F489276

General Info

Members Datasets Scaffolds Average Seq Length
1060 500 800 275

Family's Representative Sequence

Representative Sequence 3300042115|Ga0450911_000083|Ga0450911_000083_9245_10189
Length 314
Sequence MQSGGGVACFPDCIKATGDERVAGMGYNARRFSAFQAAVMQHPAEHSPLGKSSEYVSQYAPELLFPISRTTKWVELGLVAGKLPYQGVDYWNCYELSWLTPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQSAYADRAEVEAVLKRDLSACAGAPVAVRVRGLDEVAAEGVAALPGRCVDDLEIAVSDYAHPRPELMRCGDEVVEEVLYSHLLKSNCPVTGQPDWGTLVIDYRGPRLDAASLLAYVVSFRQHQDFHEQCVERVFLDLQHLLQPEKLTVYARYVRRGGLDINPYRSTEAITPDNRRLVRQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231016 Pseudomonas sp. GM50 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
25 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
64 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
65 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
66 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
67 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
68 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
69 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
70 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
71 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
72 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
73 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
74 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
75 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
76 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
77 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
78 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
79 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
80 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
81 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
82 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
83 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
84 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
85 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
86 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
87 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
88 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
89 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
90 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
91 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
92 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
93 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
94 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
95 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
96 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
97 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
98 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
99 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
100 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
101 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
102 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
103 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
104 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
105 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
106 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
107 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
108 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
109 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
110 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
111 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
112 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
113 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
114 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
115 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
116 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
117 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
118 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
119 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
120 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
121 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
122 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
123 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
124 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
125 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
126 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
127 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
128 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
129 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
130 2765235841 Pseudomonas putida AA7 Isolate Unclassified
131 2773857670 Pseudomonas sp. 478 Isolate Unclassified
132 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
133 2773857673 Pseudomonas sp. 443 Isolate Unclassified
134 2784132063 Pseudomonas sp. 424 Isolate Unclassified
135 2784132072 Pseudomonas sp. 460 Isolate Unclassified
136 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
137 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
138 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
139 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
140 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
141 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
142 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
143 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
144 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
145 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
146 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
147 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
148 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
149 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
150 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
151 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
152 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
153 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
154 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
155 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
156 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
157 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
158 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
159 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
160 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
161 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
162 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
163 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
164 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
165 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
166 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
167 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
168 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
169 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
170 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
171 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
172 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
173 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
174 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
175 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
176 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
177 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
178 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
179 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
180 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
181 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
182 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
183 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
184 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
185 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
186 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
187 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
188 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
189 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
190 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
191 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
192 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
193 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
194 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
195 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
196 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
197 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
198 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
199 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
200 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
201 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
202 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
203 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
204 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
205 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
206 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
207 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
208 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
209 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
210 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
211 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
212 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
213 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
214 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
215 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
216 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
217 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
218 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
219 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
220 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
221 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
222 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
223 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
224 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
225 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
226 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
227 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
228 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
229 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
230 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
231 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
232 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
233 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
234 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
235 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
236 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
237 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
238 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
239 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
240 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
241 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
242 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
243 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
244 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
245 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
246 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
247 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
248 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
249 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
250 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
251 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
252 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
253 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
254 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
255 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
256 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
257 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
258 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
261 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
262 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
263 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
264 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
265 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
266 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
267 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
268 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
271 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
272 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
273 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
274 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
275 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
276 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
277 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
278 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
279 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
280 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
281 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
282 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
283 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
284 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
290 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
291 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
292 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
294 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
295 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
314 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
318 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
320 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
321 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
322 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
323 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
324 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
325 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
326 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
327 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
328 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
329 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
330 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
331 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
332 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
333 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
334 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
335 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
336 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
337 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
338 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
339 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
340 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
341 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
342 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
343 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
344 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
345 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
346 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
347 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
348 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
349 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
350 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
351 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
352 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
353 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
354 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
355 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
356 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
357 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
358 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
359 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
360 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
361 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
362 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
363 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
364 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
365 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
366 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
367 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
368 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
369 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
370 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
371 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
372 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
373 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
374 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
375 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
376 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
377 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
378 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
381 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
382 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
383 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
384 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
388 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
389 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
392 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
395 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
396 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
397 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
398 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
399 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
400 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
401 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
405 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
406 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
410 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
413 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
414 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
415 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
416 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
417 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
418 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
419 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
420 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
429 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
432 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
433 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
434 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
435 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
436 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
437 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
438 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
439 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
440 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
450 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
453 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
454 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
455 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
458 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
459 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
466 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
467 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
468 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
469 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
470 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
471 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
472 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
473 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
474 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
475 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
476 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
477 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
478 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
479 8052494512 Pseudomonas putida LD6 Isolate Unclassified
480 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
481 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
482 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
483 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
484 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
485 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
486 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
487 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
488 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
489 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
490 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
491 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
492 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
493 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
494 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
495 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
496 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
497 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
498 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
499 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
500 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.47
Metatranscriptomes 0
Isolates 24.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 6.13
Nodule 2.26
Rhizoplane 7.64
Rhizosphere 68.77
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7 2124908027 Bacteria 72867
2 SwRhRL2b_contig_1594327 2162886007 Bacteria 4802
3 SwRhRL2b_contig_241481 2162886007 Bacteria 2909
4 JGI25162J39368_1000391 3300002737 Bacteria 36980
5 JGI25154J39366_1005613 3300002738 Bacteria 1967
6 JGI25163J39215_1001597 3300002771 Bacteria 3426
7 JGI25163J39215_1001662 3300002771 Bacteria 3250
8 JGI25164J39214_1000089 3300002772 Bacteria 91309
9 JGI25164J39214_1000279 3300002772 Bacteria 36980
10 JGI25165J46597_1000191 3300003214 Bacteria 91309
11 JGI25165J46597_1000510 3300003214 Bacteria 36980
12 Ga0055538_1000078 3300003751 Bacteria 86114
13 Ga0055539_1000119 3300003752 Bacteria 86114
14 Ga0055533_1000127 3300003756 Bacteria 86114
15 Ga0055532_1000068 3300003758 Bacteria 138828
16 Ga0055525_1000163 3300003759 Bacteria 86114
17 Ga0055525_1003329 3300003759 Bacteria 1455
18 Ga0055536_1000316 3300003781 Bacteria 35966
19 Ga0055536_1003702 3300003781 Bacteria 8111
20 Ga0055536_1003789 3300003781 Bacteria 7978
21 Ga0055530_10000230 3300003791 Bacteria 49999
22 Ga0055530_10000462 3300003791 Bacteria 35966
23 Ga0055530_10002879 3300003791 Bacteria 10479
24 Ga0055540_1000241 3300003792 Bacteria 49999
25 Ga0055540_1001061 3300003792 Bacteria 17512
26 Ga0055540_1002216 3300003792 Bacteria 10546
27 Ga0055531_10000511 3300003794 Bacteria 35158
28 Ga0055531_10007174 3300003794 Bacteria 6136
29 Ga0055541_1000079 3300003841 Bacteria 86114
30 Ga0065714_10000180 3300005288 Bacteria 8213
31 Ga0065714_10003160 3300005288 Bacteria 8831
32 Ga0065714_10007263 3300005288 Bacteria 3869
33 Ga0065714_10009195 3300005288 Bacteria 3434
34 Ga0065714_10065863 3300005288 Bacteria 8251
35 Ga0065714_10066039 3300005288 Bacteria 7772
36 Ga0065714_10109743 3300005288 Bacteria 1494
37 Ga0065714_10131632 3300005288 Bacteria 1238
38 Ga0065714_10142029 3300005288 Bacteria 1164
39 Ga0065704_10074907 3300005289 Bacteria 5920
40 Ga0065712_10002471 3300005290 Bacteria 11296
41 Ga0065712_10009951 3300005290 Bacteria 2146
42 Ga0065712_10070286 3300005290 Bacteria 6147
43 Ga0065715_10096155 3300005293 Bacteria 3933
44 Ga0070670_100017783 3300005331 Bacteria 6100
45 Ga0070661_100008283 3300005344 Bacteria 7177
46 Ga0070669_100000231 3300005353 Bacteria 46679
47 Ga0070662_100001224 3300005457 Bacteria 15780
48 Ga0070662_100507935 3300005457 Bacteria 1006
49 Ga0068853_100054183 3300005539 Bacteria 3456
50 Ga0070665_100583522 3300005548 Bacteria 1131
51 Ga0070664_100007813 3300005564 Bacteria 8639
52 Ga0068851_10000055 3300005834 Bacteria 67442
53 Ga0075432_10001624 3300006058 Bacteria 7392
54 Ga0075432_10009420 3300006058 Bacteria 3325
55 Ga0075432_10022216 3300006058 Bacteria 2169
56 Ga0075432_10076625 3300006058 Bacteria 1207
57 Ga0075369_10024550 3300006186 Bacteria 2499
58 Ga0075366_10000057 3300006195 Bacteria 40849
59 Ga0079104_1000213 3300006946 Bacteria 81349
60 Ga0079104_1000222 3300006946 Bacteria 78855
61 Ga0105251_10000158 3300009011 Bacteria 69153
62 Ga0105251_10000401 3300009011 Bacteria 42259
63 Ga0105251_10003936 3300009011 Bacteria 10537
64 Ga0105251_10005667 3300009011 Bacteria 8109
65 Ga0105251_10006323 3300009011 Bacteria 7575
66 Ga0105251_10009753 3300009011 Bacteria 5637
67 Ga0105251_10012020 3300009011 Bacteria 4913
68 Ga0105251_10020539 3300009011 Bacteria 3467
69 Ga0105251_10021720 3300009011 Bacteria 3345
70 Ga0105251_10038897 3300009011 Bacteria 2326
71 Ga0105251_10132236 3300009011 Bacteria 1130
72 Ga0105244_10001973 3300009036 Bacteria 15869
73 Ga0105244_10002235 3300009036 Bacteria 14746
74 Ga0105244_10004076 3300009036 Bacteria 10195
75 Ga0105244_10004822 3300009036 Bacteria 9157
76 Ga0105244_10006373 3300009036 Bacteria 7658
77 Ga0105244_10006900 3300009036 Bacteria 7284
78 Ga0105244_10013582 3300009036 Bacteria 4751
79 Ga0105244_10021324 3300009036 Bacteria 3585
80 Ga0105244_10057618 3300009036 Bacteria 1963
81 Ga0105244_10070868 3300009036 Bacteria 1738
82 Ga0105250_10000996 3300009092 Bacteria 16473
83 Ga0105250_10003977 3300009092 Bacteria 6897
84 Ga0105250_10013520 3300009092 Bacteria 3363
85 Ga0105250_10020678 3300009092 Bacteria 2658
86 Ga0105250_10030110 3300009092 Bacteria 2183
87 Ga0105250_10162089 3300009092 Bacteria 934
88 Ga0105243_10000627 3300009148 Bacteria 35211
89 Ga0105243_10002038 3300009148 Bacteria 17137
90 Ga0105243_10008887 3300009148 Bacteria 7686
91 Ga0105243_10027936 3300009148 Bacteria 4328
92 Ga0105243_10034942 3300009148 Bacteria 3896
93 Ga0105243_10130603 3300009148 Bacteria 2130
94 Ga0105242_10000734 3300009176 Bacteria 25556
95 Ga0105248_10275397 3300009177 Bacteria 1895
96 Ga0105237_10000730 3300009545 Bacteria 45375
97 Ga0105246_10003889 3300011119 Bacteria 9049
98 Ga0105246_10155032 3300011119 Bacteria 1739
99 Ga0157373_10004670 3300013100 Bacteria 10303
100 Ga0157373_10005788 3300013100 Bacteria 9261
101 Ga0157373_10010115 3300013100 Bacteria 6949
102 Ga0157373_10010961 3300013100 Bacteria 6674
103 Ga0157373_10027490 3300013100 Bacteria 4104
104 Ga0157373_10042314 3300013100 Bacteria 3256
105 Ga0157373_10078983 3300013100 Bacteria 2320
106 Ga0157373_10090802 3300013100 Bacteria 2151
107 Ga0157371_10000186 3300013102 Bacteria 91270
108 Ga0157371_10003775 3300013102 Bacteria 13559
109 Ga0157371_10005382 3300013102 Bacteria 10813
110 Ga0157371_10010666 3300013102 Bacteria 7136
111 Ga0157371_10035327 3300013102 Bacteria 3582
112 Ga0157371_10039893 3300013102 Bacteria 3356
113 Ga0157371_10299424 3300013102 Bacteria 1164
114 Ga0157370_10004247 3300013104 Bacteria 16554
115 Ga0157370_10013623 3300013104 Bacteria 8369
116 Ga0157370_10073748 3300013104 Bacteria 3220
117 Ga0157370_10085837 3300013104 Bacteria 2957
118 Ga0157370_10127606 3300013104 Bacteria 2374
119 Ga0157370_10343596 3300013104 Bacteria 1376
120 Ga0157370_10380740 3300013104 Bacteria 1300
121 Ga0157369_10006197 3300013105 Bacteria 13875
122 Ga0157369_10033267 3300013105 Bacteria 5666
123 Ga0157369_10036486 3300013105 Bacteria 5385
124 Ga0163162_10011325 3300013306 Bacteria 8697
125 Ga0157372_10004510 3300013307 Bacteria 14853
126 Ga0157372_10040263 3300013307 Bacteria 5160
127 Ga0157375_10012012 3300013308 Bacteria 7669
128 Ga0157375_10674839 3300013308 Bacteria 1188
129 Ga0182008_10001777 3300014497 Bacteria 14125
130 Ga0182008_10006367 3300014497 Bacteria 6611
131 Ga0182008_10007869 3300014497 Bacteria 5854
132 Ga0182008_10008096 3300014497 Bacteria 5756
133 Ga0182008_10009790 3300014497 Bacteria 5158
134 Ga0182008_10017212 3300014497 Bacteria 3751
135 Ga0182008_10018226 3300014497 Bacteria 3636
136 Ga0182006_1002441 3300015261 Bacteria 10157
137 Ga0182006_1003793 3300015261 Bacteria 7597
138 Ga0182006_1003932 3300015261 Bacteria 7439
139 Ga0182006_1004298 3300015261 Bacteria 7048
140 Ga0182006_1013700 3300015261 Bacteria 3509
141 Ga0182006_1016252 3300015261 Bacteria 3176
142 Ga0182007_10002905 3300015262 Bacteria 8324
143 Ga0182007_10008233 3300015262 Bacteria 4295
144 Ga0182007_10023244 3300015262 Bacteria 2181
145 Ga0182005_1014060 3300015265 Bacteria 2245
146 Ga0182005_1047910 3300015265 Bacteria 1162
147 Ga0163161_10040090 3300017792 Bacteria 3363
148 Ga0163161_10152410 3300017792 Bacteria 1758
149 Ga0163161_10181188 3300017792 Bacteria 1615
150 Ga0163161_10216202 3300017792 Bacteria 1482
151 Ga0209435_102520 3300025206 Bacteria 2135
152 Ga0209760_100087 3300025207 Bacteria 73419
153 Ga0209760_100145 3300025207 Bacteria 44471
154 Ga0209760_100173 3300025207 Bacteria 35497
155 Ga0209784_100015 3300025224 Bacteria 482117
156 Ga0209566_100012 3300025225 Bacteria 482281
157 Ga0209674_100027 3300025226 Bacteria 482281
158 Ga0209147_100019 3300025229 Bacteria 482139
159 Ga0209563_100031 3300025230 Bacteria 482281
160 Ga0209563_100856 3300025230 Bacteria 9048
161 Ga0207427_100001 3300025231 Bacteria 1410763
162 Ga0207427_100048 3300025231 Bacteria 238464
163 Ga0209437_100003 3300025233 Bacteria 1517827
164 Ga0209437_100094 3300025233 Bacteria 238465
165 Ga0209437_104886 3300025233 Bacteria 2326
166 Ga0209646_1000324 3300025246 Bacteria 36648
167 Ga0209677_100016 3300025253 Bacteria 482117
168 Ga0209759_1015352 3300025256 Bacteria 1980
169 Ga0209233_1000007 3300025261 Bacteria 1411234
170 Ga0209233_1000106 3300025261 Bacteria 268795
171 Ga0209675_1007693 3300025291 Bacteria 4081
172 Ga0209676_1000002 3300025292 Bacteria 1732948
173 Ga0209676_1000021 3300025292 Bacteria 609534
174 Ga0209676_1000166 3300025292 Bacteria 156596
175 Ga0209676_1002655 3300025292 Bacteria 12151
176 Ga0209676_1013379 3300025292 Bacteria 3159
177 Ga0209050_1000009 3300025298 Bacteria 1047265
178 Ga0209050_1000275 3300025298 Bacteria 110235
179 Ga0209050_1000395 3300025298 Bacteria 81719
180 Ga0209050_1003875 3300025298 Bacteria 10627
181 Ga0209051_1000001 3300025303 Bacteria 1732974
182 Ga0209051_1000008 3300025303 Bacteria 706935
183 Ga0209051_1000585 3300025303 Bacteria 43163
184 Ga0209257_1000181 3300025304 Bacteria 158039
185 Ga0209257_1015751 3300025304 Bacteria 3116
186 Ga0207656_10000659 3300025321 Bacteria 11289
187 Ga0207696_1000019 3300025711 Bacteria 476309
188 Ga0207696_1000063 3300025711 Bacteria 239123
189 Ga0207696_1000117 3300025711 Bacteria 148004
190 Ga0207696_1000274 3300025711 Bacteria 61734
191 Ga0207696_1003502 3300025711 Bacteria 7103
192 Ga0207696_1005934 3300025711 Bacteria 4995
193 Ga0207696_1021415 3300025711 Bacteria 2071
194 Ga0207655_1000019 3300025728 Bacteria 536324
195 Ga0207655_1000084 3300025728 Bacteria 207679
196 Ga0207655_1000096 3300025728 Bacteria 194292
197 Ga0207655_1000216 3300025728 Bacteria 99551
198 Ga0207655_1000835 3300025728 Bacteria 33137
199 Ga0207655_1002510 3300025728 Bacteria 14790
200 Ga0207655_1002846 3300025728 Bacteria 13379
201 Ga0207655_1003156 3300025728 Bacteria 12452
202 Ga0207655_1003902 3300025728 Bacteria 10832
203 Ga0207655_1005894 3300025728 Bacteria 8215
204 Ga0207655_1007227 3300025728 Bacteria 7238
205 Ga0207655_1019172 3300025728 Bacteria 3591
206 Ga0207655_1056970 3300025728 Bacteria 1538
207 Ga0207713_1000058 3300025735 Bacteria 216911
208 Ga0207713_1000160 3300025735 Bacteria 100682
209 Ga0207713_1003721 3300025735 Bacteria 10250
210 Ga0207713_1004302 3300025735 Bacteria 9280
211 Ga0207713_1004421 3300025735 Bacteria 9116
212 Ga0207713_1004598 3300025735 Bacteria 8916
213 Ga0207713_1005603 3300025735 Bacteria 7818
214 Ga0207713_1010940 3300025735 Bacteria 4981
215 Ga0207713_1011997 3300025735 Bacteria 4666
216 Ga0207713_1024386 3300025735 Bacteria 2822
217 Ga0207713_1025426 3300025735 Bacteria 2734
218 Ga0207713_1028021 3300025735 Bacteria 2547
219 Ga0207713_1068331 3300025735 Bacteria 1321
220 Ga0207671_10000079 3300025914 Bacteria 149692
221 Ga0207649_10000002 3300025920 Bacteria 498633
222 Ga0207681_10000143 3300025923 Bacteria 59590
223 Ga0207681_10131632 3300025923 Bacteria 1850
224 Ga0207650_10002170 3300025925 Bacteria 13707
225 Ga0207650_10004358 3300025925 Bacteria 9667
226 Ga0207706_10003826 3300025933 Bacteria 14341
227 Ga0207709_10000045 3300025935 Bacteria 240671
228 Ga0207709_10000763 3300025935 Bacteria 25375
229 Ga0207709_10008423 3300025935 Bacteria 5703
230 Ga0207709_10049379 3300025935 Bacteria 2568
231 Ga0207709_10051325 3300025935 Bacteria 2528
232 Ga0207709_10091677 3300025935 Bacteria 1988
233 Ga0207711_10052700 3300025941 Bacteria 3488
234 Ga0207679_10000006 3300025945 Bacteria 498868
235 Ga0207639_10037922 3300026041 Bacteria 3583
236 Ga0209281_1000011 3300027111 Bacteria 695292
237 Ga0209281_1000090 3300027111 Bacteria 242950
238 Ga0209281_1004373 3300027111 Bacteria 4248
239 Ga0209389_1000053 3300027296 Bacteria 108874
240 Ga0209371_1000245 3300027312 Bacteria 67465
241 Ga0209371_1000513 3300027312 Bacteria 36998
242 Ga0209996_1000654 3300027395 Bacteria 4161
243 Ga0209282_1019657 3300027666 Bacteria 4285
244 Ga0209971_1000371 3300027682 Bacteria 12275
245 Ga0207428_10043582 3300027907 Bacteria 3623
246 Ga0207428_10046802 3300027907 Bacteria 3477
247 Ga0207428_10240691 3300027907 Bacteria 1352
248 Ga0307517_10029448 3300028786 Bacteria 6482
249 Ga0268256_1000201 3300030500 Bacteria 67997
250 Ga0268256_1000441 3300030500 Bacteria 36967
251 Ga0314311_1110334 3300030733 Bacteria 11812
252 Ga0316178_1017010 3300030735 Bacteria 20955
253 Ga0265331_10048697 3300031250 Bacteria 2036
254 Ga0265327_10000053 3300031251 Bacteria 255002
255 Ga0307513_10002568 3300031456 Bacteria 25085
256 Ga0307513_10062742 3300031456 Bacteria 3926
257 Ga0307513_10115399 3300031456 Bacteria 2668
258 Ga0307509_10134402 3300031507 Bacteria 2422
259 Ga0307408_100000018 3300031548 Bacteria 346872
260 Ga0307408_100014661 3300031548 Bacteria 5207
261 Ga0307405_10001157 3300031731 Bacteria 10852
262 Ga0307405_10003239 3300031731 Bacteria 7424
263 Ga0307405_10006597 3300031731 Bacteria 5722
264 Ga0307405_10039823 3300031731 Bacteria 2843
265 Ga0307406_10224128 3300031901 Bacteria 1399
266 Ga0307407_10102036 3300031903 Bacteria 1783
267 Ga0307412_10001593 3300031911 Bacteria 12493
268 Ga0307412_10004029 3300031911 Bacteria 8186
269 Ga0307412_10004082 3300031911 Bacteria 8133
270 Ga0307412_10028821 3300031911 Bacteria 3479
271 Ga0307414_10041413 3300032004 Bacteria 3120
272 Ga0307414_10071338 3300032004 Bacteria 2505
273 Ga0307414_10085548 3300032004 Bacteria 2323
274 Ga0307414_10513362 3300032004 Bacteria 1062
275 Ga0307411_10036808 3300032005 Bacteria 3070
276 Ga0400483_092845 3300039062 Bacteria 4193
277 Ga0400483_150883 3300039062 Bacteria 26021
278 Ga0439436_0002628 3300041404 Bacteria 5413
279 Ga0439438_000536 3300041405 Bacteria 17257
280 Ga0439438_001084 3300041405 Bacteria 12163
281 Ga0439438_003740 3300041405 Bacteria 6035
282 Ga0439438_004003 3300041405 Bacteria 5789
283 Ga0439438_007668 3300041405 Bacteria 3662
284 Ga0439438_013102 3300041405 Bacteria 2514
285 Ga0439447_006569 3300041407 Bacteria 3761
286 Ga0439447_007774 3300041407 Bacteria 3370
287 Ga0439447_013358 3300041407 Bacteria 2333
288 Ga0439447_018294 3300041407 Bacteria 1891
289 Ga0439466_0000821 3300041411 Bacteria 11829
290 Ga0439466_0001319 3300041411 Bacteria 9670
291 Ga0439466_0006960 3300041411 Bacteria 4286
292 Ga0439466_0007055 3300041411 Bacteria 4254
293 Ga0439466_0025311 3300041411 Bacteria 2072
294 Ga0439465_0003369 3300041413 Bacteria 5214
295 Ga0451789_0749432 3300041443 Bacteria 1819
296 Ga0451791_0941148 3300041451 Bacteria 3103
297 Ga0451797_0336573 3300041453 Bacteria 2105
298 Ga0451807_1281855 3300041486 Bacteria 1157
299 Ga0451837_1500961 3300041494 Bacteria 2056
300 Ga0451837_1566606 3300041494 Bacteria 2176
301 Ga0451843_0572613 3300041509 Bacteria 1436
302 Ga0439431_0017049 3300041997 Bacteria 1705
303 Ga0439437_000834 3300042000 Bacteria 3182
304 Ga0439432_000869 3300042006 Bacteria 11311
305 Ga0439432_001543 3300042006 Bacteria 8652
306 Ga0439449_0005424 3300042007 Bacteria 4886
307 Ga0439451_009009 3300042009 Bacteria 2022
308 Ga0439451_009893 3300042009 Bacteria 1924
309 Ga0439452_002052 3300042010 Bacteria 7654
310 Ga0439452_002220 3300042010 Bacteria 7306
311 Ga0439452_002653 3300042010 Bacteria 6510
312 Ga0439452_003972 3300042010 Bacteria 5055
313 Ga0439452_004192 3300042010 Bacteria 4889
314 Ga0439452_017594 3300042010 Bacteria 1917
315 Ga0439452_038520 3300042010 Bacteria 1134
316 Ga0439455_0025721 3300042012 Bacteria 1432
317 Ga0439455_0033881 3300042012 Bacteria 1283
318 Ga0439456_000070 3300042013 Bacteria 36453
319 Ga0439456_003090 3300042013 Bacteria 3364
320 Ga0439456_003963 3300042013 Bacteria 3006
321 Ga0439463_001163 3300042016 Bacteria 7038
322 Ga0439463_002510 3300042016 Bacteria 4660
323 Ga0439463_003607 3300042016 Bacteria 3902
324 Ga0439463_011698 3300042016 Bacteria 2155
325 Ga0450911_000083 3300042115 Bacteria 37916
326 Ga0450911_001065 3300042115 Bacteria 6926
327 Ga0450919_008608 3300042121 Bacteria 1179
328 Ga0450920_003629 3300042122 Bacteria 2683
329 Ga0450922_001979 3300042124 Bacteria 1962
330 Ga0450902_004472 3300042137 Bacteria 2083
331 Ga0450903_003228 3300042138 Bacteria 2834
332 Ga0450904_000082 3300042139 Bacteria 21628
333 Ga0450904_003798 3300042139 Bacteria 1609
334 Ga0450905_001446 3300042142 Bacteria 3035
335 Ga0450905_002711 3300042142 Bacteria 2291
336 Ga0450907_000625 3300042146 Bacteria 9362
337 Ga0450907_000684 3300042146 Bacteria 8785
338 Ga0450907_013911 3300042146 Bacteria 1342
339 Ga0450910_004928 3300042147 Bacteria 1814
340 Ga0439446_0002180 3300042156 Bacteria 4663
341 Ga0439446_0018279 3300042156 Bacteria 1962
342 Ga0450909_001873 3300042185 Bacteria 2963
343 Ga0439459_0005877 3300042438 Bacteria 2029
344 Ga0439459_0029921 3300042438 Bacteria 1102
345 Ga0439464_0000409 3300042439 Bacteria 8456
346 Ga0439464_0001480 3300042439 Bacteria 5553
347 Ga0439464_0022690 3300042439 Bacteria 1730
348 Ga0439460_0001529 3300042461 Bacteria 5437
349 Ga0439460_0023703 3300042461 Bacteria 1694
350 Ga0450893_0001894 3300042532 Bacteria 3243
351 Ga0450901_000162 3300042533 Bacteria 7699
352 Ga0451577_0052572 3300042876 Bacteria 3637
353 Ga0495617_002382 3300046452 Bacteria 7496
354 Ga0495617_003876 3300046452 Bacteria 5509
355 Ga0495617_006286 3300046452 Bacteria 4174
356 Ga0495617_014919 3300046452 Bacteria 2637
357 Ga0495627_000051 3300046453 Bacteria 158822
358 Ga0495627_000140 3300046453 Bacteria 86227
359 Ga0495627_005064 3300046453 Bacteria 5385
360 Ga0495627_013658 3300046453 Bacteria 2854
361 Ga0495603_0017557 3300046455 Bacteria 4331
362 Ga0495603_0017842 3300046455 Bacteria 4296
363 Ga0495603_0058067 3300046455 Bacteria 2289
364 Ga0495590_0002910 3300046457 Bacteria 7048
365 Ga0495590_0003453 3300046457 Bacteria 6447
366 Ga0495590_0012739 3300046457 Bacteria 3111
367 Ga0495591_000018 3300046458 Bacteria 232216
368 Ga0495591_000720 3300046458 Bacteria 24007
369 Ga0495591_002135 3300046458 Bacteria 11352
370 Ga0495591_002739 3300046458 Bacteria 9543
371 Ga0495591_003389 3300046458 Bacteria 8259
372 Ga0495591_003954 3300046458 Bacteria 7430
373 Ga0495591_021328 3300046458 Bacteria 2116
374 Ga0495591_027318 3300046458 Bacteria 1761
375 Ga0495591_037719 3300046458 Bacteria 1396
376 Ga0495591_055495 3300046458 Bacteria 1068
377 Ga0495638_0008086 3300046460 Bacteria 7481
378 Ga0495638_0009256 3300046460 Bacteria 6927
379 Ga0495638_0013737 3300046460 Bacteria 5501
380 Ga0495638_0014242 3300046460 Bacteria 5382
381 Ga0495638_0049388 3300046460 Bacteria 2631
382 Ga0495638_0091040 3300046460 Bacteria 1837
383 Ga0495638_0215543 3300046460 Bacteria 1076
384 Ga0495653_0019000 3300046463 Bacteria 5576
385 Ga0495650_0001745 3300046471 Bacteria 19810
386 Ga0495650_0005287 3300046471 Bacteria 8449
387 Ga0495650_0005747 3300046471 Bacteria 7922
388 Ga0495650_0007282 3300046471 Bacteria 6690
389 Ga0495650_0007355 3300046471 Bacteria 6634
390 Ga0495650_0008282 3300046471 Bacteria 6089
391 Ga0495650_0009449 3300046471 Bacteria 5541
392 Ga0495605_0000036 3300046474 Bacteria 203902
393 Ga0495605_0000222 3300046474 Bacteria 70142
394 Ga0495605_0001613 3300046474 Bacteria 14607
395 Ga0495605_0002842 3300046474 Bacteria 10532
396 Ga0495605_0003110 3300046474 Bacteria 10007
397 Ga0495605_0004637 3300046474 Bacteria 8038
398 Ga0495605_0008220 3300046474 Bacteria 5901
399 Ga0495605_0020220 3300046474 Bacteria 3540
400 Ga0495639_0002536 3300046475 Bacteria 7970
401 Ga0495584_0004201 3300046491 Bacteria 7771
402 Ga0495584_0004645 3300046491 Bacteria 7360
403 Ga0495584_0005069 3300046491 Bacteria 6997
404 Ga0495584_0013739 3300046491 Bacteria 4129
405 Ga0495584_0015717 3300046491 Bacteria 3859
406 Ga0495584_0019288 3300046491 Bacteria 3463
407 Ga0495585_0003948 3300046492 Bacteria 9804
408 Ga0495585_0005318 3300046492 Bacteria 8131
409 Ga0495585_0005667 3300046492 Bacteria 7842
410 Ga0495585_0026931 3300046492 Bacteria 3282
411 Ga0495585_0032074 3300046492 Bacteria 2978
412 Ga0495594_0024608 3300046499 Bacteria 3235
413 Ga0495594_0113999 3300046499 Bacteria 1525
414 Ga0495596_0000105 3300046500 Bacteria 59665
415 Ga0495607_0000335 3300046501 Bacteria 48836
416 Ga0495607_0000679 3300046501 Bacteria 32917
417 Ga0495607_0000685 3300046501 Bacteria 32679
418 Ga0495607_0003854 3300046501 Bacteria 11301
419 Ga0495607_0004015 3300046501 Bacteria 11048
420 Ga0495607_0005200 3300046501 Bacteria 9370
421 Ga0495607_0008559 3300046501 Bacteria 6988
422 Ga0495607_0009291 3300046501 Bacteria 6668
423 Ga0495607_0010574 3300046501 Bacteria 6195
424 Ga0495607_0017209 3300046501 Bacteria 4648
425 Ga0495607_0019750 3300046501 Bacteria 4274
426 Ga0495607_0022541 3300046501 Bacteria 3952
427 Ga0495607_0025860 3300046501 Bacteria 3646
428 Ga0495607_0069243 3300046501 Bacteria 1976
429 Ga0495607_0092086 3300046501 Bacteria 1640
430 Ga0495607_0112208 3300046501 Bacteria 1443
431 Ga0495607_0200992 3300046501 Bacteria 986
432 Ga0495583_0000028 3300046506 Bacteria 255787
433 Ga0495583_0000561 3300046506 Bacteria 51417
434 Ga0495583_0001188 3300046506 Bacteria 28058
435 Ga0495583_0002128 3300046506 Bacteria 17722
436 Ga0495583_0006609 3300046506 Bacteria 7541
437 Ga0495583_0013452 3300046506 Bacteria 4562
438 Ga0495606_0000094 3300046507 Bacteria 151840
439 Ga0495606_0000502 3300046507 Bacteria 63679
440 Ga0495606_0000958 3300046507 Bacteria 42386
441 Ga0495606_0007380 3300046507 Bacteria 9864
442 Ga0495606_0009190 3300046507 Bacteria 8402
443 Ga0495606_0009383 3300046507 Bacteria 8285
444 Ga0495606_0011707 3300046507 Bacteria 7120
445 Ga0495606_0021273 3300046507 Bacteria 4754
446 Ga0495606_0033029 3300046507 Bacteria 3575
447 Ga0495606_0038357 3300046507 Bacteria 3242
448 Ga0495606_0039380 3300046507 Bacteria 3186
449 Ga0495606_0048675 3300046507 Bacteria 2785
450 Ga0495610_0002667 3300046512 Bacteria 14715
451 Ga0495610_0004363 3300046512 Bacteria 10489
452 Ga0495610_0006420 3300046512 Bacteria 8098
453 Ga0495610_0007567 3300046512 Bacteria 7193
454 Ga0495610_0009101 3300046512 Bacteria 6325
455 Ga0495610_0012501 3300046512 Bacteria 5104
456 Ga0495610_0012916 3300046512 Bacteria 4992
457 Ga0495610_0012994 3300046512 Bacteria 4974
458 Ga0495610_0018171 3300046512 Bacteria 3979
459 Ga0495610_0022406 3300046512 Bacteria 3456
460 Ga0495616_0003437 3300046513 Bacteria 10145
461 Ga0495616_0006678 3300046513 Bacteria 6962
462 Ga0495616_0015018 3300046513 Bacteria 4313
463 Ga0495616_0114052 3300046513 Bacteria 1253
464 Ga0495620_0000035 3300046515 Bacteria 115562
465 Ga0495620_0000073 3300046515 Bacteria 83446
466 Ga0495620_0001062 3300046515 Bacteria 16873
467 Ga0495620_0001625 3300046515 Bacteria 13297
468 Ga0495620_0002881 3300046515 Bacteria 9886
469 Ga0495620_0005281 3300046515 Bacteria 7228
470 Ga0495620_0006669 3300046515 Bacteria 6326
471 Ga0495620_0038029 3300046515 Bacteria 2138
472 Ga0495630_0052580 3300046517 Bacteria 3050
473 Ga0495630_0442925 3300046517 Bacteria 995
474 Ga0495631_0000484 3300046518 Bacteria 26620
475 Ga0495631_0002563 3300046518 Bacteria 10170
476 Ga0495631_0006603 3300046518 Bacteria 5970
477 Ga0495631_0008892 3300046518 Bacteria 5040
478 Ga0495631_0010624 3300046518 Bacteria 4553
479 Ga0495631_0013067 3300046518 Bacteria 4038
480 Ga0495632_0000449 3300046519 Bacteria 39222
481 Ga0495632_0000460 3300046519 Bacteria 38758
482 Ga0495632_0006467 3300046519 Bacteria 7525
483 Ga0495632_0006789 3300046519 Bacteria 7306
484 Ga0495632_0007385 3300046519 Bacteria 6909
485 Ga0495632_0008270 3300046519 Bacteria 6409
486 Ga0495632_0016194 3300046519 Bacteria 4153
487 Ga0495632_0019868 3300046519 Bacteria 3649
488 Ga0495632_0166286 3300046519 Bacteria 1014
489 Ga0495637_0000015 3300046520 Bacteria 228949
490 Ga0495637_0002724 3300046520 Bacteria 9627
491 Ga0495637_0005808 3300046520 Bacteria 6249
492 Ga0495637_0006843 3300046520 Bacteria 5699
493 Ga0495637_0009520 3300046520 Bacteria 4734
494 Ga0495637_0010639 3300046520 Bacteria 4442
495 Ga0495637_0011436 3300046520 Bacteria 4265
496 Ga0495637_0014163 3300046520 Bacteria 3766
497 Ga0495637_0017411 3300046520 Bacteria 3348
498 Ga0495637_0024973 3300046520 Bacteria 2699
499 Ga0495637_0029830 3300046520 Bacteria 2424
500 Ga0495637_0036053 3300046520 Bacteria 2157
501 Ga0495637_0065381 3300046520 Bacteria 1481
502 Ga0495643_0000345 3300046522 Bacteria 63090
503 Ga0495643_0000609 3300046522 Bacteria 43060
504 Ga0495643_0002906 3300046522 Bacteria 12991
505 Ga0495643_0007212 3300046522 Bacteria 7204
506 Ga0495643_0007758 3300046522 Bacteria 6870
507 Ga0495643_0013059 3300046522 Bacteria 4989
508 Ga0495643_0021487 3300046522 Bacteria 3701
509 Ga0495643_0037985 3300046522 Bacteria 2639
510 Ga0495643_0080262 3300046522 Bacteria 1698
511 Ga0495643_0142747 3300046522 Bacteria 1192
512 Ga0495644_0002921 3300046523 Bacteria 6786
513 Ga0495644_0003463 3300046523 Bacteria 6244
514 Ga0495648_0000589 3300046524 Bacteria 38874
515 Ga0495648_0005619 3300046524 Bacteria 10384
516 Ga0495648_0007013 3300046524 Bacteria 9080
517 Ga0495648_0010791 3300046524 Bacteria 6936
518 Ga0495648_0013954 3300046524 Bacteria 5910
519 Ga0495648_0022408 3300046524 Bacteria 4348
520 Ga0495648_0045597 3300046524 Bacteria 2725
521 Ga0495648_0125615 3300046524 Bacteria 1371
522 Ga0495663_0001024 3300046525 Bacteria 9246
523 Ga0495663_0005538 3300046525 Bacteria 3502
524 Ga0495666_0005790 3300046526 Bacteria 6227
525 Ga0495642_0001589 3300046528 Bacteria 9943
526 Ga0495642_0002566 3300046528 Bacteria 7338
527 Ga0495654_0000871 3300046530 Bacteria 22688
528 Ga0495654_0001727 3300046530 Bacteria 14682
529 Ga0495654_0005242 3300046530 Bacteria 7565
530 Ga0495654_0005682 3300046530 Bacteria 7194
531 Ga0495654_0006344 3300046530 Bacteria 6724
532 Ga0495654_0007076 3300046530 Bacteria 6312
533 Ga0495654_0016243 3300046530 Bacteria 3940
534 Ga0495654_0022154 3300046530 Bacteria 3302
535 Ga0495654_0047501 3300046530 Bacteria 2109
536 Ga0495654_0058238 3300046530 Bacteria 1864
537 Ga0495654_0107610 3300046530 Bacteria 1275
538 Ga0495654_0154593 3300046530 Bacteria 1012
539 Ga0495586_0253958 3300046535 Bacteria 1003
540 Ga0495587_0006210 3300046536 Bacteria 7796
541 Ga0495609_0000035 3300046538 Bacteria 196269
542 Ga0495609_0000162 3300046538 Bacteria 69584
543 Ga0495609_0000569 3300046538 Bacteria 28968
544 Ga0495609_0029729 3300046538 Bacteria 2486
545 Ga0495609_0067451 3300046538 Bacteria 1575
546 Ga0495609_0165608 3300046538 Bacteria 935
547 Ga0495597_0000044 3300046542 Bacteria 106714
548 Ga0495597_0002661 3300046542 Bacteria 11051
549 Ga0495597_0004928 3300046542 Bacteria 7174
550 Ga0495597_0011362 3300046542 Bacteria 4318
551 Ga0495597_0030461 3300046542 Bacteria 2459
552 Ga0495597_0042816 3300046542 Bacteria 2017
553 Ga0495597_0046211 3300046542 Bacteria 1929
554 Ga0495597_0067290 3300046542 Bacteria 1550
555 Ga0495622_0003194 3300046557 Bacteria 7760
556 Ga0495622_0006082 3300046557 Bacteria 5611
557 Ga0495622_0076114 3300046557 Bacteria 1546
558 Ga0495622_0191022 3300046557 Bacteria 915
559 Ga0495633_0000028 3300046558 Bacteria 203214
560 Ga0495633_0008320 3300046558 Bacteria 5858
561 Ga0495668_0004916 3300046616 Bacteria 9277
562 Ga0495668_0010092 3300046616 Bacteria 5745
563 Ga0495668_0012890 3300046616 Bacteria 4949
564 Ga0495668_0023225 3300046616 Bacteria 3539
565 Ga0495668_0036646 3300046616 Bacteria 2748
566 Ga0495634_0007654 3300046642 Bacteria 8090
567 Ga0495611_0001242 3300046648 Bacteria 13129
568 Ga0495611_0001633 3300046648 Bacteria 10885
569 Ga0495611_0002739 3300046648 Bacteria 7920
570 Ga0495625_0000004 3300046660 Bacteria 611314
571 Ga0495625_0011499 3300046660 Bacteria 7213
572 Ga0495625_0030660 3300046660 Bacteria 4009
573 Ga0495625_0076739 3300046660 Bacteria 2335
574 Ga0495625_0105121 3300046660 Bacteria 1935
575 Ga0495635_0034375 3300046663 Bacteria 3515
576 Ga0495659_0001557 3300046664 Bacteria 7729
577 Ga0495659_0005645 3300046664 Bacteria 3943
578 Ga0495661_0000006 3300046665 Bacteria 427288
579 Ga0495661_0000059 3300046665 Bacteria 131931
580 Ga0495661_0000401 3300046665 Bacteria 46171
581 Ga0495661_0000447 3300046665 Bacteria 43687
582 Ga0495661_0005286 3300046665 Bacteria 9179
583 Ga0495661_0027666 3300046665 Bacteria 3637
584 Ga0495661_0105054 3300046665 Bacteria 1582
585 Ga0495661_0166207 3300046665 Bacteria 1180
586 Ga0495588_0011458 3300046674 Bacteria 4163
587 Ga0495588_0087227 3300046674 Bacteria 1632
588 Ga0495588_0180472 3300046674 Bacteria 1116
589 Ga0495669_0004408 3300046684 Bacteria 5812
590 Ga0495613_0036295 3300046689 Bacteria 3655
591 Ga0495670_0002612 3300046691 Bacteria 8898
592 Ga0495670_0012350 3300046691 Bacteria 4198
593 Ga0495670_0014205 3300046691 Bacteria 3918
594 Ga0495670_0014270 3300046691 Bacteria 3908
595 Ga0495670_0014808 3300046691 Bacteria 3839
596 Ga0495670_0024304 3300046691 Bacteria 2995
597 Ga0495671_0002402 3300046692 Bacteria 11864
598 Ga0495671_0002948 3300046692 Bacteria 10581
599 Ga0495671_0003752 3300046692 Bacteria 9233
600 Ga0495671_0004807 3300046692 Bacteria 7980
601 Ga0495671_0005750 3300046692 Bacteria 7229
602 Ga0495671_0008524 3300046692 Bacteria 5763
603 Ga0495671_0010010 3300046692 Bacteria 5273
604 Ga0495671_0016467 3300046692 Bacteria 3947
605 Ga0495671_0026509 3300046692 Bacteria 3004
606 Ga0495671_0051666 3300046692 Bacteria 2044
607 Ga0495671_0085878 3300046692 Bacteria 1541
608 Ga0495649_0001079 3300046694 Bacteria 21270
609 Ga0495649_0003471 3300046694 Bacteria 10625
610 Ga0495649_0004328 3300046694 Bacteria 9312
611 Ga0495649_0007187 3300046694 Bacteria 6833
612 Ga0495649_0007280 3300046694 Bacteria 6771
613 Ga0495649_0015306 3300046694 Bacteria 4367
614 Ga0495649_0021425 3300046694 Bacteria 3620
615 Ga0495649_0032456 3300046694 Bacteria 2875
616 Ga0495649_0034207 3300046694 Bacteria 2796
617 Ga0495649_0120682 3300046694 Bacteria 1386
618 Ga0495589_0003843 3300046794 Bacteria 8070
619 Ga0495589_0004661 3300046794 Bacteria 7283
620 Ga0495589_0060596 3300046794 Bacteria 1859
621 Ga0495589_0071409 3300046794 Bacteria 1696
622 Ga0495600_0009911 3300046809 Bacteria 5901
623 Ga0495600_0233810 3300046809 Bacteria 1173
624 Ga0495660_0000505 3300046810 Bacteria 32144
625 Ga0495660_0001125 3300046810 Bacteria 19057
626 Ga0495660_0002977 3300046810 Bacteria 10575
627 Ga0495660_0004367 3300046810 Bacteria 8560
628 Ga0495660_0005636 3300046810 Bacteria 7486
629 Ga0495660_0022994 3300046810 Bacteria 3556
630 Ga0495660_0023806 3300046810 Bacteria 3491
631 Ga0495581_0050702 3300047315 Bacteria 2397
632 Ga0495636_0032998 3300047318 Bacteria 2125
633 Ga0495672_0005426 3300047320 Bacteria 10120
634 Ga0495672_0006857 3300047320 Bacteria 8697
635 Ga0495672_0009340 3300047320 Bacteria 7118
636 Ga0495672_0009385 3300047320 Bacteria 7094
637 Ga0495672_0009896 3300047320 Bacteria 6852
638 Ga0495672_0009926 3300047320 Bacteria 6839
639 Ga0495672_0010387 3300047320 Bacteria 6639
640 Ga0495672_0010868 3300047320 Bacteria 6457
641 Ga0495672_0015928 3300047320 Bacteria 5090
642 Ga0495672_0019887 3300047320 Bacteria 4415
643 Ga0495672_0023871 3300047320 Bacteria 3950
644 Ga0495672_0035366 3300047320 Bacteria 3077
645 Ga0495672_0080488 3300047320 Bacteria 1816
646 Ga0495676_0000004 3300047321 Bacteria 313696
647 Ga0495676_0021904 3300047321 Bacteria 5570
648 Ga0495680_0028213 3300047322 Bacteria 4603
649 Ga0495683_0000033 3300047323 Bacteria 149031
650 Ga0495683_0000091 3300047323 Bacteria 91313
651 Ga0495683_0003722 3300047323 Bacteria 8823
652 Ga0495683_0005092 3300047323 Bacteria 7350
653 Ga0495683_0018243 3300047323 Bacteria 3629
654 Ga0495683_0047733 3300047323 Bacteria 2148
655 Ga0495687_005976 3300047443 Bacteria 7587
656 Ga0495687_006399 3300047443 Bacteria 7224
657 Ga0495687_007940 3300047443 Bacteria 6165
658 Ga0495675_0013139 3300047444 Bacteria 5223
659 Ga0495675_0092161 3300047444 Bacteria 1901
660 Ga0495679_000083 3300047446 Bacteria 87051
661 Ga0495679_000461 3300047446 Bacteria 29942
662 Ga0495679_002991 3300047446 Bacteria 8327
663 Ga0495679_003054 3300047446 Bacteria 8223
664 Ga0495679_027084 3300047446 Bacteria 1896
665 Ga0495673_0003544 3300047469 Bacteria 10275
666 Ga0495673_0003918 3300047469 Bacteria 9546
667 Ga0495673_0004180 3300047469 Bacteria 9122
668 Ga0495673_0004973 3300047469 Bacteria 8174
669 Ga0495673_0006630 3300047469 Bacteria 6785
670 Ga0495673_0008633 3300047469 Bacteria 5704
671 Ga0495673_0011492 3300047469 Bacteria 4758
672 Ga0495673_0014539 3300047469 Bacteria 4089
673 Ga0495673_0016603 3300047469 Bacteria 3761
674 Ga0495673_0020443 3300047469 Bacteria 3295
675 Ga0495673_0032778 3300047469 Bacteria 2417
676 Ga0495673_0117534 3300047469 Bacteria 1056
677 Ga0495681_0003353 3300047470 Bacteria 11145
678 Ga0495681_0005364 3300047470 Bacteria 8597
679 Ga0495681_0006537 3300047470 Bacteria 7635
680 Ga0495681_0006989 3300047470 Bacteria 7301
681 Ga0495681_0007295 3300047470 Bacteria 7089
682 Ga0495681_0015124 3300047470 Bacteria 4379
683 Ga0495681_0021072 3300047470 Bacteria 3520
684 Ga0495681_0022079 3300047470 Bacteria 3413
685 Ga0495681_0033341 3300047470 Bacteria 2580
686 Ga0495681_0063608 3300047470 Bacteria 1692
687 Ga0495686_0009065 3300047472 Bacteria 7216
688 Ga0495686_0063765 3300047472 Bacteria 2282
689 Ga0495593_0006895 3300047673 Bacteria 6653
690 Ga0495626_0000173 3300048091 Bacteria 79835
691 Ga0495626_0003845 3300048091 Bacteria 9420
692 Ga0495626_0003921 3300048091 Bacteria 9319
693 Ga0495626_0004903 3300048091 Bacteria 8043
694 Ga0495626_0005054 3300048091 Bacteria 7869
695 Ga0495626_0005599 3300048091 Bacteria 7285
696 Ga0495626_0008800 3300048091 Bacteria 5492
697 Ga0496102_0007371 3300048905 Bacteria 9399
698 Ga0496110_0183626 3300048913 Bacteria 1899
699 Ga0496110_0238254 3300048913 Bacteria 1655
700 Ga0496111_0080837 3300048914 Bacteria 2372
701 Ga0496111_0462861 3300048914 Bacteria 935
702 Ga0496112_0038333 3300048915 Bacteria 4679
703 Ga0496112_0090559 3300048915 Bacteria 3028
704 Ga0496114_0047512 3300048917 Bacteria 3570
705 Ga0496116_0000574 3300048919 Bacteria 49172
706 Ga0496116_0010026 3300048919 Bacteria 7992
707 Ga0496117_0001296 3300048920 Bacteria 36823
708 Ga0496117_0004436 3300048920 Bacteria 15484
709 Ga0496117_0008721 3300048920 Bacteria 9582
710 Ga0496117_0010406 3300048920 Bacteria 8484
711 Ga0496117_0011529 3300048920 Bacteria 7910
712 Ga0496117_0048847 3300048920 Bacteria 3016
713 Ga0496117_0187291 3300048920 Bacteria 1183
714 Ga0496118_0013881 3300048921 Bacteria 7581
715 Ga0496118_0029328 3300048921 Bacteria 4616
716 Ga0496118_0039239 3300048921 Bacteria 3781
717 Ga0496118_0095737 3300048921 Bacteria 2025
718 Ga0496118_0102172 3300048921 Bacteria 1933
719 Ga0496118_0115462 3300048921 Bacteria 1767
720 Ga0496118_0257754 3300048921 Bacteria 986
721 Ga0496119_0000086 3300048922 Bacteria 137053
722 Ga0496120_0001853 3300048923 Bacteria 23531
723 Ga0496120_0019966 3300048923 Bacteria 4272
724 Ga0496121_0000299 3300048924 Bacteria 103000
725 Ga0496121_0003112 3300048924 Bacteria 23982
726 Ga0496121_0004378 3300048924 Bacteria 19076
727 Ga0496121_0015997 3300048924 Bacteria 7778
728 Ga0496121_0190928 3300048924 Bacteria 1468
729 Ga0496121_0307850 3300048924 Bacteria 1072
730 Ga0496122_0000156 3300048925 Bacteria 160178
731 Ga0496122_0005397 3300048925 Bacteria 15260
732 Ga0496122_0009262 3300048925 Bacteria 10415
733 Ga0496122_0010792 3300048925 Bacteria 9359
734 Ga0496122_0014336 3300048925 Bacteria 7671
735 Ga0496122_0017324 3300048925 Bacteria 6745
736 Ga0496122_0023244 3300048925 Bacteria 5474
737 Ga0496122_0028666 3300048925 Bacteria 4716
738 Ga0496122_0042754 3300048925 Bacteria 3560
739 Ga0496122_0073995 3300048925 Bacteria 2412
740 Ga0496122_0075708 3300048925 Bacteria 2372
741 Ga0496122_0191155 3300048925 Bacteria 1208
742 Ga0496123_0000087 3300048926 Bacteria 182994
743 Ga0496123_0000445 3300048926 Bacteria 74126
744 Ga0496123_0003302 3300048926 Bacteria 18282
745 Ga0496123_0013778 3300048926 Bacteria 6752
746 Ga0496123_0015908 3300048926 Bacteria 6138
747 Ga0496123_0021700 3300048926 Bacteria 4980
748 Ga0496123_0075191 3300048926 Bacteria 2086
749 Ga0496123_0102372 3300048926 Bacteria 1662
750 Ga0496124_0000031 3300048927 Bacteria 344232
751 Ga0496124_0006746 3300048927 Bacteria 12412
752 Ga0496124_0009610 3300048927 Bacteria 9911
753 Ga0496124_0010222 3300048927 Bacteria 9532
754 Ga0496124_0012164 3300048927 Bacteria 8519
755 Ga0496124_0017316 3300048927 Bacteria 6794
756 Ga0496124_0020633 3300048927 Bacteria 6082
757 Ga0496124_0086969 3300048927 Bacteria 2557
758 Ga0496124_0168653 3300048927 Bacteria 1698
759 Ga0496124_0275207 3300048927 Bacteria 1230
760 Ga0496125_0000658 3300048928 Bacteria 57602
761 Ga0496125_0009054 3300048928 Bacteria 10308
762 Ga0496125_0013589 3300048928 Bacteria 7996
763 Ga0496125_0020047 3300048928 Bacteria 6286
764 Ga0496125_0039884 3300048928 Bacteria 4035
765 Ga0496125_0047858 3300048928 Bacteria 3571
766 Ga0496125_0084043 3300048928 Bacteria 2419
767 Ga0496125_0115945 3300048928 Bacteria 1925
768 Ga0496125_0131980 3300048928 Bacteria 1756
769 Ga0496126_0014261 3300048929 Bacteria 8040
770 Ga0496126_0146285 3300048929 Bacteria 2029
771 Ga0496126_0176260 3300048929 Bacteria 1818
772 Ga0495678_000020 3300049459 Bacteria 253654
773 Ga0495678_000137 3300049459 Bacteria 87580
774 Ga0495678_004792 3300049459 Bacteria 7698
775 Ga0495678_005207 3300049459 Bacteria 7270
776 Ga0495678_009441 3300049459 Bacteria 4826
777 Ga0495678_011475 3300049459 Bacteria 4239
778 Ga0495678_014120 3300049459 Bacteria 3723
779 Ga0495678_021163 3300049459 Bacteria 2868
780 Ga0495678_034139 3300049459 Bacteria 2095
781 Ga0495678_045352 3300049459 Bacteria 1734
782 Ga0495678_055078 3300049459 Bacteria 1520
783 Ga0495678_098589 3300049459 Bacteria 1016
784 Ga0495682_0000492 3300049460 Bacteria 27338
785 Ga0495682_0000550 3300049460 Bacteria 25848
786 Ga0495682_0035567 3300049460 Bacteria 1834
787 Ga0495682_0085664 3300049460 Bacteria 1132
788 Ga0495682_0111945 3300049460 Bacteria 978
789 Ga0501032_0078869 3300049569 Bacteria 2192
790 Ga0501034_0000200 3300049571 Bacteria 113556
791 Ga0501034_0319183 3300049571 Bacteria 1487
792 Ga0501037_0024841 3300049573 Bacteria 4430
793 Ga0501226_000009 3300049853 Bacteria 194138
794 Ga0501226_000864 3300049853 Bacteria 4053
795 nmdc:mga0k408_97_c1 3300050493 Bacteria 42090
796 Ga0500595_012839 3300053119 Bacteria 3224
797 Ga0500618_007221 3300053125 Bacteria 3188
798 Ga0500573_0010506 3300053140 Bacteria 5168
799 Ga0500634_0010173 3300053161 Bacteria 4796
800 Ga0500609_010574 3300053731 Bacteria 1243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0102372 Ga0496123_0102372_28_786 252
2 3300025735 Ga0207713_1010940 Ga0207713_10109403 253
3 3300046665 Ga0495661_0166207 Ga0495661_0166207_12_773 253
4 3300049460 Ga0495682_0111945 Ga0495682_0111945_182_943 253
5 iso_pu_bacteria 2619619299 2621301046 263
6 3300046557 Ga0495622_0006082 Ga0495622_0006082_1853_2647 264
7 3300013102 Ga0157371_10299424 Ga0157371_102994242 266
8 3300013105 Ga0157369_10006197 Ga0157369_1000619712 266
9 3300039062 Ga0400483_092845 Ga0400483_092845_870_1739 267
10 3300032004 Ga0307414_10071338 Ga0307414_100713385 269
11 3300039062 Ga0400483_150883 Ga0400483_150883_9507_10367 269
12 3300005548 Ga0070665_100583522 Ga0070665_1005835221 270
13 3300031456 Ga0307513_10002568 Ga0307513_1000256814 270
14 3300031456 Ga0307513_10062742 Ga0307513_100627423 270
15 3300031456 Ga0307513_10115399 Ga0307513_101153993 270
16 3300041413 Ga0439465_0003369 Ga0439465_0003369_2508_3323 270
17 3300041443 Ga0451789_0749432 Ga0451789_0749432_163_978 270
18 3300041451 Ga0451791_0941148 Ga0451791_0941148_103_918 270
19 3300041453 Ga0451797_0336573 Ga0451797_0336573_892_1707 270
20 3300041494 Ga0451837_1500961 Ga0451837_1500961_501_1340 270
21 3300041494 Ga0451837_1566606 Ga0451837_1566606_832_1647 270
22 3300041509 Ga0451843_0572613 Ga0451843_0572613_368_1183 270
23 3300041997 Ga0439431_0017049 Ga0439431_0017049_762_1577 270
24 3300042007 Ga0439449_0005424 Ga0439449_0005424_2038_2853 270
25 3300046522 Ga0495643_0037985 Ga0495643_0037985_908_1723 270
26 3300046525 Ga0495663_0001024 Ga0495663_0001024_5891_6706 270
27 3300046525 Ga0495663_0005538 Ga0495663_0005538_740_1555 270
28 3300046692 Ga0495671_0008524 Ga0495671_0008524_1036_1851 270
29 3300053731 Ga0500609_010574 Ga0500609_010574_171_986 270
30 iso_pu_bacteria 2510065053 2510282126 270
31 iso_pu_bacteria 2510065055 2510291715 270
32 iso_pu_bacteria 2510065058 2510310274 270
33 iso_pu_bacteria 2773857672 2774132470 270
34 iso_pu_bacteria 2917832318 2917835881 270
35 iso_pu_bacteria 2919125081 2919125739 270
36 iso_pu_bacteria 2974298342 2974300081 270
37 iso_pu_bacteria 2984499530 2984502461 270
38 iso_pu_bacteria 2984504281 2984508927 270
39 iso_pu_bacteria 8016728285 8016728773 270
40 3300003794 Ga0055531_10007174 Ga0055531_100071744 271
41 3300031250 Ga0265331_10048697 Ga0265331_100486972 271
42 3300031251 Ga0265327_10000053 Ga0265327_10000053161 271
43 3300048925 Ga0496122_0005397 Ga0496122_0005397_4472_5296 271
44 3300053119 Ga0500595_012839 Ga0500595_012839_1779_2597 271
45 iso_pu_bacteria 2808606373 2808907714 271
46 iso_pu_bacteria 3007252601 3007252623 271
47 iso_pu_bacteria 3007315729 3007318804 271
48 iso_pu_bacteria 2511231004 2511253778 272
49 iso_pu_bacteria 2511231006 2511266162 272
50 iso_pu_bacteria 2511231007 2511270314 272
51 iso_pu_bacteria 2511231008 2511276082 272
52 iso_pu_bacteria 2511231010 2511288336 272
53 iso_pu_bacteria 2511231011 2511297880 272
54 iso_pu_bacteria 2511231014 2511312632 272
55 iso_pu_bacteria 2511231016 2511324726 272
56 iso_pu_bacteria 2511231018 2511338100 272
57 iso_pu_bacteria 2511231019 2511342884 272
58 iso_pu_bacteria 2511231020 2511352635 272
59 iso_pu_bacteria 2511231021 2511359008 272
60 iso_pu_bacteria 2511231022 2511362631 272
61 iso_pu_bacteria 2511231023 2511372126 272
62 iso_pu_bacteria 2511231024 2511377337 272
63 iso_pu_bacteria 2511231031 2511411826 272
64 iso_pu_bacteria 2511231156 2511825948 272
65 iso_pu_bacteria 2512047018 2512326883 272
66 iso_pu_bacteria 2554235132 2554814577 272
67 iso_pu_bacteria 2554235231 2555247946 272
68 iso_pu_bacteria 2554235341 2555668965 272
69 iso_pu_bacteria 2582580891 2583793490 272
70 iso_pu_bacteria 2597489887 2597857154 272
71 iso_pu_bacteria 2597489888 2597862871 272
72 iso_pu_bacteria 2597489889 2597868669 272
73 iso_pu_bacteria 2599185155 2599326505 272
74 iso_pu_bacteria 2599185160 2599357323 272
75 iso_pu_bacteria 2599185161 2599361865 272
76 iso_pu_bacteria 2599185162 2599368186 272
77 iso_pu_bacteria 2599185163 2599374975 272
78 iso_pu_bacteria 2599185164 2599382428 272
79 iso_pu_bacteria 2599185165 2599388875 272
80 iso_pu_bacteria 2599185166 2599393833 272
81 iso_pu_bacteria 2599185167 2599396570 272
82 iso_pu_bacteria 2599185168 2599405598 272
83 iso_pu_bacteria 2599185179 2599453370 272
84 iso_pu_bacteria 2599185181 2599464176 272
85 iso_pu_bacteria 2599185182 2599468472 272
86 iso_pu_bacteria 2599185185 2599484176 272
87 iso_pu_bacteria 2599185186 2599493195 272
88 iso_pu_bacteria 2599185188 2599504653 272
89 iso_pu_bacteria 2599185189 2599507552 272
90 iso_pu_bacteria 2599185190 2599514702 272
91 iso_pu_bacteria 2599185191 2599517367 272
92 iso_pu_bacteria 2599185212 2599611417 272
93 iso_pu_bacteria 2599185248 2599771495 272
94 iso_pu_bacteria 2599185257 2599801827 272
95 iso_pu_bacteria 2599185288 2599883017 272
96 iso_pu_bacteria 2599185289 2599884031 272
97 iso_pu_bacteria 2599185290 2599894033 272
98 iso_pu_bacteria 2599185291 2599899036 272
99 iso_pu_bacteria 2599185300 2599935014 272
100 iso_pu_bacteria 2599185302 2599941619 272
101 iso_pu_bacteria 2599185303 2599952423 272
102 iso_pu_bacteria 2599185304 2599952861 272
103 iso_pu_bacteria 2599185305 2599958825 272
104 iso_pu_bacteria 2599185306 2599968680 272
105 iso_pu_bacteria 2599185307 2599970591 272
106 iso_pu_bacteria 2599185308 2599976937 272
107 iso_pu_bacteria 2599185309 2599981788 272
108 iso_pu_bacteria 2599185310 2599987697 272
109 iso_pu_bacteria 2599185311 2599995189 272
110 iso_pu_bacteria 2599185312 2599998411 272
111 iso_pu_bacteria 2599185313 2600003310 272
112 iso_pu_bacteria 2599185314 2600011106 272
113 iso_pu_bacteria 2599185315 2600017885 272
114 iso_pu_bacteria 2599185316 2600022404 272
115 iso_pu_bacteria 2599185317 2600027425 272
116 iso_pu_bacteria 2599185318 2600034196 272
117 iso_pu_bacteria 2599185319 2600039704 272
118 iso_pu_bacteria 2599185320 2600046027 272
119 iso_pu_bacteria 2599185321 2600052404 272
120 iso_pu_bacteria 2599185322 2600057365 272
121 iso_pu_bacteria 2599185323 2600064542 272
122 iso_pu_bacteria 2599185324 2600069659 272
123 iso_pu_bacteria 2599185325 2600075679 272
124 iso_pu_bacteria 2599185356 2600216451 272
125 iso_pu_bacteria 2600254930 2600356866 272
126 iso_pu_bacteria 2600254931 2600365490 272
127 iso_pu_bacteria 2600254954 2600446664 272
128 iso_pu_bacteria 2600255283 2601624983 272
129 iso_pu_bacteria 2600255296 2601691403 272
130 iso_pu_bacteria 2600255313 2601776956 272
131 iso_pu_bacteria 2600255318 2601797479 272
132 iso_pu_bacteria 2600255389 2602010797 272
133 iso_pu_bacteria 2603880185 2606075788 272
134 iso_pu_bacteria 2603880199 2606130924 272
135 iso_pu_bacteria 2606217733 2608381961 272
136 iso_pu_bacteria 2623620443 2624481743 272
137 iso_pu_bacteria 2623620446 2624491342 272
138 iso_pu_bacteria 2643221565 2643846329 272
139 iso_pu_bacteria 2643221571 2643872951 272
140 iso_pu_bacteria 2643221589 2643952851 272
141 iso_pu_bacteria 2643221602 2644022613 272
142 iso_pu_bacteria 2643221633 2644188826 272
143 iso_pu_bacteria 2643221650 2644286761 272
144 iso_pu_bacteria 2643221713 2644625151 272
145 iso_pu_bacteria 2651869719 2652548620 272
146 iso_pu_bacteria 2667528170 2671091535 272
147 iso_pu_bacteria 2667528171 2671098504 272
148 iso_pu_bacteria 2667528176 2671126208 272
149 iso_pu_bacteria 2671180172 2671768776 272
150 iso_pu_bacteria 2675903420 2677896719 272
151 iso_pu_bacteria 2675903515 2678262791 272
152 iso_pu_bacteria 2713897148 2715751642 272
153 iso_pu_bacteria 2713897149 2715759811 272
154 iso_pu_bacteria 2718217725 2718635015 272
155 iso_pu_bacteria 2721755607 2723247698 272
156 iso_pu_bacteria 2728369097 2729148001 272
157 iso_pu_bacteria 2738541265 2738670330 272
158 iso_pu_bacteria 2738541271 2738688430 272
159 iso_pu_bacteria 2738541282 2738748723 272
160 iso_pu_bacteria 2738541294 2738809608 272
161 iso_pu_bacteria 2738541303 2738857765 272
162 iso_pu_bacteria 2738541309 2738896968 272
163 iso_pu_bacteria 2738543004 2739201523 272
164 iso_pu_bacteria 2738543015 2739259516 272
165 iso_pu_bacteria 2738543016 2739264162 272
166 iso_pu_bacteria 2738543020 2739285188 272
167 iso_pu_bacteria 2738543021 2739290502 272
168 iso_pu_bacteria 2738543025 2739313927 272
169 iso_pu_bacteria 2740892503 2743736573 272
170 iso_pu_bacteria 2744054620 2745009127 272
171 iso_pu_bacteria 2765235841 2765585091 272
172 iso_pu_bacteria 2773857670 2774121061 272
173 iso_pu_bacteria 2773857673 2774137258 272
174 iso_pu_bacteria 2784132063 2784263519 272
175 iso_pu_bacteria 2784132072 2784314134 272
176 iso_pu_bacteria 2791355520 2794598190 272
177 iso_pu_bacteria 2806310737 2807409226 272
178 iso_pu_bacteria 2806310745 2807457528 272
179 iso_pu_bacteria 2808606361 2808854418 272
180 iso_pu_bacteria 2808606376 2808925771 272
181 iso_pu_bacteria 2808606377 2808927662 272
182 iso_pu_bacteria 2808606378 2808934498 272
183 iso_pu_bacteria 2808606379 2808943391 272
184 iso_pu_bacteria 2808606380 2808947872 272
185 iso_pu_bacteria 2808606381 2808949798 272
186 iso_pu_bacteria 2808606382 2808957940 272
187 iso_pu_bacteria 2808606383 2808962923 272
188 iso_pu_bacteria 2808606385 2808975750 272
189 iso_pu_bacteria 2808606388 2808990611 272
190 iso_pu_bacteria 2808606389 2808997660 272
191 iso_pu_bacteria 2808606445 2809216658 272
192 iso_pu_bacteria 2811994881 2812367566 272
193 iso_pu_bacteria 2816332298 2817489603 272
194 iso_pu_bacteria 2818991456 2819656321 272
195 iso_pu_bacteria 2818991464 2819703583 272
196 iso_pu_bacteria 2823421272 2823423369 272
197 iso_pu_bacteria 2825651385 2825652850 272
198 iso_pu_bacteria 2826581358 2826583205 272
199 iso_pu_bacteria 2834028612 2834029523 272
200 iso_pu_bacteria 2842805378 2842810021 272
201 iso_pu_bacteria 2842815866 2842817454 272
202 iso_pu_bacteria 2842826826 2842830988 272
203 iso_pu_bacteria 2842832357 2842837572 272
204 iso_pu_bacteria 2842837860 2842842185 272
205 iso_pu_bacteria 2842843487 2842844482 272
206 iso_pu_bacteria 2842849001 2842850535 272
207 iso_pu_bacteria 2842854478 2842857501 272
208 iso_pu_bacteria 2844665904 2844669454 272
209 iso_pu_bacteria 2852612431 2852614958 272
210 iso_pu_bacteria 2852657418 2852658396 272
211 iso_pu_bacteria 2852667396 2852669926 272
212 iso_pu_bacteria 2860339153 2860339712 272
213 iso_pu_bacteria 2860867994 2860869516 272
214 iso_pu_bacteria 2878029506 2878033725 272
215 iso_pu_bacteria 2880230671 2880234367 272
216 iso_pu_bacteria 2904518522 2904522903 272
217 iso_pu_bacteria 2904550169 2904554373 272
218 iso_pu_bacteria 2908446538 2908448441 272
219 iso_pu_bacteria 2912963787 2912967342 272
220 iso_pu_bacteria 2913036834 2913038765 272
221 iso_pu_bacteria 2917070673 2917072754 272
222 iso_pu_bacteria 2919063839 2919069091 272
223 iso_pu_bacteria 2919155634 2919158428 272
224 iso_pu_bacteria 2919385768 2919387849 272
225 iso_pu_bacteria 2919456309 2919456806 272
226 iso_pu_bacteria 2919481497 2919482038 272
227 iso_pu_bacteria 2919487758 2919490575 272
228 iso_pu_bacteria 2919501602 2919505280 272
229 iso_pu_bacteria 2919697872 2919701148 272
230 iso_pu_bacteria 2923153595 2923155587 272
231 iso_pu_bacteria 2923519811 2923521616 272
232 iso_pu_bacteria 2923586266 2923587093 272
233 iso_pu_bacteria 2926063275 2926066957 272
234 iso_pu_bacteria 2929144301 2929146217 272
235 iso_pu_bacteria 2929189879 2929191494 272
236 iso_pu_bacteria 2931369376 2931370416 272
237 iso_pu_bacteria 2931390751 2931392533 272
238 iso_pu_bacteria 2931396565 2931400388 272
239 iso_pu_bacteria 2935353572 2935354917 272
240 iso_pu_bacteria 2939636861 2939639456 272
241 iso_pu_bacteria 2939651529 2939652858 272
242 iso_pu_bacteria 2945928738 2945929073 272
243 iso_pu_bacteria 2945961074 2945962042 272
244 iso_pu_bacteria 2946006987 2946011297 272
245 iso_pu_bacteria 2946027586 2946029721 272
246 iso_pu_bacteria 2947233263 2947236347 272
247 iso_pu_bacteria 2969304461 2969308513 272
248 iso_pu_bacteria 2974289157 2974290098 272
249 iso_pu_bacteria 2984286254 2984290435 272
250 iso_pu_bacteria 2988728565 2988733742 272
251 iso_pu_bacteria 2990196909 2990199133 272
252 iso_pu_bacteria 2998139840 2998143832 272
253 iso_pu_bacteria 3007395558 3007401126 272
254 iso_pu_bacteria 3007419365 3007421471 272
255 iso_pu_bacteria 3007511990 3007513317 272
256 iso_pu_bacteria 3007614139 3007619555 272
257 iso_pu_bacteria 3007619802 3007624960 272
258 iso_pu_bacteria 3007803356 3007808091 272
259 iso_pu_bacteria 3007855910 3007861001 272
260 iso_pu_bacteria 3007861166 3007861239 272
261 iso_pu_bacteria 3007866637 3007870090 272
262 iso_pu_bacteria 3007872151 3007875510 272
263 iso_pu_bacteria 637000220 637319306 272
264 iso_pu_bacteria 651053060 651175551 272
265 iso_pu_bacteria 8011350971 8011351860 272
266 iso_pu_bacteria 8015687852 8015689847 272
267 iso_pu_bacteria 8019769354 8019772895 272
268 iso_pu_bacteria 8019775933 8019778252 272
269 iso_pu_bacteria 8029995093 8029997045 272
270 iso_pu_bacteria 8034962539 8034963739 272
271 iso_pu_bacteria 8052494512 8052496343 272
272 iso_pu_bacteria 8054285046 8054289662 272
273 iso_pu_bacteria 8054347763 8054351956 272
274 iso_pu_bacteria 8054503363 8054505058 272
275 iso_pu_bacteria 8054929484 8054932474 272
276 iso_pu_bacteria 8055770955 8055772949 272
277 iso_pu_bacteria 8055817908 8055819564 272
278 iso_pu_bacteria 8055878733 8055880636 272
279 iso_pu_bacteria 8056115690 8056118048 272
280 iso_pu_bacteria 8056120720 8056124295 272
281 iso_pu_bacteria 8056125926 8056127843 272
282 iso_pu_bacteria 8056131705 8056133431 272
283 iso_pu_bacteria 8056137416 8056139212 272
284 iso_pu_bacteria 8056143049 8056145156 272
285 iso_pu_bacteria 8056148874 8056149703 272
286 iso_pu_bacteria 8056155041 8056156604 272
287 iso_pu_bacteria 8056161164 8056164845 272
288 iso_pu_bacteria 8056166840 8056167444 272
289 iso_pu_bacteria 8056172158 8056173449 272
290 iso_pu_bacteria 8056177738 8056183613 272
291 iso_pu_bacteria 8056569372 8056573096 272
292 iso_pu_bacteria 8057798959 8057799377 272
293 3300006195 Ga0075366_10000057 Ga0075366_1000005711 273
294 3300050493 nmdc:mga0k408_97_c1 nmdc:mga0k408_97_c1_22870_23709 273
295 3300013102 Ga0157371_10039893 Ga0157371_100398935 274
296 3300048924 Ga0496121_0307850 Ga0496121_0307850_101_928 274
297 3300013100 Ga0157373_10027490 Ga0157373_100274906 275
298 3300013102 Ga0157371_10005382 Ga0157371_1000538211 275
299 3300015261 Ga0182006_1002441 Ga0182006_10024417 275
300 3300027312 Ga0209371_1000245 Ga0209371_100024554 275
301 3300030500 Ga0268256_1000201 Ga0268256_100020154 275
302 3300042000 Ga0439437_000834 Ga0439437_000834_630_1526 275
303 3300042012 Ga0439455_0025721 Ga0439455_0025721_450_1277 275
304 3300042012 Ga0439455_0033881 Ga0439455_0033881_314_1186 275
305 3300042115 Ga0450911_000083 Ga0450911_000083_9245_10189 275
306 3300042142 Ga0450905_002711 Ga0450905_002711_23_850 275
307 3300042156 Ga0439446_0018279 Ga0439446_0018279_792_1736 275
308 3300042438 Ga0439459_0005877 Ga0439459_0005877_913_1785 275
309 3300042439 Ga0439464_0000409 Ga0439464_0000409_2624_3451 275
310 3300042439 Ga0439464_0022690 Ga0439464_0022690_414_1241 275
311 3300042532 Ga0450893_0001894 Ga0450893_0001894_1023_1895 275
312 3300048925 Ga0496122_0191155 Ga0496122_0191155_34_861 275
313 3300048926 Ga0496123_0075191 Ga0496123_0075191_316_1143 275
314 3300049569 Ga0501032_0078869 Ga0501032_0078869_711_1541 275
315 3300049571 Ga0501034_0319183 Ga0501034_0319183_546_1376 275
316 3300049573 Ga0501037_0024841 Ga0501037_0024841_2137_2967 275
317 3300049853 Ga0501226_000009 Ga0501226_000009_53855_54682 275
318 2124908027 MRS2a_Contig_7 MRS2a_00558350 276
319 2162886007 SwRhRL2b_contig_1594327 SwRhRL2b_0467.00006330 276
320 2162886007 SwRhRL2b_contig_241481 SwRhRL2b_0194.00005540 276
321 3300002737 JGI25162J39368_1000391 JGI25162J39368_100039132 276
322 3300002738 JGI25154J39366_1005613 JGI25154J39366_10056131 276
323 3300002771 JGI25163J39215_1001597 JGI25163J39215_10015971 276
324 3300002771 JGI25163J39215_1001662 JGI25163J39215_10016621 276
325 3300002772 JGI25164J39214_1000089 JGI25164J39214_100008945 276
326 3300002772 JGI25164J39214_1000279 JGI25164J39214_100027932 276
327 3300003214 JGI25165J46597_1000191 JGI25165J46597_100019145 276
328 3300003214 JGI25165J46597_1000510 JGI25165J46597_100051013 276
329 3300003751 Ga0055538_1000078 Ga0055538_10000788 276
330 3300003752 Ga0055539_1000119 Ga0055539_10001198 276
331 3300003756 Ga0055533_1000127 Ga0055533_10001278 276
332 3300003758 Ga0055532_1000068 Ga0055532_100006876 276
333 3300003759 Ga0055525_1000163 Ga0055525_10001638 276
334 3300003759 Ga0055525_1003329 Ga0055525_10033291 276
335 3300003781 Ga0055536_1000316 Ga0055536_100031624 276
336 3300003781 Ga0055536_1003702 Ga0055536_10037025 276
337 3300003781 Ga0055536_1003789 Ga0055536_10037895 276
338 3300003791 Ga0055530_10000230 Ga0055530_100002307 276
339 3300003791 Ga0055530_10000462 Ga0055530_1000046224 276
340 3300003791 Ga0055530_10002879 Ga0055530_100028795 276
341 3300003792 Ga0055540_1000241 Ga0055540_10002417 276
342 3300003792 Ga0055540_1001061 Ga0055540_10010617 276
343 3300003792 Ga0055540_1002216 Ga0055540_10022165 276
344 3300003794 Ga0055531_10000511 Ga0055531_100005117 276
345 3300003841 Ga0055541_1000079 Ga0055541_10000798 276
346 3300005288 Ga0065714_10000180 Ga0065714_100001804 276
347 3300005288 Ga0065714_10003160 Ga0065714_100031608 276
348 3300005288 Ga0065714_10007263 Ga0065714_100072633 276
349 3300005288 Ga0065714_10009195 Ga0065714_100091953 276
350 3300005288 Ga0065714_10065863 Ga0065714_100658635 276
351 3300005288 Ga0065714_10066039 Ga0065714_100660396 276
352 3300005288 Ga0065714_10109743 Ga0065714_101097431 276
353 3300005288 Ga0065714_10131632 Ga0065714_101316322 276
354 3300005288 Ga0065714_10142029 Ga0065714_101420292 276
355 3300005289 Ga0065704_10074907 Ga0065704_100749072 276
356 3300005290 Ga0065712_10002471 Ga0065712_100024711 276
357 3300005290 Ga0065712_10009951 Ga0065712_100099512 276
358 3300005290 Ga0065712_10070286 Ga0065712_100702862 276
359 3300005293 Ga0065715_10096155 Ga0065715_100961554 276
360 3300005331 Ga0070670_100017783 Ga0070670_1000177833 276
361 3300005344 Ga0070661_100008283 Ga0070661_1000082831 276
362 3300005353 Ga0070669_100000231 Ga0070669_10000023125 276
363 3300005457 Ga0070662_100001224 Ga0070662_10000122417 276
364 3300005457 Ga0070662_100507935 Ga0070662_1005079351 276
365 3300005539 Ga0068853_100054183 Ga0068853_1000541833 276
366 3300005564 Ga0070664_100007813 Ga0070664_1000078132 276
367 3300005834 Ga0068851_10000055 Ga0068851_1000005556 276
368 3300006058 Ga0075432_10001624 Ga0075432_100016245 276
369 3300006058 Ga0075432_10009420 Ga0075432_100094203 276
370 3300006058 Ga0075432_10022216 Ga0075432_100222162 276
371 3300006058 Ga0075432_10076625 Ga0075432_100766251 276
372 3300006186 Ga0075369_10024550 Ga0075369_100245503 276
373 3300006946 Ga0079104_1000213 Ga0079104_10002135 276
374 3300006946 Ga0079104_1000222 Ga0079104_100022266 276
375 3300009011 Ga0105251_10000158 Ga0105251_1000015811 276
376 3300009011 Ga0105251_10000401 Ga0105251_1000040119 276
377 3300009011 Ga0105251_10003936 Ga0105251_100039367 276
378 3300009011 Ga0105251_10005667 Ga0105251_100056677 276
379 3300009011 Ga0105251_10006323 Ga0105251_100063235 276
380 3300009011 Ga0105251_10009753 Ga0105251_100097535 276
381 3300009011 Ga0105251_10012020 Ga0105251_100120205 276
382 3300009011 Ga0105251_10020539 Ga0105251_100205392 276
383 3300009011 Ga0105251_10021720 Ga0105251_100217203 276
384 3300009011 Ga0105251_10038897 Ga0105251_100388973 276
385 3300009011 Ga0105251_10132236 Ga0105251_101322361 276
386 3300009036 Ga0105244_10001973 Ga0105244_100019739 276
387 3300009036 Ga0105244_10002235 Ga0105244_100022356 276
388 3300009036 Ga0105244_10004076 Ga0105244_100040768 276
389 3300009036 Ga0105244_10004822 Ga0105244_100048227 276
390 3300009036 Ga0105244_10006373 Ga0105244_100063734 276
391 3300009036 Ga0105244_10006900 Ga0105244_100069005 276
392 3300009036 Ga0105244_10013582 Ga0105244_100135826 276
393 3300009036 Ga0105244_10021324 Ga0105244_100213243 276
394 3300009036 Ga0105244_10057618 Ga0105244_100576181 276
395 3300009036 Ga0105244_10070868 Ga0105244_100708681 276
396 3300009092 Ga0105250_10000996 Ga0105250_100009966 276
397 3300009092 Ga0105250_10003977 Ga0105250_100039776 276
398 3300009092 Ga0105250_10013520 Ga0105250_100135203 276
399 3300009092 Ga0105250_10020678 Ga0105250_100206781 276
400 3300009092 Ga0105250_10030110 Ga0105250_100301101 276
401 3300009092 Ga0105250_10162089 Ga0105250_101620891 276
402 3300009148 Ga0105243_10000627 Ga0105243_1000062728 276
403 3300009148 Ga0105243_10002038 Ga0105243_100020387 276
404 3300009148 Ga0105243_10008887 Ga0105243_100088875 276
405 3300009148 Ga0105243_10027936 Ga0105243_100279362 276
406 3300009148 Ga0105243_10034942 Ga0105243_100349422 276
407 3300009148 Ga0105243_10130603 Ga0105243_101306032 276
408 3300009176 Ga0105242_10000734 Ga0105242_1000073421 276
409 3300009177 Ga0105248_10275397 Ga0105248_102753971 276
410 3300009545 Ga0105237_10000730 Ga0105237_1000073014 276
411 3300011119 Ga0105246_10003889 Ga0105246_100038896 276
412 3300011119 Ga0105246_10155032 Ga0105246_101550323 276
413 3300013100 Ga0157373_10004670 Ga0157373_100046707 276
414 3300013100 Ga0157373_10005788 Ga0157373_100057885 276
415 3300013100 Ga0157373_10010115 Ga0157373_100101155 276
416 3300013100 Ga0157373_10010961 Ga0157373_100109615 276
417 3300013100 Ga0157373_10042314 Ga0157373_100423144 276
418 3300013100 Ga0157373_10078983 Ga0157373_100789833 276
419 3300013100 Ga0157373_10090802 Ga0157373_100908021 276
420 3300013102 Ga0157371_10000186 Ga0157371_1000018610 276
421 3300013102 Ga0157371_10003775 Ga0157371_100037756 276
422 3300013102 Ga0157371_10010666 Ga0157371_100106665 276
423 3300013102 Ga0157371_10035327 Ga0157371_100353275 276
424 3300013104 Ga0157370_10004247 Ga0157370_100042476 276
425 3300013104 Ga0157370_10013623 Ga0157370_100136236 276
426 3300013104 Ga0157370_10073748 Ga0157370_100737483 276
427 3300013104 Ga0157370_10085837 Ga0157370_100858372 276
428 3300013104 Ga0157370_10127606 Ga0157370_101276061 276
429 3300013104 Ga0157370_10343596 Ga0157370_103435962 276
430 3300013104 Ga0157370_10380740 Ga0157370_103807402 276
431 3300013105 Ga0157369_10033267 Ga0157369_100332675 276
432 3300013105 Ga0157369_10036486 Ga0157369_100364862 276
433 3300013306 Ga0163162_10011325 Ga0163162_100113256 276
434 3300013307 Ga0157372_10004510 Ga0157372_1000451011 276
435 3300013307 Ga0157372_10040263 Ga0157372_100402636 276
436 3300013308 Ga0157375_10012012 Ga0157375_100120125 276
437 3300013308 Ga0157375_10674839 Ga0157375_106748392 276
438 3300014497 Ga0182008_10001777 Ga0182008_100017779 276
439 3300014497 Ga0182008_10006367 Ga0182008_100063675 276
440 3300014497 Ga0182008_10007869 Ga0182008_100078696 276
441 3300014497 Ga0182008_10008096 Ga0182008_100080963 276
442 3300014497 Ga0182008_10009790 Ga0182008_100097903 276
443 3300014497 Ga0182008_10017212 Ga0182008_100172124 276
444 3300014497 Ga0182008_10018226 Ga0182008_100182264 276
445 3300015261 Ga0182006_1003793 Ga0182006_10037935 276
446 3300015261 Ga0182006_1003932 Ga0182006_10039325 276
447 3300015261 Ga0182006_1004298 Ga0182006_10042987 276
448 3300015261 Ga0182006_1013700 Ga0182006_10137005 276
449 3300015261 Ga0182006_1016252 Ga0182006_10162521 276
450 3300015262 Ga0182007_10002905 Ga0182007_100029056 276
451 3300015262 Ga0182007_10008233 Ga0182007_100082333 276
452 3300015262 Ga0182007_10023244 Ga0182007_100232441 276
453 3300015265 Ga0182005_1014060 Ga0182005_10140603 276
454 3300015265 Ga0182005_1047910 Ga0182005_10479101 276
455 3300017792 Ga0163161_10040090 Ga0163161_100400905 276
456 3300017792 Ga0163161_10152410 Ga0163161_101524102 276
457 3300017792 Ga0163161_10181188 Ga0163161_101811882 276
458 3300017792 Ga0163161_10216202 Ga0163161_102162021 276
459 3300025206 Ga0209435_102520 Ga0209435_1025203 276
460 3300025207 Ga0209760_100087 Ga0209760_10008729 276
461 3300025207 Ga0209760_100145 Ga0209760_10014513 276
462 3300025207 Ga0209760_100173 Ga0209760_10017312 276
463 3300025224 Ga0209784_100015 Ga0209784_100015435 276
464 3300025225 Ga0209566_100012 Ga0209566_100012435 276
465 3300025226 Ga0209674_100027 Ga0209674_100027435 276
466 3300025229 Ga0209147_100019 Ga0209147_100019435 276
467 3300025230 Ga0209563_100031 Ga0209563_100031435 276
468 3300025230 Ga0209563_100856 Ga0209563_1008568 276
469 3300025231 Ga0207427_100001 Ga0207427_1000011227 276
470 3300025231 Ga0207427_100048 Ga0207427_10004873 276
471 3300025233 Ga0209437_100003 Ga0209437_100003145 276
472 3300025233 Ga0209437_100094 Ga0209437_10009473 276
473 3300025233 Ga0209437_104886 Ga0209437_1048863 276
474 3300025246 Ga0209646_1000324 Ga0209646_10003247 276
475 3300025253 Ga0209677_100016 Ga0209677_100016435 276
476 3300025256 Ga0209759_1015352 Ga0209759_10153523 276
477 3300025261 Ga0209233_1000007 Ga0209233_10000071227 276
478 3300025261 Ga0209233_1000106 Ga0209233_1000106184 276
479 3300025291 Ga0209675_1007693 Ga0209675_10076934 276
480 3300025292 Ga0209676_1000002 Ga0209676_100000264 276
481 3300025292 Ga0209676_1000021 Ga0209676_1000021536 276
482 3300025292 Ga0209676_1000166 Ga0209676_1000166106 276
483 3300025292 Ga0209676_1002655 Ga0209676_100265512 276
484 3300025292 Ga0209676_1013379 Ga0209676_10133793 276
485 3300025298 Ga0209050_1000009 Ga0209050_1000009556 276
486 3300025298 Ga0209050_1000275 Ga0209050_100027578 276
487 3300025298 Ga0209050_1000395 Ga0209050_100039547 276
488 3300025298 Ga0209050_1003875 Ga0209050_10038755 276
489 3300025303 Ga0209051_1000001 Ga0209051_100000164 276
490 3300025303 Ga0209051_1000008 Ga0209051_1000008313 276
491 3300025303 Ga0209051_1000585 Ga0209051_100058514 276
492 3300025304 Ga0209257_1000181 Ga0209257_100018178 276
493 3300025304 Ga0209257_1015751 Ga0209257_10157514 276
494 3300025321 Ga0207656_10000659 Ga0207656_100006594 276
495 3300025711 Ga0207696_1000019 Ga0207696_1000019346 276
496 3300025711 Ga0207696_1000063 Ga0207696_100006348 276
497 3300025711 Ga0207696_1000117 Ga0207696_100011759 276
498 3300025711 Ga0207696_1000274 Ga0207696_10002746 276
499 3300025711 Ga0207696_1003502 Ga0207696_10035027 276
500 3300025711 Ga0207696_1005934 Ga0207696_10059345 276
501 3300025711 Ga0207696_1021415 Ga0207696_10214151 276
502 3300025728 Ga0207655_1000019 Ga0207655_1000019118 276
503 3300025728 Ga0207655_1000084 Ga0207655_10000847 276
504 3300025728 Ga0207655_1000096 Ga0207655_1000096169 276
505 3300025728 Ga0207655_1000216 Ga0207655_100021683 276
506 3300025728 Ga0207655_1000835 Ga0207655_10008352 276
507 3300025728 Ga0207655_1002510 Ga0207655_100251012 276
508 3300025728 Ga0207655_1002846 Ga0207655_10028468 276
509 3300025728 Ga0207655_1003156 Ga0207655_10031567 276
510 3300025728 Ga0207655_1003902 Ga0207655_10039026 276
511 3300025728 Ga0207655_1005894 Ga0207655_10058943 276
512 3300025728 Ga0207655_1007227 Ga0207655_10072274 276
513 3300025728 Ga0207655_1019172 Ga0207655_10191723 276
514 3300025728 Ga0207655_1056970 Ga0207655_10569702 276
515 3300025735 Ga0207713_1000058 Ga0207713_1000058119 276
516 3300025735 Ga0207713_1000160 Ga0207713_100016071 276
517 3300025735 Ga0207713_1003721 Ga0207713_10037217 276
518 3300025735 Ga0207713_1004302 Ga0207713_100430210 276
519 3300025735 Ga0207713_1004421 Ga0207713_10044216 276
520 3300025735 Ga0207713_1004598 Ga0207713_10045987 276
521 3300025735 Ga0207713_1005603 Ga0207713_10056037 276
522 3300025735 Ga0207713_1011997 Ga0207713_10119976 276
523 3300025735 Ga0207713_1024386 Ga0207713_10243862 276
524 3300025735 Ga0207713_1025426 Ga0207713_10254263 276
525 3300025735 Ga0207713_1028021 Ga0207713_10280213 276
526 3300025735 Ga0207713_1068331 Ga0207713_10683311 276
527 3300025914 Ga0207671_10000079 Ga0207671_1000007939 276
528 3300025920 Ga0207649_10000002 Ga0207649_1000000292 276
529 3300025923 Ga0207681_10000143 Ga0207681_100001437 276
530 3300025923 Ga0207681_10131632 Ga0207681_101316322 276
531 3300025925 Ga0207650_10002170 Ga0207650_100021706 276
532 3300025925 Ga0207650_10004358 Ga0207650_100043586 276
533 3300025933 Ga0207706_10003826 Ga0207706_100038264 276
534 3300025935 Ga0207709_10000045 Ga0207709_10000045132 276
535 3300025935 Ga0207709_10000763 Ga0207709_1000076321 276
536 3300025935 Ga0207709_10008423 Ga0207709_100084235 276
537 3300025935 Ga0207709_10049379 Ga0207709_100493792 276
538 3300025935 Ga0207709_10051325 Ga0207709_100513251 276
539 3300025935 Ga0207709_10091677 Ga0207709_100916772 276
540 3300025941 Ga0207711_10052700 Ga0207711_100527004 276
541 3300025945 Ga0207679_10000006 Ga0207679_10000006399 276
542 3300026041 Ga0207639_10037922 Ga0207639_100379224 276
543 3300027111 Ga0209281_1000011 Ga0209281_1000011101 276
544 3300027111 Ga0209281_1000090 Ga0209281_100009067 276
545 3300027111 Ga0209281_1004373 Ga0209281_10043734 276
546 3300027296 Ga0209389_1000053 Ga0209389_100005315 276
547 3300027312 Ga0209371_1000513 Ga0209371_100051325 276
548 3300027395 Ga0209996_1000654 Ga0209996_10006543 276
549 3300027666 Ga0209282_1019657 Ga0209282_10196573 276
550 3300027682 Ga0209971_1000371 Ga0209971_10003718 276
551 3300027907 Ga0207428_10043582 Ga0207428_100435823 276
552 3300027907 Ga0207428_10046802 Ga0207428_100468024 276
553 3300027907 Ga0207428_10240691 Ga0207428_102406912 276
554 3300028786 Ga0307517_10029448 Ga0307517_100294483 276
555 3300030500 Ga0268256_1000441 Ga0268256_100044125 276
556 3300030733 Ga0314311_1110334 Ga0314311_11103349 276
557 3300030735 Ga0316178_1017010 Ga0316178_101701010 276
558 3300031507 Ga0307509_10134402 Ga0307509_101344021 276
559 3300031548 Ga0307408_100000018 Ga0307408_100000018192 276
560 3300031548 Ga0307408_100014661 Ga0307408_1000146614 276
561 3300031731 Ga0307405_10001157 Ga0307405_100011576 276
562 3300031731 Ga0307405_10003239 Ga0307405_100032395 276
563 3300031731 Ga0307405_10006597 Ga0307405_100065974 276
564 3300031731 Ga0307405_10039823 Ga0307405_100398232 276
565 3300031901 Ga0307406_10224128 Ga0307406_102241282 276
566 3300031903 Ga0307407_10102036 Ga0307407_101020362 276
567 3300031911 Ga0307412_10001593 Ga0307412_100015935 276
568 3300031911 Ga0307412_10004029 Ga0307412_100040297 276
569 3300031911 Ga0307412_10004082 Ga0307412_100040826 276
570 3300031911 Ga0307412_10028821 Ga0307412_100288212 276
571 3300032004 Ga0307414_10041413 Ga0307414_100414133 276
572 3300032004 Ga0307414_10085548 Ga0307414_100855481 276
573 3300032004 Ga0307414_10513362 Ga0307414_105133621 276
574 3300032005 Ga0307411_10036808 Ga0307411_100368082 276
575 3300041404 Ga0439436_0002628 Ga0439436_0002628_46_876 276
576 3300041405 Ga0439438_000536 Ga0439438_000536_9393_10223 276
577 3300041405 Ga0439438_001084 Ga0439438_001084_6541_7374 276
578 3300041405 Ga0439438_003740 Ga0439438_003740_2688_3518 276
579 3300041405 Ga0439438_004003 Ga0439438_004003_2308_3138 276
580 3300041405 Ga0439438_007668 Ga0439438_007668_1762_2592 276
581 3300041405 Ga0439438_013102 Ga0439438_013102_961_1791 276
582 3300041407 Ga0439447_006569 Ga0439447_006569_2800_3630 276
583 3300041407 Ga0439447_007774 Ga0439447_007774_2406_3236 276
584 3300041407 Ga0439447_013358 Ga0439447_013358_453_1283 276
585 3300041407 Ga0439447_018294 Ga0439447_018294_689_1519 276
586 3300041411 Ga0439466_0000821 Ga0439466_0000821_9761_10591 276
587 3300041411 Ga0439466_0001319 Ga0439466_0001319_3838_4668 276
588 3300041411 Ga0439466_0006960 Ga0439466_0006960_1074_1904 276
589 3300041411 Ga0439466_0007055 Ga0439466_0007055_2004_2894 276
590 3300041411 Ga0439466_0025311 Ga0439466_0025311_356_1186 276
591 3300041486 Ga0451807_1281855 Ga0451807_1281855_65_895 276
592 3300042006 Ga0439432_000869 Ga0439432_000869_5632_6462 276
593 3300042006 Ga0439432_001543 Ga0439432_001543_4780_5610 276
594 3300042009 Ga0439451_009009 Ga0439451_009009_439_1269 276
595 3300042009 Ga0439451_009893 Ga0439451_009893_1072_1902 276
596 3300042010 Ga0439452_002052 Ga0439452_002052_2945_3775 276
597 3300042010 Ga0439452_002220 Ga0439452_002220_3258_4088 276
598 3300042010 Ga0439452_002653 Ga0439452_002653_2452_3282 276
599 3300042010 Ga0439452_003972 Ga0439452_003972_3481_4311 276
600 3300042010 Ga0439452_004192 Ga0439452_004192_124_954 276
601 3300042010 Ga0439452_017594 Ga0439452_017594_408_1238 276
602 3300042010 Ga0439452_038520 Ga0439452_038520_115_945 276
603 3300042013 Ga0439456_000070 Ga0439456_000070_7558_8388 276
604 3300042013 Ga0439456_003090 Ga0439456_003090_269_1099 276
605 3300042013 Ga0439456_003963 Ga0439456_003963_1673_2503 276
606 3300042016 Ga0439463_001163 Ga0439463_001163_3262_4092 276
607 3300042016 Ga0439463_002510 Ga0439463_002510_3057_3887 276
608 3300042016 Ga0439463_003607 Ga0439463_003607_2396_3226 276
609 3300042016 Ga0439463_011698 Ga0439463_011698_1281_2111 276
610 3300042115 Ga0450911_001065 Ga0450911_001065_2339_3169 276
611 3300042121 Ga0450919_008608 Ga0450919_008608_321_1151 276
612 3300042122 Ga0450920_003629 Ga0450920_003629_1234_2064 276
613 3300042124 Ga0450922_001979 Ga0450922_001979_132_962 276
614 3300042137 Ga0450902_004472 Ga0450902_004472_1111_1941 276
615 3300042138 Ga0450903_003228 Ga0450903_003228_625_1455 276
616 3300042139 Ga0450904_000082 Ga0450904_000082_11111_11986 276
617 3300042139 Ga0450904_003798 Ga0450904_003798_721_1551 276
618 3300042142 Ga0450905_001446 Ga0450905_001446_1874_2704 276
619 3300042146 Ga0450907_000625 Ga0450907_000625_2494_3324 276
620 3300042146 Ga0450907_000684 Ga0450907_000684_5961_6791 276
621 3300042146 Ga0450907_013911 Ga0450907_013911_192_1022 276
622 3300042147 Ga0450910_004928 Ga0450910_004928_664_1494 276
623 3300042156 Ga0439446_0002180 Ga0439446_0002180_3315_4145 276
624 3300042185 Ga0450909_001873 Ga0450909_001873_264_1094 276
625 3300042438 Ga0439459_0029921 Ga0439459_0029921_19_849 276
626 3300042439 Ga0439464_0001480 Ga0439464_0001480_2699_3529 276
627 3300042461 Ga0439460_0001529 Ga0439460_0001529_2458_3288 276
628 3300042461 Ga0439460_0023703 Ga0439460_0023703_91_921 276
629 3300042533 Ga0450901_000162 Ga0450901_000162_4951_5781 276
630 3300042876 Ga0451577_0052572 Ga0451577_0052572_858_1688 276
631 3300046452 Ga0495617_002382 Ga0495617_002382_3961_4791 276
632 3300046452 Ga0495617_003876 Ga0495617_003876_1685_2515 276
633 3300046452 Ga0495617_006286 Ga0495617_006286_646_1476 276
634 3300046452 Ga0495617_014919 Ga0495617_014919_73_903 276
635 3300046453 Ga0495627_000051 Ga0495627_000051_54447_55277 276
636 3300046453 Ga0495627_000140 Ga0495627_000140_72877_73707 276
637 3300046453 Ga0495627_005064 Ga0495627_005064_4078_4908 276
638 3300046453 Ga0495627_013658 Ga0495627_013658_1814_2644 276
639 3300046455 Ga0495603_0017557 Ga0495603_0017557_440_1270 276
640 3300046455 Ga0495603_0017842 Ga0495603_0017842_3206_4036 276
641 3300046455 Ga0495603_0058067 Ga0495603_0058067_571_1401 276
642 3300046457 Ga0495590_0002910 Ga0495590_0002910_3498_4328 276
643 3300046457 Ga0495590_0003453 Ga0495590_0003453_2921_3751 276
644 3300046457 Ga0495590_0012739 Ga0495590_0012739_2258_3088 276
645 3300046458 Ga0495591_000018 Ga0495591_000018_230748_231578 276
646 3300046458 Ga0495591_000720 Ga0495591_000720_7713_8543 276
647 3300046458 Ga0495591_002135 Ga0495591_002135_7741_8571 276
648 3300046458 Ga0495591_002739 Ga0495591_002739_2647_3477 276
649 3300046458 Ga0495591_003389 Ga0495591_003389_3127_3957 276
650 3300046458 Ga0495591_003954 Ga0495591_003954_2554_3384 276
651 3300046458 Ga0495591_021328 Ga0495591_021328_331_1161 276
652 3300046458 Ga0495591_027318 Ga0495591_027318_908_1738 276
653 3300046458 Ga0495591_037719 Ga0495591_037719_79_909 276
654 3300046458 Ga0495591_055495 Ga0495591_055495_117_947 276
655 3300046460 Ga0495638_0008086 Ga0495638_0008086_3704_4534 276
656 3300046460 Ga0495638_0009256 Ga0495638_0009256_2444_3274 276
657 3300046460 Ga0495638_0013737 Ga0495638_0013737_2232_3062 276
658 3300046460 Ga0495638_0014242 Ga0495638_0014242_2135_2965 276
659 3300046460 Ga0495638_0049388 Ga0495638_0049388_745_1575 276
660 3300046460 Ga0495638_0091040 Ga0495638_0091040_317_1147 276
661 3300046460 Ga0495638_0215543 Ga0495638_0215543_226_1056 276
662 3300046463 Ga0495653_0019000 Ga0495653_0019000_4541_5371 276
663 3300046471 Ga0495650_0001745 Ga0495650_0001745_13831_14661 276
664 3300046471 Ga0495650_0005287 Ga0495650_0005287_3347_4177 276
665 3300046471 Ga0495650_0005747 Ga0495650_0005747_3904_4734 276
666 3300046471 Ga0495650_0007282 Ga0495650_0007282_2417_3247 276
667 3300046471 Ga0495650_0007355 Ga0495650_0007355_3098_3928 276
668 3300046471 Ga0495650_0008282 Ga0495650_0008282_3069_3899 276
669 3300046471 Ga0495650_0009449 Ga0495650_0009449_2514_3344 276
670 3300046474 Ga0495605_0000036 Ga0495605_0000036_105354_106184 276
671 3300046474 Ga0495605_0000222 Ga0495605_0000222_13555_14385 276
672 3300046474 Ga0495605_0001613 Ga0495605_0001613_5397_6227 276
673 3300046474 Ga0495605_0002842 Ga0495605_0002842_9027_9857 276
674 3300046474 Ga0495605_0003110 Ga0495605_0003110_5240_6070 276
675 3300046474 Ga0495605_0004637 Ga0495605_0004637_3233_4063 276
676 3300046474 Ga0495605_0008220 Ga0495605_0008220_2744_3574 276
677 3300046474 Ga0495605_0020220 Ga0495605_0020220_2677_3507 276
678 3300046475 Ga0495639_0002536 Ga0495639_0002536_3201_4031 276
679 3300046491 Ga0495584_0004201 Ga0495584_0004201_2979_3809 276
680 3300046491 Ga0495584_0004645 Ga0495584_0004645_2502_3332 276
681 3300046491 Ga0495584_0005069 Ga0495584_0005069_3051_3881 276
682 3300046491 Ga0495584_0013739 Ga0495584_0013739_2556_3386 276
683 3300046491 Ga0495584_0015717 Ga0495584_0015717_74_904 276
684 3300046491 Ga0495584_0019288 Ga0495584_0019288_158_988 276
685 3300046492 Ga0495585_0003948 Ga0495585_0003948_6251_7081 276
686 3300046492 Ga0495585_0005318 Ga0495585_0005318_1607_2437 276
687 3300046492 Ga0495585_0005667 Ga0495585_0005667_2425_3255 276
688 3300046492 Ga0495585_0026931 Ga0495585_0026931_2430_3260 276
689 3300046492 Ga0495585_0032074 Ga0495585_0032074_1789_2619 276
690 3300046499 Ga0495594_0024608 Ga0495594_0024608_2023_2853 276
691 3300046499 Ga0495594_0113999 Ga0495594_0113999_658_1488 276
692 3300046500 Ga0495596_0000105 Ga0495596_0000105_6084_6914 276
693 3300046501 Ga0495607_0000335 Ga0495607_0000335_9697_10527 276
694 3300046501 Ga0495607_0000679 Ga0495607_0000679_4525_5355 276
695 3300046501 Ga0495607_0000685 Ga0495607_0000685_17478_18308 276
696 3300046501 Ga0495607_0003854 Ga0495607_0003854_2774_3604 276
697 3300046501 Ga0495607_0004015 Ga0495607_0004015_7251_8081 276
698 3300046501 Ga0495607_0005200 Ga0495607_0005200_4726_5556 276
699 3300046501 Ga0495607_0008559 Ga0495607_0008559_28_858 276
700 3300046501 Ga0495607_0009291 Ga0495607_0009291_4563_5393 276
701 3300046501 Ga0495607_0010574 Ga0495607_0010574_3290_4120 276
702 3300046501 Ga0495607_0017209 Ga0495607_0017209_1878_2708 276
703 3300046501 Ga0495607_0019750 Ga0495607_0019750_1227_2057 276
704 3300046501 Ga0495607_0022541 Ga0495607_0022541_2129_2959 276
705 3300046501 Ga0495607_0025860 Ga0495607_0025860_717_1547 276
706 3300046501 Ga0495607_0069243 Ga0495607_0069243_985_1815 276
707 3300046501 Ga0495607_0092086 Ga0495607_0092086_323_1153 276
708 3300046501 Ga0495607_0112208 Ga0495607_0112208_479_1309 276
709 3300046501 Ga0495607_0200992 Ga0495607_0200992_73_903 276
710 3300046506 Ga0495583_0000028 Ga0495583_0000028_118603_119433 276
711 3300046506 Ga0495583_0000561 Ga0495583_0000561_16014_16844 276
712 3300046506 Ga0495583_0001188 Ga0495583_0001188_20845_21675 276
713 3300046506 Ga0495583_0002128 Ga0495583_0002128_1841_2671 276
714 3300046506 Ga0495583_0006609 Ga0495583_0006609_2697_3527 276
715 3300046506 Ga0495583_0013452 Ga0495583_0013452_2793_3623 276
716 3300046507 Ga0495606_0000094 Ga0495606_0000094_7674_8504 276
717 3300046507 Ga0495606_0000502 Ga0495606_0000502_3554_4414 276
718 3300046507 Ga0495606_0000958 Ga0495606_0000958_33346_34176 276
719 3300046507 Ga0495606_0007380 Ga0495606_0007380_3782_4612 276
720 3300046507 Ga0495606_0009190 Ga0495606_0009190_4280_5110 276
721 3300046507 Ga0495606_0009383 Ga0495606_0009383_4863_5693 276
722 3300046507 Ga0495606_0011707 Ga0495606_0011707_2787_3617 276
723 3300046507 Ga0495606_0021273 Ga0495606_0021273_2624_3454 276
724 3300046507 Ga0495606_0033029 Ga0495606_0033029_2673_3503 276
725 3300046507 Ga0495606_0038357 Ga0495606_0038357_19_849 276
726 3300046507 Ga0495606_0039380 Ga0495606_0039380_1594_2424 276
727 3300046507 Ga0495606_0048675 Ga0495606_0048675_1125_1955 276
728 3300046512 Ga0495610_0002667 Ga0495610_0002667_1765_2595 276
729 3300046512 Ga0495610_0004363 Ga0495610_0004363_6482_7312 276
730 3300046512 Ga0495610_0006420 Ga0495610_0006420_4560_5483 276
731 3300046512 Ga0495610_0007567 Ga0495610_0007567_2260_3090 276
732 3300046512 Ga0495610_0009101 Ga0495610_0009101_2221_3051 276
733 3300046512 Ga0495610_0012501 Ga0495610_0012501_1400_2230 276
734 3300046512 Ga0495610_0012916 Ga0495610_0012916_1622_2452 276
735 3300046512 Ga0495610_0012994 Ga0495610_0012994_3354_4184 276
736 3300046512 Ga0495610_0018171 Ga0495610_0018171_62_892 276
737 3300046512 Ga0495610_0022406 Ga0495610_0022406_464_1294 276
738 3300046513 Ga0495616_0003437 Ga0495616_0003437_4415_5245 276
739 3300046513 Ga0495616_0006678 Ga0495616_0006678_3295_4125 276
740 3300046513 Ga0495616_0015018 Ga0495616_0015018_714_1544 276
741 3300046513 Ga0495616_0114052 Ga0495616_0114052_396_1226 276
742 3300046515 Ga0495620_0000035 Ga0495620_0000035_106890_107720 276
743 3300046515 Ga0495620_0000073 Ga0495620_0000073_7491_8321 276
744 3300046515 Ga0495620_0001062 Ga0495620_0001062_7693_8523 276
745 3300046515 Ga0495620_0001625 Ga0495620_0001625_7974_8804 276
746 3300046515 Ga0495620_0002881 Ga0495620_0002881_3044_3874 276
747 3300046515 Ga0495620_0005281 Ga0495620_0005281_3205_4035 276
748 3300046515 Ga0495620_0006669 Ga0495620_0006669_3018_3848 276
749 3300046515 Ga0495620_0038029 Ga0495620_0038029_57_887 276
750 3300046517 Ga0495630_0052580 Ga0495630_0052580_729_1559 276
751 3300046517 Ga0495630_0442925 Ga0495630_0442925_129_959 276
752 3300046518 Ga0495631_0000484 Ga0495631_0000484_20570_21400 276
753 3300046518 Ga0495631_0002563 Ga0495631_0002563_6044_6874 276
754 3300046518 Ga0495631_0006603 Ga0495631_0006603_2964_3794 276
755 3300046518 Ga0495631_0008892 Ga0495631_0008892_2405_3235 276
756 3300046518 Ga0495631_0010624 Ga0495631_0010624_418_1248 276
757 3300046518 Ga0495631_0013067 Ga0495631_0013067_278_1108 276
758 3300046519 Ga0495632_0000449 Ga0495632_0000449_32657_33487 276
759 3300046519 Ga0495632_0000460 Ga0495632_0000460_30317_31147 276
760 3300046519 Ga0495632_0006467 Ga0495632_0006467_3982_4812 276
761 3300046519 Ga0495632_0006789 Ga0495632_0006789_4752_5582 276
762 3300046519 Ga0495632_0007385 Ga0495632_0007385_3064_3894 276
763 3300046519 Ga0495632_0008270 Ga0495632_0008270_3266_4096 276
764 3300046519 Ga0495632_0016194 Ga0495632_0016194_868_1698 276
765 3300046519 Ga0495632_0019868 Ga0495632_0019868_1415_2245 276
766 3300046519 Ga0495632_0166286 Ga0495632_0166286_77_907 276
767 3300046520 Ga0495637_0000015 Ga0495637_0000015_209476_210306 276
768 3300046520 Ga0495637_0002724 Ga0495637_0002724_3896_4726 276
769 3300046520 Ga0495637_0005808 Ga0495637_0005808_2728_3558 276
770 3300046520 Ga0495637_0006843 Ga0495637_0006843_2460_3290 276
771 3300046520 Ga0495637_0009520 Ga0495637_0009520_2830_3660 276
772 3300046520 Ga0495637_0010639 Ga0495637_0010639_1439_2269 276
773 3300046520 Ga0495637_0011436 Ga0495637_0011436_1357_2187 276
774 3300046520 Ga0495637_0014163 Ga0495637_0014163_490_1320 276
775 3300046520 Ga0495637_0017411 Ga0495637_0017411_15_845 276
776 3300046520 Ga0495637_0024973 Ga0495637_0024973_194_1024 276
777 3300046520 Ga0495637_0029830 Ga0495637_0029830_663_1493 276
778 3300046520 Ga0495637_0036053 Ga0495637_0036053_1280_2110 276
779 3300046520 Ga0495637_0065381 Ga0495637_0065381_40_870 276
780 3300046522 Ga0495643_0000345 Ga0495643_0000345_57280_58110 276
781 3300046522 Ga0495643_0000609 Ga0495643_0000609_3732_4592 276
782 3300046522 Ga0495643_0002906 Ga0495643_0002906_8157_8987 276
783 3300046522 Ga0495643_0007212 Ga0495643_0007212_3914_4744 276
784 3300046522 Ga0495643_0007758 Ga0495643_0007758_3615_4445 276
785 3300046522 Ga0495643_0013059 Ga0495643_0013059_537_1367 276
786 3300046522 Ga0495643_0021487 Ga0495643_0021487_1544_2374 276
787 3300046522 Ga0495643_0080262 Ga0495643_0080262_87_917 276
788 3300046522 Ga0495643_0142747 Ga0495643_0142747_243_1103 276
789 3300046523 Ga0495644_0002921 Ga0495644_0002921_2387_3217 276
790 3300046523 Ga0495644_0003463 Ga0495644_0003463_1978_2808 276
791 3300046524 Ga0495648_0000589 Ga0495648_0000589_7671_8501 276
792 3300046524 Ga0495648_0005619 Ga0495648_0005619_3446_4276 276
793 3300046524 Ga0495648_0007013 Ga0495648_0007013_3841_4671 276
794 3300046524 Ga0495648_0010791 Ga0495648_0010791_3768_4598 276
795 3300046524 Ga0495648_0013954 Ga0495648_0013954_3448_4278 276
796 3300046524 Ga0495648_0022408 Ga0495648_0022408_2154_2984 276
797 3300046524 Ga0495648_0045597 Ga0495648_0045597_492_1322 276
798 3300046524 Ga0495648_0125615 Ga0495648_0125615_52_882 276
799 3300046526 Ga0495666_0005790 Ga0495666_0005790_4310_5140 276
800 3300046528 Ga0495642_0001589 Ga0495642_0001589_2994_3824 276
801 3300046528 Ga0495642_0002566 Ga0495642_0002566_4043_4873 276
802 3300046530 Ga0495654_0000871 Ga0495654_0000871_11549_12379 276
803 3300046530 Ga0495654_0001727 Ga0495654_0001727_7426_8256 276
804 3300046530 Ga0495654_0005242 Ga0495654_0005242_4018_4848 276
805 3300046530 Ga0495654_0005682 Ga0495654_0005682_2459_3289 276
806 3300046530 Ga0495654_0006344 Ga0495654_0006344_3024_3854 276
807 3300046530 Ga0495654_0007076 Ga0495654_0007076_1499_2329 276
808 3300046530 Ga0495654_0016243 Ga0495654_0016243_1054_1884 276
809 3300046530 Ga0495654_0022154 Ga0495654_0022154_33_863 276
810 3300046530 Ga0495654_0047501 Ga0495654_0047501_707_1537 276
811 3300046530 Ga0495654_0058238 Ga0495654_0058238_877_1707 276
812 3300046530 Ga0495654_0107610 Ga0495654_0107610_380_1240 276
813 3300046530 Ga0495654_0154593 Ga0495654_0154593_11_841 276
814 3300046535 Ga0495586_0253958 Ga0495586_0253958_146_976 276
815 3300046536 Ga0495587_0006210 Ga0495587_0006210_2720_3550 276
816 3300046538 Ga0495609_0000035 Ga0495609_0000035_176856_177686 276
817 3300046538 Ga0495609_0000162 Ga0495609_0000162_27317_28147 276
818 3300046538 Ga0495609_0000569 Ga0495609_0000569_16076_16906 276
819 3300046538 Ga0495609_0029729 Ga0495609_0029729_74_904 276
820 3300046538 Ga0495609_0067451 Ga0495609_0067451_469_1299 276
821 3300046538 Ga0495609_0165608 Ga0495609_0165608_50_880 276
822 3300046542 Ga0495597_0000044 Ga0495597_0000044_93038_93868 276
823 3300046542 Ga0495597_0002661 Ga0495597_0002661_4047_4877 276
824 3300046542 Ga0495597_0004928 Ga0495597_0004928_2810_3640 276
825 3300046542 Ga0495597_0011362 Ga0495597_0011362_740_1570 276
826 3300046542 Ga0495597_0030461 Ga0495597_0030461_1580_2410 276
827 3300046542 Ga0495597_0042816 Ga0495597_0042816_27_857 276
828 3300046542 Ga0495597_0046211 Ga0495597_0046211_469_1299 276
829 3300046542 Ga0495597_0067290 Ga0495597_0067290_14_844 276
830 3300046557 Ga0495622_0003194 Ga0495622_0003194_3945_4775 276
831 3300046557 Ga0495622_0076114 Ga0495622_0076114_474_1304 276
832 3300046557 Ga0495622_0191022 Ga0495622_0191022_25_855 276
833 3300046558 Ga0495633_0000028 Ga0495633_0000028_128529_129359 276
834 3300046558 Ga0495633_0008320 Ga0495633_0008320_3522_4352 276
835 3300046616 Ga0495668_0004916 Ga0495668_0004916_2389_3219 276
836 3300046616 Ga0495668_0010092 Ga0495668_0010092_3980_4810 276
837 3300046616 Ga0495668_0012890 Ga0495668_0012890_1385_2215 276
838 3300046616 Ga0495668_0023225 Ga0495668_0023225_2658_3488 276
839 3300046616 Ga0495668_0036646 Ga0495668_0036646_1821_2651 276
840 3300046642 Ga0495634_0007654 Ga0495634_0007654_4588_5418 276
841 3300046648 Ga0495611_0001242 Ga0495611_0001242_9824_10654 276
842 3300046648 Ga0495611_0001633 Ga0495611_0001633_9207_10037 276
843 3300046648 Ga0495611_0002739 Ga0495611_0002739_4052_4882 276
844 3300046660 Ga0495625_0000004 Ga0495625_0000004_187693_188523 276
845 3300046660 Ga0495625_0011499 Ga0495625_0011499_3317_4147 276
846 3300046660 Ga0495625_0030660 Ga0495625_0030660_3044_3874 276
847 3300046660 Ga0495625_0076739 Ga0495625_0076739_64_894 276
848 3300046660 Ga0495625_0105121 Ga0495625_0105121_494_1324 276
849 3300046663 Ga0495635_0034375 Ga0495635_0034375_1026_1856 276
850 3300046664 Ga0495659_0001557 Ga0495659_0001557_3958_4788 276
851 3300046664 Ga0495659_0005645 Ga0495659_0005645_654_1484 276
852 3300046665 Ga0495661_0000006 Ga0495661_0000006_20954_21784 276
853 3300046665 Ga0495661_0000059 Ga0495661_0000059_96498_97328 276
854 3300046665 Ga0495661_0000401 Ga0495661_0000401_37401_38231 276
855 3300046665 Ga0495661_0000447 Ga0495661_0000447_10027_10857 276
856 3300046665 Ga0495661_0005286 Ga0495661_0005286_4874_5704 276
857 3300046665 Ga0495661_0027666 Ga0495661_0027666_2292_3122 276
858 3300046665 Ga0495661_0105054 Ga0495661_0105054_705_1535 276
859 3300046674 Ga0495588_0011458 Ga0495588_0011458_3204_4034 276
860 3300046674 Ga0495588_0087227 Ga0495588_0087227_32_862 276
861 3300046674 Ga0495588_0180472 Ga0495588_0180472_262_1092 276
862 3300046684 Ga0495669_0004408 Ga0495669_0004408_1939_2769 276
863 3300046689 Ga0495613_0036295 Ga0495613_0036295_2621_3451 276
864 3300046691 Ga0495670_0002612 Ga0495670_0002612_5902_6732 276
865 3300046691 Ga0495670_0012350 Ga0495670_0012350_1561_2391 276
866 3300046691 Ga0495670_0014205 Ga0495670_0014205_1696_2526 276
867 3300046691 Ga0495670_0014270 Ga0495670_0014270_26_856 276
868 3300046691 Ga0495670_0014808 Ga0495670_0014808_2989_3819 276
869 3300046691 Ga0495670_0024304 Ga0495670_0024304_38_868 276
870 3300046692 Ga0495671_0002402 Ga0495671_0002402_6511_7371 276
871 3300046692 Ga0495671_0002948 Ga0495671_0002948_7325_8155 276
872 3300046692 Ga0495671_0003752 Ga0495671_0003752_5953_6783 276
873 3300046692 Ga0495671_0004807 Ga0495671_0004807_4080_4910 276
874 3300046692 Ga0495671_0005750 Ga0495671_0005750_2416_3246 276
875 3300046692 Ga0495671_0010010 Ga0495671_0010010_1170_2000 276
876 3300046692 Ga0495671_0016467 Ga0495671_0016467_2383_3213 276
877 3300046692 Ga0495671_0026509 Ga0495671_0026509_39_869 276
878 3300046692 Ga0495671_0051666 Ga0495671_0051666_63_893 276
879 3300046692 Ga0495671_0085878 Ga0495671_0085878_29_859 276
880 3300046694 Ga0495649_0001079 Ga0495649_0001079_14468_15328 276
881 3300046694 Ga0495649_0003471 Ga0495649_0003471_7582_8412 276
882 3300046694 Ga0495649_0004328 Ga0495649_0004328_2469_3299 276
883 3300046694 Ga0495649_0007187 Ga0495649_0007187_2459_3289 276
884 3300046694 Ga0495649_0007280 Ga0495649_0007280_3253_4083 276
885 3300046694 Ga0495649_0015306 Ga0495649_0015306_2257_3087 276
886 3300046694 Ga0495649_0021425 Ga0495649_0021425_2428_3258 276
887 3300046694 Ga0495649_0032456 Ga0495649_0032456_29_859 276
888 3300046694 Ga0495649_0034207 Ga0495649_0034207_65_895 276
889 3300046694 Ga0495649_0120682 Ga0495649_0120682_132_992 276
890 3300046794 Ga0495589_0003843 Ga0495589_0003843_7065_7895 276
891 3300046794 Ga0495589_0004661 Ga0495589_0004661_3999_4829 276
892 3300046794 Ga0495589_0060596 Ga0495589_0060596_99_929 276
893 3300046794 Ga0495589_0071409 Ga0495589_0071409_775_1605 276
894 3300046809 Ga0495600_0009911 Ga0495600_0009911_4477_5307 276
895 3300046809 Ga0495600_0233810 Ga0495600_0233810_325_1155 276
896 3300046810 Ga0495660_0000505 Ga0495660_0000505_3961_4791 276
897 3300046810 Ga0495660_0001125 Ga0495660_0001125_5881_6711 276
898 3300046810 Ga0495660_0002977 Ga0495660_0002977_9701_10531 276
899 3300046810 Ga0495660_0004367 Ga0495660_0004367_2365_3195 276
900 3300046810 Ga0495660_0005636 Ga0495660_0005636_1954_2784 276
901 3300046810 Ga0495660_0022994 Ga0495660_0022994_2405_3235 276
902 3300046810 Ga0495660_0023806 Ga0495660_0023806_1417_2247 276
903 3300047315 Ga0495581_0050702 Ga0495581_0050702_911_1741 276
904 3300047318 Ga0495636_0032998 Ga0495636_0032998_69_899 276
905 3300047320 Ga0495672_0005426 Ga0495672_0005426_6023_6853 276
906 3300047320 Ga0495672_0006857 Ga0495672_0006857_7056_7886 276
907 3300047320 Ga0495672_0009340 Ga0495672_0009340_3820_4650 276
908 3300047320 Ga0495672_0009385 Ga0495672_0009385_4846_5676 276
909 3300047320 Ga0495672_0009896 Ga0495672_0009896_2715_3545 276
910 3300047320 Ga0495672_0009926 Ga0495672_0009926_2690_3520 276
911 3300047320 Ga0495672_0010387 Ga0495672_0010387_2484_3314 276
912 3300047320 Ga0495672_0010868 Ga0495672_0010868_2210_3040 276
913 3300047320 Ga0495672_0015928 Ga0495672_0015928_3372_4202 276
914 3300047320 Ga0495672_0019887 Ga0495672_0019887_1419_2249 276
915 3300047320 Ga0495672_0023871 Ga0495672_0023871_661_1491 276
916 3300047320 Ga0495672_0035366 Ga0495672_0035366_1976_2806 276
917 3300047320 Ga0495672_0080488 Ga0495672_0080488_690_1520 276
918 3300047321 Ga0495676_0000004 Ga0495676_0000004_280128_280958 276
919 3300047321 Ga0495676_0021904 Ga0495676_0021904_2209_3039 276
920 3300047322 Ga0495680_0028213 Ga0495680_0028213_302_1132 276
921 3300047323 Ga0495683_0000033 Ga0495683_0000033_49551_50381 276
922 3300047323 Ga0495683_0000091 Ga0495683_0000091_15375_16205 276
923 3300047323 Ga0495683_0003722 Ga0495683_0003722_3065_3895 276
924 3300047323 Ga0495683_0005092 Ga0495683_0005092_4059_4889 276
925 3300047323 Ga0495683_0018243 Ga0495683_0018243_632_1462 276
926 3300047323 Ga0495683_0047733 Ga0495683_0047733_563_1393 276
927 3300047443 Ga0495687_005976 Ga0495687_005976_4360_5190 276
928 3300047443 Ga0495687_006399 Ga0495687_006399_2459_3289 276
929 3300047443 Ga0495687_007940 Ga0495687_007940_2471_3301 276
930 3300047444 Ga0495675_0013139 Ga0495675_0013139_206_1036 276
931 3300047444 Ga0495675_0092161 Ga0495675_0092161_284_1114 276
932 3300047446 Ga0495679_000083 Ga0495679_000083_11407_12237 276
933 3300047446 Ga0495679_000461 Ga0495679_000461_17353_18183 276
934 3300047446 Ga0495679_002991 Ga0495679_002991_2678_3508 276
935 3300047446 Ga0495679_003054 Ga0495679_003054_4865_5695 276
936 3300047446 Ga0495679_027084 Ga0495679_027084_1020_1850 276
937 3300047469 Ga0495673_0003544 Ga0495673_0003544_3322_4152 276
938 3300047469 Ga0495673_0003918 Ga0495673_0003918_3781_4611 276
939 3300047469 Ga0495673_0004180 Ga0495673_0004180_4175_5005 276
940 3300047469 Ga0495673_0004973 Ga0495673_0004973_4276_5106 276
941 3300047469 Ga0495673_0006630 Ga0495673_0006630_3515_4345 276
942 3300047469 Ga0495673_0008633 Ga0495673_0008633_1880_2710 276
943 3300047469 Ga0495673_0011492 Ga0495673_0011492_1469_2299 276
944 3300047469 Ga0495673_0014539 Ga0495673_0014539_2503_3333 276
945 3300047469 Ga0495673_0016603 Ga0495673_0016603_2420_3250 276
946 3300047469 Ga0495673_0020443 Ga0495673_0020443_23_853 276
947 3300047469 Ga0495673_0032778 Ga0495673_0032778_1327_2157 276
948 3300047469 Ga0495673_0117534 Ga0495673_0117534_181_1011 276
949 3300047470 Ga0495681_0003353 Ga0495681_0003353_3870_4700 276
950 3300047470 Ga0495681_0005364 Ga0495681_0005364_2937_3767 276
951 3300047470 Ga0495681_0006537 Ga0495681_0006537_2769_3599 276
952 3300047470 Ga0495681_0006989 Ga0495681_0006989_4081_4911 276
953 3300047470 Ga0495681_0007295 Ga0495681_0007295_2291_3121 276
954 3300047470 Ga0495681_0015124 Ga0495681_0015124_1202_2032 276
955 3300047470 Ga0495681_0021072 Ga0495681_0021072_2046_2876 276
956 3300047470 Ga0495681_0022079 Ga0495681_0022079_2553_3383 276
957 3300047470 Ga0495681_0033341 Ga0495681_0033341_1324_2154 276
958 3300047470 Ga0495681_0063608 Ga0495681_0063608_826_1656 276
959 3300047472 Ga0495686_0009065 Ga0495686_0009065_4052_4882 276
960 3300047472 Ga0495686_0063765 Ga0495686_0063765_874_1704 276
961 3300047673 Ga0495593_0006895 Ga0495593_0006895_2658_3488 276
962 3300048091 Ga0495626_0000173 Ga0495626_0000173_16797_17627 276
963 3300048091 Ga0495626_0003845 Ga0495626_0003845_6058_6888 276
964 3300048091 Ga0495626_0003921 Ga0495626_0003921_6068_6898 276
965 3300048091 Ga0495626_0004903 Ga0495626_0004903_3257_4087 276
966 3300048091 Ga0495626_0005054 Ga0495626_0005054_2890_3720 276
967 3300048091 Ga0495626_0005599 Ga0495626_0005599_3987_4817 276
968 3300048091 Ga0495626_0008800 Ga0495626_0008800_3239_4069 276
969 3300048905 Ga0496102_0007371 Ga0496102_0007371_2666_3496 276
970 3300048913 Ga0496110_0183626 Ga0496110_0183626_1016_1846 276
971 3300048913 Ga0496110_0238254 Ga0496110_0238254_702_1532 276
972 3300048914 Ga0496111_0080837 Ga0496111_0080837_14_844 276
973 3300048914 Ga0496111_0462861 Ga0496111_0462861_33_863 276
974 3300048915 Ga0496112_0038333 Ga0496112_0038333_2971_3801 276
975 3300048915 Ga0496112_0090559 Ga0496112_0090559_705_1535 276
976 3300048917 Ga0496114_0047512 Ga0496114_0047512_729_1559 276
977 3300048919 Ga0496116_0000574 Ga0496116_0000574_36241_37071 276
978 3300048919 Ga0496116_0010026 Ga0496116_0010026_3940_4770 276
979 3300048920 Ga0496117_0001296 Ga0496117_0001296_7601_8431 276
980 3300048920 Ga0496117_0004436 Ga0496117_0004436_9118_9948 276
981 3300048920 Ga0496117_0008721 Ga0496117_0008721_3806_4636 276
982 3300048920 Ga0496117_0010406 Ga0496117_0010406_4223_5053 276
983 3300048920 Ga0496117_0011529 Ga0496117_0011529_4041_4871 276
984 3300048920 Ga0496117_0048847 Ga0496117_0048847_827_1657 276
985 3300048920 Ga0496117_0187291 Ga0496117_0187291_190_1020 276
986 3300048921 Ga0496118_0013881 Ga0496118_0013881_3892_4722 276
987 3300048921 Ga0496118_0029328 Ga0496118_0029328_3457_4287 276
988 3300048921 Ga0496118_0039239 Ga0496118_0039239_2865_3695 276
989 3300048921 Ga0496118_0095737 Ga0496118_0095737_827_1657 276
990 3300048921 Ga0496118_0102172 Ga0496118_0102172_82_912 276
991 3300048921 Ga0496118_0115462 Ga0496118_0115462_41_871 276
992 3300048921 Ga0496118_0257754 Ga0496118_0257754_102_932 276
993 3300048922 Ga0496119_0000086 Ga0496119_0000086_133645_134475 276
994 3300048923 Ga0496120_0001853 Ga0496120_0001853_15094_15924 276
995 3300048923 Ga0496120_0019966 Ga0496120_0019966_3424_4254 276
996 3300048924 Ga0496121_0000299 Ga0496121_0000299_7552_8382 276
997 3300048924 Ga0496121_0003112 Ga0496121_0003112_12996_13826 276
998 3300048924 Ga0496121_0004378 Ga0496121_0004378_10541_11371 276
999 3300048924 Ga0496121_0015997 Ga0496121_0015997_3188_4018 276
1000 3300048924 Ga0496121_0190928 Ga0496121_0190928_86_916 276
1001 3300048925 Ga0496122_0000156 Ga0496122_0000156_112498_113328 276
1002 3300048925 Ga0496122_0009262 Ga0496122_0009262_8438_9268 276
1003 3300048925 Ga0496122_0010792 Ga0496122_0010792_3334_4164 276
1004 3300048925 Ga0496122_0014336 Ga0496122_0014336_3931_4761 276
1005 3300048925 Ga0496122_0017324 Ga0496122_0017324_3085_3915 276
1006 3300048925 Ga0496122_0023244 Ga0496122_0023244_20_850 276
1007 3300048925 Ga0496122_0028666 Ga0496122_0028666_3429_4259 276
1008 3300048925 Ga0496122_0042754 Ga0496122_0042754_1763_2593 276
1009 3300048925 Ga0496122_0073995 Ga0496122_0073995_513_1343 276
1010 3300048925 Ga0496122_0075708 Ga0496122_0075708_1370_2200 276
1011 3300048926 Ga0496123_0000087 Ga0496123_0000087_69465_70295 276
1012 3300048926 Ga0496123_0000445 Ga0496123_0000445_68715_69545 276
1013 3300048926 Ga0496123_0003302 Ga0496123_0003302_10085_10915 276
1014 3300048926 Ga0496123_0013778 Ga0496123_0013778_3079_3909 276
1015 3300048926 Ga0496123_0015908 Ga0496123_0015908_1975_2805 276
1016 3300048926 Ga0496123_0021700 Ga0496123_0021700_3360_4190 276
1017 3300048927 Ga0496124_0000031 Ga0496124_0000031_76416_77246 276
1018 3300048927 Ga0496124_0006746 Ga0496124_0006746_9183_10013 276
1019 3300048927 Ga0496124_0009610 Ga0496124_0009610_4127_4957 276
1020 3300048927 Ga0496124_0010222 Ga0496124_0010222_2659_3489 276
1021 3300048927 Ga0496124_0012164 Ga0496124_0012164_3423_4253 276
1022 3300048927 Ga0496124_0017316 Ga0496124_0017316_3554_4384 276
1023 3300048927 Ga0496124_0020633 Ga0496124_0020633_5228_6058 276
1024 3300048927 Ga0496124_0086969 Ga0496124_0086969_793_1623 276
1025 3300048927 Ga0496124_0168653 Ga0496124_0168653_70_900 276
1026 3300048927 Ga0496124_0275207 Ga0496124_0275207_220_1050 276
1027 3300048928 Ga0496125_0000658 Ga0496125_0000658_8898_9728 276
1028 3300048928 Ga0496125_0009054 Ga0496125_0009054_6006_6836 276
1029 3300048928 Ga0496125_0013589 Ga0496125_0013589_4024_4854 276
1030 3300048928 Ga0496125_0020047 Ga0496125_0020047_4309_5139 276
1031 3300048928 Ga0496125_0039884 Ga0496125_0039884_660_1490 276
1032 3300048928 Ga0496125_0047858 Ga0496125_0047858_1010_1840 276
1033 3300048928 Ga0496125_0084043 Ga0496125_0084043_120_950 276
1034 3300048928 Ga0496125_0115945 Ga0496125_0115945_769_1599 276
1035 3300048928 Ga0496125_0131980 Ga0496125_0131980_773_1603 276
1036 3300048929 Ga0496126_0014261 Ga0496126_0014261_2547_3377 276
1037 3300048929 Ga0496126_0146285 Ga0496126_0146285_1103_1933 276
1038 3300048929 Ga0496126_0176260 Ga0496126_0176260_954_1784 276
1039 3300049459 Ga0495678_000020 Ga0495678_000020_116706_117536 276
1040 3300049459 Ga0495678_000137 Ga0495678_000137_7631_8461 276
1041 3300049459 Ga0495678_004792 Ga0495678_004792_4484_5314 276
1042 3300049459 Ga0495678_005207 Ga0495678_005207_3972_4802 276
1043 3300049459 Ga0495678_009441 Ga0495678_009441_2089_2919 276
1044 3300049459 Ga0495678_011475 Ga0495678_011475_3366_4196 276
1045 3300049459 Ga0495678_014120 Ga0495678_014120_1184_2014 276
1046 3300049459 Ga0495678_021163 Ga0495678_021163_203_1063 276
1047 3300049459 Ga0495678_034139 Ga0495678_034139_1237_2067 276
1048 3300049459 Ga0495678_045352 Ga0495678_045352_820_1650 276
1049 3300049459 Ga0495678_055078 Ga0495678_055078_607_1437 276
1050 3300049459 Ga0495678_098589 Ga0495678_098589_176_1006 276
1051 3300049460 Ga0495682_0000492 Ga0495682_0000492_10273_11103 276
1052 3300049460 Ga0495682_0000550 Ga0495682_0000550_17322_18152 276
1053 3300049460 Ga0495682_0035567 Ga0495682_0035567_823_1653 276
1054 3300049460 Ga0495682_0085664 Ga0495682_0085664_65_895 276
1055 3300049571 Ga0501034_0000200 Ga0501034_0000200_51427_52257 276
1056 3300049853 Ga0501226_000864 Ga0501226_000864_1136_1966 276
1057 3300053125 Ga0500618_007221 Ga0500618_007221_2282_3112 276
1058 3300053140 Ga0500573_0010506 Ga0500573_0010506_2280_3110 276
1059 3300053161 Ga0500634_0010173 Ga0500634_0010173_1257_2087 276
1060 iso_pu_bacteria 640427133 640487607 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14819

QueF_N

Nitrile reductase, 7-cyano-7-deazaguanine-reductase N-term

55

165

0.99

PF14489

QueF

QueF-like protein

228

305

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzp-assembly1.cif.gz_B crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 0.96 19 276
3rzp-assembly2.cif.gz_C crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 0.9595 19 276
3uxj-assembly2.cif.gz_C crystal structure of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with nadp and preq0 0.9594 19 276
3rzp-assembly2.cif.gz_D crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 0.9535 16 276
3rzp-assembly1.cif.gz_B crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 0.9528 19 276
ID Description Score Start End Superfamily
3bp1A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9584 16 131 3.30.1130.10
3bp1A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.927 16 131 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8832 140 276 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8768 140 276 3.30.1130.10
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8611 154 270 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A352G139-F1-model_v4 deleted 0.99 98 276
AF-J2RYE4-F1-model_v4 GTP cyclohydrolase I 0.9898 117 276 GO:0008616
GO:0016787
GO:0033739
AF-A0A0Q0CDB5-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase 0.9891 138 276 GO:0008616
GO:0033739
AF-A0A6H9RTP7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF 0.9844 82 235 GO:0008616
GO:0033739
AF-J2RYE4-F1-model_v4 GTP cyclohydrolase I 0.9837 117 276 GO:0008616
GO:0016787
GO:0033739

Feature Viewer

pLDDT pTM Quality
92.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map