga0070669_100026479 | |||
| 1126 | Ga0070669_100047725 | |||
| 1127 | Ga0070669_100069745 | |||
| 1128 | Ga0070669_100487457 | |||
| 1129 | Ga0070675_100000959 | |||
| 1130 | Ga0070675_100001900 | |||
| 1131 | Ga0070675_100024152 | |||
| 1132 | Ga0070675_100055602 | |||
| 1133 | Ga0070675_100073773 | |||
| 1134 | Ga0070675_100151170 | |||
| 1135 | Ga0070675_100467513 | |||
| 1136 | Ga0070671_100022553 | |||
| 1137 | Ga0070671_100126940 | |||
| 1138 | Ga0070671_100253958 | |||
| 1139 | Ga0070674_100033584 | |||
| 1140 | Ga0070674_100065050 | |||
| 1141 | Ga0070673_100003230 | |||
| 1142 | Ga0070673_100037988 | |||
| 1143 | Ga0070673_100116471 | |||
| 1144 | Ga0070673_100141214 | |||
| 1145 | Ga0070673_100205116 | |||
| 1146 | Ga0070673_100208646 | |||
| 1147 | Ga0070688_100010419 | |||
| 1148 | Ga0070688_100040657 | |||
| 1149 | Ga0070688_100099972 | |||
| 1150 | Ga0070688_100129077 | |||
| 1151 | Ga0070688_100200464 | |||
| 1152 | Ga0070659_100039930 | |||
| 1153 | Ga0070659_100259308 | |||
| 1154 | Ga0070667_100037086 | |||
| 1155 | Ga0070667_100037642 | |||
| 1156 | Ga0070667_100066967 | |||
| 1157 | Ga0070667_100092993 | |||
| 1158 | Ga0070667_100199636 | |||
| 1159 | Ga0070667_100318635 | |||
| 1160 | Ga0070709_10308846 | |||
| 1161 | Ga0070714_100002119 | |||
| 1162 | Ga0070713_100050549 | |||
| 1163 | Ga0070713_100051778 | |||
| 1164 | Ga0070713_100080848 | |||
| 1165 | Ga0070710_10500673 | |||
| 1166 | Ga0070701_10126886 | |||
| 1167 | Ga0070711_100134124 | |||
| 1168 | Ga0070705_100017998 | |||
| 1169 | Ga0070705_100126469 | |||
| 1170 | Ga0070705_100400170 | |||
| 1171 | Ga0070700_100009277 | |||
| 1172 | Ga0070700_100044778 | |||
| 1173 | Ga0070700_100452092 | |||
| 1174 | Ga0070708_100113286 | |||
| 1175 | Ga0070662_100060968 | |||
| 1176 | Ga0070662_100196388 | |||
| 1177 | Ga0070662_100285393 | |||
| 1178 | Ga0070681_10005564 | |||
| 1179 | Ga0070681_10010716 | |||
| 1180 | Ga0070681_10018804 | |||
| 1181 | Ga0070681_10131414 | |||
| 1182 | Ga0070681_10452760 | |||
| 1183 | Ga0070681_10457193 | |||
| 1184 | Ga0068867_100012139 | |||
| 1185 | Ga0068867_100020584 | |||
| 1186 | Ga0070685_10015461 | |||
| 1187 | Ga0070685_10131789 | |||
| 1188 | Ga0070685_10156322 | |||
| 1189 | Ga0070685_10210763 | |||
| 1190 | Ga0070706_100504996 | |||
| 1191 | Ga0070707_100197361 | |||
| 1192 | Ga0070699_100110705 | |||
| 1193 | Ga0070699_100211878 | |||
| 1194 | Ga0070679_100002506 | |||
| 1195 | Ga0070679_100049371 | |||
| 1196 | Ga0070684_100007753 | |||
| 1197 | Ga0070684_100036127 | |||
| 1198 | Ga0070684_100091578 | |||
| 1199 | Ga0070684_100224944 | |||
| 1200 | Ga0070684_100258061 | |||
| 1201 | Ga0070684_100558079 | |||
| 1202 | Ga0068853_100017636 | |||
| 1203 | Ga0068853_100031026 | |||
| 1204 | Ga0068853_100086521 | |||
| 1205 | Ga0068853_100159581 | |||
| 1206 | Ga0070672_100008342 | |||
| 1207 | Ga0070672_100041283 | |||
| 1208 | Ga0070672_100059469 | |||
| 1209 | Ga0070672_100071745 | |||
| 1210 | Ga0070672_100131740 | |||
| 1211 | Ga0070672_100375143 | |||
| 1212 | Ga0070686_100001675 | |||
| 1213 | Ga0070686_100059723 | |||
| 1214 | Ga0070686_100239490 | |||
| 1215 | Ga0070686_100260650 | |||
| 1216 | Ga0070695_100008485 | |||
| 1217 | Ga0070695_100009406 | |||
| 1218 | Ga0070696_100003384 | |||
| 1219 | Ga0070665_100007069 | |||
| 1220 | Ga0070665_100010348 | |||
| 1221 | Ga0070665_100021222 | |||
| 1222 | Ga0070665_100029355 | |||
| 1223 | Ga0070665_100102541 | |||
| 1224 | Ga0070704_100006916 | |||
| 1225 | Ga0070704_100040203 | |||
| 1226 | Ga0070704_100544741 | |||
| 1227 | Ga0068855_100007793 | |||
| 1228 | Ga0068855_100012889 | |||
| 1229 | Ga0068855_100030751 | |||
| 1230 | Ga0068855_100044437 | |||
| 1231 | Ga0068855_100074228 | |||
| 1232 | Ga0068855_100335425 | |||
| 1233 | Ga0068855_100420699 | |||
| 1234 | Ga0068855_100532751 | |||
| 1235 | Ga0070664_100033375 | |||
| 1236 | Ga0070664_100076552 | |||
| 1237 | Ga0070664_100102732 | |||
| 1238 | Ga0070664_100275424 | |||
| 1239 | Ga0070664_100331499 | |||
| 1240 | Ga0068857_100000140 | |||
| 1241 | Ga0068857_100005615 | |||
| 1242 | Ga0068857_100058312 | |||
| 1243 | Ga0068857_100143048 | |||
| 1244 | Ga0068857_100178770 | |||
| 1245 | Ga0068857_100196014 | |||
| 1246 | Ga0068854_100007348 | |||
| 1247 | Ga0068854_101132198 | |||
| 1248 | Ga0068856_100001686 | |||
| 1249 | Ga0068856_100007046 | |||
| 1250 | Ga0068856_100008482 | |||
| 1251 | Ga0068856_100027094 | |||
| 1252 | Ga0068856_100037209 | |||
| 1253 | Ga0070702_100049489 | |||
| 1254 | Ga0070702_100085703 | |||
| 1255 | Ga0068852_100019346 | |||
| 1256 | Ga0068852_100039063 | |||
| 1257 | Ga0068852_100051399 | |||
| 1258 | Ga0068852_100263544 | |||
| 1259 | Ga0068852_100350648 | |||
| 1260 | Ga0068859_100101925 | |||
| 1261 | Ga0068859_100144097 | |||
| 1262 | Ga0068859_100163942 | |||
| 1263 | Ga0068859_100165294 | |||
| 1264 | Ga0068859_100313512 | |||
| 1265 | Ga0068859_100387334 | |||
| 1266 | Ga0068859_100771503 | |||
| 1267 | Ga0068859_100878535 | |||
| 1268 | Ga0068864_100001542 | |||
| 1269 | Ga0068864_100010274 | |||
| 1270 | Ga0068864_100036627 | |||
| 1271 | Ga0068864_100105908 | |||
| 1272 | Ga0068864_100118658 | |||
| 1273 | Ga0068864_100330916 | |||
| 1274 | Ga0068866_10049908 | |||
| 1275 | Ga0068866_10053303 | |||
| 1276 | Ga0068866_10186674 | |||
| 1277 | Ga0068861_100002259 | |||
| 1278 | Ga0068851_10104343 | |||
| 1279 | Ga0068870_10352117 | |||
| 1280 | Ga0068863_100012751 | |||
| 1281 | Ga0068863_100185167 | |||
| 1282 | Ga0068863_100211499 | |||
| 1283 | Ga0068863_100218802 | |||
| 1284 | Ga0068863_100270463 | |||
| 1285 | Ga0068863_100609713 | |||
| 1286 | Ga0068858_100004349 | |||
| 1287 | Ga0068858_100011282 | |||
| 1288 | Ga0068858_100021863 | |||
| 1289 | Ga0068858_100038496 | |||
| 1290 | Ga0068858_100164305 | |||
| 1291 | Ga0068858_100472100 | |||
| 1292 | Ga0068858_100497379 | |||
| 1293 | Ga0068858_100517341 | |||
| 1294 | Ga0068860_100016894 | |||
| 1295 | Ga0068860_100034259 | |||
| 1296 | Ga0068860_100135286 | |||
| 1297 | Ga0068860_100307996 | |||
| 1298 | Ga0068860_100736475 | |||
| 1299 | Ga0068862_100016562 | |||
| 1300 | Ga0081455_10038869 | |||
| 1301 | Ga0081539_10001115 | |||
| 1302 | Ga0070717_10310124 | |||
| 1303 | Ga0075432_10031491 | |||
| 1304 | Ga0070716_100103215 | |||
| 1305 | Ga0070712_100447262 | |||
| 1306 | Ga0097621_100004607 | |||
| 1307 | Ga0097621_100013094 | |||
| 1308 | Ga0097621_100023848 | |||
| 1309 | Ga0097621_100035520 | |||
| 1310 | Ga0097621_100060328 | |||
| 1311 | Ga0097621_100061343 | |||
| 1312 | Ga0097621_100063563 | |||
| 1313 | Ga0097621_100096644 | |||
| 1314 | Ga0097621_100130582 | |||
| 1315 | Ga0097621_100188471 | |||
| 1316 | Ga0097621_100215887 | |||
| 1317 | Ga0097621_100724865 | |||
| 1318 | Ga0068871_100001350 | |||
| 1319 | Ga0068871_100007041 | |||
| 1320 | Ga0068871_100017256 | |||
| 1321 | Ga0068871_100025965 | |||
| 1322 | Ga0068871_100029917 | |||
| 1323 | Ga0068871_100053174 | |||
| 1324 | Ga0068871_100078682 | |||
| 1325 | Ga0068871_100185633 | |||
| 1326 | Ga0068871_100257787 | |||
| 1327 | Ga0068871_100284165 | |||
| 1328 | Ga0068871_100389282 | |||
| 1329 | Ga0068871_100422843 | |||
| 1330 | Ga0068871_100486896 | |||
| 1331 | Ga0068871_100553773 | |||
| 1332 | Ga0068871_100641512 | |||
| 1333 | Ga0075428_100370104 | |||
| 1334 | Ga0075428_100418509 | |||
| 1335 | Ga0075430_100316901 | |||
| 1336 | Ga0075433_10010820 | |||
| 1337 | Ga0075433_10161770 | |||
| 1338 | Ga0075433_10254460 | |||
| 1339 | Ga0075434_100002366 | |||
| 1340 | Ga0075434_100019226 | |||
| 1341 | Ga0075434_100043081 | |||
| 1342 | Ga0075434_100105312 | |||
| 1343 | Ga0075434_100202206 | |||
| 1344 | Ga0075434_100204691 | |||
| 1345 | Ga0068865_100036588 | |||
| 1346 | Ga0068865_100161574 | |||
| 1347 | Ga0068865_100202453 | |||
| 1348 | Ga0068865_100312243 | |||
| 1349 | Ga0068865_100454629 | |||
| 1350 | Ga0075436_100000845 | |||
| 1351 | Ga0075436_100020389 | |||
| 1352 | Ga0097620_100101926 | |||
| 1353 | Ga0097620_100144096 | |||
| 1354 | Ga0097620_100163958 | |||
| 1355 | Ga0097620_100165304 | |||
| 1356 | Ga0097620_100313508 | |||
| 1357 | Ga0097620_100387314 | |||
| 1358 | Ga0097620_100771408 | |||
| 1359 | Ga0097620_100878636 | |||
| 1360 | Ga0075435_100000049 | |||
| 1361 | Ga0075435_100034583 | |||
| 1362 | Ga0075435_100111517 | |||
| 1363 | Ga0099794_10094612 | |||
| 1364 | Ga0099794_10162469 | |||
| 1365 | Ga0105251_10036066 | |||
| 1366 | Ga0105240_10004847 | |||
| 1367 | Ga0105240_10007712 | |||
| 1368 | Ga0105240_10021843 | |||
| 1369 | Ga0105240_10110957 | |||
| 1370 | Ga0105240_10209777 | |||
| 1371 | Ga0105240_10482408 | |||
| 1372 | Ga0111539_10031279 | |||
| 1373 | Ga0111539_10036623 | |||
| 1374 | Ga0111539_10130234 | |||
| 1375 | Ga0105245_10007811 | |||
| 1376 | Ga0105245_10024868 | |||
| 1377 | Ga0105245_10029447 | |||
| 1378 | Ga0105245_10061394 | |||
| 1379 | Ga0105245_10065868 | |||
| 1380 | Ga0105245_10073044 | |||
| 1381 | Ga0105245_10094515 | |||
| 1382 | Ga0105245_10217847 | |||
| 1383 | Ga0105245_10924920 | |||
| 1384 | Ga0105245_11525010 | |||
| 1385 | Ga0105247_10037295 | |||
| 1386 | Ga0105247_10075715 | |||
| 1387 | Ga0105247_10076887 | |||
| 1388 | Ga0105247_10116754 | |||
| 1389 | Ga0114129_10000192 | |||
| 1390 | Ga0114129_10003382 | |||
| 1391 | Ga0114129_10010507 | |||
| 1392 | Ga0114129_10013092 | |||
| 1393 | Ga0114129_10014797 | |||
| 1394 | Ga0114129_10053098 | |||
| 1395 | Ga0114129_10152679 | |||
| 1396 | Ga0114129_10430983 | |||
| 1397 | Ga0114129_10732004 | |||
| 1398 | Ga0105241_10001620 | |||
| 1399 | Ga0105241_10017463 | |||
| 1400 | Ga0105241_10135675 | |||
| 1401 | Ga0105241_10191243 | |||
| 1402 | Ga0105241_10204145 | |||
| 1403 | Ga0105241_10255154 | |||
| 1404 | Ga0105241_10515283 | |||
| 1405 | Ga0105242_10008421 | |||
| 1406 | Ga0105242_10024145 | |||
| 1407 | Ga0105242_10027094 | |||
| 1408 | Ga0105242_10038927 | |||
| 1409 | Ga0105242_10041151 | |||
| 1410 | Ga0105242_10064466 | |||
| 1411 | Ga0105242_10066002 | |||
| 1412 | Ga0105242_10090102 | |||
| 1413 | Ga0105242_10094988 | |||
| 1414 | Ga0105242_10231228 | |||
| 1415 | Ga0105242_10371435 | |||
| 1416 | Ga0105242_10467149 | |||
| 1417 | Ga0105248_10008123 | |||
| 1418 | Ga0105248_10019058 | |||
| 1419 | Ga0105248_10023159 | |||
| 1420 | Ga0105248_10025953 | |||
| 1421 | Ga0105248_10034550 | |||
| 1422 | Ga0105248_10061700 | |||
| 1423 | Ga0105248_10099460 | |||
| 1424 | Ga0105248_10104301 | |||
| 1425 | Ga0105248_10106005 | |||
| 1426 | Ga0105248_10107375 | |||
| 1427 | Ga0105248_10144329 | |||
| 1428 | Ga0105248_10144410 | |||
| 1429 | Ga0105248_10149963 | |||
| 1430 | Ga0105248_10216135 | |||
| 1431 | Ga0105248_10432657 | |||
| 1432 | Ga0105248_10631121 | |||
| 1433 | Ga0105237_10007273 | |||
| 1434 | Ga0105237_10024541 | |||
| 1435 | Ga0105237_10025726 | |||
| 1436 | Ga0105237_10034903 | |||
| 1437 | Ga0105237_10112639 | |||
| 1438 | Ga0105237_10190872 | |||
| 1439 | Ga0105238_10002113 | |||
| 1440 | Ga0105238_10013430 | |||
| 1441 | Ga0105238_10020407 | |||
| 1442 | Ga0105238_10036354 | |||
| 1443 | Ga0105238_10037736 | |||
| 1444 | Ga0105238_10095132 | |||
| 1445 | Ga0105238_10115319 | |||
| 1446 | Ga0105238_10158723 | |||
| 1447 | Ga0105238_10537118 | |||
| 1448 | Ga0105238_10541319 | |||
| 1449 | Ga0105249_10622019 | |||
| 1450 | Ga0105239_10003025 | |||
| 1451 | Ga0105239_10003955 | |||
| 1452 | Ga0105239_10006171 | |||
| 1453 | Ga0105239_10017693 | |||
| 1454 | Ga0105239_10025750 | |||
| 1455 | Ga0105239_10026079 | |||
| 1456 | Ga0105239_10232058 | |||
| 1457 | Ga0105239_10307549 | |||
| 1458 | Ga0105239_10659135 | |||
| 1459 | Ga0105239_11154906 | |||
| 1460 | Ga0105246_10034267 | |||
| 1461 | Ga0105246_10231297 | |||
| 1462 | Ga0105246_10251419 | |||
| 1463 | Ga0105246_10384882 | |||
| 1464 | Ga0157373_10045002 | |||
| 1465 | Ga0157373_10127677 | |||
| 1466 | Ga0157370_10004304 | |||
| 1467 | Ga0157370_10033774 | |||
| 1468 | Ga0157370_10087583 | |||
| 1469 | Ga0157370_10089626 | |||
| 1470 | Ga0157370_10094424 | |||
| 1471 | Ga0157370_10159570 | |||
| 1472 | Ga0157369_10002200 | |||
| 1473 | Ga0157369_10011678 | |||
| 1474 | Ga0157369_10028240 | |||
| 1475 | Ga0157369_10139287 | |||
| 1476 | Ga0157369_10334768 | |||
| 1477 | Ga0157369_10566498 | |||
| 1478 | Ga0157374_10016699 | |||
| 1479 | Ga0157374_10027745 | |||
| 1480 | Ga0157374_10054140 | |||
| 1481 | Ga0157374_10055562 | |||
| 1482 | Ga0157374_10243246 | |||
| 1483 | Ga0157374_10330078 | |||
| 1484 | Ga0157374_10479276 | |||
| 1485 | Ga0157374_10480094 | |||
| 1486 | Ga0157378_10043754 | |||
| 1487 | Ga0157378_10222943 | |||
| 1488 | Ga0157378_10258108 | |||
| 1489 | Ga0157378_10419759 | |||
| 1490 | Ga0157378_10584808 | |||
| 1491 | Ga0163162_10009499 | |||
| 1492 | Ga0163162_10065289 | |||
| 1493 | Ga0163162_10079451 | |||
| 1494 | Ga0163162_10150427 | |||
| 1495 | Ga0163162_10151980 | |||
| 1496 | Ga0163162_10516220 | |||
| 1497 | Ga0163162_10891659 | |||
| 1498 | Ga0163162_10936540 | |||
| 1499 | Ga0157372_10039627 | |||
| 1500 | Ga0157372_10125659 | |||
| 1501 | Ga0157372_10168916 | |||
| 1502 | Ga0157372_10195057 | |||
| 1503 | Ga0157372_10351448 | |||
| 1504 | Ga0157372_10412866 | |||
| 1505 | Ga0157372_10614681 | |||
| 1506 | Ga0157375_10052063 | |||
| 1507 | Ga0157375_10076661 | |||
| 1508 | Ga0157375_10143279 | |||
| 1509 | Ga0157375_10186969 | |||
| 1510 | Ga0157375_10205552 | |||
| 1511 | Ga0157375_10454423 | |||
| 1512 | Ga0163163_10008779 | |||
| 1513 | Ga0163163_10026375 | |||
| 1514 | Ga0163163_10038709 | |||
| 1515 | Ga0163163_10157127 | |||
| 1516 | Ga0163163_10157701 | |||
| 1517 | Ga0163163_10198116 | |||
| 1518 | Ga0163163_10237487 | |||
| 1519 | Ga0163163_10270332 | |||
| 1520 | Ga0163163_10284719 | |||
| 1521 | Ga0163163_10336922 | |||
| 1522 | Ga0163163_10692323 | |||
| 1523 | Ga0157380_10048468 | |||
| 1524 | Ga0157380_10157829 | |||
| 1525 | Ga0157380_10180817 | |||
| 1526 | Ga0157380_10481777 | |||
| 1527 | Ga0157380_10556060 | |||
| 1528 | Ga0157377_10075853 | |||
| 1529 | Ga0157377_10130799 | |||
| 1530 | Ga0157377_10152001 | |||
| 1531 | Ga0157377_10256946 | |||
| 1532 | Ga0157379_10006149 | |||
| 1533 | Ga0157379_10030148 | |||
| 1534 | Ga0157379_10039036 | |||
| 1535 | Ga0157379_10044354 | |||
| 1536 | Ga0157379_10116210 | |||
| 1537 | Ga0157379_10196317 | |||
| 1538 | Ga0157379_10355793 | |||
| 1539 | Ga0157376_10031726 | |||
| 1540 | Ga0157376_10060945 | |||
| 1541 | Ga0157376_10089594 | |||
| 1542 | Ga0157376_10540897 | |||
| 1543 | Ga0157376_10691359 | |||
| 1544 | Ga0157376_10832203 | |||
| 1545 | Ga0163161_10015750 | |||
| 1546 | Ga0163161_10122648 | |||
| 1547 | Ga0163161_10296662 | |||
| 1548 | Ga0197907_10262591 | |||
| 1549 | Ga0197907_10535074 | |||
| 1550 | Ga0197907_10885219 | |||
| 1551 | Ga0206355_1158864 | |||
| 1552 | Ga0206355_1228848 | |||
| 1553 | Ga0206351_11005059 | |||
| 1554 | Ga0206352_10772431 | |||
| 1555 | Ga0206350_10371091 | |||
| 1556 | Ga0206350_10759031 | |||
| 1557 | Ga0206354_11177288 | |||
| 1558 | Ga0154015_1650422 | |||
| 1559 | Ga0213873_10077771 | |||
| 1560 | Ga0213872_10000098 | |||
| 1561 | Ga0213872_10052106 | |||
| 1562 | Ga0213876_10007922 | |||
| 1563 | Ga0213876_10023885 | |||
| 1564 | Ga0213875_10000004 | |||
| 1565 | Ga0213875_10003648 | |||
| 1566 | Ga0213875_10018084 | |||
| 1567 | Ga0213875_10045841 | |||
| 1568 | Ga0213875_10078637 | |||
| 1569 | Ga0213871_10010350 | |||
| 1570 | Ga0213871_10107163 | |||
| 1571 | Ga0224712_10002723 | |||
| 1572 | Ga0224712_10011276 | |||
| 1573 | Ga0224712_10017575 | |||
| 1574 | Ga0224712_10073324 | |||
| 1575 | Ga0207697_10049223 | |||
| 1576 | Ga0207656_10109387 | |||
| 1577 | Ga0207713_1074928 | |||
| 1578 | Ga0207642_10034164 | |||
| 1579 | Ga0207642_10036209 | |||
| 1580 | Ga0207642_10133026 | |||
| 1581 | Ga0207642_10141525 | |||
| 1582 | Ga0207710_10008073 | |||
| 1583 | Ga0207710_10181472 | |||
| 1584 | Ga0207710_10242906 | |||
| 1585 | Ga0207680_10005064 | |||
| 1586 | Ga0207680_10056770 | |||
| 1587 | Ga0207680_10129135 | |||
| 1588 | Ga0207680_10144715 | |||
| 1589 | Ga0207680_10363896 | |||
| 1590 | Ga0207647_10171237 | |||
| 1591 | Ga0207699_10033735 | |||
| 1592 | Ga0207699_10115310 | |||
| 1593 | Ga0207699_10132908 | |||
| 1594 | Ga0207645_10006889 | |||
| 1595 | Ga0207645_10082497 | |||
| 1596 | Ga0207645_10284243 | |||
| 1597 | Ga0207654_10024609 | |||
| 1598 | Ga0207654_10032844 | |||
| 1599 | Ga0207654_10176043 | |||
| 1600 | Ga0207654_10711013 | |||
| 1601 | Ga0207707_10003371 | |||
| 1602 | Ga0207707_10082938 | |||
| 1603 | Ga0207707_10161821 | |||
| 1604 | Ga0207707_10241681 | |||
| 1605 | Ga0207707_10955689 | |||
| 1606 | Ga0207695_10001831 | |||
| 1607 | Ga0207695_10016736 | |||
| 1608 | Ga0207695_10050165 | |||
| 1609 | Ga0207695_10310186 | |||
| 1610 | Ga0207695_10418306 | |||
| 1611 | Ga0207695_10522086 | |||
| 1612 | Ga0207671_10005457 | |||
| 1613 | Ga0207671_10064566 | |||
| 1614 | Ga0207671_10141844 | |||
| 1615 | Ga0207671_10161252 | |||
| 1616 | Ga0207671_10178827 | |||
| 1617 | Ga0207671_10557083 | |||
| 1618 | Ga0207693_10312066 | |||
| 1619 | Ga0207693_10385798 | |||
| 1620 | Ga0207663_10101302 | |||
| 1621 | Ga0207663_10139732 | |||
| 1622 | Ga0207660_10218412 | |||
| 1623 | Ga0207660_10385438 | |||
| 1624 | Ga0207662_10009816 | |||
| 1625 | Ga0207662_10151540 | |||
| 1626 | Ga0207657_10003226 | |||
| 1627 | Ga0207657_10003464 | |||
| 1628 | Ga0207657_10034462 | |||
| 1629 | Ga0207657_10110107 | |||
| 1630 | Ga0207657_10132777 | |||
| 1631 | Ga0207657_10347574 | |||
| 1632 | Ga0207649_10058629 | |||
| 1633 | Ga0207649_10078412 | |||
| 1634 | Ga0207649_10142316 | |||
| 1635 | Ga0207649_10147786 | |||
| 1636 | Ga0207652_10220426 | |||
| 1637 | Ga0207652_10622320 | |||
| 1638 | Ga0207646_10118398 | |||
| 1639 | Ga0207646_10179203 | |||
| 1640 | Ga0207646_10197631 | |||
| 1641 | Ga0207681_10002032 | |||
| 1642 | Ga0207681_10020141 | |||
| 1643 | Ga0207681_10028887 | |||
| 1644 | Ga0207681_10175423 | |||
| 1645 | Ga0207681_10418612 | |||
| 1646 | Ga0207694_10006985 | |||
| 1647 | Ga0207694_10026762 | |||
| 1648 | Ga0207694_10046060 | |||
| 1649 | Ga0207694_10146750 | |||
| 1650 | Ga0207694_10148879 | |||
| 1651 | Ga0207650_10085653 | |||
| 1652 | Ga0207650_10228674 | |||
| 1653 | Ga0207650_10365912 | |||
| 1654 | Ga0207659_10000830 | |||
| 1655 | Ga0207659_10009600 | |||
| 1656 | Ga0207659_10028750 | |||
| 1657 | Ga0207659_10047946 | |||
| 1658 | Ga0207659_10087574 | |||
| 1659 | Ga0207659_10220953 | |||
| 1660 | Ga0207659_10453692 | |||
| 1661 | Ga0207687_10007777 | |||
| 1662 | Ga0207687_10024436 | |||
| 1663 | Ga0207687_10057914 | |||
| 1664 | Ga0207687_10062351 | |||
| 1665 | Ga0207687_10105692 | |||
| 1666 | Ga0207687_10126711 | |||
| 1667 | Ga0207687_10191245 | |||
| 1668 | Ga0207700_10102628 | |||
| 1669 | Ga0207700_10155236 | |||
| 1670 | Ga0207700_10434554 | |||
| 1671 | Ga0207664_10089750 | |||
| 1672 | Ga0207644_10051779 | |||
| 1673 | Ga0207644_10277484 | |||
| 1674 | Ga0207644_10348326 | |||
| 1675 | Ga0207644_10396118 | |||
| 1676 | Ga0207690_10037356 | |||
| 1677 | Ga0207690_10151795 | |||
| 1678 | Ga0207690_10154250 | |||
| 1679 | Ga0207690_10185336 | |||
| 1680 | Ga0207706_10105500 | |||
| 1681 | Ga0207706_10113382 | |||
| 1682 | Ga0207706_10121411 | |||
| 1683 | Ga0207706_10194031 | |||
| 1684 | Ga0207686_10002438 | |||
| 1685 | Ga0207686_10010805 | |||
| 1686 | Ga0207686_10050742 | |||
| 1687 | Ga0207686_10056788 | |||
| 1688 | Ga0207686_10256878 | |||
| 1689 | Ga0207686_10406546 | |||
| 1690 | Ga0207709_10094432 | |||
| 1691 | Ga0207670_10037851 | |||
| 1692 | Ga0207670_10048792 | |||
| 1693 | Ga0207670_10131765 | |||
| 1694 | Ga0207670_10166202 | |||
| 1695 | Ga0207670_10235316 | |||
| 1696 | Ga0207670_10437555 | |||
| 1697 | Ga0207704_10024709 | |||
| 1698 | Ga0207704_10073292 | |||
| 1699 | Ga0207704_10149073 | |||
| 1700 | Ga0207704_10151426 | |||
| 1701 | Ga0207704_10172410 | |||
| 1702 | Ga0207704_10271712 | |||
| 1703 | Ga0207704_10537839 | |||
| 1704 | Ga0207665_10048285 | |||
| 1705 | Ga0207691_10010517 | |||
| 1706 | Ga0207691_10035424 | |||
| 1707 | Ga0207691_10045852 | |||
| 1708 | Ga0207691_10094716 | |||
| 1709 | Ga0207691_10384860 | |||
| 1710 | Ga0207711_10005340 | |||
| 1711 | Ga0207711_10023491 | |||
| 1712 | Ga0207711_10024174 | |||
| 1713 | Ga0207711_10024413 | |||
| 1714 | Ga0207711_10029653 | |||
| 1715 | Ga0207711_10035334 | |||
| 1716 | Ga0207711_10075347 | |||
| 1717 | Ga0207711_10082059 | |||
| 1718 | Ga0207711_10156440 | |||
| 1719 | Ga0207711_10198697 | |||
| 1720 | Ga0207711_10232352 | |||
| 1721 | Ga0207711_10371248 | |||
| 1722 | Ga0207711_10660199 | |||
| 1723 | Ga0207689_10008966 | |||
| 1724 | Ga0207689_10169652 | |||
| 1725 | Ga0207689_10262191 | |||
| 1726 | Ga0207689_10378796 | |||
| 1727 | Ga0207661_10009880 | |||
| 1728 | Ga0207661_10045841 | |||
| 1729 | Ga0207661_10049753 | |||
| 1730 | Ga0207661_10071017 | |||
| 1731 | Ga0207661_10214940 | |||
| 1732 | Ga0207661_10305818 | |||
| 1733 | Ga0207661_10330999 | |||
| 1734 | Ga0207679_10018773 | |||
| 1735 | Ga0207679_10161883 | |||
| 1736 | Ga0207679_10181760 | |||
| 1737 | Ga0207679_10219597 | |||
| 1738 | Ga0207679_10288736 | |||
| 1739 | Ga0207679_10404858 | |||
| 1740 | Ga0207679_10505588 | |||
| 1741 | Ga0207667_10014741 | |||
| 1742 | Ga0207667_10017139 | |||
| 1743 | Ga0207667_10025443 | |||
| 1744 | Ga0207667_10046637 | |||
| 1745 | Ga0207667_10060044 | |||
| 1746 | Ga0207667_10520415 | |||
| 1747 | Ga0207667_10767672 | |||
| 1748 | Ga0207651_10058060 | |||
| 1749 | Ga0207651_10103263 | |||
| 1750 | Ga0207651_10116157 | |||
| 1751 | Ga0207651_10227188 | |||
| 1752 | Ga0207651_10261659 | |||
| 1753 | Ga0207651_10325704 | |||
| 1754 | Ga0207712_10142152 | |||
| 1755 | Ga0207712_10379942 | |||
| 1756 | Ga0207712_10382393 | |||
| 1757 | Ga0207668_10104956 | |||
| 1758 | Ga0207668_10187607 | |||
| 1759 | Ga0207668_10345098 | |||
| 1760 | Ga0207640_10002390 | |||
| 1761 | Ga0207640_10126542 | |||
| 1762 | Ga0207640_10461805 | |||
| 1763 | Ga0207658_10003889 | |||
| 1764 | Ga0207658_10073501 | |||
| 1765 | Ga0207658_10116923 | |||
| 1766 | Ga0207677_10012475 | |||
| 1767 | Ga0207677_10885422 | |||
| 1768 | Ga0207703_10035156 | |||
| 1769 | Ga0207703_10040564 | |||
| 1770 | Ga0207703_10064337 | |||
| 1771 | Ga0207703_10259044 | |||
| 1772 | Ga0207703_10314466 | |||
| 1773 | Ga0207703_10353602 | |||
| 1774 | Ga0207703_10355469 | |||
| 1775 | Ga0207703_10521710 | |||
| 1776 | Ga0207639_10016444 | |||
| 1777 | Ga0207639_10073659 | |||
| 1778 | Ga0207639_10091473 | |||
| 1779 | Ga0207639_10093830 | |||
| 1780 | Ga0207639_10378869 | |||
| 1781 | Ga0207678_10011858 | |||
| 1782 | Ga0207708_10000797 | |||
| 1783 | Ga0207708_10055861 | |||
| 1784 | Ga0207708_10107678 | |||
| 1785 | Ga0207708_10166358 | |||
| 1786 | Ga0207702_10005238 | |||
| 1787 | Ga0207702_10096329 | |||
| 1788 | Ga0207702_10167331 | |||
| 1789 | Ga0207702_10220642 | |||
| 1790 | Ga0207702_10413274 | |||
| 1791 | Ga0207702_10492465 | |||
| 1792 | Ga0207641_10004288 | |||
| 1793 | Ga0207641_10017364 | |||
| 1794 | Ga0207641_10100013 | |||
| 1795 | Ga0207641_10184819 | |||
| 1796 | Ga0207641_10188875 | |||
| 1797 | Ga0207641_10292099 | |||
| 1798 | Ga0207641_10591679 | |||
| 1799 | Ga0207641_10634513 | |||
| 1800 | Ga0207648_10007685 | |||
| 1801 | Ga0207648_10025669 | |||
| 1802 | Ga0207648_10039476 | |||
| 1803 | Ga0207648_10044313 | |||
| 1804 | Ga0207648_10191703 | |||
| 1805 | Ga0207648_10591426 | |||
| 1806 | Ga0207676_10024041 | |||
| 1807 | Ga0207676_10032574 | |||
| 1808 | Ga0207676_10133671 | |||
| 1809 | Ga0207676_10364513 | |||
| 1810 | Ga0207674_10001211 | |||
| 1811 | Ga0207674_10007293 | |||
| 1812 | Ga0207674_10095167 | |||
| 1813 | Ga0207674_10140935 | |||
| 1814 | Ga0207674_10176180 | |||
| 1815 | Ga0207674_10486341 | |||
| 1816 | Ga0207675_100028134 | |||
| 1817 | Ga0207675_100087563 | |||
| 1818 | Ga0207675_100187158 | |||
| 1819 | Ga0207675_100188507 | |||
| 1820 | Ga0207675_100416514 | |||
| 1821 | Ga0207683_10002520 | |||
| 1822 | Ga0207683_10004271 | |||
| 1823 | Ga0207683_10107413 | |||
| 1824 | Ga0207683_10422326 | |||
| 1825 | Ga0207698_10363440 | |||
| 1826 | Ga0207698_10411457 | |||
| 1827 | Ga0207698_10462038 | |||
| 1828 | Ga0207428_10015888 | |||
| 1829 | Ga0207428_10016431 | |||
| 1830 | Ga0207428_10048271 | |||
| 1831 | Ga0207428_10458690 | |||
| 1832 | Ga0268266_10002664 | |||
| 1833 | Ga0268266_10009440 | |||
| 1834 | Ga0268266_10014990 | |||
| 1835 | Ga0268266_10033575 | |||
| 1836 | Ga0268266_10143042 | |||
| 1837 | Ga0268266_10159568 | |||
| 1838 | Ga0268266_10689846 | |||
| 1839 | Ga0268265_10019405 | |||
| 1840 | Ga0268265_10163292 | |||
| 1841 | Ga0268265_10216940 | |||
| 1842 | Ga0268265_10810562 | |||
| 1843 | Ga0268264_10008480 | |||
| 1844 | Ga0268264_10021345 | |||
| 1845 | Ga0268264_10035414 | |||
| 1846 | Ga0268264_10678225 | |||
| 1847 | Ga0265332_10043963 | |||
| 1848 | Ga0265316_10028020 | |||
| 1849 | Ga0265316_10518153 | |||
| 1850 | Ga0307408_100046668 | |||
| 1851 | Ga0265313_10000978 | |||
| 1852 | Ga0265314_10000542 | |||
| 1853 | Ga0265314_10064164 | |||
| 1854 | Ga0265314_10110478 | |||
| 1855 | Ga0307405_10066244 | |||
| 1856 | Ga0307413_10057539 | |||
| 1857 | Ga0307412_10090258 | |||
| 1858 | Ga0307409_100028667 | |||
| 1859 | Ga0307409_100218822 | |||
| 1860 | Ga0307416_100105838 | |||
| 1861 | Ga0307415_100036781 | |||
| 1862 | Ga0373930_0005530 | |||
| 1863 | Ga0373950_0000509 | |||
| 1864 | Ga0373938_0014194 | |||
| 1865 | Ga0373926_0018141 | |||
| 1866 | Ga0373929_0002238 | |||
| 1867 | Ga0373934_0000504 | |||
| 1868 | Ga0373934_0036203 | |||
| 1869 | Ga0373940_0008809 | |||
| 1870 | Ga0373949_0001582 | |||
| 1871 | Ga0373951_0001506 | |||
| 1872 | Ga0373932_0000705 | |||
| 1873 | Ga0373936_0110736 | |||
| 1874 | Ga0373939_0000674 | |||
| 1875 | Ga0373939_0129491 | |||
| 1876 | Ga0373941_0000861 | |||
| 1877 | Ga0373953_0194875 | |||
| 1878 | Ga0373957_0096854 | |||
| 1879 | Ga0373955_0075626 | |||
| 1880 | Ga0373955_0125183 | |||
| 1881 | Ga0373955_0189047 | |||
| 1882 | Ga0373942_0003169 | |||
| 1883 | Ga0373961_0025257 | |||
| 1884 | Ga0373962_0045019 | |||
| 1885 | Ga0373931_0007379 | |||
| 1886 | Ga0373933_0195387 | |||
| 1887 | Ga0373947_0045629 | |||
| 1888 | Ga0373937_0094534 | |||
| 1889 | Ga0373937_0100290 | |||
| 1890 | Ga0373937_0134282 | |||
| 1891 | Ga0373937_0515651 | |||
| 1892 | Ga0373925_0196494 | |||
| 1893 | Ga0436364_0017646 | |||
| 1894 | Ga0436364_0019305 | |||
| 1895 | Ga0436364_0069467 | |||
| 1896 | Ga0436364_0094240 | |||
| 1897 | Ga0436364_0449695 | |||
| 1898 | Ga0436364_0463517 | |||
| 1899 | Ga0436364_0491033 | |||
| 1900 | Ga0436364_0605122 | |||
| 1901 | Ga0436364_0748068 | |||
| 1902 | Ga0436364_0763039 | |||
| 1903 | Ga0436364_1356593 | |||
| 1904 | Ga0436364_1416970 | |||
| 1905 | Ga0436365_0610679 | |||
| 1906 | Ga0436365_0945465 | |||
| 1907 | Ga0436365_1696515 | |||
| 1908 | Ga0436361_0314405 | |||
| 1909 | Ga0436361_0511602 | |||
| 1910 | Ga0436361_0881798 | |||
| 1911 | Ga0436363_0691901 | |||
| 1912 | Ga0436363_0807582 | |||
| 1913 | Ga0436363_1364227 | |||
| 1914 | Ga0436363_1450594 | |||
| 1915 | Ga0436362_0947914 | |||
| 1916 | Ga0451839_0499901 | |||
| 1917 | Ga0439450_059025 | |||
| 1918 | Ga0439457_017314 | |||
| 1919 | Ga0439462_0018876 | |||
| 1920 | Ga0439434_0032167 | |||
| 1921 | Ga0439464_0033468 | |||
| 1922 | Ga0450916_002929 | |||
| 1923 | Ga0466961_0080143 | |||
| 1924 | Ga0453684_0909713 | |||
| 1925 | Ga0466959_0120927 | |||
| 1926 | Ga0451576_0035765 | |||
| 1927 | Ga0451576_0227006 | |||
| 1928 | Ga0451576_0286519 | |||
| 1929 | Ga0466967_0554080 | |||
| 1930 | Ga0495603_0093154 | |||
| 1931 | Ga0495629_0279726 | |||
| 1932 | Ga0495582_0062221 | |||
| 1933 | Ga0495639_0196206 | |||
| 1934 | Ga0495594_0049725 | |||
| 1935 | Ga0495628_0100883 | |||
| 1936 | Ga0495628_0270396 | |||
| 1937 | Ga0495628_0595526 | |||
| 1938 | Ga0495640_0129560 | |||
| 1939 | Ga0495586_0109220 | |||
| 1940 | Ga0495586_0131216 | |||
| 1941 | Ga0495645_0015063 | |||
| 1942 | Ga0495645_0034303 | |||
| 1943 | Ga0495656_0179078 | |||
| 1944 | Ga0495599_0181569 | |||
| 1945 | Ga0495647_0038186 | |||
| 1946 | Ga0495647_0078313 | |||
| 1947 | Ga0495658_0036374 | |||
| 1948 | Ga0495658_0092955 | |||
| 1949 | Ga0495669_0017811 | |||
| 1950 | Ga0495669_0042593 | |||
| 1951 | Ga0495669_0151424 | |||
| 1952 | Ga0495670_0085167 | |||
| 1953 | Ga0495600_0216400 | |||
| 1954 | Ga0495604_0108310 | |||
| 1955 | Ga0495604_0315178 | |||
| 1956 | Ga0495674_0012415 | |||
| 1957 | Ga0495674_0163845 | |||
| 1958 | Ga0495684_0134895 | |||
| 1959 | Ga0495593_0166647 | |||
| 1960 | Ga0496100_0001606 | |||
| 1961 | Ga0496101_0001080 | |||
| 1962 | Ga0496101_0282095 | |||
| 1963 | Ga0496102_0157568 | |||
| 1964 | Ga0496102_0176865 | |||
| 1965 | Ga0496102_0329902 | |||
| 1966 | Ga0496103_0096133 | |||
| 1967 | Ga0496104_0017733 | |||
| 1968 | Ga0496104_0068126 | |||
| 1969 | Ga0496104_0072447 | |||
| 1970 | Ga0496104_0079486 | |||
| 1971 | Ga0496104_0217861 | |||
| 1972 | Ga0496104_0322802 | |||
| 1973 | Ga0496105_0165337 | |||
| 1974 | Ga0496105_0385081 | |||
| 1975 | Ga0496106_0026452 | |||
| 1976 | Ga0496106_0083572 | |||
| 1977 | Ga0496106_0361951 | |||
| 1978 | Ga0496107_0013906 | |||
| 1979 | Ga0496107_0469017 | |||
| 1980 | Ga0496108_0018047 | |||
| 1981 | Ga0496108_0022160 | |||
| 1982 | Ga0496109_0004045 | |||
| 1983 | Ga0496109_0043132 | |||
| 1984 | Ga0496110_0006669 | |||
| 1985 | Ga0496111_0401271 | |||
| 1986 | Ga0496112_0006973 | |||
| 1987 | Ga0496112_0230477 | |||
| 1988 | Ga0496112_0358392 | |||
| 1989 | Ga0496112_0528198 | |||
| 1990 | Ga0496113_0025522 | |||
| 1991 | Ga0496114_0000608 | |||
| 1992 | Ga0496114_0043245 | |||
| 1993 | Ga0496114_0087236 | |||
| 1994 | Ga0496114_0191588 | |||
| 1995 | Ga0496114_0201734 | |||
| 1996 | Ga0496114_0310887 | |||
| 1997 | Ga0496115_0030399 | |||
| 1998 | Ga0496115_0089131 | |||
| 1999 | Ga0501032_0015337 | |||
| 2000 | Ga0501033_0009149 | |||
| 2001 | Ga0501033_0017809 | |||
| 2002 | Ga0501034_0009674 | |||
| 2003 | Ga0501034_0022314 | |||
| 2004 | Ga0501034_0241943 | |||
| 2005 | Ga0501034_0448227 | |||
| 2006 | Ga0501036_0044215 | |||
| 2007 | Ga0501036_0175650 | |||
| 2008 | Ga0501036_0200631 | |||
| 2009 | Ga0501037_0015187 | |||
| 2010 | Ga0501037_0022034 | |||
| 2011 | Ga0501037_0037302 | |||
| 2012 | Ga0501037_0159874 | |||
| 2013 | Ga0501038_0007487 | |||
| 2014 | Ga0501038_0150124 | |||
| 2015 | Ga0501039_0004793 | |||
| 2016 | Ga0501041_0024338 | |||
| 2017 | Ga0501042_0014450 | |||
| 2018 | Ga0501042_0030122 | |||
| 2019 | Ga0501043_0018705 | |||
| 2020 | Ga0501043_0032499 | |||
| 2021 | Ga0501043_0048484 | |||
| 2022 | Ga0501043_0299674 | |||
| 2023 | Ga0501046_0007495 | |||
| 2024 | Ga0501046_0007937 | |||
| 2025 | Ga0501047_0001847 | |||
| 2026 | Ga0501047_0051962 | |||
| 2027 | Ga0501047_0116499 | |||
| 2028 | Ga0501047_0148148 | |||
| 2029 | Ga0501048_0049639 | |||
| 2030 | Ga0501048_0126359 | |||
| 2031 | Ga0501048_0223447 | |||
| 2032 | Ga0501068_0003344 | |||
| 2033 | Ga0501069_0011932 | |||
| 2034 | Ga0501069_0109055 | |||
| 2035 | Ga0501070_0011902 | |||
| 2036 | Ga0501070_0013841 | |||
| 2037 | Ga0501070_0087039 | |||
| 2038 | Ga0501071_0192362 | |||
| 2039 | Ga0501072_0055609 | |||
| 2040 | Ga0501072_0436577 | |||
| 2041 | Ga0501073_0020874 | |||
| 2042 | Ga0501073_0039566 | |||
| 2043 | Ga0501073_0077727 | |||
| 2044 | Ga0501073_0113019 | |||
| 2045 | Ga0501074_0001487 | |||
| 2046 | Ga0501074_0086423 | |||
| 2047 | Ga0501075_0404069 | |||
| 2048 | Ga0501076_0005798 | |||
| 2049 | Ga0501249_008502 | |||
| 2050 | Ga0501079_0005839 | |||
| 2051 | Ga0501079_0281299 | |||
| 2052 | Ga0501080_0136948 | |||
| 2053 | Ga0501080_0211560 | |||
| 2054 | Ga0501080_0226487 | |||
| 2055 | Ga0501080_0497549 | |||
| 2056 | Ga0501083_0180720 | |||
| 2057 | Ga0501035_0007020 | |||
| 2058 | Ga0501035_0018527 | |||
| 2059 | Ga0501035_0032873 | |||
| 2060 | Ga0501044_0025658 | |||
| 2061 | Ga0501045_0044761 | |||
| 2062 | Ga0501045_0063895 | |||
| 2063 | Ga0501045_0088307 | |||
| 2064 | nmdc:mga05p37_13907_c1 | |||
| 2065 | nmdc:mga05p37_16061_c1 | |||
| 2066 | nmdc:mga05p37_175586_c1 | |||
| 2067 | nmdc:mga05p37_220856_c1 | |||
| 2068 | nmdc:mga05p37_5090_c2 | |||
| 2069 | nmdc:mga05p37_60646_c1 | |||
| 2070 | nmdc:mga05p37_62494_c1 | |||
| 2071 | nmdc:mga05p37_6904_c1 | |||
| 2072 | nmdc:mga05p37_8417_c1 | |||
| 2073 | nmdc:mga0qj67_309867_c1 | |||
| 2074 | nmdc:mga06r32_160485_c1 | |||
| 2075 | nmdc:mga06r32_658016_c1 | |||
| 2076 | nmdc:mga08y16_165953_c1 | |||
| 2077 | nmdc:mga08y16_20531_c1 | |||
| 2078 | nmdc:mga08y16_4191_c1 | |||
| 2079 | nmdc:mga08y16_458079_c1 | |||
| 2080 | nmdc:mga08y16_49772_c1 | |||
| 2081 | nmdc:mga08y16_590020_c1 | |||
| 2082 | nmdc:mga08y16_603474_c1 | |||
| 2083 | nmdc:mga08y16_74827_c1 | |||
| 2084 | nmdc:mga0n895_192586_c1 | |||
| 2085 | nmdc:mga0n895_21468_c1 | |||
| 2086 | nmdc:mga0n895_260845_c1 | |||
| 2087 | nmdc:mga0n895_30_c1 | |||
| 2088 | nmdc:mga0n895_40784_c1 | |||
| 2089 | nmdc:mga0n895_679151_c1 | |||
| 2090 | nmdc:mga0n895_83529_c1 | |||
| 2091 | nmdc:mga0rr50_159893_c1 | |||
| 2092 | nmdc:mga0rr50_2_c1 | |||
| 2093 | nmdc:mga0rr50_67605_c1 | |||
| 2094 | nmdc:mga0rr50_750_c1 | |||
| 2095 | nmdc:mga08x19_145335_c1 | |||
| 2096 | nmdc:mga08x19_180090_c1 | |||
| 2097 | nmdc:mga08x19_231400_c1 | |||
| 2098 | nmdc:mga08x19_39694_c1 | |||
| 2099 | nmdc:mga08x19_76_c1 | |||
| 2100 | nmdc:mga0a205_119416_c1 | |||
| 2101 | nmdc:mga0a205_134556_c1 | |||
| 2102 | nmdc:mga0a205_14486_c1 | |||
| 2103 | nmdc:mga0a205_273393_c1 | |||
| 2104 | nmdc:mga0a205_303480_c1 | |||
| 2105 | nmdc:mga0a205_325774_c1 | |||
| 2106 | nmdc:mga0a205_61167_c1 | |||
| 2107 | Ga0495595_0140190 | |||
| 2108 | Ga0495619_0010909 | |||
| 2109 | Ga0495619_0116747 | |||
| 2110 | Ga0495619_0132889 | |||
| 2111 | Ga0495619_0318384 | |||
| 2112 | Ga0500568_0000885 | |||
| 2113 | Ga0501084_0000668 | |||
| 2114 | Ga0501084_0019052 | |||
| 2115 | Ga0501084_0477863 | |||
| 2116 | Ga0590071_007470 | |||
| 2117 | Ga0590075_037852 | |||
| 2118 | Ga0587128_013038 | |||
| 2119 | Ga0501082_0006692 | |||
| 2120 | Ga0501082_0007117 | |||
| 2121 | Ga0501082_0097858 | |||
| 2122 | Ga0530510_0041329 | |||
| 2123 | Ga0530510_0045136 | |||
| 2124 | Ga0530510_0301573 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h59-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound | 0.909 | 15 | 195 |
| 6wmv-assembly1.cif.gz_C | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.8903 | 8 | 195 |
| 6wm5-assembly1.cif.gz_C | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.8845 | 9 | 192 |
| 5d92-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.883 | 21 | 200 |
| 5d92-assembly2.cif.gz_C | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.8781 | 21 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9062 | 15 | 195 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8648 | 5 | 200 | 1.20.120.1760 |
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8402 | 15 | 195 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8329 | 5 | 200 | 1.20.120.1760 |
| af_P76226_9_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8261 | 15 | 199 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A143PRP5-F1-model_v4 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) | 0.9753 | 1 | 200 |
GO:0003881
GO:0008654 GO:0016020 |
| AF-A0A257UJB8-F1-model_v4 | CDP-alcohol phosphatidyltransferase | 0.9746 | 18 | 183 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A2V8DIS4-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.964 | 1 | 175 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7W0LCC3-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.958 | 1 | 130 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7Z9TA81-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9579 | 1 | 200 |
GO:0008654
GO:0016020 GO:0016780 |