F489122

General Info

Members Datasets Scaffolds Average Seq Length
1054 592 871 322

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100058712|Ga0070706_1000587124
Length 360
Sequence VLFRAVRAAKHAMNVYDETFATKNKIWGKLPMNRRELLKAAAALPLAPTVFADTAFAQAGYPNRNITMIVPFPAGGQADLAARPVALALERILSKPVIVDNRAGGAGGSIGNAQAARAEPDGYTLLMTLSSLAVLPEADRLFDRPVAYEVSQFAPIARVLADPTLLAVPASAPWKTLQDFVDDAKKRPGQIPYGSSGPYGTLHVAMEMFTASAGIKLLHVPFRGAGPALTALLSGTVQALASAPGTLKQQVDDGKMRVLANWGAQRIASFPDLPTFRELGYKDIEFYIWAGLFAQSALPTPIMTRLREAMAQAVKSPEVTKTFETAGSPVAYLDAPEFSKFVAEDSARLIAAVKKIGKVE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355199
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
34 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
35 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
49 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
50 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
51 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
52 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
53 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
54 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
55 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
56 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
57 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
58 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
59 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
60 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
61 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
62 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
63 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
64 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
65 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
66 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
67 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
68 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
69 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
70 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
71 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
72 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
73 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
74 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
75 2904699407
76 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
77 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
78 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
79 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
80 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
81 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
82 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
83 2922368715
84 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
85 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
86 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
87 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
88 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
89 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
90 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
91 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
92 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
93 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
94 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
95 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
96 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
97 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
98 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
99 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
100 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
101 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
102 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
103 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
104 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
105 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
106 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
107 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
108 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
109 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
110 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
111 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
112 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
113 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
114 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
115 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
116 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
117 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
118 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
119 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
120 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
121 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
122 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
123 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
124 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
125 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
126 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
127 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
128 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
129 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
130 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
131 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
132 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
133 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
134 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
135 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
136 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
137 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
138 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
139 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
140 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
141 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
142 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
143 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
144 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
145 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
146 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
147 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
148 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
149 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
150 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
151 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
154 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
155 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
156 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
157 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
160 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
161 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
162 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
163 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
164 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
165 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
166 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
167 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
168 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
169 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
170 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
171 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
172 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
173 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
174 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
175 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
176 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
177 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
178 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
179 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
180 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
181 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
182 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
183 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
184 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
185 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
186 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
187 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
188 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
189 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
190 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
191 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
192 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
193 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
194 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
195 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
196 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
197 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
198 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
199 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
200 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
201 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
202 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
203 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
204 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
205 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
206 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
207 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
208 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
209 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
210 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
211 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
212 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
213 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
214 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
215 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
216 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
217 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
218 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
219 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
220 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
221 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
222 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
223 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
224 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
225 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
229 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
230 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
231 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
232 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
234 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
235 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
236 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
237 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
238 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
239 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
240 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
241 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
245 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
246 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
247 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
250 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
251 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
252 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
253 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
254 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
255 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
256 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
257 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
259 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
261 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
322 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
323 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
328 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
329 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
333 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
334 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
335 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
336 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
337 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
338 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
339 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
340 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
341 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
342 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
343 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
344 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
345 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
346 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
347 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
350 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
351 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
352 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
353 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
354 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
355 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
356 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
357 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
358 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
359 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
360 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
361 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
362 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
363 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
364 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
365 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
366 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
367 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
369 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
371 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
372 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
373 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
374 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
375 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
376 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
377 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
378 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
379 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
380 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
381 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
382 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
383 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
384 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
385 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
386 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
395 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
396 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
397 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
398 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
399 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
400 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
401 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
402 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
403 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
404 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
405 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
406 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
407 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
408 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
409 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
410 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
411 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
412 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
413 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
414 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
415 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
416 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
417 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
418 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
421 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
422 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
423 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
424 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
425 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
426 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
427 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
428 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
429 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
430 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
431 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
432 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
433 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
434 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
435 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
436 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
441 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
442 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
443 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
444 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
445 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
446 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
447 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
448 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
449 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
450 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
451 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
452 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
453 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
454 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
455 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
456 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
457 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
458 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
459 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
460 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
461 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
462 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
463 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
464 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
465 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
466 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
467 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
468 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
469 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
479 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
481 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
491 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
492 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
493 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
494 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
495 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
496 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
497 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
498 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
499 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
500 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
501 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
503 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
504 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
505 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
506 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
507 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
508 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
509 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
510 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
511 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
512 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
513 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
514 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
517 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
518 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
519 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
520 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
521 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
522 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
523 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
524 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
525 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
526 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
527 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
528 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
531 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
532 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
533 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
534 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
535 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
536 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
537 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
541 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
544 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
545 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
546 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
547 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
548 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
549 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
550 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
551 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
552 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
553 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
554 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
555 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
556 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
557 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
558 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
559 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
560 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
561 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
562 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
563 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
564 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
565 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
566 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
567 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
568 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
569 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
570 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
571 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
572 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
573 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
574 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
575 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
576 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
577 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
578 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
579 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
580 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
581 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
582 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
583 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
584 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
585 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
586 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
587 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
588 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
589 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
590 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
591 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
592 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.87
Metatranscriptomes 0
Isolates 17.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 14.61
Rhizoplane 7.12
Rhizosphere 56.55
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000133 3300003203 Bacteria 32510
2 JGI25153J46596_10000371 3300003215 Bacteria 30777
3 JGI25153J46596_10000865 3300003215 Bacteria 18448
4 JGI25153J46596_10006554 3300003215 Bacteria 5869
5 JGI25153J46596_10015409 3300003215 Bacteria 3115
6 JGI25153J46596_10026895 3300003215 Bacteria 2026
7 JGI25160J50197_1000678 3300003354 Bacteria 18870
8 JGI25160J50197_1016398 3300003354 Bacteria 2388
9 JGI25160J50197_1019515 3300003354 Bacteria 2076
10 JGI25404J52841_10005502 3300003659 Bacteria 2617
11 Ga0055531_10005980 3300003794 Bacteria 6988
12 Ga0065165_1001685 3300005262 Bacteria 22303
13 Ga0065165_1004072 3300005262 Bacteria 9480
14 Ga0065165_1008657 3300005262 Bacteria 4714
15 Ga0070658_10007681 3300005327 Bacteria 8691
16 Ga0070683_100010541 3300005329 Bacteria 7946
17 Ga0070683_100034098 3300005329 Bacteria 4648
18 Ga0070690_100023058 3300005330 Bacteria 3814
19 Ga0070690_100246931 3300005330 Bacteria 1261
20 Ga0070670_100143455 3300005331 Bacteria 2065
21 Ga0068869_100055491 3300005334 Bacteria 2887
22 Ga0068869_100104948 3300005334 Bacteria 2142
23 Ga0070666_10345553 3300005335 Bacteria 1064
24 Ga0070680_100008274 3300005336 Bacteria 7957
25 Ga0070680_100050122 3300005336 Bacteria 3405
26 Ga0070680_100215949 3300005336 Bacteria 1618
27 Ga0068868_100059787 3300005338 Bacteria 3015
28 Ga0070689_100047251 3300005340 Bacteria 3319
29 Ga0070661_100100294 3300005344 Bacteria 2153
30 Ga0070668_100027647 3300005347 Bacteria 4306
31 Ga0070668_100040165 3300005347 Bacteria 3580
32 Ga0070668_100065858 3300005347 Bacteria 2810
33 Ga0070668_100079103 3300005347 Bacteria 2573
34 Ga0070668_100164455 3300005347 Bacteria 1802
35 Ga0070675_100105651 3300005354 Bacteria 2376
36 Ga0070671_100062490 3300005355 Bacteria 3101
37 Ga0070671_100103241 3300005355 Bacteria 2392
38 Ga0070671_100122250 3300005355 Bacteria 2191
39 Ga0070671_100200995 3300005355 Bacteria 1690
40 Ga0070673_100156740 3300005364 Bacteria 1933
41 Ga0070659_100059480 3300005366 Bacteria 3017
42 Ga0070667_100147878 3300005367 Bacteria 2062
43 Ga0070709_10006064 3300005434 Bacteria 6579
44 Ga0070709_10031136 3300005434 Bacteria 3207
45 Ga0070709_10052999 3300005434 Bacteria 2552
46 Ga0070714_100061439 3300005435 Bacteria 3227
47 Ga0070714_100314018 3300005435 Bacteria 1464
48 Ga0070713_100012380 3300005436 Bacteria 6253
49 Ga0070713_100028548 3300005436 Bacteria 4406
50 Ga0070710_10063955 3300005437 Bacteria 2103
51 Ga0070711_100005721 3300005439 Bacteria 7455
52 Ga0070711_100006314 3300005439 Bacteria 7135
53 Ga0070663_100009946 3300005455 Bacteria 5912
54 Ga0070663_100073675 3300005455 Bacteria 2491
55 Ga0070678_100048188 3300005456 Bacteria 3067
56 Ga0070678_100085113 3300005456 Bacteria 2408
57 Ga0070678_100193439 3300005456 Bacteria 1674
58 Ga0070662_100133704 3300005457 Bacteria 1916
59 Ga0070681_10036493 3300005458 Bacteria 4936
60 Ga0070681_10070615 3300005458 Bacteria 3457
61 Ga0070681_10096880 3300005458 Bacteria 2898
62 Ga0068867_100324475 3300005459 Bacteria 1277
63 Ga0070685_10178696 3300005466 Bacteria 1365
64 Ga0070706_100058712 3300005467 Bacteria 3551
65 Ga0070707_100050135 3300005468 Bacteria 4002
66 Ga0070707_100067293 3300005468 Bacteria 3446
67 Ga0070698_100061688 3300005471 Bacteria 3784
68 Ga0070679_100044206 3300005530 Bacteria 4438
69 Ga0070679_100516046 3300005530 Bacteria 1139
70 Ga0070684_100001737 3300005535 Bacteria 15848
71 Ga0070684_100010579 3300005535 Bacteria 7315
72 Ga0070697_100134239 3300005536 Bacteria 2078
73 Ga0068853_100001167 3300005539 Bacteria 18689
74 Ga0068853_100073476 3300005539 Bacteria 2982
75 Ga0068853_100193905 3300005539 Bacteria 1847
76 Ga0070695_100064525 3300005545 Bacteria 2383
77 Ga0070695_100108876 3300005545 Bacteria 1877
78 Ga0070696_100017975 3300005546 Bacteria 4775
79 Ga0070665_100023285 3300005548 Bacteria 6237
80 Ga0070665_100068737 3300005548 Bacteria 3551
81 Ga0070665_100078112 3300005548 Bacteria 3316
82 Ga0070665_100227374 3300005548 Bacteria 1866
83 Ga0070665_100370296 3300005548 Bacteria 1439
84 Ga0070665_100371796 3300005548 Bacteria 1436
85 Ga0070704_100018424 3300005549 Bacteria 4466
86 Ga0068855_100024736 3300005563 Bacteria 7184
87 Ga0068855_100033225 3300005563 Bacteria 6159
88 Ga0068855_100034345 3300005563 Bacteria 6049
89 Ga0068855_100222708 3300005563 Bacteria 2115
90 Ga0070664_100008147 3300005564 Bacteria 8474
91 Ga0070664_100178810 3300005564 Bacteria 1885
92 Ga0070664_100223115 3300005564 Bacteria 1687
93 Ga0068857_100008553 3300005577 Bacteria 8850
94 Ga0068856_100000046 3300005614 Bacteria 109174
95 Ga0068856_100105914 3300005614 Bacteria 2806
96 Ga0068852_100272757 3300005616 Bacteria 1628
97 Ga0068852_100560589 3300005616 Bacteria 1144
98 Ga0068859_100049211 3300005617 Bacteria 4233
99 Ga0068859_100139093 3300005617 Bacteria 2502
100 Ga0068864_100032861 3300005618 Bacteria 4409
101 Ga0068864_100072113 3300005618 Bacteria 3009
102 Ga0068861_100209307 3300005719 Bacteria 1642
103 Ga0068851_10006569 3300005834 Bacteria 5317
104 Ga0068863_100240146 3300005841 Bacteria 1749
105 Ga0068863_100305745 3300005841 Bacteria 1543
106 Ga0068858_100021643 3300005842 Bacteria 6010
107 Ga0068860_100002690 3300005843 Bacteria 18501
108 Ga0068860_100107190 3300005843 Bacteria 2670
109 Ga0068862_100045564 3300005844 Bacteria 3742
110 Ga0068862_100112253 3300005844 Bacteria 2394
111 Ga0068862_100143926 3300005844 Bacteria 2117
112 Ga0068862_100210056 3300005844 Bacteria 1758
113 Ga0068862_100249712 3300005844 Bacteria 1616
114 Ga0081455_10000875 3300005937 Bacteria 38950
115 Ga0081455_10001281 3300005937 Bacteria 31263
116 Ga0081455_10006371 3300005937 Bacteria 12668
117 Ga0081455_10013731 3300005937 Bacteria 7972
118 Ga0081455_10037949 3300005937 Bacteria 4269
119 Ga0081455_10038108 3300005937 Bacteria 4259
120 Ga0081455_10070498 3300005937 Bacteria 2902
121 Ga0081538_10053586 3300005981 Bacteria 2396
122 Ga0081538_10056076 3300005981 Bacteria 2312
123 Ga0081540_1000055 3300005983 Bacteria 122642
124 Ga0081540_1005014 3300005983 Bacteria 9945
125 Ga0081540_1008353 3300005983 Bacteria 7236
126 Ga0081540_1011111 3300005983 Bacteria 6044
127 Ga0081540_1013509 3300005983 Bacteria 5304
128 Ga0081540_1020858 3300005983 Bacteria 3925
129 Ga0081540_1028891 3300005983 Bacteria 3102
130 Ga0081540_1039018 3300005983 Bacteria 2494
131 Ga0081540_1039050 3300005983 Bacteria 2493
132 Ga0081540_1040637 3300005983 Bacteria 2422
133 Ga0081539_10000099 3300005985 Bacteria 201018
134 Ga0081539_10001953 3300005985 Bacteria 31481
135 Ga0081539_10036981 3300005985 Bacteria 2913
136 Ga0075365_10023866 3300006038 Bacteria 3851
137 Ga0075365_10026996 3300006038 Bacteria 3649
138 Ga0075365_10049111 3300006038 Bacteria 2779
139 Ga0075365_10163801 3300006038 Bacteria 1550
140 Ga0075368_10007168 3300006042 Bacteria 3928
141 Ga0075368_10015164 3300006042 Bacteria 2854
142 Ga0075368_10025165 3300006042 Bacteria 2284
143 Ga0075363_100021478 3300006048 Bacteria 3252
144 Ga0075363_100033053 3300006048 Bacteria 2691
145 Ga0075363_100104818 3300006048 Bacteria 1568
146 Ga0075363_100134361 3300006048 Bacteria 1389
147 Ga0075363_100169517 3300006048 Bacteria 1239
148 Ga0075364_10142361 3300006051 Bacteria 1613
149 Ga0075364_10213157 3300006051 Bacteria 1310
150 Ga0075364_10222364 3300006051 Bacteria 1281
151 Ga0070716_100111545 3300006173 Bacteria 1696
152 Ga0070716_100112173 3300006173 Bacteria 1692
153 Ga0070712_100055917 3300006175 Bacteria 2766
154 Ga0070712_100058029 3300006175 Bacteria 2722
155 Ga0070712_100125260 3300006175 Bacteria 1939
156 Ga0075362_10019134 3300006177 Bacteria 2844
157 Ga0075362_10019479 3300006177 Bacteria 2822
158 Ga0075362_10062560 3300006177 Bacteria 1686
159 Ga0075367_10005197 3300006178 Bacteria 6434
160 Ga0075367_10007145 3300006178 Bacteria 5697
161 Ga0075367_10026687 3300006178 Bacteria 3277
162 Ga0075367_10067047 3300006178 Bacteria 2151
163 Ga0075367_10081245 3300006178 Bacteria 1961
164 Ga0075367_10211331 3300006178 Bacteria 1213
165 Ga0075369_10018451 3300006186 Bacteria 2840
166 Ga0075369_10025257 3300006186 Bacteria 2468
167 Ga0075369_10129826 3300006186 Bacteria 1144
168 Ga0075366_10005248 3300006195 Bacteria 7013
169 Ga0075366_10015948 3300006195 Bacteria 4313
170 Ga0075366_10024275 3300006195 Bacteria 3536
171 Ga0075366_10047427 3300006195 Bacteria 2546
172 Ga0075366_10049459 3300006195 Bacteria 2494
173 Ga0075366_10153162 3300006195 Bacteria 1396
174 Ga0075366_10182446 3300006195 Bacteria 1275
175 Ga0097621_100047456 3300006237 Bacteria 3481
176 Ga0075370_10041656 3300006353 Bacteria 2592
177 Ga0075370_10101607 3300006353 Bacteria 1664
178 Ga0075370_10171147 3300006353 Bacteria 1277
179 Ga0068871_100111287 3300006358 Bacteria 2303
180 Ga0068871_100269890 3300006358 Bacteria 1486
181 Ga0075428_100031338 3300006844 Bacteria 5879
182 Ga0075428_100043684 3300006844 Bacteria 4927
183 Ga0075428_100059241 3300006844 Bacteria 4193
184 Ga0075428_100174356 3300006844 Bacteria 2330
185 Ga0075430_100032196 3300006846 Bacteria 4452
186 Ga0075430_100050201 3300006846 Bacteria 3519
187 Ga0075431_100105259 3300006847 Bacteria 2911
188 Ga0075429_100024575 3300006880 Bacteria 5228
189 Ga0075429_100037833 3300006880 Bacteria 4200
190 Ga0068865_100022835 3300006881 Bacteria 4087
191 Ga0097620_100049210 3300006931 Bacteria 4233
192 Ga0097620_100139090 3300006931 Bacteria 2502
193 Ga0099794_10011788 3300007265 Bacteria 3754
194 Ga0105240_10004093 3300009093 Bacteria 22404
195 Ga0105240_10558393 3300009093 Bacteria 1266
196 Ga0111539_10019170 3300009094 Bacteria 8451
197 Ga0111539_10095964 3300009094 Bacteria 3483
198 Ga0111539_10406088 3300009094 Bacteria 1586
199 Ga0105245_10080814 3300009098 Bacteria 2970
200 Ga0105245_10091933 3300009098 Bacteria 2793
201 Ga0114129_10110710 3300009147 Bacteria 3790
202 Ga0105243_10036179 3300009148 Bacteria 3831
203 Ga0105243_10170264 3300009148 Bacteria 1885
204 Ga0105243_10184435 3300009148 Bacteria 1817
205 Ga0105243_10341412 3300009148 Bacteria 1372
206 Ga0105241_10040357 3300009174 Bacteria 3524
207 Ga0105242_10061390 3300009176 Bacteria 3091
208 Ga0105248_10009064 3300009177 Bacteria 10945
209 Ga0105248_10087017 3300009177 Bacteria 3516
210 Ga0105237_10008240 3300009545 Bacteria 11316
211 Ga0105237_10041340 3300009545 Bacteria 4650
212 Ga0105237_10043361 3300009545 Bacteria 4532
213 Ga0105238_10006431 3300009551 Bacteria 11688
214 Ga0105249_10115108 3300009553 Bacteria 2547
215 Ga0105239_10019170 3300010375 Bacteria 7557
216 Ga0105239_10023758 3300010375 Bacteria 6750
217 Ga0105239_10026562 3300010375 Bacteria 6372
218 Ga0105239_10358191 3300010375 Bacteria 1647
219 Ga0105239_10536793 3300010375 Bacteria 1331
220 Ga0105239_10570913 3300010375 Bacteria 1289
221 Ga0105246_10101669 3300011119 Bacteria 2094
222 Ga0105246_10108983 3300011119 Bacteria 2031
223 Ga0157370_10042061 3300013104 Bacteria 4405
224 Ga0157369_10004737 3300013105 Bacteria 15983
225 Ga0157374_10007199 3300013296 Bacteria 9475
226 Ga0157378_10015652 3300013297 Bacteria 6644
227 Ga0163162_10075484 3300013306 Bacteria 3432
228 Ga0163162_10149339 3300013306 Bacteria 2454
229 Ga0157372_10500092 3300013307 Bacteria 1417
230 Ga0157375_10022464 3300013308 Bacteria 5806
231 Ga0163163_10006013 3300014325 Bacteria 10560
232 Ga0163163_10056218 3300014325 Bacteria 3889
233 Ga0163163_10467790 3300014325 Bacteria 1321
234 Ga0157380_10074749 3300014326 Bacteria 2752
235 Ga0157380_10125864 3300014326 Bacteria 2178
236 Ga0157379_10058636 3300014968 Bacteria 3443
237 Ga0157379_10201681 3300014968 Bacteria 1799
238 Ga0157376_10004438 3300014969 Bacteria 9773
239 Ga0157376_10321201 3300014969 Bacteria 1472
240 Ga0214544_1000003 3300021320 Bacteria 643752
241 Ga0214544_1024221 3300021320 Bacteria 3202
242 Ga0214542_1000022 3300021321 Bacteria 193578
243 Ga0214542_1021284 3300021321 Bacteria 4504
244 Ga0214545_1000010 3300021324 Bacteria 193578
245 Ga0214545_1019543 3300021324 Bacteria 5771
246 Ga0214543_1000035 3300021327 Bacteria 183100
247 Ga0214543_1022474 3300021327 Bacteria 4468
248 Ga0209677_105299 3300025253 Bacteria 3405
249 Ga0209233_1005042 3300025261 Bacteria 4425
250 Ga0209455_1002543 3300025272 Bacteria 6976
251 Ga0209758_1000106 3300025297 Bacteria 218450
252 Ga0209758_1000344 3300025297 Bacteria 85133
253 Ga0209758_1000619 3300025297 Bacteria 54561
254 Ga0209758_1001326 3300025297 Bacteria 30016
255 Ga0209758_1003819 3300025297 Bacteria 13240
256 Ga0209758_1009962 3300025297 Bacteria 5783
257 Ga0209758_1017145 3300025297 Bacteria 3628
258 Ga0209758_1028430 3300025297 Bacteria 2365
259 Ga0209256_1004815 3300025299 Bacteria 8187
260 Ga0207426_1000819 3300025302 Bacteria 33379
261 Ga0207426_1007089 3300025302 Bacteria 4740
262 Ga0207426_1007145 3300025302 Bacteria 4716
263 Ga0209051_1038240 3300025303 Bacteria 1749
264 Ga0209257_1000819 3300025304 Bacteria 45046
265 Ga0209257_1007500 3300025304 Bacteria 6562
266 Ga0207697_10039196 3300025315 Bacteria 1943
267 Ga0207697_10111107 3300025315 Bacteria 1173
268 Ga0207692_10012181 3300025898 Bacteria 3686
269 Ga0207642_10033579 3300025899 Bacteria 2172
270 Ga0207710_10041890 3300025900 Bacteria 2032
271 Ga0207688_10096405 3300025901 Bacteria 1703
272 Ga0207647_10003565 3300025904 Bacteria 11684
273 Ga0207685_10091678 3300025905 Bacteria 1281
274 Ga0207699_10027045 3300025906 Bacteria 3171
275 Ga0207645_10210274 3300025907 Bacteria 1281
276 Ga0207643_10074007 3300025908 Bacteria 1964
277 Ga0207705_10015948 3300025909 Bacteria 5393
278 Ga0207684_10028686 3300025910 Bacteria 4741
279 Ga0207684_10123484 3300025910 Bacteria 2221
280 Ga0207654_10003986 3300025911 Bacteria 7435
281 Ga0207654_10057535 3300025911 Bacteria 2260
282 Ga0207707_10001530 3300025912 Bacteria 21349
283 Ga0207707_10061226 3300025912 Bacteria 3275
284 Ga0207695_10000123 3300025913 Bacteria 232059
285 Ga0207695_10075212 3300025913 Bacteria 3437
286 Ga0207671_10002081 3300025914 Bacteria 21897
287 Ga0207671_10012099 3300025914 Bacteria 6967
288 Ga0207693_10004353 3300025915 Bacteria 11975
289 Ga0207693_10005579 3300025915 Bacteria 10469
290 Ga0207693_10080795 3300025915 Bacteria 2545
291 Ga0207663_10115318 3300025916 Bacteria 1830
292 Ga0207663_10137017 3300025916 Bacteria 1700
293 Ga0207660_10001829 3300025917 Bacteria 14174
294 Ga0207660_10343450 3300025917 Bacteria 1195
295 Ga0207662_10016112 3300025918 Bacteria 4214
296 Ga0207652_10006474 3300025921 Bacteria 9442
297 Ga0207652_10143841 3300025921 Bacteria 2133
298 Ga0207652_10177099 3300025921 Bacteria 1915
299 Ga0207646_10031950 3300025922 Bacteria 4765
300 Ga0207646_10180585 3300025922 Bacteria 1906
301 Ga0207681_10065803 3300025923 Bacteria 2507
302 Ga0207694_10074304 3300025924 Bacteria 2661
303 Ga0207694_10111879 3300025924 Bacteria 2173
304 Ga0207659_10171187 3300025926 Bacteria 1713
305 Ga0207664_10433793 3300025929 Bacteria 1171
306 Ga0207644_10024492 3300025931 Bacteria 4145
307 Ga0207644_10243911 3300025931 Bacteria 1431
308 Ga0207690_10045868 3300025932 Bacteria 2891
309 Ga0207690_10130804 3300025932 Bacteria 1837
310 Ga0207706_10034621 3300025933 Bacteria 4493
311 Ga0207706_10078282 3300025933 Bacteria 2908
312 Ga0207706_10131828 3300025933 Bacteria 2198
313 Ga0207709_10022456 3300025935 Bacteria 3579
314 Ga0207709_10026424 3300025935 Bacteria 3334
315 Ga0207709_10041668 3300025935 Bacteria 2757
316 Ga0207669_10147193 3300025937 Bacteria 1644
317 Ga0207704_10035898 3300025938 Bacteria 2846
318 Ga0207665_10081997 3300025939 Bacteria 2222
319 Ga0207665_10121712 3300025939 Bacteria 1844
320 Ga0207691_10036011 3300025940 Bacteria 4587
321 Ga0207711_10005945 3300025941 Bacteria 10316
322 Ga0207711_10011210 3300025941 Bacteria 7448
323 Ga0207689_10014451 3300025942 Bacteria 6716
324 Ga0207661_10017444 3300025944 Bacteria 5314
325 Ga0207661_10050215 3300025944 Bacteria 3322
326 Ga0207679_10030648 3300025945 Bacteria 3758
327 Ga0207679_10051400 3300025945 Bacteria 3017
328 Ga0207679_10115694 3300025945 Bacteria 2125
329 Ga0207667_10008657 3300025949 Bacteria 12068
330 Ga0207667_10098994 3300025949 Bacteria 3008
331 Ga0207667_10241755 3300025949 Bacteria 1847
332 Ga0207712_10029108 3300025961 Bacteria 3702
333 Ga0207668_10010865 3300025972 Bacteria 5516
334 Ga0207668_10014836 3300025972 Bacteria 4829
335 Ga0207668_10030991 3300025972 Bacteria 3518
336 Ga0207668_10099992 3300025972 Bacteria 2152
337 Ga0207668_10127790 3300025972 Bacteria 1936
338 Ga0207668_10138362 3300025972 Bacteria 1869
339 Ga0207668_10184701 3300025972 Bacteria 1647
340 Ga0207668_10185070 3300025972 Bacteria 1646
341 Ga0207640_10177309 3300025981 Bacteria 1594
342 Ga0207677_10043343 3300026023 Bacteria 2990
343 Ga0207703_10081357 3300026035 Bacteria 2700
344 Ga0207703_10218167 3300026035 Bacteria 1704
345 Ga0207703_10231295 3300026035 Bacteria 1657
346 Ga0207639_10005343 3300026041 Bacteria 8679
347 Ga0207678_10003472 3300026067 Bacteria 14191
348 Ga0207678_10046790 3300026067 Bacteria 3742
349 Ga0207678_10049637 3300026067 Bacteria 3626
350 Ga0207678_10064611 3300026067 Bacteria 3144
351 Ga0207678_10296903 3300026067 Bacteria 1388
352 Ga0207702_10000014 3300026078 Bacteria 253304
353 Ga0207702_10282267 3300026078 Bacteria 1570
354 Ga0207641_10240986 3300026088 Bacteria 1685
355 Ga0207641_10273472 3300026088 Bacteria 1586
356 Ga0207648_10085382 3300026089 Bacteria 2753
357 Ga0207648_10107966 3300026089 Bacteria 2443
358 Ga0207676_10011441 3300026095 Bacteria 6342
359 Ga0207676_10019822 3300026095 Bacteria 4913
360 Ga0207674_10013973 3300026116 Bacteria 8879
361 Ga0207675_100127247 3300026118 Bacteria 2414
362 Ga0207683_10018049 3300026121 Bacteria 6016
363 Ga0207683_10046736 3300026121 Bacteria 3790
364 Ga0207683_10127390 3300026121 Bacteria 2289
365 Ga0207683_10154629 3300026121 Bacteria 2071
366 Ga0207683_10218403 3300026121 Bacteria 1736
367 Ga0207683_10240885 3300026121 Bacteria 1650
368 Ga0207698_10045704 3300026142 Bacteria 3301
369 Ga0207698_10187316 3300026142 Bacteria 1839
370 Ga0207698_10293517 3300026142 Bacteria 1510
371 Ga0209389_1000016 3300027296 Bacteria 184844
372 Ga0209969_1002107 3300027360 Bacteria 2741
373 Ga0209489_100063 3300027361 Bacteria 144408
374 Ga0209700_100012 3300027363 Bacteria 357892
375 Ga0210000_1000508 3300027462 Bacteria 5300
376 Ga0209995_1002427 3300027471 Bacteria 2943
377 Ga0209999_1004186 3300027543 Bacteria 2597
378 Ga0209588_1011313 3300027671 Bacteria 2694
379 Ga0209813_10006183 3300027866 Bacteria 2947
380 Ga0207428_10023941 3300027907 Bacteria 5129
381 Ga0268266_10014838 3300028379 Bacteria 6692
382 Ga0268266_10132219 3300028379 Bacteria 2233
383 Ga0268266_10158756 3300028379 Bacteria 2044
384 Ga0268266_10160826 3300028379 Bacteria 2031
385 Ga0268266_10259661 3300028379 Bacteria 1609
386 Ga0268266_10288308 3300028379 Bacteria 1528
387 Ga0268265_10027240 3300028380 Bacteria 4076
388 Ga0268265_10047819 3300028380 Bacteria 3208
389 Ga0268265_10087904 3300028380 Bacteria 2474
390 Ga0268264_10000042 3300028381 Bacteria 372069
391 Ga0268264_10053083 3300028381 Bacteria 3381
392 Ga0268264_10087570 3300028381 Bacteria 2678
393 Ga0307517_10000176 3300028786 Bacteria 105402
394 Ga0307515_10075181 3300028794 Bacteria 4505
395 Ga0307511_10053634 3300030521 Bacteria 3192
396 Ga0265332_10071281 3300031238 Bacteria 1480
397 Ga0265325_10002323 3300031241 Bacteria 12907
398 Ga0265325_10010610 3300031241 Bacteria 5325
399 Ga0265340_10011845 3300031247 Bacteria 4622
400 Ga0265340_10019263 3300031247 Bacteria 3513
401 Ga0265316_10087257 3300031344 Bacteria 2384
402 Ga0307513_10142183 3300031456 Bacteria 2324
403 Ga0307509_10022374 3300031507 Bacteria 7127
404 Ga0307509_10129452 3300031507 Bacteria 2483
405 Ga0307509_10345703 3300031507 Bacteria 1213
406 Ga0307408_100103483 3300031548 Bacteria 2174
407 Ga0307408_100241512 3300031548 Bacteria 1485
408 Ga0307508_10046720 3300031616 Bacteria 3865
409 Ga0265314_10007706 3300031711 Bacteria 9310
410 Ga0265314_10016415 3300031711 Bacteria 5849
411 Ga0265314_10079251 3300031711 Bacteria 2172
412 Ga0265342_10009595 3300031712 Bacteria 6796
413 Ga0265342_10023757 3300031712 Bacteria 3875
414 Ga0265342_10065180 3300031712 Bacteria 2136
415 Ga0307516_10020012 3300031730 Bacteria 6920
416 Ga0307411_10088911 3300032005 Bacteria 2150
417 Ga0307411_10425833 3300032005 Bacteria 1104
418 Ga0307415_100110411 3300032126 Bacteria 2039
419 Ga0307510_10007730 3300033180 Bacteria 12823
420 Ga0307510_10020603 3300033180 Bacteria 7701
421 Ga0307510_10024013 3300033180 Bacteria 7054
422 Ga0307510_10264543 3300033180 Bacteria 1199
423 Ga0315911_1000012 3300033442 Bacteria 248988
424 Ga0373930_0005629 3300034816 Bacteria 2091
425 Ga0373926_0005379 3300035083 Bacteria 4218
426 Ga0373929_0005434 3300035085 Bacteria 2292
427 Ga0373934_0002178 3300035086 Bacteria 7205
428 Ga0373944_0008059 3300035089 Bacteria 2839
429 Ga0373923_0001946 3300035111 Bacteria 6191
430 Ga0373923_0080726 3300035111 Bacteria 1410
431 Ga0373936_0008199 3300035113 Bacteria 3926
432 Ga0373936_0038186 3300035113 Bacteria 1919
433 Ga0373939_0063301 3300035114 Bacteria 1185
434 Ga0373953_0039692 3300035117 Bacteria 1866
435 Ga0373954_0002355 3300035118 Bacteria 7899
436 Ga0373956_0002239 3300035119 Bacteria 7967
437 Ga0373956_0049325 3300035119 Bacteria 1888
438 Ga0373956_0053696 3300035119 Bacteria 1814
439 Ga0373957_0000527 3300035120 Bacteria 9628
440 Ga0373957_0049538 3300035120 Bacteria 1603
441 Ga0373943_0016178 3300035170 Bacteria 3398
442 Ga0373946_0016253 3300035171 Bacteria 2833
443 Ga0373955_0000535 3300035172 Bacteria 16084
444 Ga0373955_0054645 3300035172 Bacteria 2184
445 Ga0373955_0065771 3300035172 Bacteria 2014
446 Ga0373955_0245171 3300035172 Bacteria 1073
447 Ga0373955_0282663 3300035172 Bacteria 998
448 Ga0373961_0106377 3300035241 Bacteria 914
449 Ga0373962_0022693 3300035242 Bacteria 1666
450 Ga0373924_0004005 3300035410 Bacteria 5117
451 Ga0373924_0032496 3300035410 Bacteria 2102
452 Ga0373931_0004821 3300035691 Bacteria 6194
453 Ga0373931_0014148 3300035691 Bacteria 3896
454 Ga0373931_0019707 3300035691 Unclassified 3369
455 Ga0373935_0002921 3300035692 Bacteria 9842
456 Ga0373927_0042604 3300035695 Bacteria 2941
457 Ga0373927_0344767 3300035695 Bacteria 981
458 Ga0373933_0002165 3300035724 Bacteria 11241
459 Ga0373933_0081588 3300035724 Bacteria 1984
460 Ga0373933_0107022 3300035724 Bacteria 1740
461 Ga0373947_0007981 3300035725 Bacteria 6104
462 Ga0373947_0013638 3300035725 Bacteria 4655
463 Ga0373937_0022868 3300036401 Bacteria 5623
464 Ga0373937_0050675 3300036401 Bacteria 3803
465 Ga0373937_0101164 3300036401 Bacteria 2675
466 Ga0373937_0315490 3300036401 Bacteria 1479
467 Ga0373937_0369106 3300036401 Bacteria 1360
468 Ga0373937_0395220 3300036401 Bacteria 1311
469 Ga0373925_0002335 3300037068 Bacteria 15260
470 Ga0373925_0332378 3300037068 Bacteria 1231
471 Ga0395900_0335819 3300037418 Bacteria 1488
472 Ga0395900_0447228 3300037418 Bacteria 1249
473 Ga0395898_0037345 3300037466 Bacteria 4820
474 Ga0395898_0183734 3300037466 Bacteria 1998
475 Ga0395905_0103258 3300037471 Bacteria 2676
476 Ga0395905_0136451 3300037471 Bacteria 2308
477 Ga0451851_0758436 3300041507 Bacteria 1429
478 Ga0439446_0017631 3300042156 Bacteria 1997
479 Ga0439434_0004260 3300042435 Bacteria 4181
480 Ga0439435_0001020 3300042436 Bacteria 4928
481 Ga0439435_0029194 3300042436 Bacteria 1487
482 Ga0439459_0007728 3300042438 Bacteria 1823
483 Ga0466972_0000179 3300044658 Bacteria 49010
484 Ga0451576_0017197 3300045051 Bacteria 7955
485 Ga0466967_0178875 3300045976 Bacteria 1999
486 Ga0495617_006222 3300046452 Bacteria 4200
487 Ga0495592_0021832 3300046454 Bacteria 4870
488 Ga0495592_0041663 3300046454 Bacteria 3441
489 Ga0495603_0000923 3300046455 Bacteria 16862
490 Ga0495603_0008603 3300046455 Bacteria 6169
491 Ga0495603_0021384 3300046455 Bacteria 3918
492 Ga0495603_0028744 3300046455 Bacteria 3354
493 Ga0495603_0055227 3300046455 Bacteria 2353
494 Ga0495603_0093236 3300046455 Bacteria 1760
495 Ga0495603_0160008 3300046455 Bacteria 1306
496 Ga0495629_0001841 3300046459 Bacteria 16607
497 Ga0495629_0002400 3300046459 Bacteria 14408
498 Ga0495629_0033029 3300046459 Bacteria 3662
499 Ga0495629_0145279 3300046459 Bacteria 1650
500 Ga0495638_0001078 3300046460 Bacteria 26592
501 Ga0495638_0030773 3300046460 Bacteria 3451
502 Ga0495641_0011027 3300046461 Bacteria 5182
503 Ga0495651_0087761 3300046462 Bacteria 2338
504 Ga0495653_0004149 3300046463 Bacteria 11724
505 Ga0495653_0037943 3300046463 Bacteria 3783
506 Ga0495653_0085483 3300046463 Bacteria 2320
507 Ga0495580_0009257 3300046472 Bacteria 7756
508 Ga0495580_0010859 3300046472 Bacteria 7068
509 Ga0495580_0030671 3300046472 Bacteria 3891
510 Ga0495582_0000283 3300046473 Bacteria 28312
511 Ga0495582_0106808 3300046473 Bacteria 1571
512 Ga0495582_0112943 3300046473 Bacteria 1526
513 Ga0495639_0004800 3300046475 Bacteria 5813
514 Ga0495639_0074969 3300046475 Bacteria 1568
515 Ga0495662_0001975 3300046476 Bacteria 10288
516 Ga0495662_0027547 3300046476 Bacteria 2745
517 Ga0495664_0007158 3300046477 Bacteria 6183
518 Ga0495664_0013420 3300046477 Bacteria 4645
519 Ga0495664_0141800 3300046477 Bacteria 1457
520 Ga0495664_0239213 3300046477 Bacteria 1098
521 Ga0495585_0037502 3300046492 Bacteria 2730
522 Ga0495585_0150073 3300046492 Unclassified 1216
523 Ga0495594_0000509 3300046499 Bacteria 19796
524 Ga0495594_0055155 3300046499 Bacteria 2191
525 Ga0495596_0074110 3300046500 Bacteria 1322
526 Ga0495606_0000357 3300046507 Bacteria 78015
527 Ga0495606_0010827 3300046507 Bacteria 7515
528 Ga0495606_0156888 3300046507 Bacteria 1331
529 Ga0495608_0020082 3300046511 Bacteria 4593
530 Ga0495608_0105511 3300046511 Bacteria 1814
531 Ga0495618_0032005 3300046514 Bacteria 3294
532 Ga0495618_0048943 3300046514 Bacteria 2669
533 Ga0495618_0095039 3300046514 Bacteria 1906
534 Ga0495620_0058506 3300046515 Bacteria 1613
535 Ga0495628_0063319 3300046516 Bacteria 2898
536 Ga0495628_0108220 3300046516 Bacteria 2140
537 Ga0495628_0152094 3300046516 Bacteria 1762
538 Ga0495630_0008393 3300046517 Bacteria 7407
539 Ga0495630_0018211 3300046517 Bacteria 5157
540 Ga0495630_0162430 3300046517 Bacteria 1701
541 Ga0495631_0105821 3300046518 Bacteria 1210
542 Ga0495632_0043888 3300046519 Bacteria 2233
543 Ga0495643_0060867 3300046522 Bacteria 2003
544 Ga0495648_0001411 3300046524 Bacteria 23498
545 Ga0495648_0006902 3300046524 Bacteria 9160
546 Ga0495642_0021165 3300046528 Bacteria 2557
547 Ga0495652_0016077 3300046529 Bacteria 6694
548 Ga0495652_0040475 3300046529 Bacteria 4028
549 Ga0495652_0106314 3300046529 Bacteria 2266
550 Ga0495652_0114790 3300046529 Bacteria 2160
551 Ga0495652_0151102 3300046529 Bacteria 1814
552 Ga0495665_0000145 3300046531 Bacteria 34959
553 Ga0495640_0007751 3300046533 Bacteria 8449
554 Ga0495640_0016865 3300046533 Bacteria 5459
555 Ga0495640_0039415 3300046533 Bacteria 3315
556 Ga0495640_0140585 3300046533 Bacteria 1556
557 Ga0495587_0018462 3300046536 Bacteria 4325
558 Ga0495597_0110835 3300046542 Bacteria 1151
559 Ga0495645_0013988 3300046543 Bacteria 5686
560 Ga0495645_0104249 3300046543 Bacteria 2014
561 Ga0495645_0218986 3300046543 Bacteria 1281
562 Ga0495622_0006137 3300046557 Bacteria 5584
563 Ga0495667_0033824 3300046559 Bacteria 3419
564 Ga0495667_0066606 3300046559 Bacteria 2354
565 Ga0495667_0066888 3300046559 Bacteria 2349
566 Ga0495667_0076114 3300046559 Bacteria 2183
567 Ga0495656_0014930 3300046615 Bacteria 2922
568 Ga0495656_0027175 3300046615 Bacteria 2283
569 Ga0495668_0027456 3300046616 Bacteria 3225
570 Ga0495668_0033297 3300046616 Bacteria 2896
571 Ga0495634_0001108 3300046642 Bacteria 24957
572 Ga0495634_0009918 3300046642 Bacteria 7000
573 Ga0495634_0018655 3300046642 Bacteria 4935
574 Ga0495634_0082129 3300046642 Bacteria 2106
575 Ga0495634_0122835 3300046642 Bacteria 1662
576 Ga0495611_0044668 3300046648 Bacteria 1982
577 Ga0495611_0097200 3300046648 Bacteria 1364
578 Ga0495625_0085058 3300046660 Bacteria 2196
579 Ga0495625_0112735 3300046660 Bacteria 1858
580 Ga0495635_0002477 3300046663 Bacteria 12604
581 Ga0495635_0009937 3300046663 Bacteria 6652
582 Ga0495635_0013665 3300046663 Bacteria 5682
583 Ga0495635_0068873 3300046663 Bacteria 2427
584 Ga0495588_0013234 3300046674 Bacteria 3926
585 Ga0495588_0028524 3300046674 Bacteria 2794
586 Ga0495588_0130449 3300046674 Bacteria 1326
587 Ga0495588_0140974 3300046674 Bacteria 1273
588 Ga0495657_0021483 3300046675 Bacteria 4630
589 Ga0495657_0024161 3300046675 Bacteria 4332
590 Ga0495657_0204093 3300046675 Bacteria 1203
591 Ga0495599_0005563 3300046678 Bacteria 7558
592 Ga0495599_0025078 3300046678 Bacteria 3731
593 Ga0495623_0002992 3300046679 Bacteria 11118
594 Ga0495623_0010731 3300046679 Bacteria 5931
595 Ga0495623_0090320 3300046679 Bacteria 1881
596 Ga0495646_0021267 3300046680 Bacteria 4101
597 Ga0495646_0036786 3300046680 Bacteria 3031
598 Ga0495646_0049099 3300046680 Bacteria 2561
599 Ga0495646_0145751 3300046680 Bacteria 1320
600 Ga0495647_0007604 3300046681 Bacteria 3636
601 Ga0495658_0000547 3300046683 Bacteria 20542
602 Ga0495658_0139704 3300046683 Bacteria 1481
603 Ga0495669_0033559 3300046684 Bacteria 2259
604 Ga0495613_0002250 3300046689 Bacteria 14591
605 Ga0495613_0068935 3300046689 Bacteria 2579
606 Ga0495613_0106435 3300046689 Bacteria 2024
607 Ga0495624_0005060 3300046690 Bacteria 9536
608 Ga0495649_0051812 3300046694 Bacteria 2225
609 Ga0495589_0049304 3300046794 Bacteria 2084
610 Ga0495600_0027802 3300046809 Bacteria 3656
611 Ga0495581_0000529 3300047315 Bacteria 19610
612 Ga0495581_0049088 3300047315 Bacteria 2437
613 Ga0495581_0199949 3300047315 Bacteria 1169
614 Ga0495604_0014830 3300047317 Bacteria 6215
615 Ga0495604_0022506 3300047317 Bacteria 5031
616 Ga0495604_0040425 3300047317 Bacteria 3661
617 Ga0495604_0049547 3300047317 Bacteria 3263
618 Ga0495674_0012072 3300047319 Bacteria 8141
619 Ga0495674_0023272 3300047319 Bacteria 5712
620 Ga0495674_0032883 3300047319 Bacteria 4701
621 Ga0495674_0036651 3300047319 Bacteria 4413
622 Ga0495674_0141178 3300047319 Bacteria 2024
623 Ga0495672_0085850 3300047320 Bacteria 1742
624 Ga0495676_0153006 3300047321 Bacteria 1639
625 Ga0495680_0001426 3300047322 Bacteria 25752
626 Ga0495680_0012571 3300047322 Bacteria 7441
627 Ga0495683_0046627 3300047323 Bacteria 2175
628 Ga0495675_0136036 3300047444 Bacteria 1525
629 Ga0495679_053256 3300047446 Bacteria 1209
630 Ga0495673_0042339 3300047469 Bacteria 2045
631 Ga0495673_0090072 3300047469 Bacteria 1255
632 Ga0495684_0001145 3300047471 Bacteria 21346
633 Ga0495684_0078066 3300047471 Bacteria 2512
634 Ga0495684_0123791 3300047471 Bacteria 1946
635 Ga0495593_0000526 3300047673 Bacteria 21677
636 Ga0495593_0000877 3300047673 Bacteria 17432
637 Ga0495593_0040050 3300047673 Bacteria 2524
638 Ga0495602_0007749 3300048088 Bacteria 11224
639 Ga0495602_0009427 3300048088 Bacteria 10154
640 Ga0495602_0028167 3300048088 Bacteria 5381
641 Ga0495602_0170130 3300048088 Bacteria 1692
642 Ga0495615_0012801 3300048090 Bacteria 1738
643 Ga0495615_0036565 3300048090 Bacteria 1206
644 Ga0496100_0036611 3300048903 Bacteria 3097
645 Ga0496100_0083844 3300048903 Bacteria 2159
646 Ga0496101_0008287 3300048904 Bacteria 6790
647 Ga0496101_0068460 3300048904 Bacteria 2595
648 Ga0496101_0448082 3300048904 Bacteria 1018
649 Ga0496102_0072086 3300048905 Bacteria 3173
650 Ga0496102_0151850 3300048905 Bacteria 2177
651 Ga0496102_0202316 3300048905 Bacteria 1872
652 Ga0496103_0047232 3300048906 Bacteria 2660
653 Ga0496103_0057689 3300048906 Bacteria 2411
654 Ga0496104_0000812 3300048907 Bacteria 26879
655 Ga0496104_0001312 3300048907 Bacteria 21461
656 Ga0496104_0009449 3300048907 Bacteria 8674
657 Ga0496104_0025169 3300048907 Bacteria 5485
658 Ga0496104_0041576 3300048907 Bacteria 4311
659 Ga0496104_0117418 3300048907 Bacteria 2553
660 Ga0496104_0132565 3300048907 Bacteria 2394
661 Ga0496104_0398523 3300048907 Bacteria 1288
662 Ga0496105_0007262 3300048908 Bacteria 8558
663 Ga0496105_0013952 3300048908 Bacteria 6388
664 Ga0496105_0044074 3300048908 Bacteria 3678
665 Ga0496105_0063015 3300048908 Bacteria 3059
666 Ga0496105_0078734 3300048908 Bacteria 2721
667 Ga0496106_0081988 3300048909 Bacteria 2479
668 Ga0496106_0131628 3300048909 Bacteria 1962
669 Ga0496106_0365910 3300048909 Bacteria 1158
670 Ga0496107_0004840 3300048910 Bacteria 9144
671 Ga0496107_0052219 3300048910 Bacteria 2949
672 Ga0496107_0224243 3300048910 Bacteria 1398
673 Ga0496108_0039050 3300048911 Bacteria 3957
674 Ga0496108_0114638 3300048911 Bacteria 2307
675 Ga0496108_0207552 3300048911 Bacteria 1700
676 Ga0496108_0362302 3300048911 Bacteria 1266
677 Ga0496108_0511472 3300048911 Bacteria 1048
678 Ga0496109_0014503 3300048912 Bacteria 6856
679 Ga0496109_0021350 3300048912 Bacteria 5724
680 Ga0496109_0059361 3300048912 Bacteria 3494
681 Ga0496109_0150548 3300048912 Bacteria 2178
682 Ga0496109_0178337 3300048912 Bacteria 1995
683 Ga0496109_0330078 3300048912 Bacteria 1440
684 Ga0496110_0134451 3300048913 Bacteria 2234
685 Ga0496110_0148096 3300048913 Bacteria 2124
686 Ga0496110_0173181 3300048913 Bacteria 1958
687 Ga0496110_0211501 3300048913 Bacteria 1763
688 Ga0496111_0021899 3300048914 Bacteria 4468
689 Ga0496111_0034817 3300048914 Bacteria 3597
690 Ga0496112_0000052 3300048915 Bacteria 81285
691 Ga0496112_0022947 3300048915 Bacteria 5955
692 Ga0496112_0079304 3300048915 Bacteria 3248
693 Ga0496112_0095845 3300048915 Bacteria 2937
694 Ga0496112_0119669 3300048915 Bacteria 2603
695 Ga0496112_0124651 3300048915 Bacteria 2547
696 Ga0496112_0154761 3300048915 Bacteria 2260
697 Ga0496112_0174421 3300048915 Bacteria 2115
698 Ga0496112_0341230 3300048915 Bacteria 1441
699 Ga0496113_0019366 3300048916 Bacteria 4759
700 Ga0496113_0098949 3300048916 Bacteria 2258
701 Ga0496113_0136402 3300048916 Bacteria 1928
702 Ga0496113_0213124 3300048916 Bacteria 1538
703 Ga0496113_0247750 3300048916 Bacteria 1422
704 Ga0496114_0006660 3300048917 Bacteria 9104
705 Ga0496114_0041961 3300048917 Unclassified 3791
706 Ga0496114_0061283 3300048917 Bacteria 3146
707 Ga0496114_0075094 3300048917 Bacteria 2846
708 Ga0496114_0098275 3300048917 Bacteria 2495
709 Ga0496114_0125156 3300048917 Bacteria 2215
710 Ga0496114_0142504 3300048917 Bacteria 2076
711 Ga0496114_0208667 3300048917 Bacteria 1713
712 Ga0496115_0000981 3300048918 Bacteria 20690
713 Ga0496115_0016513 3300048918 Bacteria 5623
714 Ga0496115_0049802 3300048918 Bacteria 3354
715 Ga0496115_0071871 3300048918 Bacteria 2806
716 Ga0496115_0102143 3300048918 Bacteria 2351
717 Ga0496115_0120672 3300048918 Bacteria 2157
718 Ga0496115_0268417 3300048918 Bacteria 1402
719 Ga0496118_0037250 3300048921 Bacteria 3919
720 Ga0496118_0053748 3300048921 Bacteria 3057
721 Ga0496119_0072162 3300048922 Bacteria 2018
722 Ga0496119_0084115 3300048922 Bacteria 1825
723 Ga0496119_0093768 3300048922 Bacteria 1700
724 Ga0496120_0011332 3300048923 Bacteria 6137
725 Ga0496120_0027756 3300048923 Bacteria 3477
726 Ga0496120_0050193 3300048923 Bacteria 2390
727 Ga0496121_0000753 3300048924 Bacteria 59517
728 Ga0496121_0001173 3300048924 Bacteria 45935
729 Ga0496121_0011996 3300048924 Bacteria 9526
730 Ga0496121_0078769 3300048924 Bacteria 2618
731 Ga0496121_0083299 3300048924 Bacteria 2525
732 Ga0496121_0096056 3300048924 Bacteria 2301
733 Ga0496121_0097922 3300048924 Bacteria 2271
734 Ga0496121_0099229 3300048924 Bacteria 2251
735 Ga0496121_0200554 3300048924 Bacteria 1422
736 Ga0496121_0321808 3300048924 Bacteria 1041
737 Ga0496123_0022865 3300048926 Bacteria 4803
738 Ga0496124_0025489 3300048927 Bacteria 5355
739 Ga0496124_0045919 3300048927 Bacteria 3743
740 Ga0496124_0181722 3300048927 Bacteria 1618
741 Ga0496125_0000099 3300048928 Bacteria 203333
742 Ga0496125_0088394 3300048928 Bacteria 2335
743 Ga0496125_0109206 3300048928 Bacteria 2009
744 Ga0496126_0004189 3300048929 Bacteria 17378
745 Ga0496126_0004375 3300048929 Bacteria 16937
746 Ga0496126_0010575 3300048929 Bacteria 9650
747 Ga0496126_0060475 3300048929 Bacteria 3406
748 Ga0496126_0216461 3300048929 Bacteria 1611
749 Ga0495682_0099429 3300049460 Bacteria 1043
750 Ga0501032_0050900 3300049569 Bacteria 2793
751 Ga0501033_0141713 3300049570 Bacteria 1737
752 Ga0501036_0205855 3300049572 Bacteria 1654
753 Ga0501037_0144704 3300049573 Bacteria 1700
754 Ga0501038_0172198 3300049574 Bacteria 1751
755 Ga0501039_0023343 3300049575 Bacteria 4748
756 Ga0501039_0212880 3300049575 Bacteria 1520
757 Ga0501040_0010938 3300049576 Bacteria 5935
758 Ga0501041_0007647 3300049577 Bacteria 6346
759 Ga0501042_0090331 3300049578 Bacteria 2198
760 Ga0501043_0024532 3300049579 Bacteria 4732
761 Ga0501043_0033989 3300049579 Bacteria 4011
762 Ga0501048_0082653 3300049582 Bacteria 2266
763 Ga0501068_0020221 3300049584 Bacteria 3876
764 Ga0501071_0047599 3300049587 Bacteria 3081
765 Ga0501072_0056896 3300049588 Bacteria 3081
766 Ga0501073_0033574 3300049589 Bacteria 3653
767 Ga0501075_0007243 3300049591 Bacteria 7690
768 Ga0501076_0007427 3300049592 Bacteria 7978
769 Ga0501076_0391098 3300049592 Bacteria 1143
770 Ga0501077_0041950 3300049593 Bacteria 2912
771 Ga0501079_0053796 3300049741 Bacteria 3105
772 Ga0501080_0018823 3300049742 Bacteria 6395
773 Ga0501081_0005665 3300049743 Bacteria 8083
774 Ga0501083_0151715 3300049744 Bacteria 1517
775 Ga0501035_0097682 3300049822 Bacteria 2579
776 Ga0501045_0031338 3300049824 Bacteria 3851
777 nmdc:mga03683_145360_c1 3300050489 Bacteria 1068
778 nmdc:mga03683_3223_c1 3300050489 Bacteria 5220
779 nmdc:mga03n38_448_c1 3300050490 Bacteria 10279
780 nmdc:mga03n38_8403_c1 3300050490 Bacteria 3705
781 nmdc:mga00v17_101476_c1 3300050491 Bacteria 1817
782 nmdc:mga0yw44_104096_c1 3300050492 Bacteria 1811
783 nmdc:mga0yw44_55403_c1 3300050492 Bacteria 2412
784 nmdc:mga0k408_271842_c1 3300050493 Bacteria 1012
785 nmdc:mga0k408_39071_c1 3300050493 Bacteria 2725
786 nmdc:mga06z11_11791_c1 3300050494 Bacteria 3780
787 nmdc:mga06z11_16094_c1 3300050494 Bacteria 3359
788 nmdc:mga06z11_16892_c1 3300050494 Bacteria 3299
789 nmdc:mga06z11_26154_c1 3300050494 Bacteria 2774
790 nmdc:mga06z11_86105_c1 3300050494 Bacteria 1697
791 nmdc:mga04h51_64006_c1 3300050495 Bacteria 1268
792 nmdc:mga04h51_83459_c1 3300050495 Bacteria 1138
793 nmdc:mga07m45_21914_c1 3300050496 Bacteria 3484
794 nmdc:mga07m45_42134_c1 3300050496 Bacteria 2559
795 nmdc:mga07m45_66106_c1 3300050496 Bacteria 2054
796 nmdc:mga0qj67_83578_c1 3300050509 Bacteria 2559
797 nmdc:mga06r32_153643_c1 3300050510 Bacteria 2281
798 nmdc:mga06r32_166682_c1 3300050510 Bacteria 2186
799 nmdc:mga06r32_349262_c1 3300050510 Bacteria 1464
800 nmdc:mga08y16_231412_c1 3300050511 Bacteria 1911
801 nmdc:mga08y16_298429_c1 3300050511 Bacteria 1661
802 nmdc:mga08y16_378851_c1 3300050511 Bacteria 1450
803 nmdc:mga08y16_4970_c1 3300050511 Bacteria 13898
804 nmdc:mga0sz30_28196_c1 3300050516 Bacteria 2309
805 nmdc:mga0sz30_33849_c1 3300050516 Bacteria 2125
806 Ga0495601_0026489 3300053077 Bacteria 3580
807 Ga0495601_0259974 3300053077 Bacteria 1133
808 Ga0495612_0025418 3300053078 Bacteria 2377
809 Ga0500635_0030865 3300053080 Bacteria 1731
810 Ga0500635_0044516 3300053080 Bacteria 1498
811 Ga0495655_0030398 3300053083 Bacteria 1306
812 Ga0495595_0001351 3300053084 Bacteria 9525
813 Ga0495619_0001695 3300053085 Bacteria 14587
814 Ga0495619_0106527 3300053085 Bacteria 1912
815 Ga0500578_0082245 3300053086 Bacteria 2047
816 Ga0500578_0115128 3300053086 Bacteria 1693
817 Ga0500578_0137605 3300053086 Bacteria 1528
818 Ga0500643_000180 3300053087 Bacteria 61907
819 Ga0500643_036936 3300053087 Bacteria 1457
820 Ga0500581_133791 3300053089 Bacteria 1183
821 Ga0500583_0076954 3300053092 Bacteria 1605
822 Ga0500583_0144694 3300053092 Bacteria 1182
823 Ga0500566_0003442 3300053094 Bacteria 9438
824 Ga0500566_0004614 3300053094 Bacteria 8202
825 Ga0500566_0005672 3300053094 Bacteria 7420
826 Ga0500640_005231 3300053095 Bacteria 4812
827 Ga0500641_0006262 3300053096 Bacteria 4221
828 Ga0500641_0038405 3300053096 Bacteria 1924
829 Ga0500554_027341 3300053102 Bacteria 1648
830 Ga0500556_0049725 3300053104 Bacteria 1512
831 Ga0500557_000046 3300053105 Bacteria 59508
832 Ga0500562_003205 3300053108 Bacteria 4078
833 Ga0500562_030257 3300053108 Bacteria 1426
834 Ga0500572_004446 3300053111 Bacteria 3179
835 Ga0500594_0015624 3300053118 Bacteria 1833
836 Ga0500595_000615 3300053119 Bacteria 21276
837 Ga0500595_001062 3300053119 Bacteria 15299
838 Ga0500595_006544 3300053119 Bacteria 4930
839 Ga0500595_011027 3300053119 Bacteria 3561
840 Ga0500595_031388 3300053119 Bacteria 1783
841 Ga0500595_036174 3300053119 Bacteria 1620
842 Ga0500621_073463 3300053126 Bacteria 1377
843 Ga0500626_066857 3300053128 Bacteria 1603
844 Ga0500642_0000038 3300053130 Bacteria 98299
845 Ga0500642_0011795 3300053130 Bacteria 3142
846 Ga0500642_0119061 3300053130 Bacteria 1234
847 Ga0500559_0005719 3300053136 Bacteria 5684
848 Ga0500568_0006530 3300053139 Bacteria 5843
849 Ga0500590_058173 3300053148 Bacteria 1948
850 Ga0500603_001321 3300053150 Bacteria 5680
851 Ga0500616_0000048 3300053153 Bacteria 313108
852 Ga0500616_0011113 3300053153 Bacteria 5345
853 Ga0500616_0014341 3300053153 Bacteria 4557
854 Ga0500622_0026880 3300053156 Bacteria 3034
855 Ga0500630_033291 3300053159 Bacteria 2528
856 Ga0500634_0021323 3300053161 Bacteria 3511
857 Ga0500638_015298 3300053162 Bacteria 3516
858 Ga0500639_000125 3300053163 Bacteria 36885
859 Ga0500639_049653 3300053163 Bacteria 2188
860 Ga0500636_0005096 3300053177 Bacteria 7460
861 Ga0500636_0054320 3300053177 Bacteria 2348
862 Ga0500637_0000445 3300053178 Bacteria 15850
863 Ga0500637_0015830 3300053178 Bacteria 4007
864 Ga0500625_003345 3300053729 Bacteria 6318
865 Ga0500609_001963 3300053731 Bacteria 2969
866 Ga0500596_002626 3300053735 Bacteria 3528
867 Ga0500601_000170 3300053737 Bacteria 13475
868 Ga0501084_0053012 3300054114 Bacteria 3393
869 Ga0501084_0158770 3300054114 Bacteria 1908
870 Ga0500661_000331 3300055283 Bacteria 8597
871 Ga0501082_0021916 3300060353 Bacteria 5507

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_145360_c1 nmdc:mga03683_145360_c1_131_1021 279
2 3300048904 Ga0496101_0448082 Ga0496101_0448082_27_875 280
3 3300050493 nmdc:mga0k408_271842_c1 nmdc:mga0k408_271842_c1_67_957 282
4 3300025315 Ga0207697_10039196 Ga0207697_100391962 292
5 3300031241 Ga0265325_10002323 Ga0265325_100023233 292
6 3300053119 Ga0500595_036174 Ga0500595_036174_716_1606 292
7 3300035172 Ga0373955_0282663 Ga0373955_0282663_22_903 293
8 3300035241 Ga0373961_0106377 Ga0373961_0106377_12_893 293
9 3300035695 Ga0373927_0344767 Ga0373927_0344767_72_953 293
10 3300046533 Ga0495640_0140585 Ga0495640_0140585_62_943 293
11 3300047315 Ga0495581_0199949 Ga0495581_0199949_222_1103 293
12 3300048906 Ga0496103_0057689 Ga0496103_0057689_1509_2390 293
13 3300048907 Ga0496104_0398523 Ga0496104_0398523_395_1276 293
14 3300048909 Ga0496106_0365910 Ga0496106_0365910_59_940 293
15 3300048911 Ga0496108_0511472 Ga0496108_0511472_154_1035 293
16 3300053086 Ga0500578_0082245 Ga0500578_0082245_62_943 293
17 3300009148 Ga0105243_10341412 Ga0105243_103414121 294
18 3300006195 Ga0075366_10182446 Ga0075366_101824461 296
19 3300027360 Ga0209969_1002107 Ga0209969_10021072 296
20 3300027462 Ga0210000_1000508 Ga0210000_10005082 296
21 3300027471 Ga0209995_1002427 Ga0209995_10024273 296
22 3300027543 Ga0209999_1004186 Ga0209999_10041863 296
23 3300031548 Ga0307408_100241512 Ga0307408_1002415122 296
24 3300009098 Ga0105245_10091933 Ga0105245_100919333 297
25 3300009176 Ga0105242_10061390 Ga0105242_100613904 297
26 3300025922 Ga0207646_10180585 Ga0207646_101805853 297
27 3300042156 Ga0439446_0017631 Ga0439446_0017631_379_1347 297
28 3300042435 Ga0439434_0004260 Ga0439434_0004260_2433_3401 297
29 3300042436 Ga0439435_0001020 Ga0439435_0001020_1348_2316 297
30 3300048912 Ga0496109_0330078 Ga0496109_0330078_28_1014 298
31 3300048913 Ga0496110_0148096 Ga0496110_0148096_413_1399 298
32 3300049592 Ga0501076_0391098 Ga0501076_0391098_35_1021 298
33 3300053126 Ga0500621_073463 Ga0500621_073463_14_982 298
34 3300053148 Ga0500590_058173 Ga0500590_058173_17_985 298
35 iso_pu_bacteria 8016603502 8016607675 298
36 iso_pu_bacteria 2847939898 2847943386 299
37 3300009177 Ga0105248_10009064 Ga0105248_1000906412 300
38 3300028381 Ga0268264_10053083 Ga0268264_100530832 300
39 3300035691 Ga0373931_0019707 Ga0373931_0019707_1590_2495 300
40 3300048909 Ga0496106_0131628 Ga0496106_0131628_1026_1952 300
41 3300048910 Ga0496107_0052219 Ga0496107_0052219_727_1632 300
42 3300048915 Ga0496112_0124651 Ga0496112_0124651_939_1844 300
43 3300048916 Ga0496113_0247750 Ga0496113_0247750_247_1152 300
44 3300048918 Ga0496115_0016513 Ga0496115_0016513_4176_5081 300
45 3300003215 JGI25153J46596_10026895 JGI25153J46596_100268952 301
46 3300005327 Ga0070658_10007681 Ga0070658_100076813 301
47 3300005548 Ga0070665_100068737 Ga0070665_1000687374 301
48 3300005548 Ga0070665_100371796 Ga0070665_1003717961 301
49 3300005564 Ga0070664_100178810 Ga0070664_1001788101 301
50 3300005616 Ga0068852_100560589 Ga0068852_1005605892 301
51 3300006051 Ga0075364_10213157 Ga0075364_102131572 301
52 3300010375 Ga0105239_10570913 Ga0105239_105709132 301
53 3300025297 Ga0209758_1017145 Ga0209758_10171451 301
54 3300025299 Ga0209256_1004815 Ga0209256_10048154 301
55 3300025972 Ga0207668_10184701 Ga0207668_101847011 301
56 3300026088 Ga0207641_10273472 Ga0207641_102734722 301
57 3300028379 Ga0268266_10259661 Ga0268266_102596611 301
58 3300041507 Ga0451851_0758436 Ga0451851_0758436_103_1086 301
59 3300042438 Ga0439459_0007728 Ga0439459_0007728_330_1319 301
60 3300046459 Ga0495629_0145279 Ga0495629_0145279_283_1344 301
61 3300048924 Ga0496121_0099229 Ga0496121_0099229_813_1802 301
62 3300053105 Ga0500557_000046 Ga0500557_000046_14829_15812 301
63 3300053130 Ga0500642_0000038 Ga0500642_0000038_68653_69636 301
64 3300053729 Ga0500625_003345 Ga0500625_003345_1650_2633 301
65 3300005937 Ga0081455_10013731 Ga0081455_100137312 302
66 3300005983 Ga0081540_1013509 Ga0081540_10135093 302
67 3300006178 Ga0075367_10211331 Ga0075367_102113311 302
68 3300032005 Ga0307411_10088911 Ga0307411_100889111 302
69 3300032005 Ga0307411_10425833 Ga0307411_104258331 302
70 3300045051 Ga0451576_0017197 Ga0451576_0017197_2991_3962 302
71 3300046452 Ga0495617_006222 Ga0495617_006222_3090_4079 302
72 3300046460 Ga0495638_0030773 Ga0495638_0030773_1242_2231 302
73 3300046519 Ga0495632_0043888 Ga0495632_0043888_719_1708 302
74 3300046528 Ga0495642_0021165 Ga0495642_0021165_845_1834 302
75 3300046615 Ga0495656_0014930 Ga0495656_0014930_1034_2023 302
76 3300046616 Ga0495668_0027456 Ga0495668_0027456_970_1959 302
77 3300046660 Ga0495625_0085058 Ga0495625_0085058_121_1110 302
78 3300048924 Ga0496121_0200554 Ga0496121_0200554_372_1358 302
79 3300005616 Ga0068852_100272757 Ga0068852_1002727572 303
80 3300005937 Ga0081455_10000875 Ga0081455_1000087520 303
81 3300005983 Ga0081540_1040637 Ga0081540_10406374 303
82 3300005985 Ga0081539_10001953 Ga0081539_1000195325 303
83 3300006048 Ga0075363_100104818 Ga0075363_1001048181 303
84 3300006048 Ga0075363_100169517 Ga0075363_1001695171 303
85 3300025981 Ga0207640_10177309 Ga0207640_101773092 303
86 3300026142 Ga0207698_10187316 Ga0207698_101873162 303
87 3300028794 Ga0307515_10075181 Ga0307515_100751812 303
88 3300031507 Ga0307509_10022374 Ga0307509_100223742 303
89 3300046455 Ga0495603_0021384 Ga0495603_0021384_2695_3681 303
90 3300046499 Ga0495594_0055155 Ga0495594_0055155_328_1314 303
91 3300046616 Ga0495668_0033297 Ga0495668_0033297_1788_2774 303
92 3300048905 Ga0496102_0151850 Ga0496102_0151850_964_1950 303
93 3300048928 Ga0496125_0000099 Ga0496125_0000099_30929_31927 303
94 3300003215 JGI25153J46596_10000371 JGI25153J46596_1000037118 304
95 3300003215 JGI25153J46596_10000865 JGI25153J46596_1000086516 304
96 3300003215 JGI25153J46596_10006554 JGI25153J46596_100065543 304
97 3300003354 JGI25160J50197_1016398 JGI25160J50197_10163983 304
98 3300003354 JGI25160J50197_1019515 JGI25160J50197_10195153 304
99 3300003794 Ga0055531_10005980 Ga0055531_100059807 304
100 3300005262 Ga0065165_1001685 Ga0065165_100168517 304
101 3300005262 Ga0065165_1004072 Ga0065165_10040727 304
102 3300005262 Ga0065165_1008657 Ga0065165_10086578 304
103 3300005331 Ga0070670_100143455 Ga0070670_1001434553 304
104 3300005334 Ga0068869_100055491 Ga0068869_1000554913 304
105 3300005334 Ga0068869_100104948 Ga0068869_1001049484 304
106 3300005338 Ga0068868_100059787 Ga0068868_1000597873 304
107 3300005344 Ga0070661_100100294 Ga0070661_1001002941 304
108 3300005347 Ga0070668_100027647 Ga0070668_1000276472 304
109 3300005347 Ga0070668_100040165 Ga0070668_1000401653 304
110 3300005347 Ga0070668_100065858 Ga0070668_1000658583 304
111 3300005347 Ga0070668_100079103 Ga0070668_1000791032 304
112 3300005347 Ga0070668_100164455 Ga0070668_1001644551 304
113 3300005355 Ga0070671_100062490 Ga0070671_1000624901 304
114 3300005355 Ga0070671_100103241 Ga0070671_1001032412 304
115 3300005367 Ga0070667_100147878 Ga0070667_1001478782 304
116 3300005455 Ga0070663_100073675 Ga0070663_1000736753 304
117 3300005457 Ga0070662_100133704 Ga0070662_1001337042 304
118 3300005459 Ga0068867_100324475 Ga0068867_1003244751 304
119 3300005466 Ga0070685_10178696 Ga0070685_101786961 304
120 3300005539 Ga0068853_100073476 Ga0068853_1000734763 304
121 3300005548 Ga0070665_100023285 Ga0070665_1000232854 304
122 3300005548 Ga0070665_100227374 Ga0070665_1002273742 304
123 3300005548 Ga0070665_100370296 Ga0070665_1003702961 304
124 3300005563 Ga0068855_100033225 Ga0068855_1000332255 304
125 3300005563 Ga0068855_100222708 Ga0068855_1002227083 304
126 3300005564 Ga0070664_100223115 Ga0070664_1002231151 304
127 3300005614 Ga0068856_100105914 Ga0068856_1001059143 304
128 3300005617 Ga0068859_100049211 Ga0068859_1000492115 304
129 3300005617 Ga0068859_100139093 Ga0068859_1001390932 304
130 3300005618 Ga0068864_100032861 Ga0068864_1000328612 304
131 3300005618 Ga0068864_100072113 Ga0068864_1000721133 304
132 3300005842 Ga0068858_100021643 Ga0068858_1000216433 304
133 3300005844 Ga0068862_100045564 Ga0068862_1000455643 304
134 3300005844 Ga0068862_100143926 Ga0068862_1001439262 304
135 3300005844 Ga0068862_100210056 Ga0068862_1002100562 304
136 3300005844 Ga0068862_100249712 Ga0068862_1002497121 304
137 3300005937 Ga0081455_10001281 Ga0081455_1000128128 304
138 3300005937 Ga0081455_10037949 Ga0081455_100379491 304
139 3300005937 Ga0081455_10038108 Ga0081455_100381087 304
140 3300005937 Ga0081455_10070498 Ga0081455_100704983 304
141 3300005981 Ga0081538_10053586 Ga0081538_100535862 304
142 3300005983 Ga0081540_1005014 Ga0081540_10050147 304
143 3300005983 Ga0081540_1008353 Ga0081540_10083536 304
144 3300005983 Ga0081540_1020858 Ga0081540_10208581 304
145 3300005983 Ga0081540_1028891 Ga0081540_10288913 304
146 3300005983 Ga0081540_1039018 Ga0081540_10390183 304
147 3300005983 Ga0081540_1039050 Ga0081540_10390503 304
148 3300006038 Ga0075365_10023866 Ga0075365_100238662 304
149 3300006038 Ga0075365_10049111 Ga0075365_100491113 304
150 3300006042 Ga0075368_10015164 Ga0075368_100151642 304
151 3300006042 Ga0075368_10025165 Ga0075368_100251654 304
152 3300006048 Ga0075363_100021478 Ga0075363_1000214783 304
153 3300006048 Ga0075363_100033053 Ga0075363_1000330532 304
154 3300006051 Ga0075364_10142361 Ga0075364_101423611 304
155 3300006051 Ga0075364_10222364 Ga0075364_102223641 304
156 3300006177 Ga0075362_10019479 Ga0075362_100194792 304
157 3300006178 Ga0075367_10026687 Ga0075367_100266873 304
158 3300006178 Ga0075367_10067047 Ga0075367_100670472 304
159 3300006178 Ga0075367_10081245 Ga0075367_100812451 304
160 3300006186 Ga0075369_10018451 Ga0075369_100184513 304
161 3300006186 Ga0075369_10025257 Ga0075369_100252573 304
162 3300006186 Ga0075369_10129826 Ga0075369_101298261 304
163 3300006195 Ga0075366_10015948 Ga0075366_100159485 304
164 3300006195 Ga0075366_10024275 Ga0075366_100242752 304
165 3300006195 Ga0075366_10049459 Ga0075366_100494593 304
166 3300006353 Ga0075370_10171147 Ga0075370_101711471 304
167 3300006358 Ga0068871_100111287 Ga0068871_1001112871 304
168 3300006844 Ga0075428_100174356 Ga0075428_1001743562 304
169 3300006881 Ga0068865_100022835 Ga0068865_1000228353 304
170 3300006931 Ga0097620_100049210 Ga0097620_1000492105 304
171 3300006931 Ga0097620_100139090 Ga0097620_1001390903 304
172 3300009094 Ga0111539_10095964 Ga0111539_100959642 304
173 3300009094 Ga0111539_10406088 Ga0111539_104060881 304
174 3300009148 Ga0105243_10036179 Ga0105243_100361794 304
175 3300009174 Ga0105241_10040357 Ga0105241_100403576 304
176 3300010375 Ga0105239_10358191 Ga0105239_103581912 304
177 3300010375 Ga0105239_10536793 Ga0105239_105367932 304
178 3300011119 Ga0105246_10101669 Ga0105246_101016692 304
179 3300011119 Ga0105246_10108983 Ga0105246_101089832 304
180 3300013306 Ga0163162_10149339 Ga0163162_101493392 304
181 3300014325 Ga0163163_10006013 Ga0163163_100060135 304
182 3300014326 Ga0157380_10074749 Ga0157380_100747493 304
183 3300014326 Ga0157380_10125864 Ga0157380_101258643 304
184 3300021320 Ga0214544_1000003 Ga0214544_1000003544 304
185 3300021320 Ga0214544_1024221 Ga0214544_10242212 304
186 3300021321 Ga0214542_1000022 Ga0214542_1000022114 304
187 3300021321 Ga0214542_1021284 Ga0214542_10212846 304
188 3300021324 Ga0214545_1000010 Ga0214545_100001069 304
189 3300021324 Ga0214545_1019543 Ga0214545_10195436 304
190 3300021327 Ga0214543_1000035 Ga0214543_1000035114 304
191 3300021327 Ga0214543_1022474 Ga0214543_10224742 304
192 3300025253 Ga0209677_105299 Ga0209677_1052994 304
193 3300025261 Ga0209233_1005042 Ga0209233_10050426 304
194 3300025297 Ga0209758_1000106 Ga0209758_100010653 304
195 3300025297 Ga0209758_1000344 Ga0209758_100034429 304
196 3300025297 Ga0209758_1001326 Ga0209758_100132625 304
197 3300025297 Ga0209758_1009962 Ga0209758_10099626 304
198 3300025297 Ga0209758_1028430 Ga0209758_10284301 304
199 3300025302 Ga0207426_1007089 Ga0207426_10070896 304
200 3300025302 Ga0207426_1007145 Ga0207426_10071453 304
201 3300025303 Ga0209051_1038240 Ga0209051_10382401 304
202 3300025304 Ga0209257_1000819 Ga0209257_100081934 304
203 3300025304 Ga0209257_1007500 Ga0209257_10075004 304
204 3300025315 Ga0207697_10111107 Ga0207697_101111071 304
205 3300025899 Ga0207642_10033579 Ga0207642_100335793 304
206 3300025901 Ga0207688_10096405 Ga0207688_100964052 304
207 3300025904 Ga0207647_10003565 Ga0207647_100035653 304
208 3300025907 Ga0207645_10210274 Ga0207645_102102741 304
209 3300025908 Ga0207643_10074007 Ga0207643_100740071 304
210 3300025911 Ga0207654_10003986 Ga0207654_100039861 304
211 3300025924 Ga0207694_10111879 Ga0207694_101118792 304
212 3300025931 Ga0207644_10243911 Ga0207644_102439113 304
213 3300025932 Ga0207690_10130804 Ga0207690_101308041 304
214 3300025933 Ga0207706_10078282 Ga0207706_100782823 304
215 3300025933 Ga0207706_10131828 Ga0207706_101318281 304
216 3300025935 Ga0207709_10022456 Ga0207709_100224564 304
217 3300025935 Ga0207709_10026424 Ga0207709_100264244 304
218 3300025935 Ga0207709_10041668 Ga0207709_100416683 304
219 3300025937 Ga0207669_10147193 Ga0207669_101471932 304
220 3300025938 Ga0207704_10035898 Ga0207704_100358981 304
221 3300025940 Ga0207691_10036011 Ga0207691_100360111 304
222 3300025942 Ga0207689_10014451 Ga0207689_100144513 304
223 3300025945 Ga0207679_10030648 Ga0207679_100306483 304
224 3300025945 Ga0207679_10115694 Ga0207679_101156942 304
225 3300025972 Ga0207668_10010865 Ga0207668_100108653 304
226 3300025972 Ga0207668_10014836 Ga0207668_100148365 304
227 3300025972 Ga0207668_10030991 Ga0207668_100309912 304
228 3300025972 Ga0207668_10099992 Ga0207668_100999923 304
229 3300026023 Ga0207677_10043343 Ga0207677_100433435 304
230 3300026067 Ga0207678_10046790 Ga0207678_100467903 304
231 3300026067 Ga0207678_10049637 Ga0207678_100496372 304
232 3300026067 Ga0207678_10064611 Ga0207678_100646111 304
233 3300026067 Ga0207678_10296903 Ga0207678_102969031 304
234 3300026078 Ga0207702_10282267 Ga0207702_102822673 304
235 3300026089 Ga0207648_10085382 Ga0207648_100853823 304
236 3300026089 Ga0207648_10107966 Ga0207648_101079662 304
237 3300026095 Ga0207676_10011441 Ga0207676_100114416 304
238 3300026095 Ga0207676_10019822 Ga0207676_100198224 304
239 3300026121 Ga0207683_10046736 Ga0207683_100467362 304
240 3300027296 Ga0209389_1000016 Ga0209389_1000016156 304
241 3300027361 Ga0209489_100063 Ga0209489_100063114 304
242 3300027363 Ga0209700_100012 Ga0209700_100012157 304
243 3300028379 Ga0268266_10014838 Ga0268266_100148387 304
244 3300028379 Ga0268266_10158756 Ga0268266_101587563 304
245 3300028379 Ga0268266_10288308 Ga0268266_102883082 304
246 3300028380 Ga0268265_10027240 Ga0268265_100272403 304
247 3300028380 Ga0268265_10087904 Ga0268265_100879043 304
248 3300028786 Ga0307517_10000176 Ga0307517_10000176102 304
249 3300031456 Ga0307513_10142183 Ga0307513_101421833 304
250 3300031548 Ga0307408_100103483 Ga0307408_1001034832 304
251 3300031616 Ga0307508_10046720 Ga0307508_100467204 304
252 3300032126 Ga0307415_100110411 Ga0307415_1001104113 304
253 3300033180 Ga0307510_10007730 Ga0307510_100077307 304
254 3300033180 Ga0307510_10020603 Ga0307510_1002060313 304
255 3300035114 Ga0373939_0063301 Ga0373939_0063301_149_1138 304
256 3300037418 Ga0395900_0447228 Ga0395900_0447228_241_1230 304
257 3300037466 Ga0395898_0037345 Ga0395898_0037345_3311_4297 304
258 3300037471 Ga0395905_0103258 Ga0395905_0103258_1158_2144 304
259 3300044658 Ga0466972_0000179 Ga0466972_0000179_42058_43044 304
260 3300046455 Ga0495603_0055227 Ga0495603_0055227_68_1057 304
261 3300046455 Ga0495603_0160008 Ga0495603_0160008_62_1051 304
262 3300046460 Ga0495638_0001078 Ga0495638_0001078_15578_16567 304
263 3300046492 Ga0495585_0037502 Ga0495585_0037502_1322_2311 304
264 3300046515 Ga0495620_0058506 Ga0495620_0058506_35_1024 304
265 3300046518 Ga0495631_0105821 Ga0495631_0105821_160_1149 304
266 3300046522 Ga0495643_0060867 Ga0495643_0060867_693_1679 304
267 3300046542 Ga0495597_0110835 Ga0495597_0110835_150_1139 304
268 3300046615 Ga0495656_0027175 Ga0495656_0027175_1274_2263 304
269 3300046648 Ga0495611_0044668 Ga0495611_0044668_529_1518 304
270 3300046648 Ga0495611_0097200 Ga0495611_0097200_100_1089 304
271 3300046674 Ga0495588_0140974 Ga0495588_0140974_132_1121 304
272 3300046684 Ga0495669_0033559 Ga0495669_0033559_751_1740 304
273 3300046794 Ga0495589_0049304 Ga0495589_0049304_752_1741 304
274 3300047446 Ga0495679_053256 Ga0495679_053256_82_1071 304
275 3300047469 Ga0495673_0042339 Ga0495673_0042339_526_1515 304
276 3300047469 Ga0495673_0090072 Ga0495673_0090072_164_1153 304
277 3300048090 Ga0495615_0012801 Ga0495615_0012801_67_1056 304
278 3300048090 Ga0495615_0036565 Ga0495615_0036565_31_1020 304
279 3300048905 Ga0496102_0202316 Ga0496102_0202316_753_1742 304
280 3300048907 Ga0496104_0041576 Ga0496104_0041576_3223_4212 304
281 3300048907 Ga0496104_0132565 Ga0496104_0132565_128_1117 304
282 3300048908 Ga0496105_0007262 Ga0496105_0007262_331_1317 304
283 3300048908 Ga0496105_0044074 Ga0496105_0044074_2274_3263 304
284 3300048910 Ga0496107_0224243 Ga0496107_0224243_16_1005 304
285 3300048911 Ga0496108_0039050 Ga0496108_0039050_2112_3101 304
286 3300048911 Ga0496108_0207552 Ga0496108_0207552_21_1019 304
287 3300048912 Ga0496109_0021350 Ga0496109_0021350_3230_4216 304
288 3300048915 Ga0496112_0154761 Ga0496112_0154761_1257_2246 304
289 3300048916 Ga0496113_0213124 Ga0496113_0213124_526_1515 304
290 3300048917 Ga0496114_0061283 Ga0496114_0061283_1710_2699 304
291 3300048917 Ga0496114_0125156 Ga0496114_0125156_669_1658 304
292 3300048921 Ga0496118_0037250 Ga0496118_0037250_213_1262 304
293 3300048921 Ga0496118_0053748 Ga0496118_0053748_394_1383 304
294 3300048922 Ga0496119_0084115 Ga0496119_0084115_268_1254 304
295 3300048922 Ga0496119_0093768 Ga0496119_0093768_266_1255 304
296 3300048923 Ga0496120_0027756 Ga0496120_0027756_469_1458 304
297 3300048924 Ga0496121_0011996 Ga0496121_0011996_5833_6822 304
298 3300048924 Ga0496121_0078769 Ga0496121_0078769_1056_2153 304
299 3300048924 Ga0496121_0083299 Ga0496121_0083299_1136_2125 304
300 3300048927 Ga0496124_0181722 Ga0496124_0181722_533_1519 304
301 3300048928 Ga0496125_0109206 Ga0496125_0109206_941_1927 304
302 3300048929 Ga0496126_0060475 Ga0496126_0060475_569_1558 304
303 3300049460 Ga0495682_0099429 Ga0495682_0099429_33_1031 304
304 3300050490 nmdc:mga03n38_448_c1 nmdc:mga03n38_448_c1_3840_4829 304
305 3300050492 nmdc:mga0yw44_104096_c1 nmdc:mga0yw44_104096_c1_548_1537 304
306 3300050494 nmdc:mga06z11_11791_c1 nmdc:mga06z11_11791_c1_1763_2752 304
307 3300050494 nmdc:mga06z11_16892_c1 nmdc:mga06z11_16892_c1_658_1647 304
308 3300050494 nmdc:mga06z11_26154_c1 nmdc:mga06z11_26154_c1_1608_2597 304
309 3300050496 nmdc:mga07m45_21914_c1 nmdc:mga07m45_21914_c1_1330_2319 304
310 3300050511 nmdc:mga08y16_298429_c1 nmdc:mga08y16_298429_c1_369_1358 304
311 3300050511 nmdc:mga08y16_378851_c1 nmdc:mga08y16_378851_c1_412_1401 304
312 3300050516 nmdc:mga0sz30_28196_c1 nmdc:mga0sz30_28196_c1_1181_2173 304
313 3300050516 nmdc:mga0sz30_33849_c1 nmdc:mga0sz30_33849_c1_1093_2079 304
314 3300053080 Ga0500635_0030865 Ga0500635_0030865_427_1416 304
315 3300053086 Ga0500578_0137605 Ga0500578_0137605_234_1223 304
316 3300053087 Ga0500643_000180 Ga0500643_000180_36760_37749 304
317 3300053087 Ga0500643_036936 Ga0500643_036936_114_1103 304
318 3300053089 Ga0500581_133791 Ga0500581_133791_71_1060 304
319 3300053092 Ga0500583_0076954 Ga0500583_0076954_187_1176 304
320 3300053092 Ga0500583_0144694 Ga0500583_0144694_83_1072 304
321 3300053094 Ga0500566_0003442 Ga0500566_0003442_2412_3398 304
322 3300053096 Ga0500641_0006262 Ga0500641_0006262_63_1052 304
323 3300053104 Ga0500556_0049725 Ga0500556_0049725_245_1234 304
324 3300053108 Ga0500562_003205 Ga0500562_003205_1041_2030 304
325 3300053119 Ga0500595_006544 Ga0500595_006544_916_1905 304
326 3300053128 Ga0500626_066857 Ga0500626_066857_403_1389 304
327 3300053130 Ga0500642_0119061 Ga0500642_0119061_22_1011 304
328 3300053153 Ga0500616_0014341 Ga0500616_0014341_561_1550 304
329 3300053156 Ga0500622_0026880 Ga0500622_0026880_136_1125 304
330 3300053177 Ga0500636_0005096 Ga0500636_0005096_5764_6750 304
331 3300053731 Ga0500609_001963 Ga0500609_001963_1847_2836 304
332 3300053737 Ga0500601_000170 Ga0500601_000170_11244_12233 304
333 3300003659 JGI25404J52841_10005502 JGI25404J52841_100055022 305
334 3300005614 Ga0068856_100000046 Ga0068856_10000004644 305
335 3300005983 Ga0081540_1011111 Ga0081540_10111115 305
336 3300006038 Ga0075365_10163801 Ga0075365_101638012 305
337 3300006177 Ga0075362_10062560 Ga0075362_100625602 305
338 3300006353 Ga0075370_10041656 Ga0075370_100416562 305
339 3300026078 Ga0207702_10000014 Ga0207702_10000014128 305
340 3300026121 Ga0207683_10240885 Ga0207683_102408852 305
341 3300031711 Ga0265314_10007706 Ga0265314_100077066 305
342 3300046473 Ga0495582_0112943 Ga0495582_0112943_127_1116 305
343 3300046475 Ga0495639_0074969 Ga0495639_0074969_348_1343 305
344 3300046524 Ga0495648_0001411 Ga0495648_0001411_10435_11433 305
345 3300048924 Ga0496121_0096056 Ga0496121_0096056_464_1453 305
346 3300048927 Ga0496124_0025489 Ga0496124_0025489_3744_4733 305
347 iso_pu_bacteria 8019648815 8019653500 305
348 3300006844 Ga0075428_100043684 Ga0075428_1000436845 306
349 3300006880 Ga0075429_100037833 Ga0075429_1000378333 306
350 3300009094 Ga0111539_10019170 Ga0111539_100191704 306
351 3300027907 Ga0207428_10023941 Ga0207428_100239414 306
352 3300050511 nmdc:mga08y16_4970_c1 nmdc:mga08y16_4970_c1_2443_3423 306
353 3300006048 Ga0075363_100134361 Ga0075363_1001343612 308
354 3300006195 Ga0075366_10153162 Ga0075366_101531622 308
355 3300006353 Ga0075370_10101607 Ga0075370_101016072 308
356 3300050491 nmdc:mga00v17_101476_c1 nmdc:mga00v17_101476_c1_579_1571 308
357 3300050494 nmdc:mga06z11_86105_c1 nmdc:mga06z11_86105_c1_108_1106 308
358 3300050495 nmdc:mga04h51_83459_c1 nmdc:mga04h51_83459_c1_82_1074 308
359 3300050496 nmdc:mga07m45_42134_c1 nmdc:mga07m45_42134_c1_252_1244 308
360 3300050496 nmdc:mga07m45_66106_c1 nmdc:mga07m45_66106_c1_797_1795 308
361 3300050511 nmdc:mga08y16_231412_c1 nmdc:mga08y16_231412_c1_197_1174 308
362 3300046492 Ga0495585_0150073 Ga0495585_0150073_241_1197 309
363 iso_pu_bacteria 8016522445 8016525022 309
364 3300053108 Ga0500562_030257 Ga0500562_030257_187_1179 310
365 3300005548 Ga0070665_100078112 Ga0070665_1000781123 311
366 3300028379 Ga0268266_10160826 Ga0268266_101608262 311
367 3300030521 Ga0307511_10053634 Ga0307511_100536342 311
368 3300005545 Ga0070695_100064525 Ga0070695_1000645253 313
369 3300005330 Ga0070690_100246931 Ga0070690_1002469311 314
370 3300005719 Ga0068861_100209307 Ga0068861_1002093072 314
371 3300005844 Ga0068862_100112253 Ga0068862_1001122532 314
372 3300006042 Ga0075368_10007168 Ga0075368_100071683 314
373 3300006178 Ga0075367_10005197 Ga0075367_100051973 314
374 3300006844 Ga0075428_100031338 Ga0075428_1000313383 314
375 3300006846 Ga0075430_100032196 Ga0075430_1000321963 314
376 3300025302 Ga0207426_1000819 Ga0207426_100081917 314
377 3300025972 Ga0207668_10127790 Ga0207668_101277903 314
378 3300026118 Ga0207675_100127247 Ga0207675_1001272472 314
379 3300027866 Ga0209813_10006183 Ga0209813_100061831 314
380 3300028380 Ga0268265_10047819 Ga0268265_100478193 314
381 3300031247 Ga0265340_10011845 Ga0265340_100118456 314
382 3300050490 nmdc:mga03n38_8403_c1 nmdc:mga03n38_8403_c1_534_1511 314
383 3300050494 nmdc:mga06z11_16094_c1 nmdc:mga06z11_16094_c1_2209_3186 314
384 3300050495 nmdc:mga04h51_64006_c1 nmdc:mga04h51_64006_c1_237_1214 314
385 3300050510 nmdc:mga06r32_153643_c1 nmdc:mga06r32_153643_c1_300_1304 314
386 3300053153 Ga0500616_0000048 Ga0500616_0000048_188637_189635 314
387 3300003354 JGI25160J50197_1000678 JGI25160J50197_100067810 315
388 3300025924 Ga0207694_10074304 Ga0207694_100743044 315
389 3300026035 Ga0207703_10231295 Ga0207703_102312952 315
390 3300031730 Ga0307516_10020012 Ga0307516_100200122 315
391 3300048927 Ga0496124_0045919 Ga0496124_0045919_2722_3711 315
392 3300048928 Ga0496125_0088394 Ga0496125_0088394_338_1363 315
393 iso_pu_bacteria 2507262055 2507512028 315
394 iso_pu_bacteria 2508501009 2508545687 315
395 iso_pu_bacteria 2508501042 2508694509 315
396 iso_pu_bacteria 2515154112 2515624559 315
397 iso_pu_bacteria 2874590934 2874595798 315
398 iso_pu_bacteria 2874645413 2874651570 315
399 iso_pu_bacteria 2876771140 2876775995 315
400 iso_pu_bacteria 2876818435 2876821203 315
401 iso_pu_bacteria 2879074833 2879080084 315
402 iso_pu_bacteria 2879127579 2879132686 315
403 iso_pu_bacteria 2879142872 2879146471 315
404 iso_pu_bacteria 2935608549 2935613326 315
405 iso_pu_bacteria 2935648319 2935653796 315
406 iso_pu_bacteria 2935656913 2935662545 315
407 iso_pu_bacteria 2935769743 2935776372 315
408 iso_pu_bacteria 2935777560 2935784367 315
409 iso_pu_bacteria 2935785616 2935792403 315
410 iso_pu_bacteria 2935793552 2935800566 315
411 iso_pu_bacteria 2935819856 2935824820 315
412 iso_pu_bacteria 2935847175 2935852040 315
413 iso_pu_bacteria 2935908558 2935911387 315
414 iso_pu_bacteria 2935916978 2935920920 315
415 iso_pu_bacteria 2935926038 2935928416 315
416 iso_pu_bacteria 2935934488 2935938061 315
417 iso_pu_bacteria 2935942939 2935945343 315
418 iso_pu_bacteria 2935951376 2935954151 315
419 iso_pu_bacteria 2935959822 2935965974 315
420 iso_pu_bacteria 2935967501 2935971581 315
421 iso_pu_bacteria 2935975950 2935979978 315
422 iso_pu_bacteria 2935984226 2935989406 315
423 iso_pu_bacteria 2936011229 2936016807 315
424 iso_pu_bacteria 2936019824 2936025440 315
425 iso_pu_bacteria 2936028420 2936034322 315
426 iso_pu_bacteria 2936046547 2936052379 315
427 iso_pu_bacteria 2936055302 2936060659 315
428 iso_pu_bacteria 8016539877 8016542886 315
429 iso_pu_bacteria 8016548790 8016550403 315
430 iso_pu_bacteria 8016557553 8016558817 315
431 iso_pu_bacteria 8016566248 8016568277 315
432 iso_pu_bacteria 8016575299 8016580943 315
433 iso_pu_bacteria 8016595262 8016596785 315
434 iso_pu_bacteria 8016613128 8016619467 315
435 iso_pu_bacteria 8016630954 8016637027 315
436 iso_pu_bacteria 8019530166 8019538268 315
437 iso_pu_bacteria 8019538911 8019541709 315
438 iso_pu_bacteria 8019619141 8019623982 315
439 iso_pu_bacteria 8019638758 8019641585 315
440 iso_pu_bacteria 8019659431 8019665973 315
441 iso_pu_bacteria 8019668869 8019675491 315
442 iso_pu_bacteria 8019678201 8019680608 315
443 iso_pu_bacteria 8019687851 8019695153 315
444 3300005458 Ga0070681_10096880 Ga0070681_100968802 316
445 3300005539 Ga0068853_100193905 Ga0068853_1001939053 316
446 3300005563 Ga0068855_100034345 Ga0068855_1000343452 316
447 3300006846 Ga0075430_100050201 Ga0075430_1000502013 316
448 3300006847 Ga0075431_100105259 Ga0075431_1001052593 316
449 3300006880 Ga0075429_100024575 Ga0075429_1000245753 316
450 3300009147 Ga0114129_10110710 Ga0114129_101107103 316
451 3300013104 Ga0157370_10042061 Ga0157370_100420617 316
452 3300025917 Ga0207660_10343450 Ga0207660_103434501 316
453 3300025921 Ga0207652_10177099 Ga0207652_101770992 316
454 3300025949 Ga0207667_10241755 Ga0207667_102417552 316
455 3300028379 Ga0268266_10132219 Ga0268266_101322191 316
456 3300048924 Ga0496121_0321808 Ga0496121_0321808_18_1007 316
457 3300050510 nmdc:mga06r32_349262_c1 nmdc:mga06r32_349262_c1_32_1012 316
458 3300053094 Ga0500566_0004614 Ga0500566_0004614_2897_3886 316
459 3300053119 Ga0500595_000615 Ga0500595_000615_19790_20779 316
460 3300053161 Ga0500634_0021323 Ga0500634_0021323_996_1994 316
461 3300053162 Ga0500638_015298 Ga0500638_015298_2093_3082 316
462 3300053177 Ga0500636_0054320 Ga0500636_0054320_864_1853 316
463 3300053178 Ga0500637_0000445 Ga0500637_0000445_585_1574 316
464 3300055283 Ga0500661_000331 Ga0500661_000331_6004_6993 316
465 iso_pu_bacteria 2513237092 2513624583 316
466 iso_pu_bacteria 2513237095 2513650058 316
467 iso_pu_bacteria 2513237104 2513720202 316
468 iso_pu_bacteria 2513237139 2513874339 316
469 iso_pu_bacteria 2513237161 2514016834 316
470 iso_pu_bacteria 2517093001 2517104508 316
471 iso_pu_bacteria 2617270735 2617353127 316
472 iso_pu_bacteria 2617270741 2617374546 316
473 iso_pu_bacteria 2744054633 2745078369 316
474 iso_pu_bacteria 2791355196 2793059477 316
475 iso_pu_bacteria 2802429603 2805916106 316
476 iso_pu_bacteria 2816332527 2818242954 316
477 iso_pu_bacteria 2824600985 2824604499 316
478 iso_pu_bacteria 2824609381 2824614960 316
479 iso_pu_bacteria 2824653114 2824657517 316
480 iso_pu_bacteria 2824671348 2824673991 316
481 iso_pu_bacteria 2824696289 2824701377 316
482 iso_pu_bacteria 2824732956 2824736052 316
483 iso_pu_bacteria 2824746037 2824750678 316
484 iso_pu_bacteria 2824753945 2824761576 316
485 iso_pu_bacteria 2824763712 2824772114 316
486 iso_pu_bacteria 2824773399 2824778328 316
487 iso_pu_bacteria 2838122688 2838128544 316
488 iso_pu_bacteria 2841941048 2841942401 316
489 iso_pu_bacteria 2841949485 2841953253 316
490 iso_pu_bacteria 2841957949 2841960782 316
491 iso_pu_bacteria 2841966195 2841973858 316
492 iso_pu_bacteria 2841974524 2841982923 316
493 iso_pu_bacteria 2841983080 2841984417 316
494 iso_pu_bacteria 2842038055 2842041855 316
495 iso_pu_bacteria 2842045827 2842049898 316
496 iso_pu_bacteria 2847930680 2847932156 316
497 iso_pu_bacteria 2857509624 2857514597 316
498 iso_pu_bacteria 2874612657 2874614929 316
499 iso_pu_bacteria 2876761206 2876767580 316
500 iso_pu_bacteria 2879083081 2879089437 316
501 iso_pu_bacteria 2885366525 2885374583 316
502 iso_pu_bacteria 2885409591 2885414042 316
503 iso_pu_bacteria 2888378607 2888387548 316
504 iso_pu_bacteria 2888388044 2888391650 316
505 iso_pu_bacteria 2888419890 2888426771 316
506 iso_pu_bacteria 2904711408 2904713841 316
507 iso_pu_bacteria 2906643746 2906645729 316
508 iso_pu_bacteria 2908775508 2908777026 316
509 iso_pu_bacteria 2922393267 2922393417 316
510 iso_pu_bacteria 2932794094 2932796739 316
511 iso_pu_bacteria 2932801729 2932802481 316
512 iso_pu_bacteria 2935883170 2935887077 316
513 iso_pu_bacteria 3005506211 3005506746 316
514 iso_pu_bacteria 3005587118 3005588869 316
515 iso_pu_bacteria 8006926726 8006932163 316
516 3300005456 Ga0070678_100048188 Ga0070678_1000481883 317
517 3300005545 Ga0070695_100108876 Ga0070695_1001088761 317
518 3300005546 Ga0070696_100017975 Ga0070696_1000179753 317
519 3300005549 Ga0070704_100018424 Ga0070704_1000184243 317
520 3300005985 Ga0081539_10036981 Ga0081539_100369812 317
521 3300009148 Ga0105243_10184435 Ga0105243_101844353 317
522 3300009553 Ga0105249_10115108 Ga0105249_101151082 317
523 3300025941 Ga0207711_10011210 Ga0207711_100112109 317
524 3300025961 Ga0207712_10029108 Ga0207712_100291082 317
525 3300026121 Ga0207683_10127390 Ga0207683_101273902 317
526 3300048912 Ga0496109_0014503 Ga0496109_0014503_4634_5620 317
527 3300048914 Ga0496111_0034817 Ga0496111_0034817_349_1335 317
528 3300048917 Ga0496114_0041961 Ga0496114_0041961_2391_3377 317
529 3300049569 Ga0501032_0050900 Ga0501032_0050900_1594_2571 317
530 3300049570 Ga0501033_0141713 Ga0501033_0141713_127_1104 317
531 3300049572 Ga0501036_0205855 Ga0501036_0205855_37_1014 317
532 3300049573 Ga0501037_0144704 Ga0501037_0144704_103_1080 317
533 3300049574 Ga0501038_0172198 Ga0501038_0172198_196_1173 317
534 3300049575 Ga0501039_0023343 Ga0501039_0023343_3267_4244 317
535 3300049576 Ga0501040_0010938 Ga0501040_0010938_3354_4331 317
536 3300049577 Ga0501041_0007647 Ga0501041_0007647_3373_4350 317
537 3300049578 Ga0501042_0090331 Ga0501042_0090331_1189_2166 317
538 3300049579 Ga0501043_0024532 Ga0501043_0024532_1388_2365 317
539 3300049579 Ga0501043_0033989 Ga0501043_0033989_2344_3321 317
540 3300049582 Ga0501048_0082653 Ga0501048_0082653_990_1967 317
541 3300049584 Ga0501068_0020221 Ga0501068_0020221_565_1542 317
542 3300049587 Ga0501071_0047599 Ga0501071_0047599_1510_2487 317
543 3300049588 Ga0501072_0056896 Ga0501072_0056896_1951_2928 317
544 3300049589 Ga0501073_0033574 Ga0501073_0033574_892_1869 317
545 3300049591 Ga0501075_0007243 Ga0501075_0007243_3604_4581 317
546 3300049592 Ga0501076_0007427 Ga0501076_0007427_4697_5674 317
547 3300049593 Ga0501077_0041950 Ga0501077_0041950_217_1194 317
548 3300049741 Ga0501079_0053796 Ga0501079_0053796_1697_2674 317
549 3300049742 Ga0501080_0018823 Ga0501080_0018823_3450_4427 317
550 3300049743 Ga0501081_0005665 Ga0501081_0005665_4701_5678 317
551 3300049744 Ga0501083_0151715 Ga0501083_0151715_355_1332 317
552 3300049822 Ga0501035_0097682 Ga0501035_0097682_1177_2154 317
553 3300049824 Ga0501045_0031338 Ga0501045_0031338_2069_3046 317
554 3300054114 Ga0501084_0053012 Ga0501084_0053012_945_1922 317
555 3300060353 Ga0501082_0021916 Ga0501082_0021916_1384_2361 317
556 iso_pu_bacteria 2511231028 2511401323 317
557 iso_pu_bacteria 2513237096 2513655554 317
558 iso_pu_bacteria 2513237098 2513677192 317
559 iso_pu_bacteria 2513237137 2513859763 317
560 iso_pu_bacteria 2513237145 2513916368 317
561 iso_pu_bacteria 2517572143 2517890017 317
562 iso_pu_bacteria 2524023210 2524466324 317
563 iso_pu_bacteria 2524023228 2524534904 317
564 iso_pu_bacteria 2528768022 2528850236 317
565 iso_pu_bacteria 2721755755 2723842654 317
566 iso_pu_bacteria 2791355199 2793080475 317
567 iso_pu_bacteria 2824661429 2824669386 317
568 iso_pu_bacteria 2874604998 2874606671 317
569 iso_pu_bacteria 2874628541 2874630398 317
570 iso_pu_bacteria 2876808645 2876808730 317
571 iso_pu_bacteria 2879099564 2879106442 317
572 iso_pu_bacteria 2879110137 2879111994 317
573 iso_pu_bacteria 2885383462 2885388865 317
574 iso_pu_bacteria 2889033259 2889034050 317
575 iso_pu_bacteria 2903768456 2903772522 317
576 iso_pu_bacteria 2904690495 2904697648 317
577 iso_pu_bacteria 2904699407 2904710980 317
578 iso_pu_bacteria 2906635258 2906638432 317
579 iso_pu_bacteria 2906660503 2906663283 317
580 iso_pu_bacteria 2908756301 2908757755 317
581 iso_pu_bacteria 2922361189 2922367451 317
582 iso_pu_bacteria 2922368715 2922376523 317
583 iso_pu_bacteria 2922386360 2922389853 317
584 iso_pu_bacteria 2929615660 2929619972 317
585 iso_pu_bacteria 2929624759 2929629284 317
586 iso_pu_bacteria 2932784394 2932789587 317
587 iso_pu_bacteria 2932809354 2932814906 317
588 iso_pu_bacteria 2932818245 2932824238 317
589 iso_pu_bacteria 2932828146 2932834035 317
590 iso_pu_bacteria 2933577622 2933581890 317
591 iso_pu_bacteria 2935616580 2935623575 317
592 iso_pu_bacteria 2935638405 2935644962 317
593 iso_pu_bacteria 2935665750 2935672011 317
594 iso_pu_bacteria 2935675223 2935683061 317
595 iso_pu_bacteria 2935684952 2935689231 317
596 iso_pu_bacteria 2935694250 2935697510 317
597 iso_pu_bacteria 2935703347 2935711086 317
598 iso_pu_bacteria 2935713505 2935720177 317
599 iso_pu_bacteria 2935722832 2935728206 317
600 iso_pu_bacteria 2935732158 2935737197 317
601 iso_pu_bacteria 2935741537 2935746742 317
602 iso_pu_bacteria 2935750917 2935757709 317
603 iso_pu_bacteria 2935760218 2935764087 317
604 iso_pu_bacteria 2935801545 2935808675 317
605 iso_pu_bacteria 2935810662 2935817472 317
606 iso_pu_bacteria 2935827899 2935834192 317
607 iso_pu_bacteria 2935837841 2935844794 317
608 iso_pu_bacteria 2935855204 2935861818 317
609 iso_pu_bacteria 2935864058 2935868546 317
610 iso_pu_bacteria 2935873716 2935879320 317
611 iso_pu_bacteria 2935992306 2935998513 317
612 iso_pu_bacteria 2936002035 2936009027 317
613 iso_pu_bacteria 2936037263 2936044269 317
614 iso_pu_bacteria 2940556831 2940563469 317
615 iso_pu_bacteria 2941538514 2941545311 317
616 iso_pu_bacteria 3005710791 3005717325 317
617 iso_pu_bacteria 8006933436 8006937570 317
618 iso_pu_bacteria 8006964411 8006965961 317
619 iso_pu_bacteria 8006973647 8006977600 317
620 iso_pu_bacteria 8006984368 8006989911 317
621 iso_pu_bacteria 8006994254 8006998267 317
622 iso_pu_bacteria 8016511872 8016519316 317
623 iso_pu_bacteria 8017057580 8017066199 317
624 iso_pu_bacteria 8019576017 8019578428 317
625 iso_pu_bacteria 8019586578 8019596468 317
626 iso_pu_bacteria 8019597564 8019605233 317
627 iso_pu_bacteria 8019608314 8019613315 317
628 iso_pu_bacteria 8055742211 8055750276 317
629 iso_pu_bacteria 8056673599 8056677890 317
630 iso_pu_bacteria 8056681323 8056686054 317
631 iso_pu_bacteria 8056689827 8056695357 317
632 3300003215 JGI25153J46596_10015409 JGI25153J46596_100154093 318
633 3300005330 Ga0070690_100023058 Ga0070690_1000230582 318
634 3300005335 Ga0070666_10345553 Ga0070666_103455531 318
635 3300005336 Ga0070680_100215949 Ga0070680_1002159491 318
636 3300005340 Ga0070689_100047251 Ga0070689_1000472514 318
637 3300005355 Ga0070671_100200995 Ga0070671_1002009952 318
638 3300005456 Ga0070678_100085113 Ga0070678_1000851133 318
639 3300005530 Ga0070679_100516046 Ga0070679_1005160461 318
640 3300005841 Ga0068863_100305745 Ga0068863_1003057452 318
641 3300005843 Ga0068860_100107190 Ga0068860_1001071902 318
642 3300005937 Ga0081455_10006371 Ga0081455_100063719 318
643 3300005981 Ga0081538_10056076 Ga0081538_100560762 318
644 3300006175 Ga0070712_100058029 Ga0070712_1000580293 318
645 3300006177 Ga0075362_10019134 Ga0075362_100191342 318
646 3300006195 Ga0075366_10047427 Ga0075366_100474274 318
647 3300006844 Ga0075428_100059241 Ga0075428_1000592413 318
648 3300009177 Ga0105248_10087017 Ga0105248_100870174 318
649 3300009545 Ga0105237_10041340 Ga0105237_100413403 318
650 3300013306 Ga0163162_10075484 Ga0163162_100754842 318
651 3300014325 Ga0163163_10056218 Ga0163163_100562184 318
652 3300014969 Ga0157376_10321201 Ga0157376_103212011 318
653 3300025297 Ga0209758_1000619 Ga0209758_100061936 318
654 3300025905 Ga0207685_10091678 Ga0207685_100916781 318
655 3300025911 Ga0207654_10057535 Ga0207654_100575352 318
656 3300025915 Ga0207693_10080795 Ga0207693_100807953 318
657 3300025916 Ga0207663_10137017 Ga0207663_101370172 318
658 3300025918 Ga0207662_10016112 Ga0207662_100161125 318
659 3300025923 Ga0207681_10065803 Ga0207681_100658032 318
660 3300025931 Ga0207644_10024492 Ga0207644_100244924 318
661 3300025941 Ga0207711_10005945 Ga0207711_100059452 318
662 3300025972 Ga0207668_10185070 Ga0207668_101850702 318
663 3300026035 Ga0207703_10081357 Ga0207703_100813573 318
664 3300026121 Ga0207683_10018049 Ga0207683_100180495 318
665 3300026142 Ga0207698_10293517 Ga0207698_102935172 318
666 3300028381 Ga0268264_10087570 Ga0268264_100875703 318
667 3300031238 Ga0265332_10071281 Ga0265332_100712811 318
668 3300034816 Ga0373930_0005629 Ga0373930_0005629_612_1604 318
669 3300035085 Ga0373929_0005434 Ga0373929_0005434_634_1623 318
670 3300035242 Ga0373962_0022693 Ga0373962_0022693_585_1574 318
671 3300035691 Ga0373931_0004821 Ga0373931_0004821_4513_5502 318
672 3300037068 Ga0373925_0332378 Ga0373925_0332378_102_1103 318
673 3300042436 Ga0439435_0029194 Ga0439435_0029194_286_1272 318
674 3300046500 Ga0495596_0074110 Ga0495596_0074110_243_1235 318
675 3300048903 Ga0496100_0083844 Ga0496100_0083844_452_1441 318
676 3300048904 Ga0496101_0068460 Ga0496101_0068460_1063_2052 318
677 3300048907 Ga0496104_0000812 Ga0496104_0000812_18918_19904 318
678 3300048907 Ga0496104_0001312 Ga0496104_0001312_20461_21450 318
679 3300048912 Ga0496109_0178337 Ga0496109_0178337_130_1116 318
680 3300048914 Ga0496111_0021899 Ga0496111_0021899_1393_2382 318
681 3300048915 Ga0496112_0119669 Ga0496112_0119669_1021_2010 318
682 3300048915 Ga0496112_0341230 Ga0496112_0341230_80_1066 318
683 3300048916 Ga0496113_0098949 Ga0496113_0098949_552_1574 318
684 3300048917 Ga0496114_0006660 Ga0496114_0006660_1781_2770 318
685 3300048918 Ga0496115_0102143 Ga0496115_0102143_1016_2005 318
686 3300049575 Ga0501039_0212880 Ga0501039_0212880_474_1463 318
687 3300053077 Ga0495601_0259974 Ga0495601_0259974_46_1032 318
688 3300053096 Ga0500641_0038405 Ga0500641_0038405_437_1429 318
689 3300053119 Ga0500595_031388 Ga0500595_031388_733_1713 318
690 3300054114 Ga0501084_0158770 Ga0501084_0158770_371_1423 318
691 3300005354 Ga0070675_100105651 Ga0070675_1001056511 319
692 3300005983 Ga0081540_1000055 Ga0081540_1000055120 319
693 3300014325 Ga0163163_10467790 Ga0163163_104677901 319
694 3300014968 Ga0157379_10058636 Ga0157379_100586365 319
695 3300025926 Ga0207659_10171187 Ga0207659_101711872 319
696 3300025972 Ga0207668_10138362 Ga0207668_101383622 319
697 3300035111 Ga0373923_0080726 Ga0373923_0080726_377_1372 319
698 3300046459 Ga0495629_0033029 Ga0495629_0033029_149_1144 319
699 3300050489 nmdc:mga03683_3223_c1 nmdc:mga03683_3223_c1_2177_3163 319
700 3300053080 Ga0500635_0044516 Ga0500635_0044516_291_1304 319
701 3300005439 Ga0070711_100005721 Ga0070711_1000057215 320
702 3300006038 Ga0075365_10026996 Ga0075365_100269961 320
703 3300006173 Ga0070716_100112173 Ga0070716_1001121732 320
704 3300006175 Ga0070712_100055917 Ga0070712_1000559173 320
705 3300006178 Ga0075367_10007145 Ga0075367_100071452 320
706 3300006195 Ga0075366_10005248 Ga0075366_100052481 320
707 3300009093 Ga0105240_10004093 Ga0105240_1000409314 320
708 3300009148 Ga0105243_10170264 Ga0105243_101702641 320
709 3300009545 Ga0105237_10008240 Ga0105237_100082404 320
710 3300010375 Ga0105239_10023758 Ga0105239_100237586 320
711 3300013297 Ga0157378_10015652 Ga0157378_100156525 320
712 3300025272 Ga0209455_1002543 Ga0209455_10025435 320
713 3300025913 Ga0207695_10000123 Ga0207695_10000123178 320
714 3300025914 Ga0207671_10002081 Ga0207671_1000208114 320
715 3300025915 Ga0207693_10005579 Ga0207693_100055793 320
716 3300025916 Ga0207663_10115318 Ga0207663_101153181 320
717 3300025933 Ga0207706_10034621 Ga0207706_100346212 320
718 3300025939 Ga0207665_10121712 Ga0207665_101217122 320
719 3300033180 Ga0307510_10264543 Ga0307510_102645431 320
720 3300035695 Ga0373927_0042604 Ga0373927_0042604_1019_2005 320
721 3300046454 Ga0495592_0041663 Ga0495592_0041663_1660_2646 320
722 3300046455 Ga0495603_0093236 Ga0495603_0093236_669_1691 320
723 3300046463 Ga0495653_0037943 Ga0495653_0037943_2498_3484 320
724 3300046473 Ga0495582_0106808 Ga0495582_0106808_345_1331 320
725 3300046507 Ga0495606_0010827 Ga0495606_0010827_4105_5091 320
726 3300046511 Ga0495608_0105511 Ga0495608_0105511_293_1279 320
727 3300046516 Ga0495628_0152094 Ga0495628_0152094_132_1118 320
728 3300046524 Ga0495648_0006902 Ga0495648_0006902_6352_7338 320
729 3300046529 Ga0495652_0114790 Ga0495652_0114790_119_1105 320
730 3300046529 Ga0495652_0151102 Ga0495652_0151102_304_1290 320
731 3300046533 Ga0495640_0039415 Ga0495640_0039415_2091_3077 320
732 3300046543 Ga0495645_0013988 Ga0495645_0013988_1551_2537 320
733 3300046543 Ga0495645_0218986 Ga0495645_0218986_84_1070 320
734 3300046559 Ga0495667_0076114 Ga0495667_0076114_332_1318 320
735 3300046642 Ga0495634_0018655 Ga0495634_0018655_3723_4709 320
736 3300046642 Ga0495634_0122835 Ga0495634_0122835_106_1092 320
737 3300046663 Ga0495635_0013665 Ga0495635_0013665_1203_2189 320
738 3300046674 Ga0495588_0130449 Ga0495588_0130449_34_1020 320
739 3300046675 Ga0495657_0021483 Ga0495657_0021483_1353_2339 320
740 3300046675 Ga0495657_0024161 Ga0495657_0024161_2891_3877 320
741 3300046678 Ga0495599_0005563 Ga0495599_0005563_4482_5468 320
742 3300046679 Ga0495623_0002992 Ga0495623_0002992_4255_5241 320
743 3300046680 Ga0495646_0145751 Ga0495646_0145751_224_1210 320
744 3300046683 Ga0495658_0139704 Ga0495658_0139704_287_1273 320
745 3300046689 Ga0495613_0106435 Ga0495613_0106435_470_1456 320
746 3300046694 Ga0495649_0051812 Ga0495649_0051812_147_1133 320
747 3300047317 Ga0495604_0014830 Ga0495604_0014830_4136_5122 320
748 3300047317 Ga0495604_0022506 Ga0495604_0022506_3890_4876 320
749 3300047319 Ga0495674_0023272 Ga0495674_0023272_4390_5376 320
750 3300047320 Ga0495672_0085850 Ga0495672_0085850_589_1575 320
751 3300047321 Ga0495676_0153006 Ga0495676_0153006_71_1057 320
752 3300047322 Ga0495680_0001426 Ga0495680_0001426_20672_21658 320
753 3300047323 Ga0495683_0046627 Ga0495683_0046627_147_1133 320
754 3300047471 Ga0495684_0123791 Ga0495684_0123791_435_1421 320
755 3300047673 Ga0495593_0040050 Ga0495593_0040050_603_1589 320
756 3300048088 Ga0495602_0007749 Ga0495602_0007749_3361_4347 320
757 3300048907 Ga0496104_0009449 Ga0496104_0009449_155_1141 320
758 3300048908 Ga0496105_0063015 Ga0496105_0063015_1389_2375 320
759 3300048911 Ga0496108_0362302 Ga0496108_0362302_121_1107 320
760 3300048917 Ga0496114_0208667 Ga0496114_0208667_621_1607 320
761 3300048922 Ga0496119_0072162 Ga0496119_0072162_142_1128 320
762 3300048923 Ga0496120_0011332 Ga0496120_0011332_1395_2381 320
763 3300048924 Ga0496121_0000753 Ga0496121_0000753_327_1313 320
764 3300050492 nmdc:mga0yw44_55403_c1 nmdc:mga0yw44_55403_c1_130_1152 320
765 3300050493 nmdc:mga0k408_39071_c1 nmdc:mga0k408_39071_c1_1467_2465 320
766 3300053083 Ga0495655_0030398 Ga0495655_0030398_225_1211 320
767 3300053086 Ga0500578_0115128 Ga0500578_0115128_40_1026 320
768 3300053118 Ga0500594_0015624 Ga0500594_0015624_513_1547 320
769 3300053119 Ga0500595_001062 Ga0500595_001062_12138_13124 320
770 3300053119 Ga0500595_011027 Ga0500595_011027_1986_2972 320
771 3300053130 Ga0500642_0011795 Ga0500642_0011795_1319_2353 320
772 3300053153 Ga0500616_0011113 Ga0500616_0011113_543_1544 320
773 iso_pu_bacteria 8056967851 8056976054 320
774 3300003203 JGI25406J46586_10000133 JGI25406J46586_1000013312 321
775 3300005329 Ga0070683_100010541 Ga0070683_10001054112 321
776 3300005329 Ga0070683_100034098 Ga0070683_1000340983 321
777 3300005336 Ga0070680_100008274 Ga0070680_1000082745 321
778 3300005336 Ga0070680_100050122 Ga0070680_1000501222 321
779 3300005355 Ga0070671_100122250 Ga0070671_1001222502 321
780 3300005364 Ga0070673_100156740 Ga0070673_1001567403 321
781 3300005366 Ga0070659_100059480 Ga0070659_1000594802 321
782 3300005434 Ga0070709_10006064 Ga0070709_100060645 321
783 3300005434 Ga0070709_10031136 Ga0070709_100311363 321
784 3300005434 Ga0070709_10052999 Ga0070709_100529992 321
785 3300005435 Ga0070714_100061439 Ga0070714_1000614393 321
786 3300005435 Ga0070714_100314018 Ga0070714_1003140182 321
787 3300005436 Ga0070713_100012380 Ga0070713_1000123807 321
788 3300005436 Ga0070713_100028548 Ga0070713_1000285483 321
789 3300005437 Ga0070710_10063955 Ga0070710_100639552 321
790 3300005439 Ga0070711_100006314 Ga0070711_1000063147 321
791 3300005455 Ga0070663_100009946 Ga0070663_1000099467 321
792 3300005456 Ga0070678_100193439 Ga0070678_1001934391 321
793 3300005458 Ga0070681_10036493 Ga0070681_100364936 321
794 3300005458 Ga0070681_10070615 Ga0070681_100706153 321
795 3300005467 Ga0070706_100058712 Ga0070706_1000587124 321
796 3300005468 Ga0070707_100050135 Ga0070707_1000501355 321
797 3300005468 Ga0070707_100067293 Ga0070707_1000672934 321
798 3300005471 Ga0070698_100061688 Ga0070698_1000616882 321
799 3300005530 Ga0070679_100044206 Ga0070679_1000442066 321
800 3300005535 Ga0070684_100001737 Ga0070684_1000017377 321
801 3300005535 Ga0070684_100010579 Ga0070684_10001057911 321
802 3300005536 Ga0070697_100134239 Ga0070697_1001342393 321
803 3300005539 Ga0068853_100001167 Ga0068853_1000011675 321
804 3300005563 Ga0068855_100024736 Ga0068855_1000247364 321
805 3300005564 Ga0070664_100008147 Ga0070664_1000081475 321
806 3300005577 Ga0068857_100008553 Ga0068857_1000085535 321
807 3300005834 Ga0068851_10006569 Ga0068851_100065694 321
808 3300005841 Ga0068863_100240146 Ga0068863_1002401462 321
809 3300005843 Ga0068860_100002690 Ga0068860_1000026909 321
810 3300005985 Ga0081539_10000099 Ga0081539_1000009979 321
811 3300006173 Ga0070716_100111545 Ga0070716_1001115452 321
812 3300006175 Ga0070712_100125260 Ga0070712_1001252601 321
813 3300006237 Ga0097621_100047456 Ga0097621_1000474564 321
814 3300006358 Ga0068871_100269890 Ga0068871_1002698902 321
815 3300007265 Ga0099794_10011788 Ga0099794_100117882 321
816 3300009093 Ga0105240_10558393 Ga0105240_105583932 321
817 3300009098 Ga0105245_10080814 Ga0105245_100808143 321
818 3300009545 Ga0105237_10043361 Ga0105237_100433613 321
819 3300009551 Ga0105238_10006431 Ga0105238_1000643110 321
820 3300010375 Ga0105239_10019170 Ga0105239_100191706 321
821 3300010375 Ga0105239_10026562 Ga0105239_100265626 321
822 3300013105 Ga0157369_10004737 Ga0157369_100047375 321
823 3300013296 Ga0157374_10007199 Ga0157374_100071998 321
824 3300013307 Ga0157372_10500092 Ga0157372_105000921 321
825 3300013308 Ga0157375_10022464 Ga0157375_100224641 321
826 3300014968 Ga0157379_10201681 Ga0157379_102016813 321
827 3300014969 Ga0157376_10004438 Ga0157376_100044388 321
828 3300025297 Ga0209758_1003819 Ga0209758_10038195 321
829 3300025898 Ga0207692_10012181 Ga0207692_100121812 321
830 3300025900 Ga0207710_10041890 Ga0207710_100418902 321
831 3300025906 Ga0207699_10027045 Ga0207699_100270453 321
832 3300025909 Ga0207705_10015948 Ga0207705_100159485 321
833 3300025910 Ga0207684_10028686 Ga0207684_100286864 321
834 3300025910 Ga0207684_10123484 Ga0207684_101234842 321
835 3300025912 Ga0207707_10001530 Ga0207707_100015307 321
836 3300025912 Ga0207707_10061226 Ga0207707_100612262 321
837 3300025913 Ga0207695_10075212 Ga0207695_100752122 321
838 3300025914 Ga0207671_10012099 Ga0207671_100120998 321
839 3300025915 Ga0207693_10004353 Ga0207693_1000435313 321
840 3300025917 Ga0207660_10001829 Ga0207660_1000182913 321
841 3300025921 Ga0207652_10006474 Ga0207652_100064749 321
842 3300025921 Ga0207652_10143841 Ga0207652_101438411 321
843 3300025922 Ga0207646_10031950 Ga0207646_100319504 321
844 3300025929 Ga0207664_10433793 Ga0207664_104337931 321
845 3300025932 Ga0207690_10045868 Ga0207690_100458682 321
846 3300025939 Ga0207665_10081997 Ga0207665_100819971 321
847 3300025944 Ga0207661_10017444 Ga0207661_100174442 321
848 3300025944 Ga0207661_10050215 Ga0207661_100502155 321
849 3300025945 Ga0207679_10051400 Ga0207679_100514003 321
850 3300025949 Ga0207667_10008657 Ga0207667_100086577 321
851 3300025949 Ga0207667_10098994 Ga0207667_100989944 321
852 3300026035 Ga0207703_10218167 Ga0207703_102181671 321
853 3300026041 Ga0207639_10005343 Ga0207639_100053439 321
854 3300026067 Ga0207678_10003472 Ga0207678_100034729 321
855 3300026088 Ga0207641_10240986 Ga0207641_102409862 321
856 3300026116 Ga0207674_10013973 Ga0207674_100139738 321
857 3300026121 Ga0207683_10154629 Ga0207683_101546292 321
858 3300026121 Ga0207683_10218403 Ga0207683_102184032 321
859 3300026142 Ga0207698_10045704 Ga0207698_100457043 321
860 3300027671 Ga0209588_1011313 Ga0209588_10113133 321
861 3300028381 Ga0268264_10000042 Ga0268264_10000042194 321
862 3300031241 Ga0265325_10010610 Ga0265325_100106102 321
863 3300031247 Ga0265340_10019263 Ga0265340_100192632 321
864 3300031344 Ga0265316_10087257 Ga0265316_100872572 321
865 3300031507 Ga0307509_10129452 Ga0307509_101294523 321
866 3300031507 Ga0307509_10345703 Ga0307509_103457031 321
867 3300031711 Ga0265314_10016415 Ga0265314_100164153 321
868 3300031711 Ga0265314_10079251 Ga0265314_100792513 321
869 3300031712 Ga0265342_10009595 Ga0265342_100095955 321
870 3300031712 Ga0265342_10023757 Ga0265342_100237573 321
871 3300031712 Ga0265342_10065180 Ga0265342_100651802 321
872 3300033180 Ga0307510_10024013 Ga0307510_100240134 321
873 3300033442 Ga0315911_1000012 Ga0315911_10000121 321
874 3300035083 Ga0373926_0005379 Ga0373926_0005379_1506_2501 321
875 3300035086 Ga0373934_0002178 Ga0373934_0002178_1684_2673 321
876 3300035089 Ga0373944_0008059 Ga0373944_0008059_90_1079 321
877 3300035111 Ga0373923_0001946 Ga0373923_0001946_1915_2904 321
878 3300035113 Ga0373936_0008199 Ga0373936_0008199_2175_3170 321
879 3300035113 Ga0373936_0038186 Ga0373936_0038186_854_1843 321
880 3300035117 Ga0373953_0039692 Ga0373953_0039692_659_1648 321
881 3300035118 Ga0373954_0002355 Ga0373954_0002355_6146_7135 321
882 3300035119 Ga0373956_0002239 Ga0373956_0002239_4444_5433 321
883 3300035119 Ga0373956_0049325 Ga0373956_0049325_696_1691 321
884 3300035119 Ga0373956_0053696 Ga0373956_0053696_520_1509 321
885 3300035120 Ga0373957_0000527 Ga0373957_0000527_5116_6105 321
886 3300035120 Ga0373957_0049538 Ga0373957_0049538_147_1136 321
887 3300035170 Ga0373943_0016178 Ga0373943_0016178_1747_2736 321
888 3300035171 Ga0373946_0016253 Ga0373946_0016253_626_1615 321
889 3300035172 Ga0373955_0000535 Ga0373955_0000535_11600_12589 321
890 3300035172 Ga0373955_0054645 Ga0373955_0054645_964_1953 321
891 3300035172 Ga0373955_0065771 Ga0373955_0065771_461_1450 321
892 3300035172 Ga0373955_0245171 Ga0373955_0245171_17_1012 321
893 3300035410 Ga0373924_0004005 Ga0373924_0004005_76_1065 321
894 3300035410 Ga0373924_0032496 Ga0373924_0032496_700_1689 321
895 3300035691 Ga0373931_0014148 Ga0373931_0014148_328_1317 321
896 3300035692 Ga0373935_0002921 Ga0373935_0002921_5898_6887 321
897 3300035724 Ga0373933_0002165 Ga0373933_0002165_9616_10605 321
898 3300035724 Ga0373933_0081588 Ga0373933_0081588_143_1132 321
899 3300035724 Ga0373933_0107022 Ga0373933_0107022_245_1234 321
900 3300035725 Ga0373947_0007981 Ga0373947_0007981_4157_5146 321
901 3300035725 Ga0373947_0013638 Ga0373947_0013638_61_1056 321
902 3300036401 Ga0373937_0022868 Ga0373937_0022868_1281_2276 321
903 3300036401 Ga0373937_0050675 Ga0373937_0050675_1661_2650 321
904 3300036401 Ga0373937_0101164 Ga0373937_0101164_1479_2468 321
905 3300036401 Ga0373937_0315490 Ga0373937_0315490_426_1415 321
906 3300036401 Ga0373937_0369106 Ga0373937_0369106_153_1142 321
907 3300036401 Ga0373937_0395220 Ga0373937_0395220_306_1295 321
908 3300037068 Ga0373925_0002335 Ga0373925_0002335_10120_11109 321
909 3300037418 Ga0395900_0335819 Ga0395900_0335819_367_1356 321
910 3300037466 Ga0395898_0183734 Ga0395898_0183734_205_1200 321
911 3300037471 Ga0395905_0136451 Ga0395905_0136451_1296_2294 321
912 3300045976 Ga0466967_0178875 Ga0466967_0178875_407_1396 321
913 3300046454 Ga0495592_0021832 Ga0495592_0021832_3756_4745 321
914 3300046455 Ga0495603_0000923 Ga0495603_0000923_4670_5659 321
915 3300046455 Ga0495603_0008603 Ga0495603_0008603_2113_3102 321
916 3300046455 Ga0495603_0028744 Ga0495603_0028744_1536_2525 321
917 3300046459 Ga0495629_0001841 Ga0495629_0001841_8582_9571 321
918 3300046459 Ga0495629_0002400 Ga0495629_0002400_5079_6068 321
919 3300046461 Ga0495641_0011027 Ga0495641_0011027_3370_4359 321
920 3300046462 Ga0495651_0087761 Ga0495651_0087761_25_1014 321
921 3300046463 Ga0495653_0004149 Ga0495653_0004149_8778_9767 321
922 3300046463 Ga0495653_0085483 Ga0495653_0085483_686_1675 321
923 3300046472 Ga0495580_0009257 Ga0495580_0009257_6673_7668 321
924 3300046472 Ga0495580_0010859 Ga0495580_0010859_641_1630 321
925 3300046472 Ga0495580_0030671 Ga0495580_0030671_1184_2173 321
926 3300046473 Ga0495582_0000283 Ga0495582_0000283_5805_6794 321
927 3300046475 Ga0495639_0004800 Ga0495639_0004800_3277_4266 321
928 3300046476 Ga0495662_0001975 Ga0495662_0001975_8217_9206 321
929 3300046476 Ga0495662_0027547 Ga0495662_0027547_550_1545 321
930 3300046477 Ga0495664_0007158 Ga0495664_0007158_2230_3225 321
931 3300046477 Ga0495664_0013420 Ga0495664_0013420_1795_2784 321
932 3300046477 Ga0495664_0141800 Ga0495664_0141800_366_1355 321
933 3300046477 Ga0495664_0239213 Ga0495664_0239213_60_1049 321
934 3300046499 Ga0495594_0000509 Ga0495594_0000509_10377_11366 321
935 3300046507 Ga0495606_0000357 Ga0495606_0000357_39742_40731 321
936 3300046507 Ga0495606_0156888 Ga0495606_0156888_293_1282 321
937 3300046511 Ga0495608_0020082 Ga0495608_0020082_3073_4062 321
938 3300046514 Ga0495618_0032005 Ga0495618_0032005_1270_2259 321
939 3300046514 Ga0495618_0048943 Ga0495618_0048943_354_1343 321
940 3300046514 Ga0495618_0095039 Ga0495618_0095039_552_1541 321
941 3300046516 Ga0495628_0063319 Ga0495628_0063319_423_1412 321
942 3300046516 Ga0495628_0108220 Ga0495628_0108220_997_1986 321
943 3300046517 Ga0495630_0008393 Ga0495630_0008393_2319_3317 321
944 3300046517 Ga0495630_0018211 Ga0495630_0018211_2006_3001 321
945 3300046517 Ga0495630_0162430 Ga0495630_0162430_501_1490 321
946 3300046529 Ga0495652_0016077 Ga0495652_0016077_5488_6477 321
947 3300046529 Ga0495652_0040475 Ga0495652_0040475_1819_2808 321
948 3300046529 Ga0495652_0106314 Ga0495652_0106314_18_1007 321
949 3300046531 Ga0495665_0000145 Ga0495665_0000145_18384_19373 321
950 3300046533 Ga0495640_0007751 Ga0495640_0007751_5478_6467 321
951 3300046533 Ga0495640_0016865 Ga0495640_0016865_3822_4817 321
952 3300046536 Ga0495587_0018462 Ga0495587_0018462_397_1386 321
953 3300046543 Ga0495645_0104249 Ga0495645_0104249_97_1086 321
954 3300046557 Ga0495622_0006137 Ga0495622_0006137_2078_3067 321
955 3300046559 Ga0495667_0033824 Ga0495667_0033824_2337_3326 321
956 3300046559 Ga0495667_0066606 Ga0495667_0066606_1024_2019 321
957 3300046559 Ga0495667_0066888 Ga0495667_0066888_160_1149 321
958 3300046642 Ga0495634_0001108 Ga0495634_0001108_4669_5658 321
959 3300046642 Ga0495634_0009918 Ga0495634_0009918_5910_6899 321
960 3300046642 Ga0495634_0082129 Ga0495634_0082129_685_1674 321
961 3300046660 Ga0495625_0112735 Ga0495625_0112735_614_1612 321
962 3300046663 Ga0495635_0002477 Ga0495635_0002477_5460_6449 321
963 3300046663 Ga0495635_0009937 Ga0495635_0009937_4034_5023 321
964 3300046663 Ga0495635_0068873 Ga0495635_0068873_543_1532 321
965 3300046674 Ga0495588_0013234 Ga0495588_0013234_1494_2483 321
966 3300046674 Ga0495588_0028524 Ga0495588_0028524_1390_2379 321
967 3300046675 Ga0495657_0204093 Ga0495657_0204093_190_1179 321
968 3300046678 Ga0495599_0025078 Ga0495599_0025078_647_1636 321
969 3300046679 Ga0495623_0010731 Ga0495623_0010731_4725_5714 321
970 3300046679 Ga0495623_0090320 Ga0495623_0090320_259_1248 321
971 3300046680 Ga0495646_0021267 Ga0495646_0021267_2603_3592 321
972 3300046680 Ga0495646_0036786 Ga0495646_0036786_552_1541 321
973 3300046680 Ga0495646_0049099 Ga0495646_0049099_504_1493 321
974 3300046681 Ga0495647_0007604 Ga0495647_0007604_1450_2439 321
975 3300046683 Ga0495658_0000547 Ga0495658_0000547_1178_2167 321
976 3300046689 Ga0495613_0002250 Ga0495613_0002250_5372_6361 321
977 3300046689 Ga0495613_0068935 Ga0495613_0068935_1007_1996 321
978 3300046690 Ga0495624_0005060 Ga0495624_0005060_5580_6569 321
979 3300046809 Ga0495600_0027802 Ga0495600_0027802_331_1320 321
980 3300047315 Ga0495581_0000529 Ga0495581_0000529_7249_8238 321
981 3300047315 Ga0495581_0049088 Ga0495581_0049088_1133_2122 321
982 3300047317 Ga0495604_0040425 Ga0495604_0040425_2338_3327 321
983 3300047317 Ga0495604_0049547 Ga0495604_0049547_1048_2037 321
984 3300047319 Ga0495674_0012072 Ga0495674_0012072_3672_4661 321
985 3300047319 Ga0495674_0032883 Ga0495674_0032883_328_1323 321
986 3300047319 Ga0495674_0036651 Ga0495674_0036651_3318_4307 321
987 3300047319 Ga0495674_0141178 Ga0495674_0141178_85_1074 321
988 3300047322 Ga0495680_0012571 Ga0495680_0012571_3298_4287 321
989 3300047444 Ga0495675_0136036 Ga0495675_0136036_397_1386 321
990 3300047471 Ga0495684_0001145 Ga0495684_0001145_12840_13829 321
991 3300047471 Ga0495684_0078066 Ga0495684_0078066_99_1088 321
992 3300047673 Ga0495593_0000526 Ga0495593_0000526_12423_13412 321
993 3300047673 Ga0495593_0000877 Ga0495593_0000877_5678_6667 321
994 3300048088 Ga0495602_0009427 Ga0495602_0009427_5295_6284 321
995 3300048088 Ga0495602_0028167 Ga0495602_0028167_1159_2148 321
996 3300048088 Ga0495602_0170130 Ga0495602_0170130_586_1575 321
997 3300048903 Ga0496100_0036611 Ga0496100_0036611_120_1109 321
998 3300048904 Ga0496101_0008287 Ga0496101_0008287_4221_5210 321
999 3300048905 Ga0496102_0072086 Ga0496102_0072086_540_1529 321
1000 3300048906 Ga0496103_0047232 Ga0496103_0047232_250_1239 321
1001 3300048907 Ga0496104_0025169 Ga0496104_0025169_4361_5413 321
1002 3300048907 Ga0496104_0117418 Ga0496104_0117418_295_1284 321
1003 3300048908 Ga0496105_0013952 Ga0496105_0013952_62_1051 321
1004 3300048908 Ga0496105_0078734 Ga0496105_0078734_1346_2335 321
1005 3300048909 Ga0496106_0081988 Ga0496106_0081988_481_1470 321
1006 3300048910 Ga0496107_0004840 Ga0496107_0004840_5678_6667 321
1007 3300048911 Ga0496108_0114638 Ga0496108_0114638_1238_2227 321
1008 3300048912 Ga0496109_0059361 Ga0496109_0059361_1282_2334 321
1009 3300048912 Ga0496109_0150548 Ga0496109_0150548_66_1055 321
1010 3300048913 Ga0496110_0134451 Ga0496110_0134451_172_1161 321
1011 3300048913 Ga0496110_0173181 Ga0496110_0173181_64_1053 321
1012 3300048913 Ga0496110_0211501 Ga0496110_0211501_57_1046 321
1013 3300048915 Ga0496112_0000052 Ga0496112_0000052_61822_62811 321
1014 3300048915 Ga0496112_0022947 Ga0496112_0022947_4939_5928 321
1015 3300048915 Ga0496112_0079304 Ga0496112_0079304_1137_2126 321
1016 3300048915 Ga0496112_0095845 Ga0496112_0095845_1043_2032 321
1017 3300048915 Ga0496112_0174421 Ga0496112_0174421_953_1942 321
1018 3300048916 Ga0496113_0019366 Ga0496113_0019366_3720_4709 321
1019 3300048916 Ga0496113_0136402 Ga0496113_0136402_523_1512 321
1020 3300048917 Ga0496114_0075094 Ga0496114_0075094_751_1740 321
1021 3300048917 Ga0496114_0098275 Ga0496114_0098275_1074_2063 321
1022 3300048917 Ga0496114_0142504 Ga0496114_0142504_742_1731 321
1023 3300048918 Ga0496115_0000981 Ga0496115_0000981_4404_5393 321
1024 3300048918 Ga0496115_0049802 Ga0496115_0049802_1504_2493 321
1025 3300048918 Ga0496115_0071871 Ga0496115_0071871_188_1177 321
1026 3300048918 Ga0496115_0120672 Ga0496115_0120672_157_1149 321
1027 3300048918 Ga0496115_0268417 Ga0496115_0268417_339_1328 321
1028 3300048923 Ga0496120_0050193 Ga0496120_0050193_1314_2303 321
1029 3300048924 Ga0496121_0001173 Ga0496121_0001173_26376_27374 321
1030 3300048924 Ga0496121_0097922 Ga0496121_0097922_671_1660 321
1031 3300048926 Ga0496123_0022865 Ga0496123_0022865_3356_4354 321
1032 3300048929 Ga0496126_0004189 Ga0496126_0004189_2773_3771 321
1033 3300048929 Ga0496126_0004375 Ga0496126_0004375_7880_8869 321
1034 3300048929 Ga0496126_0010575 Ga0496126_0010575_894_1886 321
1035 3300048929 Ga0496126_0216461 Ga0496126_0216461_117_1115 321
1036 3300050509 nmdc:mga0qj67_83578_c1 nmdc:mga0qj67_83578_c1_1173_2174 321
1037 3300050510 nmdc:mga06r32_166682_c1 nmdc:mga06r32_166682_c1_785_1786 321
1038 3300053077 Ga0495601_0026489 Ga0495601_0026489_2353_3342 321
1039 3300053078 Ga0495612_0025418 Ga0495612_0025418_492_1481 321
1040 3300053084 Ga0495595_0001351 Ga0495595_0001351_3525_4514 321
1041 3300053085 Ga0495619_0001695 Ga0495619_0001695_8714_9703 321
1042 3300053085 Ga0495619_0106527 Ga0495619_0106527_288_1277 321
1043 3300053094 Ga0500566_0005672 Ga0500566_0005672_1331_2320 321
1044 3300053095 Ga0500640_005231 Ga0500640_005231_2473_3462 321
1045 3300053102 Ga0500554_027341 Ga0500554_027341_182_1171 321
1046 3300053111 Ga0500572_004446 Ga0500572_004446_838_1827 321
1047 3300053136 Ga0500559_0005719 Ga0500559_0005719_1362_2351 321
1048 3300053139 Ga0500568_0006530 Ga0500568_0006530_2792_3790 321
1049 3300053150 Ga0500603_001321 Ga0500603_001321_1328_2317 321
1050 3300053159 Ga0500630_033291 Ga0500630_033291_128_1117 321
1051 3300053163 Ga0500639_000125 Ga0500639_000125_1421_2410 321
1052 3300053163 Ga0500639_049653 Ga0500639_049653_719_1708 321
1053 3300053178 Ga0500637_0015830 Ga0500637_0015830_2959_3948 321
1054 3300053735 Ga0500596_002626 Ga0500596_002626_1328_2317 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

81

358

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9567 25 315
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.948 22 316
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.93 22 315
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9237 22 316
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9133 22 314
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9639 124 243 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9433 124 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9369 126 246 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9329 124 243 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9325 124 247 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Y1S0I1-F1-model_v4 ABC transporter substrate-binding protein 0.967 22 317
AF-A0A1F4DQL8-F1-model_v4 LacI family transcriptional regulator 0.9619 21 315
AF-I3UDY1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9596 19 316
AF-A0A1B2QZA4-F1-model_v4 ABC transporter substrate-binding protein 0.9568 22 316
AF-V7I8H6-F1-model_v4 ABC transporter substrate-binding protein 0.9566 22 309

Feature Viewer

pLDDT pTM Quality
92.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map