F489122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 592 | 871 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100058712|Ga0070706_1000587124 |
| Length | 360 |
| Sequence | VLFRAVRAAKHAMNVYDETFATKNKIWGKLPMNRRELLKAAAALPLAPTVFADTAFAQAGYPNRNITMIVPFPAGGQADLAARPVALALERILSKPVIVDNRAGGAGGSIGNAQAARAEPDGYTLLMTLSSLAVLPEADRLFDRPVAYEVSQFAPIARVLADPTLLAVPASAPWKTLQDFVDDAKKRPGQIPYGSSGPYGTLHVAMEMFTASAGIKLLHVPFRGAGPALTALLSGTVQALASAPGTLKQQVDDGKMRVLANWGAQRIASFPDLPTFRELGYKDIEFYIWAGLFAQSALPTPIMTRLREAMAQAVKSPEVTKTFETAGSPVAYLDAPEFSKFVAEDSARLIAAVKKIGKVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2791355199 | |||
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 34 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 35 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 36 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 37 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 38 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 39 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 40 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 41 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 42 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 43 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 44 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 45 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 46 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 47 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 48 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 49 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 50 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 51 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 52 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 53 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 54 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 55 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 56 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 57 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 58 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 59 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 60 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 61 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 62 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 63 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 64 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 65 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 66 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 67 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 68 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 69 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 70 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 71 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 72 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 73 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 74 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 75 | 2904699407 | |||
| 76 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 77 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 78 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 79 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 80 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 81 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 82 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 83 | 2922368715 | |||
| 84 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 85 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 86 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 87 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 88 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 89 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 90 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 91 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 92 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 93 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 94 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 95 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 96 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 97 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 98 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 99 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 100 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 101 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 102 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 103 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 104 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 105 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 106 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 107 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 108 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 109 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 110 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 111 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 112 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 113 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 114 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 115 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 116 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 117 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 118 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 119 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 120 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 121 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 122 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 123 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 124 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 125 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 126 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 127 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 128 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 129 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 130 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 131 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 132 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 133 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 134 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 135 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 136 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 137 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 138 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 139 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 140 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 141 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 142 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 143 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 144 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 145 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 146 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 147 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 148 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 149 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 150 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 151 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 152 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 153 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 154 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 157 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 159 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 161 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 162 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 163 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 179 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 180 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 186 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 188 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 193 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 195 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 196 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 197 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 198 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 199 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 200 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 201 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 202 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 203 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 204 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 205 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 206 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 207 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 208 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 209 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 210 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 211 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 212 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 213 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 216 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 217 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 218 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 219 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 221 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 222 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 223 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 224 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 225 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 226 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 227 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 229 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 254 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 255 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 256 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 257 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 320 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 323 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 329 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 333 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 334 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 335 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 336 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 337 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 338 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 339 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 340 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 341 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 342 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 343 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 344 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 345 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 346 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 347 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 348 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 349 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 350 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 351 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 352 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 353 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 354 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 355 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 356 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 357 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 358 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 359 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 360 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 361 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 362 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 363 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 364 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 365 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 366 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 367 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 368 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 369 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 371 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 372 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 373 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 374 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 375 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 376 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 377 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 378 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 379 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 380 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 381 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 382 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 383 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 384 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 385 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 386 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 457 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 458 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 459 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 460 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 461 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 462 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 465 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 466 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 467 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 468 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 469 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 470 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 471 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 472 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 473 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 474 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 504 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 505 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 506 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 507 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 508 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 509 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 510 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 511 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 518 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 522 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 523 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 525 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 527 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 528 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 529 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 531 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 532 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 533 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 534 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 535 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 536 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 537 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 539 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 540 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 541 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 542 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 543 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 544 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 545 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 546 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 547 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 548 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 549 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 550 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 551 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 552 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 553 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 554 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 556 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 557 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 558 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 559 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 560 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 561 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 562 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 563 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 564 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 565 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 566 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 567 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 568 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 569 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 570 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 571 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 572 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 573 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 574 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 575 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 576 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 577 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 578 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 579 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 580 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 581 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 582 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 583 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 584 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 585 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 586 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 587 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 588 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 589 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 590 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 591 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 592 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.87 |
| Metatranscriptomes | 0 |
| Isolates | 17.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.76 |
| Nodule | 14.61 |
| Rhizoplane | 7.12 |
| Rhizosphere | 56.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000133 | 3300003203 | Bacteria | 32510 |
| 2 | JGI25153J46596_10000371 | 3300003215 | Bacteria | 30777 |
| 3 | JGI25153J46596_10000865 | 3300003215 | Bacteria | 18448 |
| 4 | JGI25153J46596_10006554 | 3300003215 | Bacteria | 5869 |
| 5 | JGI25153J46596_10015409 | 3300003215 | Bacteria | 3115 |
| 6 | JGI25153J46596_10026895 | 3300003215 | Bacteria | 2026 |
| 7 | JGI25160J50197_1000678 | 3300003354 | Bacteria | 18870 |
| 8 | JGI25160J50197_1016398 | 3300003354 | Bacteria | 2388 |
| 9 | JGI25160J50197_1019515 | 3300003354 | Bacteria | 2076 |
| 10 | JGI25404J52841_10005502 | 3300003659 | Bacteria | 2617 |
| 11 | Ga0055531_10005980 | 3300003794 | Bacteria | 6988 |
| 12 | Ga0065165_1001685 | 3300005262 | Bacteria | 22303 |
| 13 | Ga0065165_1004072 | 3300005262 | Bacteria | 9480 |
| 14 | Ga0065165_1008657 | 3300005262 | Bacteria | 4714 |
| 15 | Ga0070658_10007681 | 3300005327 | Bacteria | 8691 |
| 16 | Ga0070683_100010541 | 3300005329 | Bacteria | 7946 |
| 17 | Ga0070683_100034098 | 3300005329 | Bacteria | 4648 |
| 18 | Ga0070690_100023058 | 3300005330 | Bacteria | 3814 |
| 19 | Ga0070690_100246931 | 3300005330 | Bacteria | 1261 |
| 20 | Ga0070670_100143455 | 3300005331 | Bacteria | 2065 |
| 21 | Ga0068869_100055491 | 3300005334 | Bacteria | 2887 |
| 22 | Ga0068869_100104948 | 3300005334 | Bacteria | 2142 |
| 23 | Ga0070666_10345553 | 3300005335 | Bacteria | 1064 |
| 24 | Ga0070680_100008274 | 3300005336 | Bacteria | 7957 |
| 25 | Ga0070680_100050122 | 3300005336 | Bacteria | 3405 |
| 26 | Ga0070680_100215949 | 3300005336 | Bacteria | 1618 |
| 27 | Ga0068868_100059787 | 3300005338 | Bacteria | 3015 |
| 28 | Ga0070689_100047251 | 3300005340 | Bacteria | 3319 |
| 29 | Ga0070661_100100294 | 3300005344 | Bacteria | 2153 |
| 30 | Ga0070668_100027647 | 3300005347 | Bacteria | 4306 |
| 31 | Ga0070668_100040165 | 3300005347 | Bacteria | 3580 |
| 32 | Ga0070668_100065858 | 3300005347 | Bacteria | 2810 |
| 33 | Ga0070668_100079103 | 3300005347 | Bacteria | 2573 |
| 34 | Ga0070668_100164455 | 3300005347 | Bacteria | 1802 |
| 35 | Ga0070675_100105651 | 3300005354 | Bacteria | 2376 |
| 36 | Ga0070671_100062490 | 3300005355 | Bacteria | 3101 |
| 37 | Ga0070671_100103241 | 3300005355 | Bacteria | 2392 |
| 38 | Ga0070671_100122250 | 3300005355 | Bacteria | 2191 |
| 39 | Ga0070671_100200995 | 3300005355 | Bacteria | 1690 |
| 40 | Ga0070673_100156740 | 3300005364 | Bacteria | 1933 |
| 41 | Ga0070659_100059480 | 3300005366 | Bacteria | 3017 |
| 42 | Ga0070667_100147878 | 3300005367 | Bacteria | 2062 |
| 43 | Ga0070709_10006064 | 3300005434 | Bacteria | 6579 |
| 44 | Ga0070709_10031136 | 3300005434 | Bacteria | 3207 |
| 45 | Ga0070709_10052999 | 3300005434 | Bacteria | 2552 |
| 46 | Ga0070714_100061439 | 3300005435 | Bacteria | 3227 |
| 47 | Ga0070714_100314018 | 3300005435 | Bacteria | 1464 |
| 48 | Ga0070713_100012380 | 3300005436 | Bacteria | 6253 |
| 49 | Ga0070713_100028548 | 3300005436 | Bacteria | 4406 |
| 50 | Ga0070710_10063955 | 3300005437 | Bacteria | 2103 |
| 51 | Ga0070711_100005721 | 3300005439 | Bacteria | 7455 |
| 52 | Ga0070711_100006314 | 3300005439 | Bacteria | 7135 |
| 53 | Ga0070663_100009946 | 3300005455 | Bacteria | 5912 |
| 54 | Ga0070663_100073675 | 3300005455 | Bacteria | 2491 |
| 55 | Ga0070678_100048188 | 3300005456 | Bacteria | 3067 |
| 56 | Ga0070678_100085113 | 3300005456 | Bacteria | 2408 |
| 57 | Ga0070678_100193439 | 3300005456 | Bacteria | 1674 |
| 58 | Ga0070662_100133704 | 3300005457 | Bacteria | 1916 |
| 59 | Ga0070681_10036493 | 3300005458 | Bacteria | 4936 |
| 60 | Ga0070681_10070615 | 3300005458 | Bacteria | 3457 |
| 61 | Ga0070681_10096880 | 3300005458 | Bacteria | 2898 |
| 62 | Ga0068867_100324475 | 3300005459 | Bacteria | 1277 |
| 63 | Ga0070685_10178696 | 3300005466 | Bacteria | 1365 |
| 64 | Ga0070706_100058712 | 3300005467 | Bacteria | 3551 |
| 65 | Ga0070707_100050135 | 3300005468 | Bacteria | 4002 |
| 66 | Ga0070707_100067293 | 3300005468 | Bacteria | 3446 |
| 67 | Ga0070698_100061688 | 3300005471 | Bacteria | 3784 |
| 68 | Ga0070679_100044206 | 3300005530 | Bacteria | 4438 |
| 69 | Ga0070679_100516046 | 3300005530 | Bacteria | 1139 |
| 70 | Ga0070684_100001737 | 3300005535 | Bacteria | 15848 |
| 71 | Ga0070684_100010579 | 3300005535 | Bacteria | 7315 |
| 72 | Ga0070697_100134239 | 3300005536 | Bacteria | 2078 |
| 73 | Ga0068853_100001167 | 3300005539 | Bacteria | 18689 |
| 74 | Ga0068853_100073476 | 3300005539 | Bacteria | 2982 |
| 75 | Ga0068853_100193905 | 3300005539 | Bacteria | 1847 |
| 76 | Ga0070695_100064525 | 3300005545 | Bacteria | 2383 |
| 77 | Ga0070695_100108876 | 3300005545 | Bacteria | 1877 |
| 78 | Ga0070696_100017975 | 3300005546 | Bacteria | 4775 |
| 79 | Ga0070665_100023285 | 3300005548 | Bacteria | 6237 |
| 80 | Ga0070665_100068737 | 3300005548 | Bacteria | 3551 |
| 81 | Ga0070665_100078112 | 3300005548 | Bacteria | 3316 |
| 82 | Ga0070665_100227374 | 3300005548 | Bacteria | 1866 |
| 83 | Ga0070665_100370296 | 3300005548 | Bacteria | 1439 |
| 84 | Ga0070665_100371796 | 3300005548 | Bacteria | 1436 |
| 85 | Ga0070704_100018424 | 3300005549 | Bacteria | 4466 |
| 86 | Ga0068855_100024736 | 3300005563 | Bacteria | 7184 |
| 87 | Ga0068855_100033225 | 3300005563 | Bacteria | 6159 |
| 88 | Ga0068855_100034345 | 3300005563 | Bacteria | 6049 |
| 89 | Ga0068855_100222708 | 3300005563 | Bacteria | 2115 |
| 90 | Ga0070664_100008147 | 3300005564 | Bacteria | 8474 |
| 91 | Ga0070664_100178810 | 3300005564 | Bacteria | 1885 |
| 92 | Ga0070664_100223115 | 3300005564 | Bacteria | 1687 |
| 93 | Ga0068857_100008553 | 3300005577 | Bacteria | 8850 |
| 94 | Ga0068856_100000046 | 3300005614 | Bacteria | 109174 |
| 95 | Ga0068856_100105914 | 3300005614 | Bacteria | 2806 |
| 96 | Ga0068852_100272757 | 3300005616 | Bacteria | 1628 |
| 97 | Ga0068852_100560589 | 3300005616 | Bacteria | 1144 |
| 98 | Ga0068859_100049211 | 3300005617 | Bacteria | 4233 |
| 99 | Ga0068859_100139093 | 3300005617 | Bacteria | 2502 |
| 100 | Ga0068864_100032861 | 3300005618 | Bacteria | 4409 |
| 101 | Ga0068864_100072113 | 3300005618 | Bacteria | 3009 |
| 102 | Ga0068861_100209307 | 3300005719 | Bacteria | 1642 |
| 103 | Ga0068851_10006569 | 3300005834 | Bacteria | 5317 |
| 104 | Ga0068863_100240146 | 3300005841 | Bacteria | 1749 |
| 105 | Ga0068863_100305745 | 3300005841 | Bacteria | 1543 |
| 106 | Ga0068858_100021643 | 3300005842 | Bacteria | 6010 |
| 107 | Ga0068860_100002690 | 3300005843 | Bacteria | 18501 |
| 108 | Ga0068860_100107190 | 3300005843 | Bacteria | 2670 |
| 109 | Ga0068862_100045564 | 3300005844 | Bacteria | 3742 |
| 110 | Ga0068862_100112253 | 3300005844 | Bacteria | 2394 |
| 111 | Ga0068862_100143926 | 3300005844 | Bacteria | 2117 |
| 112 | Ga0068862_100210056 | 3300005844 | Bacteria | 1758 |
| 113 | Ga0068862_100249712 | 3300005844 | Bacteria | 1616 |
| 114 | Ga0081455_10000875 | 3300005937 | Bacteria | 38950 |
| 115 | Ga0081455_10001281 | 3300005937 | Bacteria | 31263 |
| 116 | Ga0081455_10006371 | 3300005937 | Bacteria | 12668 |
| 117 | Ga0081455_10013731 | 3300005937 | Bacteria | 7972 |
| 118 | Ga0081455_10037949 | 3300005937 | Bacteria | 4269 |
| 119 | Ga0081455_10038108 | 3300005937 | Bacteria | 4259 |
| 120 | Ga0081455_10070498 | 3300005937 | Bacteria | 2902 |
| 121 | Ga0081538_10053586 | 3300005981 | Bacteria | 2396 |
| 122 | Ga0081538_10056076 | 3300005981 | Bacteria | 2312 |
| 123 | Ga0081540_1000055 | 3300005983 | Bacteria | 122642 |
| 124 | Ga0081540_1005014 | 3300005983 | Bacteria | 9945 |
| 125 | Ga0081540_1008353 | 3300005983 | Bacteria | 7236 |
| 126 | Ga0081540_1011111 | 3300005983 | Bacteria | 6044 |
| 127 | Ga0081540_1013509 | 3300005983 | Bacteria | 5304 |
| 128 | Ga0081540_1020858 | 3300005983 | Bacteria | 3925 |
| 129 | Ga0081540_1028891 | 3300005983 | Bacteria | 3102 |
| 130 | Ga0081540_1039018 | 3300005983 | Bacteria | 2494 |
| 131 | Ga0081540_1039050 | 3300005983 | Bacteria | 2493 |
| 132 | Ga0081540_1040637 | 3300005983 | Bacteria | 2422 |
| 133 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 134 | Ga0081539_10001953 | 3300005985 | Bacteria | 31481 |
| 135 | Ga0081539_10036981 | 3300005985 | Bacteria | 2913 |
| 136 | Ga0075365_10023866 | 3300006038 | Bacteria | 3851 |
| 137 | Ga0075365_10026996 | 3300006038 | Bacteria | 3649 |
| 138 | Ga0075365_10049111 | 3300006038 | Bacteria | 2779 |
| 139 | Ga0075365_10163801 | 3300006038 | Bacteria | 1550 |
| 140 | Ga0075368_10007168 | 3300006042 | Bacteria | 3928 |
| 141 | Ga0075368_10015164 | 3300006042 | Bacteria | 2854 |
| 142 | Ga0075368_10025165 | 3300006042 | Bacteria | 2284 |
| 143 | Ga0075363_100021478 | 3300006048 | Bacteria | 3252 |
| 144 | Ga0075363_100033053 | 3300006048 | Bacteria | 2691 |
| 145 | Ga0075363_100104818 | 3300006048 | Bacteria | 1568 |
| 146 | Ga0075363_100134361 | 3300006048 | Bacteria | 1389 |
| 147 | Ga0075363_100169517 | 3300006048 | Bacteria | 1239 |
| 148 | Ga0075364_10142361 | 3300006051 | Bacteria | 1613 |
| 149 | Ga0075364_10213157 | 3300006051 | Bacteria | 1310 |
| 150 | Ga0075364_10222364 | 3300006051 | Bacteria | 1281 |
| 151 | Ga0070716_100111545 | 3300006173 | Bacteria | 1696 |
| 152 | Ga0070716_100112173 | 3300006173 | Bacteria | 1692 |
| 153 | Ga0070712_100055917 | 3300006175 | Bacteria | 2766 |
| 154 | Ga0070712_100058029 | 3300006175 | Bacteria | 2722 |
| 155 | Ga0070712_100125260 | 3300006175 | Bacteria | 1939 |
| 156 | Ga0075362_10019134 | 3300006177 | Bacteria | 2844 |
| 157 | Ga0075362_10019479 | 3300006177 | Bacteria | 2822 |
| 158 | Ga0075362_10062560 | 3300006177 | Bacteria | 1686 |
| 159 | Ga0075367_10005197 | 3300006178 | Bacteria | 6434 |
| 160 | Ga0075367_10007145 | 3300006178 | Bacteria | 5697 |
| 161 | Ga0075367_10026687 | 3300006178 | Bacteria | 3277 |
| 162 | Ga0075367_10067047 | 3300006178 | Bacteria | 2151 |
| 163 | Ga0075367_10081245 | 3300006178 | Bacteria | 1961 |
| 164 | Ga0075367_10211331 | 3300006178 | Bacteria | 1213 |
| 165 | Ga0075369_10018451 | 3300006186 | Bacteria | 2840 |
| 166 | Ga0075369_10025257 | 3300006186 | Bacteria | 2468 |
| 167 | Ga0075369_10129826 | 3300006186 | Bacteria | 1144 |
| 168 | Ga0075366_10005248 | 3300006195 | Bacteria | 7013 |
| 169 | Ga0075366_10015948 | 3300006195 | Bacteria | 4313 |
| 170 | Ga0075366_10024275 | 3300006195 | Bacteria | 3536 |
| 171 | Ga0075366_10047427 | 3300006195 | Bacteria | 2546 |
| 172 | Ga0075366_10049459 | 3300006195 | Bacteria | 2494 |
| 173 | Ga0075366_10153162 | 3300006195 | Bacteria | 1396 |
| 174 | Ga0075366_10182446 | 3300006195 | Bacteria | 1275 |
| 175 | Ga0097621_100047456 | 3300006237 | Bacteria | 3481 |
| 176 | Ga0075370_10041656 | 3300006353 | Bacteria | 2592 |
| 177 | Ga0075370_10101607 | 3300006353 | Bacteria | 1664 |
| 178 | Ga0075370_10171147 | 3300006353 | Bacteria | 1277 |
| 179 | Ga0068871_100111287 | 3300006358 | Bacteria | 2303 |
| 180 | Ga0068871_100269890 | 3300006358 | Bacteria | 1486 |
| 181 | Ga0075428_100031338 | 3300006844 | Bacteria | 5879 |
| 182 | Ga0075428_100043684 | 3300006844 | Bacteria | 4927 |
| 183 | Ga0075428_100059241 | 3300006844 | Bacteria | 4193 |
| 184 | Ga0075428_100174356 | 3300006844 | Bacteria | 2330 |
| 185 | Ga0075430_100032196 | 3300006846 | Bacteria | 4452 |
| 186 | Ga0075430_100050201 | 3300006846 | Bacteria | 3519 |
| 187 | Ga0075431_100105259 | 3300006847 | Bacteria | 2911 |
| 188 | Ga0075429_100024575 | 3300006880 | Bacteria | 5228 |
| 189 | Ga0075429_100037833 | 3300006880 | Bacteria | 4200 |
| 190 | Ga0068865_100022835 | 3300006881 | Bacteria | 4087 |
| 191 | Ga0097620_100049210 | 3300006931 | Bacteria | 4233 |
| 192 | Ga0097620_100139090 | 3300006931 | Bacteria | 2502 |
| 193 | Ga0099794_10011788 | 3300007265 | Bacteria | 3754 |
| 194 | Ga0105240_10004093 | 3300009093 | Bacteria | 22404 |
| 195 | Ga0105240_10558393 | 3300009093 | Bacteria | 1266 |
| 196 | Ga0111539_10019170 | 3300009094 | Bacteria | 8451 |
| 197 | Ga0111539_10095964 | 3300009094 | Bacteria | 3483 |
| 198 | Ga0111539_10406088 | 3300009094 | Bacteria | 1586 |
| 199 | Ga0105245_10080814 | 3300009098 | Bacteria | 2970 |
| 200 | Ga0105245_10091933 | 3300009098 | Bacteria | 2793 |
| 201 | Ga0114129_10110710 | 3300009147 | Bacteria | 3790 |
| 202 | Ga0105243_10036179 | 3300009148 | Bacteria | 3831 |
| 203 | Ga0105243_10170264 | 3300009148 | Bacteria | 1885 |
| 204 | Ga0105243_10184435 | 3300009148 | Bacteria | 1817 |
| 205 | Ga0105243_10341412 | 3300009148 | Bacteria | 1372 |
| 206 | Ga0105241_10040357 | 3300009174 | Bacteria | 3524 |
| 207 | Ga0105242_10061390 | 3300009176 | Bacteria | 3091 |
| 208 | Ga0105248_10009064 | 3300009177 | Bacteria | 10945 |
| 209 | Ga0105248_10087017 | 3300009177 | Bacteria | 3516 |
| 210 | Ga0105237_10008240 | 3300009545 | Bacteria | 11316 |
| 211 | Ga0105237_10041340 | 3300009545 | Bacteria | 4650 |
| 212 | Ga0105237_10043361 | 3300009545 | Bacteria | 4532 |
| 213 | Ga0105238_10006431 | 3300009551 | Bacteria | 11688 |
| 214 | Ga0105249_10115108 | 3300009553 | Bacteria | 2547 |
| 215 | Ga0105239_10019170 | 3300010375 | Bacteria | 7557 |
| 216 | Ga0105239_10023758 | 3300010375 | Bacteria | 6750 |
| 217 | Ga0105239_10026562 | 3300010375 | Bacteria | 6372 |
| 218 | Ga0105239_10358191 | 3300010375 | Bacteria | 1647 |
| 219 | Ga0105239_10536793 | 3300010375 | Bacteria | 1331 |
| 220 | Ga0105239_10570913 | 3300010375 | Bacteria | 1289 |
| 221 | Ga0105246_10101669 | 3300011119 | Bacteria | 2094 |
| 222 | Ga0105246_10108983 | 3300011119 | Bacteria | 2031 |
| 223 | Ga0157370_10042061 | 3300013104 | Bacteria | 4405 |
| 224 | Ga0157369_10004737 | 3300013105 | Bacteria | 15983 |
| 225 | Ga0157374_10007199 | 3300013296 | Bacteria | 9475 |
| 226 | Ga0157378_10015652 | 3300013297 | Bacteria | 6644 |
| 227 | Ga0163162_10075484 | 3300013306 | Bacteria | 3432 |
| 228 | Ga0163162_10149339 | 3300013306 | Bacteria | 2454 |
| 229 | Ga0157372_10500092 | 3300013307 | Bacteria | 1417 |
| 230 | Ga0157375_10022464 | 3300013308 | Bacteria | 5806 |
| 231 | Ga0163163_10006013 | 3300014325 | Bacteria | 10560 |
| 232 | Ga0163163_10056218 | 3300014325 | Bacteria | 3889 |
| 233 | Ga0163163_10467790 | 3300014325 | Bacteria | 1321 |
| 234 | Ga0157380_10074749 | 3300014326 | Bacteria | 2752 |
| 235 | Ga0157380_10125864 | 3300014326 | Bacteria | 2178 |
| 236 | Ga0157379_10058636 | 3300014968 | Bacteria | 3443 |
| 237 | Ga0157379_10201681 | 3300014968 | Bacteria | 1799 |
| 238 | Ga0157376_10004438 | 3300014969 | Bacteria | 9773 |
| 239 | Ga0157376_10321201 | 3300014969 | Bacteria | 1472 |
| 240 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 241 | Ga0214544_1024221 | 3300021320 | Bacteria | 3202 |
| 242 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 243 | Ga0214542_1021284 | 3300021321 | Bacteria | 4504 |
| 244 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 245 | Ga0214545_1019543 | 3300021324 | Bacteria | 5771 |
| 246 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 247 | Ga0214543_1022474 | 3300021327 | Bacteria | 4468 |
| 248 | Ga0209677_105299 | 3300025253 | Bacteria | 3405 |
| 249 | Ga0209233_1005042 | 3300025261 | Bacteria | 4425 |
| 250 | Ga0209455_1002543 | 3300025272 | Bacteria | 6976 |
| 251 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 252 | Ga0209758_1000344 | 3300025297 | Bacteria | 85133 |
| 253 | Ga0209758_1000619 | 3300025297 | Bacteria | 54561 |
| 254 | Ga0209758_1001326 | 3300025297 | Bacteria | 30016 |
| 255 | Ga0209758_1003819 | 3300025297 | Bacteria | 13240 |
| 256 | Ga0209758_1009962 | 3300025297 | Bacteria | 5783 |
| 257 | Ga0209758_1017145 | 3300025297 | Bacteria | 3628 |
| 258 | Ga0209758_1028430 | 3300025297 | Bacteria | 2365 |
| 259 | Ga0209256_1004815 | 3300025299 | Bacteria | 8187 |
| 260 | Ga0207426_1000819 | 3300025302 | Bacteria | 33379 |
| 261 | Ga0207426_1007089 | 3300025302 | Bacteria | 4740 |
| 262 | Ga0207426_1007145 | 3300025302 | Bacteria | 4716 |
| 263 | Ga0209051_1038240 | 3300025303 | Bacteria | 1749 |
| 264 | Ga0209257_1000819 | 3300025304 | Bacteria | 45046 |
| 265 | Ga0209257_1007500 | 3300025304 | Bacteria | 6562 |
| 266 | Ga0207697_10039196 | 3300025315 | Bacteria | 1943 |
| 267 | Ga0207697_10111107 | 3300025315 | Bacteria | 1173 |
| 268 | Ga0207692_10012181 | 3300025898 | Bacteria | 3686 |
| 269 | Ga0207642_10033579 | 3300025899 | Bacteria | 2172 |
| 270 | Ga0207710_10041890 | 3300025900 | Bacteria | 2032 |
| 271 | Ga0207688_10096405 | 3300025901 | Bacteria | 1703 |
| 272 | Ga0207647_10003565 | 3300025904 | Bacteria | 11684 |
| 273 | Ga0207685_10091678 | 3300025905 | Bacteria | 1281 |
| 274 | Ga0207699_10027045 | 3300025906 | Bacteria | 3171 |
| 275 | Ga0207645_10210274 | 3300025907 | Bacteria | 1281 |
| 276 | Ga0207643_10074007 | 3300025908 | Bacteria | 1964 |
| 277 | Ga0207705_10015948 | 3300025909 | Bacteria | 5393 |
| 278 | Ga0207684_10028686 | 3300025910 | Bacteria | 4741 |
| 279 | Ga0207684_10123484 | 3300025910 | Bacteria | 2221 |
| 280 | Ga0207654_10003986 | 3300025911 | Bacteria | 7435 |
| 281 | Ga0207654_10057535 | 3300025911 | Bacteria | 2260 |
| 282 | Ga0207707_10001530 | 3300025912 | Bacteria | 21349 |
| 283 | Ga0207707_10061226 | 3300025912 | Bacteria | 3275 |
| 284 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 285 | Ga0207695_10075212 | 3300025913 | Bacteria | 3437 |
| 286 | Ga0207671_10002081 | 3300025914 | Bacteria | 21897 |
| 287 | Ga0207671_10012099 | 3300025914 | Bacteria | 6967 |
| 288 | Ga0207693_10004353 | 3300025915 | Bacteria | 11975 |
| 289 | Ga0207693_10005579 | 3300025915 | Bacteria | 10469 |
| 290 | Ga0207693_10080795 | 3300025915 | Bacteria | 2545 |
| 291 | Ga0207663_10115318 | 3300025916 | Bacteria | 1830 |
| 292 | Ga0207663_10137017 | 3300025916 | Bacteria | 1700 |
| 293 | Ga0207660_10001829 | 3300025917 | Bacteria | 14174 |
| 294 | Ga0207660_10343450 | 3300025917 | Bacteria | 1195 |
| 295 | Ga0207662_10016112 | 3300025918 | Bacteria | 4214 |
| 296 | Ga0207652_10006474 | 3300025921 | Bacteria | 9442 |
| 297 | Ga0207652_10143841 | 3300025921 | Bacteria | 2133 |
| 298 | Ga0207652_10177099 | 3300025921 | Bacteria | 1915 |
| 299 | Ga0207646_10031950 | 3300025922 | Bacteria | 4765 |
| 300 | Ga0207646_10180585 | 3300025922 | Bacteria | 1906 |
| 301 | Ga0207681_10065803 | 3300025923 | Bacteria | 2507 |
| 302 | Ga0207694_10074304 | 3300025924 | Bacteria | 2661 |
| 303 | Ga0207694_10111879 | 3300025924 | Bacteria | 2173 |
| 304 | Ga0207659_10171187 | 3300025926 | Bacteria | 1713 |
| 305 | Ga0207664_10433793 | 3300025929 | Bacteria | 1171 |
| 306 | Ga0207644_10024492 | 3300025931 | Bacteria | 4145 |
| 307 | Ga0207644_10243911 | 3300025931 | Bacteria | 1431 |
| 308 | Ga0207690_10045868 | 3300025932 | Bacteria | 2891 |
| 309 | Ga0207690_10130804 | 3300025932 | Bacteria | 1837 |
| 310 | Ga0207706_10034621 | 3300025933 | Bacteria | 4493 |
| 311 | Ga0207706_10078282 | 3300025933 | Bacteria | 2908 |
| 312 | Ga0207706_10131828 | 3300025933 | Bacteria | 2198 |
| 313 | Ga0207709_10022456 | 3300025935 | Bacteria | 3579 |
| 314 | Ga0207709_10026424 | 3300025935 | Bacteria | 3334 |
| 315 | Ga0207709_10041668 | 3300025935 | Bacteria | 2757 |
| 316 | Ga0207669_10147193 | 3300025937 | Bacteria | 1644 |
| 317 | Ga0207704_10035898 | 3300025938 | Bacteria | 2846 |
| 318 | Ga0207665_10081997 | 3300025939 | Bacteria | 2222 |
| 319 | Ga0207665_10121712 | 3300025939 | Bacteria | 1844 |
| 320 | Ga0207691_10036011 | 3300025940 | Bacteria | 4587 |
| 321 | Ga0207711_10005945 | 3300025941 | Bacteria | 10316 |
| 322 | Ga0207711_10011210 | 3300025941 | Bacteria | 7448 |
| 323 | Ga0207689_10014451 | 3300025942 | Bacteria | 6716 |
| 324 | Ga0207661_10017444 | 3300025944 | Bacteria | 5314 |
| 325 | Ga0207661_10050215 | 3300025944 | Bacteria | 3322 |
| 326 | Ga0207679_10030648 | 3300025945 | Bacteria | 3758 |
| 327 | Ga0207679_10051400 | 3300025945 | Bacteria | 3017 |
| 328 | Ga0207679_10115694 | 3300025945 | Bacteria | 2125 |
| 329 | Ga0207667_10008657 | 3300025949 | Bacteria | 12068 |
| 330 | Ga0207667_10098994 | 3300025949 | Bacteria | 3008 |
| 331 | Ga0207667_10241755 | 3300025949 | Bacteria | 1847 |
| 332 | Ga0207712_10029108 | 3300025961 | Bacteria | 3702 |
| 333 | Ga0207668_10010865 | 3300025972 | Bacteria | 5516 |
| 334 | Ga0207668_10014836 | 3300025972 | Bacteria | 4829 |
| 335 | Ga0207668_10030991 | 3300025972 | Bacteria | 3518 |
| 336 | Ga0207668_10099992 | 3300025972 | Bacteria | 2152 |
| 337 | Ga0207668_10127790 | 3300025972 | Bacteria | 1936 |
| 338 | Ga0207668_10138362 | 3300025972 | Bacteria | 1869 |
| 339 | Ga0207668_10184701 | 3300025972 | Bacteria | 1647 |
| 340 | Ga0207668_10185070 | 3300025972 | Bacteria | 1646 |
| 341 | Ga0207640_10177309 | 3300025981 | Bacteria | 1594 |
| 342 | Ga0207677_10043343 | 3300026023 | Bacteria | 2990 |
| 343 | Ga0207703_10081357 | 3300026035 | Bacteria | 2700 |
| 344 | Ga0207703_10218167 | 3300026035 | Bacteria | 1704 |
| 345 | Ga0207703_10231295 | 3300026035 | Bacteria | 1657 |
| 346 | Ga0207639_10005343 | 3300026041 | Bacteria | 8679 |
| 347 | Ga0207678_10003472 | 3300026067 | Bacteria | 14191 |
| 348 | Ga0207678_10046790 | 3300026067 | Bacteria | 3742 |
| 349 | Ga0207678_10049637 | 3300026067 | Bacteria | 3626 |
| 350 | Ga0207678_10064611 | 3300026067 | Bacteria | 3144 |
| 351 | Ga0207678_10296903 | 3300026067 | Bacteria | 1388 |
| 352 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 353 | Ga0207702_10282267 | 3300026078 | Bacteria | 1570 |
| 354 | Ga0207641_10240986 | 3300026088 | Bacteria | 1685 |
| 355 | Ga0207641_10273472 | 3300026088 | Bacteria | 1586 |
| 356 | Ga0207648_10085382 | 3300026089 | Bacteria | 2753 |
| 357 | Ga0207648_10107966 | 3300026089 | Bacteria | 2443 |
| 358 | Ga0207676_10011441 | 3300026095 | Bacteria | 6342 |
| 359 | Ga0207676_10019822 | 3300026095 | Bacteria | 4913 |
| 360 | Ga0207674_10013973 | 3300026116 | Bacteria | 8879 |
| 361 | Ga0207675_100127247 | 3300026118 | Bacteria | 2414 |
| 362 | Ga0207683_10018049 | 3300026121 | Bacteria | 6016 |
| 363 | Ga0207683_10046736 | 3300026121 | Bacteria | 3790 |
| 364 | Ga0207683_10127390 | 3300026121 | Bacteria | 2289 |
| 365 | Ga0207683_10154629 | 3300026121 | Bacteria | 2071 |
| 366 | Ga0207683_10218403 | 3300026121 | Bacteria | 1736 |
| 367 | Ga0207683_10240885 | 3300026121 | Bacteria | 1650 |
| 368 | Ga0207698_10045704 | 3300026142 | Bacteria | 3301 |
| 369 | Ga0207698_10187316 | 3300026142 | Bacteria | 1839 |
| 370 | Ga0207698_10293517 | 3300026142 | Bacteria | 1510 |
| 371 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 372 | Ga0209969_1002107 | 3300027360 | Bacteria | 2741 |
| 373 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 374 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 375 | Ga0210000_1000508 | 3300027462 | Bacteria | 5300 |
| 376 | Ga0209995_1002427 | 3300027471 | Bacteria | 2943 |
| 377 | Ga0209999_1004186 | 3300027543 | Bacteria | 2597 |
| 378 | Ga0209588_1011313 | 3300027671 | Bacteria | 2694 |
| 379 | Ga0209813_10006183 | 3300027866 | Bacteria | 2947 |
| 380 | Ga0207428_10023941 | 3300027907 | Bacteria | 5129 |
| 381 | Ga0268266_10014838 | 3300028379 | Bacteria | 6692 |
| 382 | Ga0268266_10132219 | 3300028379 | Bacteria | 2233 |
| 383 | Ga0268266_10158756 | 3300028379 | Bacteria | 2044 |
| 384 | Ga0268266_10160826 | 3300028379 | Bacteria | 2031 |
| 385 | Ga0268266_10259661 | 3300028379 | Bacteria | 1609 |
| 386 | Ga0268266_10288308 | 3300028379 | Bacteria | 1528 |
| 387 | Ga0268265_10027240 | 3300028380 | Bacteria | 4076 |
| 388 | Ga0268265_10047819 | 3300028380 | Bacteria | 3208 |
| 389 | Ga0268265_10087904 | 3300028380 | Bacteria | 2474 |
| 390 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 391 | Ga0268264_10053083 | 3300028381 | Bacteria | 3381 |
| 392 | Ga0268264_10087570 | 3300028381 | Bacteria | 2678 |
| 393 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 394 | Ga0307515_10075181 | 3300028794 | Bacteria | 4505 |
| 395 | Ga0307511_10053634 | 3300030521 | Bacteria | 3192 |
| 396 | Ga0265332_10071281 | 3300031238 | Bacteria | 1480 |
| 397 | Ga0265325_10002323 | 3300031241 | Bacteria | 12907 |
| 398 | Ga0265325_10010610 | 3300031241 | Bacteria | 5325 |
| 399 | Ga0265340_10011845 | 3300031247 | Bacteria | 4622 |
| 400 | Ga0265340_10019263 | 3300031247 | Bacteria | 3513 |
| 401 | Ga0265316_10087257 | 3300031344 | Bacteria | 2384 |
| 402 | Ga0307513_10142183 | 3300031456 | Bacteria | 2324 |
| 403 | Ga0307509_10022374 | 3300031507 | Bacteria | 7127 |
| 404 | Ga0307509_10129452 | 3300031507 | Bacteria | 2483 |
| 405 | Ga0307509_10345703 | 3300031507 | Bacteria | 1213 |
| 406 | Ga0307408_100103483 | 3300031548 | Bacteria | 2174 |
| 407 | Ga0307408_100241512 | 3300031548 | Bacteria | 1485 |
| 408 | Ga0307508_10046720 | 3300031616 | Bacteria | 3865 |
| 409 | Ga0265314_10007706 | 3300031711 | Bacteria | 9310 |
| 410 | Ga0265314_10016415 | 3300031711 | Bacteria | 5849 |
| 411 | Ga0265314_10079251 | 3300031711 | Bacteria | 2172 |
| 412 | Ga0265342_10009595 | 3300031712 | Bacteria | 6796 |
| 413 | Ga0265342_10023757 | 3300031712 | Bacteria | 3875 |
| 414 | Ga0265342_10065180 | 3300031712 | Bacteria | 2136 |
| 415 | Ga0307516_10020012 | 3300031730 | Bacteria | 6920 |
| 416 | Ga0307411_10088911 | 3300032005 | Bacteria | 2150 |
| 417 | Ga0307411_10425833 | 3300032005 | Bacteria | 1104 |
| 418 | Ga0307415_100110411 | 3300032126 | Bacteria | 2039 |
| 419 | Ga0307510_10007730 | 3300033180 | Bacteria | 12823 |
| 420 | Ga0307510_10020603 | 3300033180 | Bacteria | 7701 |
| 421 | Ga0307510_10024013 | 3300033180 | Bacteria | 7054 |
| 422 | Ga0307510_10264543 | 3300033180 | Bacteria | 1199 |
| 423 | Ga0315911_1000012 | 3300033442 | Bacteria | 248988 |
| 424 | Ga0373930_0005629 | 3300034816 | Bacteria | 2091 |
| 425 | Ga0373926_0005379 | 3300035083 | Bacteria | 4218 |
| 426 | Ga0373929_0005434 | 3300035085 | Bacteria | 2292 |
| 427 | Ga0373934_0002178 | 3300035086 | Bacteria | 7205 |
| 428 | Ga0373944_0008059 | 3300035089 | Bacteria | 2839 |
| 429 | Ga0373923_0001946 | 3300035111 | Bacteria | 6191 |
| 430 | Ga0373923_0080726 | 3300035111 | Bacteria | 1410 |
| 431 | Ga0373936_0008199 | 3300035113 | Bacteria | 3926 |
| 432 | Ga0373936_0038186 | 3300035113 | Bacteria | 1919 |
| 433 | Ga0373939_0063301 | 3300035114 | Bacteria | 1185 |
| 434 | Ga0373953_0039692 | 3300035117 | Bacteria | 1866 |
| 435 | Ga0373954_0002355 | 3300035118 | Bacteria | 7899 |
| 436 | Ga0373956_0002239 | 3300035119 | Bacteria | 7967 |
| 437 | Ga0373956_0049325 | 3300035119 | Bacteria | 1888 |
| 438 | Ga0373956_0053696 | 3300035119 | Bacteria | 1814 |
| 439 | Ga0373957_0000527 | 3300035120 | Bacteria | 9628 |
| 440 | Ga0373957_0049538 | 3300035120 | Bacteria | 1603 |
| 441 | Ga0373943_0016178 | 3300035170 | Bacteria | 3398 |
| 442 | Ga0373946_0016253 | 3300035171 | Bacteria | 2833 |
| 443 | Ga0373955_0000535 | 3300035172 | Bacteria | 16084 |
| 444 | Ga0373955_0054645 | 3300035172 | Bacteria | 2184 |
| 445 | Ga0373955_0065771 | 3300035172 | Bacteria | 2014 |
| 446 | Ga0373955_0245171 | 3300035172 | Bacteria | 1073 |
| 447 | Ga0373955_0282663 | 3300035172 | Bacteria | 998 |
| 448 | Ga0373961_0106377 | 3300035241 | Bacteria | 914 |
| 449 | Ga0373962_0022693 | 3300035242 | Bacteria | 1666 |
| 450 | Ga0373924_0004005 | 3300035410 | Bacteria | 5117 |
| 451 | Ga0373924_0032496 | 3300035410 | Bacteria | 2102 |
| 452 | Ga0373931_0004821 | 3300035691 | Bacteria | 6194 |
| 453 | Ga0373931_0014148 | 3300035691 | Bacteria | 3896 |
| 454 | Ga0373931_0019707 | 3300035691 | Unclassified | 3369 |
| 455 | Ga0373935_0002921 | 3300035692 | Bacteria | 9842 |
| 456 | Ga0373927_0042604 | 3300035695 | Bacteria | 2941 |
| 457 | Ga0373927_0344767 | 3300035695 | Bacteria | 981 |
| 458 | Ga0373933_0002165 | 3300035724 | Bacteria | 11241 |
| 459 | Ga0373933_0081588 | 3300035724 | Bacteria | 1984 |
| 460 | Ga0373933_0107022 | 3300035724 | Bacteria | 1740 |
| 461 | Ga0373947_0007981 | 3300035725 | Bacteria | 6104 |
| 462 | Ga0373947_0013638 | 3300035725 | Bacteria | 4655 |
| 463 | Ga0373937_0022868 | 3300036401 | Bacteria | 5623 |
| 464 | Ga0373937_0050675 | 3300036401 | Bacteria | 3803 |
| 465 | Ga0373937_0101164 | 3300036401 | Bacteria | 2675 |
| 466 | Ga0373937_0315490 | 3300036401 | Bacteria | 1479 |
| 467 | Ga0373937_0369106 | 3300036401 | Bacteria | 1360 |
| 468 | Ga0373937_0395220 | 3300036401 | Bacteria | 1311 |
| 469 | Ga0373925_0002335 | 3300037068 | Bacteria | 15260 |
| 470 | Ga0373925_0332378 | 3300037068 | Bacteria | 1231 |
| 471 | Ga0395900_0335819 | 3300037418 | Bacteria | 1488 |
| 472 | Ga0395900_0447228 | 3300037418 | Bacteria | 1249 |
| 473 | Ga0395898_0037345 | 3300037466 | Bacteria | 4820 |
| 474 | Ga0395898_0183734 | 3300037466 | Bacteria | 1998 |
| 475 | Ga0395905_0103258 | 3300037471 | Bacteria | 2676 |
| 476 | Ga0395905_0136451 | 3300037471 | Bacteria | 2308 |
| 477 | Ga0451851_0758436 | 3300041507 | Bacteria | 1429 |
| 478 | Ga0439446_0017631 | 3300042156 | Bacteria | 1997 |
| 479 | Ga0439434_0004260 | 3300042435 | Bacteria | 4181 |
| 480 | Ga0439435_0001020 | 3300042436 | Bacteria | 4928 |
| 481 | Ga0439435_0029194 | 3300042436 | Bacteria | 1487 |
| 482 | Ga0439459_0007728 | 3300042438 | Bacteria | 1823 |
| 483 | Ga0466972_0000179 | 3300044658 | Bacteria | 49010 |
| 484 | Ga0451576_0017197 | 3300045051 | Bacteria | 7955 |
| 485 | Ga0466967_0178875 | 3300045976 | Bacteria | 1999 |
| 486 | Ga0495617_006222 | 3300046452 | Bacteria | 4200 |
| 487 | Ga0495592_0021832 | 3300046454 | Bacteria | 4870 |
| 488 | Ga0495592_0041663 | 3300046454 | Bacteria | 3441 |
| 489 | Ga0495603_0000923 | 3300046455 | Bacteria | 16862 |
| 490 | Ga0495603_0008603 | 3300046455 | Bacteria | 6169 |
| 491 | Ga0495603_0021384 | 3300046455 | Bacteria | 3918 |
| 492 | Ga0495603_0028744 | 3300046455 | Bacteria | 3354 |
| 493 | Ga0495603_0055227 | 3300046455 | Bacteria | 2353 |
| 494 | Ga0495603_0093236 | 3300046455 | Bacteria | 1760 |
| 495 | Ga0495603_0160008 | 3300046455 | Bacteria | 1306 |
| 496 | Ga0495629_0001841 | 3300046459 | Bacteria | 16607 |
| 497 | Ga0495629_0002400 | 3300046459 | Bacteria | 14408 |
| 498 | Ga0495629_0033029 | 3300046459 | Bacteria | 3662 |
| 499 | Ga0495629_0145279 | 3300046459 | Bacteria | 1650 |
| 500 | Ga0495638_0001078 | 3300046460 | Bacteria | 26592 |
| 501 | Ga0495638_0030773 | 3300046460 | Bacteria | 3451 |
| 502 | Ga0495641_0011027 | 3300046461 | Bacteria | 5182 |
| 503 | Ga0495651_0087761 | 3300046462 | Bacteria | 2338 |
| 504 | Ga0495653_0004149 | 3300046463 | Bacteria | 11724 |
| 505 | Ga0495653_0037943 | 3300046463 | Bacteria | 3783 |
| 506 | Ga0495653_0085483 | 3300046463 | Bacteria | 2320 |
| 507 | Ga0495580_0009257 | 3300046472 | Bacteria | 7756 |
| 508 | Ga0495580_0010859 | 3300046472 | Bacteria | 7068 |
| 509 | Ga0495580_0030671 | 3300046472 | Bacteria | 3891 |
| 510 | Ga0495582_0000283 | 3300046473 | Bacteria | 28312 |
| 511 | Ga0495582_0106808 | 3300046473 | Bacteria | 1571 |
| 512 | Ga0495582_0112943 | 3300046473 | Bacteria | 1526 |
| 513 | Ga0495639_0004800 | 3300046475 | Bacteria | 5813 |
| 514 | Ga0495639_0074969 | 3300046475 | Bacteria | 1568 |
| 515 | Ga0495662_0001975 | 3300046476 | Bacteria | 10288 |
| 516 | Ga0495662_0027547 | 3300046476 | Bacteria | 2745 |
| 517 | Ga0495664_0007158 | 3300046477 | Bacteria | 6183 |
| 518 | Ga0495664_0013420 | 3300046477 | Bacteria | 4645 |
| 519 | Ga0495664_0141800 | 3300046477 | Bacteria | 1457 |
| 520 | Ga0495664_0239213 | 3300046477 | Bacteria | 1098 |
| 521 | Ga0495585_0037502 | 3300046492 | Bacteria | 2730 |
| 522 | Ga0495585_0150073 | 3300046492 | Unclassified | 1216 |
| 523 | Ga0495594_0000509 | 3300046499 | Bacteria | 19796 |
| 524 | Ga0495594_0055155 | 3300046499 | Bacteria | 2191 |
| 525 | Ga0495596_0074110 | 3300046500 | Bacteria | 1322 |
| 526 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 527 | Ga0495606_0010827 | 3300046507 | Bacteria | 7515 |
| 528 | Ga0495606_0156888 | 3300046507 | Bacteria | 1331 |
| 529 | Ga0495608_0020082 | 3300046511 | Bacteria | 4593 |
| 530 | Ga0495608_0105511 | 3300046511 | Bacteria | 1814 |
| 531 | Ga0495618_0032005 | 3300046514 | Bacteria | 3294 |
| 532 | Ga0495618_0048943 | 3300046514 | Bacteria | 2669 |
| 533 | Ga0495618_0095039 | 3300046514 | Bacteria | 1906 |
| 534 | Ga0495620_0058506 | 3300046515 | Bacteria | 1613 |
| 535 | Ga0495628_0063319 | 3300046516 | Bacteria | 2898 |
| 536 | Ga0495628_0108220 | 3300046516 | Bacteria | 2140 |
| 537 | Ga0495628_0152094 | 3300046516 | Bacteria | 1762 |
| 538 | Ga0495630_0008393 | 3300046517 | Bacteria | 7407 |
| 539 | Ga0495630_0018211 | 3300046517 | Bacteria | 5157 |
| 540 | Ga0495630_0162430 | 3300046517 | Bacteria | 1701 |
| 541 | Ga0495631_0105821 | 3300046518 | Bacteria | 1210 |
| 542 | Ga0495632_0043888 | 3300046519 | Bacteria | 2233 |
| 543 | Ga0495643_0060867 | 3300046522 | Bacteria | 2003 |
| 544 | Ga0495648_0001411 | 3300046524 | Bacteria | 23498 |
| 545 | Ga0495648_0006902 | 3300046524 | Bacteria | 9160 |
| 546 | Ga0495642_0021165 | 3300046528 | Bacteria | 2557 |
| 547 | Ga0495652_0016077 | 3300046529 | Bacteria | 6694 |
| 548 | Ga0495652_0040475 | 3300046529 | Bacteria | 4028 |
| 549 | Ga0495652_0106314 | 3300046529 | Bacteria | 2266 |
| 550 | Ga0495652_0114790 | 3300046529 | Bacteria | 2160 |
| 551 | Ga0495652_0151102 | 3300046529 | Bacteria | 1814 |
| 552 | Ga0495665_0000145 | 3300046531 | Bacteria | 34959 |
| 553 | Ga0495640_0007751 | 3300046533 | Bacteria | 8449 |
| 554 | Ga0495640_0016865 | 3300046533 | Bacteria | 5459 |
| 555 | Ga0495640_0039415 | 3300046533 | Bacteria | 3315 |
| 556 | Ga0495640_0140585 | 3300046533 | Bacteria | 1556 |
| 557 | Ga0495587_0018462 | 3300046536 | Bacteria | 4325 |
| 558 | Ga0495597_0110835 | 3300046542 | Bacteria | 1151 |
| 559 | Ga0495645_0013988 | 3300046543 | Bacteria | 5686 |
| 560 | Ga0495645_0104249 | 3300046543 | Bacteria | 2014 |
| 561 | Ga0495645_0218986 | 3300046543 | Bacteria | 1281 |
| 562 | Ga0495622_0006137 | 3300046557 | Bacteria | 5584 |
| 563 | Ga0495667_0033824 | 3300046559 | Bacteria | 3419 |
| 564 | Ga0495667_0066606 | 3300046559 | Bacteria | 2354 |
| 565 | Ga0495667_0066888 | 3300046559 | Bacteria | 2349 |
| 566 | Ga0495667_0076114 | 3300046559 | Bacteria | 2183 |
| 567 | Ga0495656_0014930 | 3300046615 | Bacteria | 2922 |
| 568 | Ga0495656_0027175 | 3300046615 | Bacteria | 2283 |
| 569 | Ga0495668_0027456 | 3300046616 | Bacteria | 3225 |
| 570 | Ga0495668_0033297 | 3300046616 | Bacteria | 2896 |
| 571 | Ga0495634_0001108 | 3300046642 | Bacteria | 24957 |
| 572 | Ga0495634_0009918 | 3300046642 | Bacteria | 7000 |
| 573 | Ga0495634_0018655 | 3300046642 | Bacteria | 4935 |
| 574 | Ga0495634_0082129 | 3300046642 | Bacteria | 2106 |
| 575 | Ga0495634_0122835 | 3300046642 | Bacteria | 1662 |
| 576 | Ga0495611_0044668 | 3300046648 | Bacteria | 1982 |
| 577 | Ga0495611_0097200 | 3300046648 | Bacteria | 1364 |
| 578 | Ga0495625_0085058 | 3300046660 | Bacteria | 2196 |
| 579 | Ga0495625_0112735 | 3300046660 | Bacteria | 1858 |
| 580 | Ga0495635_0002477 | 3300046663 | Bacteria | 12604 |
| 581 | Ga0495635_0009937 | 3300046663 | Bacteria | 6652 |
| 582 | Ga0495635_0013665 | 3300046663 | Bacteria | 5682 |
| 583 | Ga0495635_0068873 | 3300046663 | Bacteria | 2427 |
| 584 | Ga0495588_0013234 | 3300046674 | Bacteria | 3926 |
| 585 | Ga0495588_0028524 | 3300046674 | Bacteria | 2794 |
| 586 | Ga0495588_0130449 | 3300046674 | Bacteria | 1326 |
| 587 | Ga0495588_0140974 | 3300046674 | Bacteria | 1273 |
| 588 | Ga0495657_0021483 | 3300046675 | Bacteria | 4630 |
| 589 | Ga0495657_0024161 | 3300046675 | Bacteria | 4332 |
| 590 | Ga0495657_0204093 | 3300046675 | Bacteria | 1203 |
| 591 | Ga0495599_0005563 | 3300046678 | Bacteria | 7558 |
| 592 | Ga0495599_0025078 | 3300046678 | Bacteria | 3731 |
| 593 | Ga0495623_0002992 | 3300046679 | Bacteria | 11118 |
| 594 | Ga0495623_0010731 | 3300046679 | Bacteria | 5931 |
| 595 | Ga0495623_0090320 | 3300046679 | Bacteria | 1881 |
| 596 | Ga0495646_0021267 | 3300046680 | Bacteria | 4101 |
| 597 | Ga0495646_0036786 | 3300046680 | Bacteria | 3031 |
| 598 | Ga0495646_0049099 | 3300046680 | Bacteria | 2561 |
| 599 | Ga0495646_0145751 | 3300046680 | Bacteria | 1320 |
| 600 | Ga0495647_0007604 | 3300046681 | Bacteria | 3636 |
| 601 | Ga0495658_0000547 | 3300046683 | Bacteria | 20542 |
| 602 | Ga0495658_0139704 | 3300046683 | Bacteria | 1481 |
| 603 | Ga0495669_0033559 | 3300046684 | Bacteria | 2259 |
| 604 | Ga0495613_0002250 | 3300046689 | Bacteria | 14591 |
| 605 | Ga0495613_0068935 | 3300046689 | Bacteria | 2579 |
| 606 | Ga0495613_0106435 | 3300046689 | Bacteria | 2024 |
| 607 | Ga0495624_0005060 | 3300046690 | Bacteria | 9536 |
| 608 | Ga0495649_0051812 | 3300046694 | Bacteria | 2225 |
| 609 | Ga0495589_0049304 | 3300046794 | Bacteria | 2084 |
| 610 | Ga0495600_0027802 | 3300046809 | Bacteria | 3656 |
| 611 | Ga0495581_0000529 | 3300047315 | Bacteria | 19610 |
| 612 | Ga0495581_0049088 | 3300047315 | Bacteria | 2437 |
| 613 | Ga0495581_0199949 | 3300047315 | Bacteria | 1169 |
| 614 | Ga0495604_0014830 | 3300047317 | Bacteria | 6215 |
| 615 | Ga0495604_0022506 | 3300047317 | Bacteria | 5031 |
| 616 | Ga0495604_0040425 | 3300047317 | Bacteria | 3661 |
| 617 | Ga0495604_0049547 | 3300047317 | Bacteria | 3263 |
| 618 | Ga0495674_0012072 | 3300047319 | Bacteria | 8141 |
| 619 | Ga0495674_0023272 | 3300047319 | Bacteria | 5712 |
| 620 | Ga0495674_0032883 | 3300047319 | Bacteria | 4701 |
| 621 | Ga0495674_0036651 | 3300047319 | Bacteria | 4413 |
| 622 | Ga0495674_0141178 | 3300047319 | Bacteria | 2024 |
| 623 | Ga0495672_0085850 | 3300047320 | Bacteria | 1742 |
| 624 | Ga0495676_0153006 | 3300047321 | Bacteria | 1639 |
| 625 | Ga0495680_0001426 | 3300047322 | Bacteria | 25752 |
| 626 | Ga0495680_0012571 | 3300047322 | Bacteria | 7441 |
| 627 | Ga0495683_0046627 | 3300047323 | Bacteria | 2175 |
| 628 | Ga0495675_0136036 | 3300047444 | Bacteria | 1525 |
| 629 | Ga0495679_053256 | 3300047446 | Bacteria | 1209 |
| 630 | Ga0495673_0042339 | 3300047469 | Bacteria | 2045 |
| 631 | Ga0495673_0090072 | 3300047469 | Bacteria | 1255 |
| 632 | Ga0495684_0001145 | 3300047471 | Bacteria | 21346 |
| 633 | Ga0495684_0078066 | 3300047471 | Bacteria | 2512 |
| 634 | Ga0495684_0123791 | 3300047471 | Bacteria | 1946 |
| 635 | Ga0495593_0000526 | 3300047673 | Bacteria | 21677 |
| 636 | Ga0495593_0000877 | 3300047673 | Bacteria | 17432 |
| 637 | Ga0495593_0040050 | 3300047673 | Bacteria | 2524 |
| 638 | Ga0495602_0007749 | 3300048088 | Bacteria | 11224 |
| 639 | Ga0495602_0009427 | 3300048088 | Bacteria | 10154 |
| 640 | Ga0495602_0028167 | 3300048088 | Bacteria | 5381 |
| 641 | Ga0495602_0170130 | 3300048088 | Bacteria | 1692 |
| 642 | Ga0495615_0012801 | 3300048090 | Bacteria | 1738 |
| 643 | Ga0495615_0036565 | 3300048090 | Bacteria | 1206 |
| 644 | Ga0496100_0036611 | 3300048903 | Bacteria | 3097 |
| 645 | Ga0496100_0083844 | 3300048903 | Bacteria | 2159 |
| 646 | Ga0496101_0008287 | 3300048904 | Bacteria | 6790 |
| 647 | Ga0496101_0068460 | 3300048904 | Bacteria | 2595 |
| 648 | Ga0496101_0448082 | 3300048904 | Bacteria | 1018 |
| 649 | Ga0496102_0072086 | 3300048905 | Bacteria | 3173 |
| 650 | Ga0496102_0151850 | 3300048905 | Bacteria | 2177 |
| 651 | Ga0496102_0202316 | 3300048905 | Bacteria | 1872 |
| 652 | Ga0496103_0047232 | 3300048906 | Bacteria | 2660 |
| 653 | Ga0496103_0057689 | 3300048906 | Bacteria | 2411 |
| 654 | Ga0496104_0000812 | 3300048907 | Bacteria | 26879 |
| 655 | Ga0496104_0001312 | 3300048907 | Bacteria | 21461 |
| 656 | Ga0496104_0009449 | 3300048907 | Bacteria | 8674 |
| 657 | Ga0496104_0025169 | 3300048907 | Bacteria | 5485 |
| 658 | Ga0496104_0041576 | 3300048907 | Bacteria | 4311 |
| 659 | Ga0496104_0117418 | 3300048907 | Bacteria | 2553 |
| 660 | Ga0496104_0132565 | 3300048907 | Bacteria | 2394 |
| 661 | Ga0496104_0398523 | 3300048907 | Bacteria | 1288 |
| 662 | Ga0496105_0007262 | 3300048908 | Bacteria | 8558 |
| 663 | Ga0496105_0013952 | 3300048908 | Bacteria | 6388 |
| 664 | Ga0496105_0044074 | 3300048908 | Bacteria | 3678 |
| 665 | Ga0496105_0063015 | 3300048908 | Bacteria | 3059 |
| 666 | Ga0496105_0078734 | 3300048908 | Bacteria | 2721 |
| 667 | Ga0496106_0081988 | 3300048909 | Bacteria | 2479 |
| 668 | Ga0496106_0131628 | 3300048909 | Bacteria | 1962 |
| 669 | Ga0496106_0365910 | 3300048909 | Bacteria | 1158 |
| 670 | Ga0496107_0004840 | 3300048910 | Bacteria | 9144 |
| 671 | Ga0496107_0052219 | 3300048910 | Bacteria | 2949 |
| 672 | Ga0496107_0224243 | 3300048910 | Bacteria | 1398 |
| 673 | Ga0496108_0039050 | 3300048911 | Bacteria | 3957 |
| 674 | Ga0496108_0114638 | 3300048911 | Bacteria | 2307 |
| 675 | Ga0496108_0207552 | 3300048911 | Bacteria | 1700 |
| 676 | Ga0496108_0362302 | 3300048911 | Bacteria | 1266 |
| 677 | Ga0496108_0511472 | 3300048911 | Bacteria | 1048 |
| 678 | Ga0496109_0014503 | 3300048912 | Bacteria | 6856 |
| 679 | Ga0496109_0021350 | 3300048912 | Bacteria | 5724 |
| 680 | Ga0496109_0059361 | 3300048912 | Bacteria | 3494 |
| 681 | Ga0496109_0150548 | 3300048912 | Bacteria | 2178 |
| 682 | Ga0496109_0178337 | 3300048912 | Bacteria | 1995 |
| 683 | Ga0496109_0330078 | 3300048912 | Bacteria | 1440 |
| 684 | Ga0496110_0134451 | 3300048913 | Bacteria | 2234 |
| 685 | Ga0496110_0148096 | 3300048913 | Bacteria | 2124 |
| 686 | Ga0496110_0173181 | 3300048913 | Bacteria | 1958 |
| 687 | Ga0496110_0211501 | 3300048913 | Bacteria | 1763 |
| 688 | Ga0496111_0021899 | 3300048914 | Bacteria | 4468 |
| 689 | Ga0496111_0034817 | 3300048914 | Bacteria | 3597 |
| 690 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 691 | Ga0496112_0022947 | 3300048915 | Bacteria | 5955 |
| 692 | Ga0496112_0079304 | 3300048915 | Bacteria | 3248 |
| 693 | Ga0496112_0095845 | 3300048915 | Bacteria | 2937 |
| 694 | Ga0496112_0119669 | 3300048915 | Bacteria | 2603 |
| 695 | Ga0496112_0124651 | 3300048915 | Bacteria | 2547 |
| 696 | Ga0496112_0154761 | 3300048915 | Bacteria | 2260 |
| 697 | Ga0496112_0174421 | 3300048915 | Bacteria | 2115 |
| 698 | Ga0496112_0341230 | 3300048915 | Bacteria | 1441 |
| 699 | Ga0496113_0019366 | 3300048916 | Bacteria | 4759 |
| 700 | Ga0496113_0098949 | 3300048916 | Bacteria | 2258 |
| 701 | Ga0496113_0136402 | 3300048916 | Bacteria | 1928 |
| 702 | Ga0496113_0213124 | 3300048916 | Bacteria | 1538 |
| 703 | Ga0496113_0247750 | 3300048916 | Bacteria | 1422 |
| 704 | Ga0496114_0006660 | 3300048917 | Bacteria | 9104 |
| 705 | Ga0496114_0041961 | 3300048917 | Unclassified | 3791 |
| 706 | Ga0496114_0061283 | 3300048917 | Bacteria | 3146 |
| 707 | Ga0496114_0075094 | 3300048917 | Bacteria | 2846 |
| 708 | Ga0496114_0098275 | 3300048917 | Bacteria | 2495 |
| 709 | Ga0496114_0125156 | 3300048917 | Bacteria | 2215 |
| 710 | Ga0496114_0142504 | 3300048917 | Bacteria | 2076 |
| 711 | Ga0496114_0208667 | 3300048917 | Bacteria | 1713 |
| 712 | Ga0496115_0000981 | 3300048918 | Bacteria | 20690 |
| 713 | Ga0496115_0016513 | 3300048918 | Bacteria | 5623 |
| 714 | Ga0496115_0049802 | 3300048918 | Bacteria | 3354 |
| 715 | Ga0496115_0071871 | 3300048918 | Bacteria | 2806 |
| 716 | Ga0496115_0102143 | 3300048918 | Bacteria | 2351 |
| 717 | Ga0496115_0120672 | 3300048918 | Bacteria | 2157 |
| 718 | Ga0496115_0268417 | 3300048918 | Bacteria | 1402 |
| 719 | Ga0496118_0037250 | 3300048921 | Bacteria | 3919 |
| 720 | Ga0496118_0053748 | 3300048921 | Bacteria | 3057 |
| 721 | Ga0496119_0072162 | 3300048922 | Bacteria | 2018 |
| 722 | Ga0496119_0084115 | 3300048922 | Bacteria | 1825 |
| 723 | Ga0496119_0093768 | 3300048922 | Bacteria | 1700 |
| 724 | Ga0496120_0011332 | 3300048923 | Bacteria | 6137 |
| 725 | Ga0496120_0027756 | 3300048923 | Bacteria | 3477 |
| 726 | Ga0496120_0050193 | 3300048923 | Bacteria | 2390 |
| 727 | Ga0496121_0000753 | 3300048924 | Bacteria | 59517 |
| 728 | Ga0496121_0001173 | 3300048924 | Bacteria | 45935 |
| 729 | Ga0496121_0011996 | 3300048924 | Bacteria | 9526 |
| 730 | Ga0496121_0078769 | 3300048924 | Bacteria | 2618 |
| 731 | Ga0496121_0083299 | 3300048924 | Bacteria | 2525 |
| 732 | Ga0496121_0096056 | 3300048924 | Bacteria | 2301 |
| 733 | Ga0496121_0097922 | 3300048924 | Bacteria | 2271 |
| 734 | Ga0496121_0099229 | 3300048924 | Bacteria | 2251 |
| 735 | Ga0496121_0200554 | 3300048924 | Bacteria | 1422 |
| 736 | Ga0496121_0321808 | 3300048924 | Bacteria | 1041 |
| 737 | Ga0496123_0022865 | 3300048926 | Bacteria | 4803 |
| 738 | Ga0496124_0025489 | 3300048927 | Bacteria | 5355 |
| 739 | Ga0496124_0045919 | 3300048927 | Bacteria | 3743 |
| 740 | Ga0496124_0181722 | 3300048927 | Bacteria | 1618 |
| 741 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 742 | Ga0496125_0088394 | 3300048928 | Bacteria | 2335 |
| 743 | Ga0496125_0109206 | 3300048928 | Bacteria | 2009 |
| 744 | Ga0496126_0004189 | 3300048929 | Bacteria | 17378 |
| 745 | Ga0496126_0004375 | 3300048929 | Bacteria | 16937 |
| 746 | Ga0496126_0010575 | 3300048929 | Bacteria | 9650 |
| 747 | Ga0496126_0060475 | 3300048929 | Bacteria | 3406 |
| 748 | Ga0496126_0216461 | 3300048929 | Bacteria | 1611 |
| 749 | Ga0495682_0099429 | 3300049460 | Bacteria | 1043 |
| 750 | Ga0501032_0050900 | 3300049569 | Bacteria | 2793 |
| 751 | Ga0501033_0141713 | 3300049570 | Bacteria | 1737 |
| 752 | Ga0501036_0205855 | 3300049572 | Bacteria | 1654 |
| 753 | Ga0501037_0144704 | 3300049573 | Bacteria | 1700 |
| 754 | Ga0501038_0172198 | 3300049574 | Bacteria | 1751 |
| 755 | Ga0501039_0023343 | 3300049575 | Bacteria | 4748 |
| 756 | Ga0501039_0212880 | 3300049575 | Bacteria | 1520 |
| 757 | Ga0501040_0010938 | 3300049576 | Bacteria | 5935 |
| 758 | Ga0501041_0007647 | 3300049577 | Bacteria | 6346 |
| 759 | Ga0501042_0090331 | 3300049578 | Bacteria | 2198 |
| 760 | Ga0501043_0024532 | 3300049579 | Bacteria | 4732 |
| 761 | Ga0501043_0033989 | 3300049579 | Bacteria | 4011 |
| 762 | Ga0501048_0082653 | 3300049582 | Bacteria | 2266 |
| 763 | Ga0501068_0020221 | 3300049584 | Bacteria | 3876 |
| 764 | Ga0501071_0047599 | 3300049587 | Bacteria | 3081 |
| 765 | Ga0501072_0056896 | 3300049588 | Bacteria | 3081 |
| 766 | Ga0501073_0033574 | 3300049589 | Bacteria | 3653 |
| 767 | Ga0501075_0007243 | 3300049591 | Bacteria | 7690 |
| 768 | Ga0501076_0007427 | 3300049592 | Bacteria | 7978 |
| 769 | Ga0501076_0391098 | 3300049592 | Bacteria | 1143 |
| 770 | Ga0501077_0041950 | 3300049593 | Bacteria | 2912 |
| 771 | Ga0501079_0053796 | 3300049741 | Bacteria | 3105 |
| 772 | Ga0501080_0018823 | 3300049742 | Bacteria | 6395 |
| 773 | Ga0501081_0005665 | 3300049743 | Bacteria | 8083 |
| 774 | Ga0501083_0151715 | 3300049744 | Bacteria | 1517 |
| 775 | Ga0501035_0097682 | 3300049822 | Bacteria | 2579 |
| 776 | Ga0501045_0031338 | 3300049824 | Bacteria | 3851 |
| 777 | nmdc:mga03683_145360_c1 | 3300050489 | Bacteria | 1068 |
| 778 | nmdc:mga03683_3223_c1 | 3300050489 | Bacteria | 5220 |
| 779 | nmdc:mga03n38_448_c1 | 3300050490 | Bacteria | 10279 |
| 780 | nmdc:mga03n38_8403_c1 | 3300050490 | Bacteria | 3705 |
| 781 | nmdc:mga00v17_101476_c1 | 3300050491 | Bacteria | 1817 |
| 782 | nmdc:mga0yw44_104096_c1 | 3300050492 | Bacteria | 1811 |
| 783 | nmdc:mga0yw44_55403_c1 | 3300050492 | Bacteria | 2412 |
| 784 | nmdc:mga0k408_271842_c1 | 3300050493 | Bacteria | 1012 |
| 785 | nmdc:mga0k408_39071_c1 | 3300050493 | Bacteria | 2725 |
| 786 | nmdc:mga06z11_11791_c1 | 3300050494 | Bacteria | 3780 |
| 787 | nmdc:mga06z11_16094_c1 | 3300050494 | Bacteria | 3359 |
| 788 | nmdc:mga06z11_16892_c1 | 3300050494 | Bacteria | 3299 |
| 789 | nmdc:mga06z11_26154_c1 | 3300050494 | Bacteria | 2774 |
| 790 | nmdc:mga06z11_86105_c1 | 3300050494 | Bacteria | 1697 |
| 791 | nmdc:mga04h51_64006_c1 | 3300050495 | Bacteria | 1268 |
| 792 | nmdc:mga04h51_83459_c1 | 3300050495 | Bacteria | 1138 |
| 793 | nmdc:mga07m45_21914_c1 | 3300050496 | Bacteria | 3484 |
| 794 | nmdc:mga07m45_42134_c1 | 3300050496 | Bacteria | 2559 |
| 795 | nmdc:mga07m45_66106_c1 | 3300050496 | Bacteria | 2054 |
| 796 | nmdc:mga0qj67_83578_c1 | 3300050509 | Bacteria | 2559 |
| 797 | nmdc:mga06r32_153643_c1 | 3300050510 | Bacteria | 2281 |
| 798 | nmdc:mga06r32_166682_c1 | 3300050510 | Bacteria | 2186 |
| 799 | nmdc:mga06r32_349262_c1 | 3300050510 | Bacteria | 1464 |
| 800 | nmdc:mga08y16_231412_c1 | 3300050511 | Bacteria | 1911 |
| 801 | nmdc:mga08y16_298429_c1 | 3300050511 | Bacteria | 1661 |
| 802 | nmdc:mga08y16_378851_c1 | 3300050511 | Bacteria | 1450 |
| 803 | nmdc:mga08y16_4970_c1 | 3300050511 | Bacteria | 13898 |
| 804 | nmdc:mga0sz30_28196_c1 | 3300050516 | Bacteria | 2309 |
| 805 | nmdc:mga0sz30_33849_c1 | 3300050516 | Bacteria | 2125 |
| 806 | Ga0495601_0026489 | 3300053077 | Bacteria | 3580 |
| 807 | Ga0495601_0259974 | 3300053077 | Bacteria | 1133 |
| 808 | Ga0495612_0025418 | 3300053078 | Bacteria | 2377 |
| 809 | Ga0500635_0030865 | 3300053080 | Bacteria | 1731 |
| 810 | Ga0500635_0044516 | 3300053080 | Bacteria | 1498 |
| 811 | Ga0495655_0030398 | 3300053083 | Bacteria | 1306 |
| 812 | Ga0495595_0001351 | 3300053084 | Bacteria | 9525 |
| 813 | Ga0495619_0001695 | 3300053085 | Bacteria | 14587 |
| 814 | Ga0495619_0106527 | 3300053085 | Bacteria | 1912 |
| 815 | Ga0500578_0082245 | 3300053086 | Bacteria | 2047 |
| 816 | Ga0500578_0115128 | 3300053086 | Bacteria | 1693 |
| 817 | Ga0500578_0137605 | 3300053086 | Bacteria | 1528 |
| 818 | Ga0500643_000180 | 3300053087 | Bacteria | 61907 |
| 819 | Ga0500643_036936 | 3300053087 | Bacteria | 1457 |
| 820 | Ga0500581_133791 | 3300053089 | Bacteria | 1183 |
| 821 | Ga0500583_0076954 | 3300053092 | Bacteria | 1605 |
| 822 | Ga0500583_0144694 | 3300053092 | Bacteria | 1182 |
| 823 | Ga0500566_0003442 | 3300053094 | Bacteria | 9438 |
| 824 | Ga0500566_0004614 | 3300053094 | Bacteria | 8202 |
| 825 | Ga0500566_0005672 | 3300053094 | Bacteria | 7420 |
| 826 | Ga0500640_005231 | 3300053095 | Bacteria | 4812 |
| 827 | Ga0500641_0006262 | 3300053096 | Bacteria | 4221 |
| 828 | Ga0500641_0038405 | 3300053096 | Bacteria | 1924 |
| 829 | Ga0500554_027341 | 3300053102 | Bacteria | 1648 |
| 830 | Ga0500556_0049725 | 3300053104 | Bacteria | 1512 |
| 831 | Ga0500557_000046 | 3300053105 | Bacteria | 59508 |
| 832 | Ga0500562_003205 | 3300053108 | Bacteria | 4078 |
| 833 | Ga0500562_030257 | 3300053108 | Bacteria | 1426 |
| 834 | Ga0500572_004446 | 3300053111 | Bacteria | 3179 |
| 835 | Ga0500594_0015624 | 3300053118 | Bacteria | 1833 |
| 836 | Ga0500595_000615 | 3300053119 | Bacteria | 21276 |
| 837 | Ga0500595_001062 | 3300053119 | Bacteria | 15299 |
| 838 | Ga0500595_006544 | 3300053119 | Bacteria | 4930 |
| 839 | Ga0500595_011027 | 3300053119 | Bacteria | 3561 |
| 840 | Ga0500595_031388 | 3300053119 | Bacteria | 1783 |
| 841 | Ga0500595_036174 | 3300053119 | Bacteria | 1620 |
| 842 | Ga0500621_073463 | 3300053126 | Bacteria | 1377 |
| 843 | Ga0500626_066857 | 3300053128 | Bacteria | 1603 |
| 844 | Ga0500642_0000038 | 3300053130 | Bacteria | 98299 |
| 845 | Ga0500642_0011795 | 3300053130 | Bacteria | 3142 |
| 846 | Ga0500642_0119061 | 3300053130 | Bacteria | 1234 |
| 847 | Ga0500559_0005719 | 3300053136 | Bacteria | 5684 |
| 848 | Ga0500568_0006530 | 3300053139 | Bacteria | 5843 |
| 849 | Ga0500590_058173 | 3300053148 | Bacteria | 1948 |
| 850 | Ga0500603_001321 | 3300053150 | Bacteria | 5680 |
| 851 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 852 | Ga0500616_0011113 | 3300053153 | Bacteria | 5345 |
| 853 | Ga0500616_0014341 | 3300053153 | Bacteria | 4557 |
| 854 | Ga0500622_0026880 | 3300053156 | Bacteria | 3034 |
| 855 | Ga0500630_033291 | 3300053159 | Bacteria | 2528 |
| 856 | Ga0500634_0021323 | 3300053161 | Bacteria | 3511 |
| 857 | Ga0500638_015298 | 3300053162 | Bacteria | 3516 |
| 858 | Ga0500639_000125 | 3300053163 | Bacteria | 36885 |
| 859 | Ga0500639_049653 | 3300053163 | Bacteria | 2188 |
| 860 | Ga0500636_0005096 | 3300053177 | Bacteria | 7460 |
| 861 | Ga0500636_0054320 | 3300053177 | Bacteria | 2348 |
| 862 | Ga0500637_0000445 | 3300053178 | Bacteria | 15850 |
| 863 | Ga0500637_0015830 | 3300053178 | Bacteria | 4007 |
| 864 | Ga0500625_003345 | 3300053729 | Bacteria | 6318 |
| 865 | Ga0500609_001963 | 3300053731 | Bacteria | 2969 |
| 866 | Ga0500596_002626 | 3300053735 | Bacteria | 3528 |
| 867 | Ga0500601_000170 | 3300053737 | Bacteria | 13475 |
| 868 | Ga0501084_0053012 | 3300054114 | Bacteria | 3393 |
| 869 | Ga0501084_0158770 | 3300054114 | Bacteria | 1908 |
| 870 | Ga0500661_000331 | 3300055283 | Bacteria | 8597 |
| 871 | Ga0501082_0021916 | 3300060353 | Bacteria | 5507 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_145360_c1 | nmdc:mga03683_145360_c1_131_1021 | 279 |
| 2 | 3300048904 | Ga0496101_0448082 | Ga0496101_0448082_27_875 | 280 |
| 3 | 3300050493 | nmdc:mga0k408_271842_c1 | nmdc:mga0k408_271842_c1_67_957 | 282 |
| 4 | 3300025315 | Ga0207697_10039196 | Ga0207697_100391962 | 292 |
| 5 | 3300031241 | Ga0265325_10002323 | Ga0265325_100023233 | 292 |
| 6 | 3300053119 | Ga0500595_036174 | Ga0500595_036174_716_1606 | 292 |
| 7 | 3300035172 | Ga0373955_0282663 | Ga0373955_0282663_22_903 | 293 |
| 8 | 3300035241 | Ga0373961_0106377 | Ga0373961_0106377_12_893 | 293 |
| 9 | 3300035695 | Ga0373927_0344767 | Ga0373927_0344767_72_953 | 293 |
| 10 | 3300046533 | Ga0495640_0140585 | Ga0495640_0140585_62_943 | 293 |
| 11 | 3300047315 | Ga0495581_0199949 | Ga0495581_0199949_222_1103 | 293 |
| 12 | 3300048906 | Ga0496103_0057689 | Ga0496103_0057689_1509_2390 | 293 |
| 13 | 3300048907 | Ga0496104_0398523 | Ga0496104_0398523_395_1276 | 293 |
| 14 | 3300048909 | Ga0496106_0365910 | Ga0496106_0365910_59_940 | 293 |
| 15 | 3300048911 | Ga0496108_0511472 | Ga0496108_0511472_154_1035 | 293 |
| 16 | 3300053086 | Ga0500578_0082245 | Ga0500578_0082245_62_943 | 293 |
| 17 | 3300009148 | Ga0105243_10341412 | Ga0105243_103414121 | 294 |
| 18 | 3300006195 | Ga0075366_10182446 | Ga0075366_101824461 | 296 |
| 19 | 3300027360 | Ga0209969_1002107 | Ga0209969_10021072 | 296 |
| 20 | 3300027462 | Ga0210000_1000508 | Ga0210000_10005082 | 296 |
| 21 | 3300027471 | Ga0209995_1002427 | Ga0209995_10024273 | 296 |
| 22 | 3300027543 | Ga0209999_1004186 | Ga0209999_10041863 | 296 |
| 23 | 3300031548 | Ga0307408_100241512 | Ga0307408_1002415122 | 296 |
| 24 | 3300009098 | Ga0105245_10091933 | Ga0105245_100919333 | 297 |
| 25 | 3300009176 | Ga0105242_10061390 | Ga0105242_100613904 | 297 |
| 26 | 3300025922 | Ga0207646_10180585 | Ga0207646_101805853 | 297 |
| 27 | 3300042156 | Ga0439446_0017631 | Ga0439446_0017631_379_1347 | 297 |
| 28 | 3300042435 | Ga0439434_0004260 | Ga0439434_0004260_2433_3401 | 297 |
| 29 | 3300042436 | Ga0439435_0001020 | Ga0439435_0001020_1348_2316 | 297 |
| 30 | 3300048912 | Ga0496109_0330078 | Ga0496109_0330078_28_1014 | 298 |
| 31 | 3300048913 | Ga0496110_0148096 | Ga0496110_0148096_413_1399 | 298 |
| 32 | 3300049592 | Ga0501076_0391098 | Ga0501076_0391098_35_1021 | 298 |
| 33 | 3300053126 | Ga0500621_073463 | Ga0500621_073463_14_982 | 298 |
| 34 | 3300053148 | Ga0500590_058173 | Ga0500590_058173_17_985 | 298 |
| 35 | iso_pu_bacteria | 8016603502 | 8016607675 | 298 |
| 36 | iso_pu_bacteria | 2847939898 | 2847943386 | 299 |
| 37 | 3300009177 | Ga0105248_10009064 | Ga0105248_1000906412 | 300 |
| 38 | 3300028381 | Ga0268264_10053083 | Ga0268264_100530832 | 300 |
| 39 | 3300035691 | Ga0373931_0019707 | Ga0373931_0019707_1590_2495 | 300 |
| 40 | 3300048909 | Ga0496106_0131628 | Ga0496106_0131628_1026_1952 | 300 |
| 41 | 3300048910 | Ga0496107_0052219 | Ga0496107_0052219_727_1632 | 300 |
| 42 | 3300048915 | Ga0496112_0124651 | Ga0496112_0124651_939_1844 | 300 |
| 43 | 3300048916 | Ga0496113_0247750 | Ga0496113_0247750_247_1152 | 300 |
| 44 | 3300048918 | Ga0496115_0016513 | Ga0496115_0016513_4176_5081 | 300 |
| 45 | 3300003215 | JGI25153J46596_10026895 | JGI25153J46596_100268952 | 301 |
| 46 | 3300005327 | Ga0070658_10007681 | Ga0070658_100076813 | 301 |
| 47 | 3300005548 | Ga0070665_100068737 | Ga0070665_1000687374 | 301 |
| 48 | 3300005548 | Ga0070665_100371796 | Ga0070665_1003717961 | 301 |
| 49 | 3300005564 | Ga0070664_100178810 | Ga0070664_1001788101 | 301 |
| 50 | 3300005616 | Ga0068852_100560589 | Ga0068852_1005605892 | 301 |
| 51 | 3300006051 | Ga0075364_10213157 | Ga0075364_102131572 | 301 |
| 52 | 3300010375 | Ga0105239_10570913 | Ga0105239_105709132 | 301 |
| 53 | 3300025297 | Ga0209758_1017145 | Ga0209758_10171451 | 301 |
| 54 | 3300025299 | Ga0209256_1004815 | Ga0209256_10048154 | 301 |
| 55 | 3300025972 | Ga0207668_10184701 | Ga0207668_101847011 | 301 |
| 56 | 3300026088 | Ga0207641_10273472 | Ga0207641_102734722 | 301 |
| 57 | 3300028379 | Ga0268266_10259661 | Ga0268266_102596611 | 301 |
| 58 | 3300041507 | Ga0451851_0758436 | Ga0451851_0758436_103_1086 | 301 |
| 59 | 3300042438 | Ga0439459_0007728 | Ga0439459_0007728_330_1319 | 301 |
| 60 | 3300046459 | Ga0495629_0145279 | Ga0495629_0145279_283_1344 | 301 |
| 61 | 3300048924 | Ga0496121_0099229 | Ga0496121_0099229_813_1802 | 301 |
| 62 | 3300053105 | Ga0500557_000046 | Ga0500557_000046_14829_15812 | 301 |
| 63 | 3300053130 | Ga0500642_0000038 | Ga0500642_0000038_68653_69636 | 301 |
| 64 | 3300053729 | Ga0500625_003345 | Ga0500625_003345_1650_2633 | 301 |
| 65 | 3300005937 | Ga0081455_10013731 | Ga0081455_100137312 | 302 |
| 66 | 3300005983 | Ga0081540_1013509 | Ga0081540_10135093 | 302 |
| 67 | 3300006178 | Ga0075367_10211331 | Ga0075367_102113311 | 302 |
| 68 | 3300032005 | Ga0307411_10088911 | Ga0307411_100889111 | 302 |
| 69 | 3300032005 | Ga0307411_10425833 | Ga0307411_104258331 | 302 |
| 70 | 3300045051 | Ga0451576_0017197 | Ga0451576_0017197_2991_3962 | 302 |
| 71 | 3300046452 | Ga0495617_006222 | Ga0495617_006222_3090_4079 | 302 |
| 72 | 3300046460 | Ga0495638_0030773 | Ga0495638_0030773_1242_2231 | 302 |
| 73 | 3300046519 | Ga0495632_0043888 | Ga0495632_0043888_719_1708 | 302 |
| 74 | 3300046528 | Ga0495642_0021165 | Ga0495642_0021165_845_1834 | 302 |
| 75 | 3300046615 | Ga0495656_0014930 | Ga0495656_0014930_1034_2023 | 302 |
| 76 | 3300046616 | Ga0495668_0027456 | Ga0495668_0027456_970_1959 | 302 |
| 77 | 3300046660 | Ga0495625_0085058 | Ga0495625_0085058_121_1110 | 302 |
| 78 | 3300048924 | Ga0496121_0200554 | Ga0496121_0200554_372_1358 | 302 |
| 79 | 3300005616 | Ga0068852_100272757 | Ga0068852_1002727572 | 303 |
| 80 | 3300005937 | Ga0081455_10000875 | Ga0081455_1000087520 | 303 |
| 81 | 3300005983 | Ga0081540_1040637 | Ga0081540_10406374 | 303 |
| 82 | 3300005985 | Ga0081539_10001953 | Ga0081539_1000195325 | 303 |
| 83 | 3300006048 | Ga0075363_100104818 | Ga0075363_1001048181 | 303 |
| 84 | 3300006048 | Ga0075363_100169517 | Ga0075363_1001695171 | 303 |
| 85 | 3300025981 | Ga0207640_10177309 | Ga0207640_101773092 | 303 |
| 86 | 3300026142 | Ga0207698_10187316 | Ga0207698_101873162 | 303 |
| 87 | 3300028794 | Ga0307515_10075181 | Ga0307515_100751812 | 303 |
| 88 | 3300031507 | Ga0307509_10022374 | Ga0307509_100223742 | 303 |
| 89 | 3300046455 | Ga0495603_0021384 | Ga0495603_0021384_2695_3681 | 303 |
| 90 | 3300046499 | Ga0495594_0055155 | Ga0495594_0055155_328_1314 | 303 |
| 91 | 3300046616 | Ga0495668_0033297 | Ga0495668_0033297_1788_2774 | 303 |
| 92 | 3300048905 | Ga0496102_0151850 | Ga0496102_0151850_964_1950 | 303 |
| 93 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_30929_31927 | 303 |
| 94 | 3300003215 | JGI25153J46596_10000371 | JGI25153J46596_1000037118 | 304 |
| 95 | 3300003215 | JGI25153J46596_10000865 | JGI25153J46596_1000086516 | 304 |
| 96 | 3300003215 | JGI25153J46596_10006554 | JGI25153J46596_100065543 | 304 |
| 97 | 3300003354 | JGI25160J50197_1016398 | JGI25160J50197_10163983 | 304 |
| 98 | 3300003354 | JGI25160J50197_1019515 | JGI25160J50197_10195153 | 304 |
| 99 | 3300003794 | Ga0055531_10005980 | Ga0055531_100059807 | 304 |
| 100 | 3300005262 | Ga0065165_1001685 | Ga0065165_100168517 | 304 |
| 101 | 3300005262 | Ga0065165_1004072 | Ga0065165_10040727 | 304 |
| 102 | 3300005262 | Ga0065165_1008657 | Ga0065165_10086578 | 304 |
| 103 | 3300005331 | Ga0070670_100143455 | Ga0070670_1001434553 | 304 |
| 104 | 3300005334 | Ga0068869_100055491 | Ga0068869_1000554913 | 304 |
| 105 | 3300005334 | Ga0068869_100104948 | Ga0068869_1001049484 | 304 |
| 106 | 3300005338 | Ga0068868_100059787 | Ga0068868_1000597873 | 304 |
| 107 | 3300005344 | Ga0070661_100100294 | Ga0070661_1001002941 | 304 |
| 108 | 3300005347 | Ga0070668_100027647 | Ga0070668_1000276472 | 304 |
| 109 | 3300005347 | Ga0070668_100040165 | Ga0070668_1000401653 | 304 |
| 110 | 3300005347 | Ga0070668_100065858 | Ga0070668_1000658583 | 304 |
| 111 | 3300005347 | Ga0070668_100079103 | Ga0070668_1000791032 | 304 |
| 112 | 3300005347 | Ga0070668_100164455 | Ga0070668_1001644551 | 304 |
| 113 | 3300005355 | Ga0070671_100062490 | Ga0070671_1000624901 | 304 |
| 114 | 3300005355 | Ga0070671_100103241 | Ga0070671_1001032412 | 304 |
| 115 | 3300005367 | Ga0070667_100147878 | Ga0070667_1001478782 | 304 |
| 116 | 3300005455 | Ga0070663_100073675 | Ga0070663_1000736753 | 304 |
| 117 | 3300005457 | Ga0070662_100133704 | Ga0070662_1001337042 | 304 |
| 118 | 3300005459 | Ga0068867_100324475 | Ga0068867_1003244751 | 304 |
| 119 | 3300005466 | Ga0070685_10178696 | Ga0070685_101786961 | 304 |
| 120 | 3300005539 | Ga0068853_100073476 | Ga0068853_1000734763 | 304 |
| 121 | 3300005548 | Ga0070665_100023285 | Ga0070665_1000232854 | 304 |
| 122 | 3300005548 | Ga0070665_100227374 | Ga0070665_1002273742 | 304 |
| 123 | 3300005548 | Ga0070665_100370296 | Ga0070665_1003702961 | 304 |
| 124 | 3300005563 | Ga0068855_100033225 | Ga0068855_1000332255 | 304 |
| 125 | 3300005563 | Ga0068855_100222708 | Ga0068855_1002227083 | 304 |
| 126 | 3300005564 | Ga0070664_100223115 | Ga0070664_1002231151 | 304 |
| 127 | 3300005614 | Ga0068856_100105914 | Ga0068856_1001059143 | 304 |
| 128 | 3300005617 | Ga0068859_100049211 | Ga0068859_1000492115 | 304 |
| 129 | 3300005617 | Ga0068859_100139093 | Ga0068859_1001390932 | 304 |
| 130 | 3300005618 | Ga0068864_100032861 | Ga0068864_1000328612 | 304 |
| 131 | 3300005618 | Ga0068864_100072113 | Ga0068864_1000721133 | 304 |
| 132 | 3300005842 | Ga0068858_100021643 | Ga0068858_1000216433 | 304 |
| 133 | 3300005844 | Ga0068862_100045564 | Ga0068862_1000455643 | 304 |
| 134 | 3300005844 | Ga0068862_100143926 | Ga0068862_1001439262 | 304 |
| 135 | 3300005844 | Ga0068862_100210056 | Ga0068862_1002100562 | 304 |
| 136 | 3300005844 | Ga0068862_100249712 | Ga0068862_1002497121 | 304 |
| 137 | 3300005937 | Ga0081455_10001281 | Ga0081455_1000128128 | 304 |
| 138 | 3300005937 | Ga0081455_10037949 | Ga0081455_100379491 | 304 |
| 139 | 3300005937 | Ga0081455_10038108 | Ga0081455_100381087 | 304 |
| 140 | 3300005937 | Ga0081455_10070498 | Ga0081455_100704983 | 304 |
| 141 | 3300005981 | Ga0081538_10053586 | Ga0081538_100535862 | 304 |
| 142 | 3300005983 | Ga0081540_1005014 | Ga0081540_10050147 | 304 |
| 143 | 3300005983 | Ga0081540_1008353 | Ga0081540_10083536 | 304 |
| 144 | 3300005983 | Ga0081540_1020858 | Ga0081540_10208581 | 304 |
| 145 | 3300005983 | Ga0081540_1028891 | Ga0081540_10288913 | 304 |
| 146 | 3300005983 | Ga0081540_1039018 | Ga0081540_10390183 | 304 |
| 147 | 3300005983 | Ga0081540_1039050 | Ga0081540_10390503 | 304 |
| 148 | 3300006038 | Ga0075365_10023866 | Ga0075365_100238662 | 304 |
| 149 | 3300006038 | Ga0075365_10049111 | Ga0075365_100491113 | 304 |
| 150 | 3300006042 | Ga0075368_10015164 | Ga0075368_100151642 | 304 |
| 151 | 3300006042 | Ga0075368_10025165 | Ga0075368_100251654 | 304 |
| 152 | 3300006048 | Ga0075363_100021478 | Ga0075363_1000214783 | 304 |
| 153 | 3300006048 | Ga0075363_100033053 | Ga0075363_1000330532 | 304 |
| 154 | 3300006051 | Ga0075364_10142361 | Ga0075364_101423611 | 304 |
| 155 | 3300006051 | Ga0075364_10222364 | Ga0075364_102223641 | 304 |
| 156 | 3300006177 | Ga0075362_10019479 | Ga0075362_100194792 | 304 |
| 157 | 3300006178 | Ga0075367_10026687 | Ga0075367_100266873 | 304 |
| 158 | 3300006178 | Ga0075367_10067047 | Ga0075367_100670472 | 304 |
| 159 | 3300006178 | Ga0075367_10081245 | Ga0075367_100812451 | 304 |
| 160 | 3300006186 | Ga0075369_10018451 | Ga0075369_100184513 | 304 |
| 161 | 3300006186 | Ga0075369_10025257 | Ga0075369_100252573 | 304 |
| 162 | 3300006186 | Ga0075369_10129826 | Ga0075369_101298261 | 304 |
| 163 | 3300006195 | Ga0075366_10015948 | Ga0075366_100159485 | 304 |
| 164 | 3300006195 | Ga0075366_10024275 | Ga0075366_100242752 | 304 |
| 165 | 3300006195 | Ga0075366_10049459 | Ga0075366_100494593 | 304 |
| 166 | 3300006353 | Ga0075370_10171147 | Ga0075370_101711471 | 304 |
| 167 | 3300006358 | Ga0068871_100111287 | Ga0068871_1001112871 | 304 |
| 168 | 3300006844 | Ga0075428_100174356 | Ga0075428_1001743562 | 304 |
| 169 | 3300006881 | Ga0068865_100022835 | Ga0068865_1000228353 | 304 |
| 170 | 3300006931 | Ga0097620_100049210 | Ga0097620_1000492105 | 304 |
| 171 | 3300006931 | Ga0097620_100139090 | Ga0097620_1001390903 | 304 |
| 172 | 3300009094 | Ga0111539_10095964 | Ga0111539_100959642 | 304 |
| 173 | 3300009094 | Ga0111539_10406088 | Ga0111539_104060881 | 304 |
| 174 | 3300009148 | Ga0105243_10036179 | Ga0105243_100361794 | 304 |
| 175 | 3300009174 | Ga0105241_10040357 | Ga0105241_100403576 | 304 |
| 176 | 3300010375 | Ga0105239_10358191 | Ga0105239_103581912 | 304 |
| 177 | 3300010375 | Ga0105239_10536793 | Ga0105239_105367932 | 304 |
| 178 | 3300011119 | Ga0105246_10101669 | Ga0105246_101016692 | 304 |
| 179 | 3300011119 | Ga0105246_10108983 | Ga0105246_101089832 | 304 |
| 180 | 3300013306 | Ga0163162_10149339 | Ga0163162_101493392 | 304 |
| 181 | 3300014325 | Ga0163163_10006013 | Ga0163163_100060135 | 304 |
| 182 | 3300014326 | Ga0157380_10074749 | Ga0157380_100747493 | 304 |
| 183 | 3300014326 | Ga0157380_10125864 | Ga0157380_101258643 | 304 |
| 184 | 3300021320 | Ga0214544_1000003 | Ga0214544_1000003544 | 304 |
| 185 | 3300021320 | Ga0214544_1024221 | Ga0214544_10242212 | 304 |
| 186 | 3300021321 | Ga0214542_1000022 | Ga0214542_1000022114 | 304 |
| 187 | 3300021321 | Ga0214542_1021284 | Ga0214542_10212846 | 304 |
| 188 | 3300021324 | Ga0214545_1000010 | Ga0214545_100001069 | 304 |
| 189 | 3300021324 | Ga0214545_1019543 | Ga0214545_10195436 | 304 |
| 190 | 3300021327 | Ga0214543_1000035 | Ga0214543_1000035114 | 304 |
| 191 | 3300021327 | Ga0214543_1022474 | Ga0214543_10224742 | 304 |
| 192 | 3300025253 | Ga0209677_105299 | Ga0209677_1052994 | 304 |
| 193 | 3300025261 | Ga0209233_1005042 | Ga0209233_10050426 | 304 |
| 194 | 3300025297 | Ga0209758_1000106 | Ga0209758_100010653 | 304 |
| 195 | 3300025297 | Ga0209758_1000344 | Ga0209758_100034429 | 304 |
| 196 | 3300025297 | Ga0209758_1001326 | Ga0209758_100132625 | 304 |
| 197 | 3300025297 | Ga0209758_1009962 | Ga0209758_10099626 | 304 |
| 198 | 3300025297 | Ga0209758_1028430 | Ga0209758_10284301 | 304 |
| 199 | 3300025302 | Ga0207426_1007089 | Ga0207426_10070896 | 304 |
| 200 | 3300025302 | Ga0207426_1007145 | Ga0207426_10071453 | 304 |
| 201 | 3300025303 | Ga0209051_1038240 | Ga0209051_10382401 | 304 |
| 202 | 3300025304 | Ga0209257_1000819 | Ga0209257_100081934 | 304 |
| 203 | 3300025304 | Ga0209257_1007500 | Ga0209257_10075004 | 304 |
| 204 | 3300025315 | Ga0207697_10111107 | Ga0207697_101111071 | 304 |
| 205 | 3300025899 | Ga0207642_10033579 | Ga0207642_100335793 | 304 |
| 206 | 3300025901 | Ga0207688_10096405 | Ga0207688_100964052 | 304 |
| 207 | 3300025904 | Ga0207647_10003565 | Ga0207647_100035653 | 304 |
| 208 | 3300025907 | Ga0207645_10210274 | Ga0207645_102102741 | 304 |
| 209 | 3300025908 | Ga0207643_10074007 | Ga0207643_100740071 | 304 |
| 210 | 3300025911 | Ga0207654_10003986 | Ga0207654_100039861 | 304 |
| 211 | 3300025924 | Ga0207694_10111879 | Ga0207694_101118792 | 304 |
| 212 | 3300025931 | Ga0207644_10243911 | Ga0207644_102439113 | 304 |
| 213 | 3300025932 | Ga0207690_10130804 | Ga0207690_101308041 | 304 |
| 214 | 3300025933 | Ga0207706_10078282 | Ga0207706_100782823 | 304 |
| 215 | 3300025933 | Ga0207706_10131828 | Ga0207706_101318281 | 304 |
| 216 | 3300025935 | Ga0207709_10022456 | Ga0207709_100224564 | 304 |
| 217 | 3300025935 | Ga0207709_10026424 | Ga0207709_100264244 | 304 |
| 218 | 3300025935 | Ga0207709_10041668 | Ga0207709_100416683 | 304 |
| 219 | 3300025937 | Ga0207669_10147193 | Ga0207669_101471932 | 304 |
| 220 | 3300025938 | Ga0207704_10035898 | Ga0207704_100358981 | 304 |
| 221 | 3300025940 | Ga0207691_10036011 | Ga0207691_100360111 | 304 |
| 222 | 3300025942 | Ga0207689_10014451 | Ga0207689_100144513 | 304 |
| 223 | 3300025945 | Ga0207679_10030648 | Ga0207679_100306483 | 304 |
| 224 | 3300025945 | Ga0207679_10115694 | Ga0207679_101156942 | 304 |
| 225 | 3300025972 | Ga0207668_10010865 | Ga0207668_100108653 | 304 |
| 226 | 3300025972 | Ga0207668_10014836 | Ga0207668_100148365 | 304 |
| 227 | 3300025972 | Ga0207668_10030991 | Ga0207668_100309912 | 304 |
| 228 | 3300025972 | Ga0207668_10099992 | Ga0207668_100999923 | 304 |
| 229 | 3300026023 | Ga0207677_10043343 | Ga0207677_100433435 | 304 |
| 230 | 3300026067 | Ga0207678_10046790 | Ga0207678_100467903 | 304 |
| 231 | 3300026067 | Ga0207678_10049637 | Ga0207678_100496372 | 304 |
| 232 | 3300026067 | Ga0207678_10064611 | Ga0207678_100646111 | 304 |
| 233 | 3300026067 | Ga0207678_10296903 | Ga0207678_102969031 | 304 |
| 234 | 3300026078 | Ga0207702_10282267 | Ga0207702_102822673 | 304 |
| 235 | 3300026089 | Ga0207648_10085382 | Ga0207648_100853823 | 304 |
| 236 | 3300026089 | Ga0207648_10107966 | Ga0207648_101079662 | 304 |
| 237 | 3300026095 | Ga0207676_10011441 | Ga0207676_100114416 | 304 |
| 238 | 3300026095 | Ga0207676_10019822 | Ga0207676_100198224 | 304 |
| 239 | 3300026121 | Ga0207683_10046736 | Ga0207683_100467362 | 304 |
| 240 | 3300027296 | Ga0209389_1000016 | Ga0209389_1000016156 | 304 |
| 241 | 3300027361 | Ga0209489_100063 | Ga0209489_100063114 | 304 |
| 242 | 3300027363 | Ga0209700_100012 | Ga0209700_100012157 | 304 |
| 243 | 3300028379 | Ga0268266_10014838 | Ga0268266_100148387 | 304 |
| 244 | 3300028379 | Ga0268266_10158756 | Ga0268266_101587563 | 304 |
| 245 | 3300028379 | Ga0268266_10288308 | Ga0268266_102883082 | 304 |
| 246 | 3300028380 | Ga0268265_10027240 | Ga0268265_100272403 | 304 |
| 247 | 3300028380 | Ga0268265_10087904 | Ga0268265_100879043 | 304 |
| 248 | 3300028786 | Ga0307517_10000176 | Ga0307517_10000176102 | 304 |
| 249 | 3300031456 | Ga0307513_10142183 | Ga0307513_101421833 | 304 |
| 250 | 3300031548 | Ga0307408_100103483 | Ga0307408_1001034832 | 304 |
| 251 | 3300031616 | Ga0307508_10046720 | Ga0307508_100467204 | 304 |
| 252 | 3300032126 | Ga0307415_100110411 | Ga0307415_1001104113 | 304 |
| 253 | 3300033180 | Ga0307510_10007730 | Ga0307510_100077307 | 304 |
| 254 | 3300033180 | Ga0307510_10020603 | Ga0307510_1002060313 | 304 |
| 255 | 3300035114 | Ga0373939_0063301 | Ga0373939_0063301_149_1138 | 304 |
| 256 | 3300037418 | Ga0395900_0447228 | Ga0395900_0447228_241_1230 | 304 |
| 257 | 3300037466 | Ga0395898_0037345 | Ga0395898_0037345_3311_4297 | 304 |
| 258 | 3300037471 | Ga0395905_0103258 | Ga0395905_0103258_1158_2144 | 304 |
| 259 | 3300044658 | Ga0466972_0000179 | Ga0466972_0000179_42058_43044 | 304 |
| 260 | 3300046455 | Ga0495603_0055227 | Ga0495603_0055227_68_1057 | 304 |
| 261 | 3300046455 | Ga0495603_0160008 | Ga0495603_0160008_62_1051 | 304 |
| 262 | 3300046460 | Ga0495638_0001078 | Ga0495638_0001078_15578_16567 | 304 |
| 263 | 3300046492 | Ga0495585_0037502 | Ga0495585_0037502_1322_2311 | 304 |
| 264 | 3300046515 | Ga0495620_0058506 | Ga0495620_0058506_35_1024 | 304 |
| 265 | 3300046518 | Ga0495631_0105821 | Ga0495631_0105821_160_1149 | 304 |
| 266 | 3300046522 | Ga0495643_0060867 | Ga0495643_0060867_693_1679 | 304 |
| 267 | 3300046542 | Ga0495597_0110835 | Ga0495597_0110835_150_1139 | 304 |
| 268 | 3300046615 | Ga0495656_0027175 | Ga0495656_0027175_1274_2263 | 304 |
| 269 | 3300046648 | Ga0495611_0044668 | Ga0495611_0044668_529_1518 | 304 |
| 270 | 3300046648 | Ga0495611_0097200 | Ga0495611_0097200_100_1089 | 304 |
| 271 | 3300046674 | Ga0495588_0140974 | Ga0495588_0140974_132_1121 | 304 |
| 272 | 3300046684 | Ga0495669_0033559 | Ga0495669_0033559_751_1740 | 304 |
| 273 | 3300046794 | Ga0495589_0049304 | Ga0495589_0049304_752_1741 | 304 |
| 274 | 3300047446 | Ga0495679_053256 | Ga0495679_053256_82_1071 | 304 |
| 275 | 3300047469 | Ga0495673_0042339 | Ga0495673_0042339_526_1515 | 304 |
| 276 | 3300047469 | Ga0495673_0090072 | Ga0495673_0090072_164_1153 | 304 |
| 277 | 3300048090 | Ga0495615_0012801 | Ga0495615_0012801_67_1056 | 304 |
| 278 | 3300048090 | Ga0495615_0036565 | Ga0495615_0036565_31_1020 | 304 |
| 279 | 3300048905 | Ga0496102_0202316 | Ga0496102_0202316_753_1742 | 304 |
| 280 | 3300048907 | Ga0496104_0041576 | Ga0496104_0041576_3223_4212 | 304 |
| 281 | 3300048907 | Ga0496104_0132565 | Ga0496104_0132565_128_1117 | 304 |
| 282 | 3300048908 | Ga0496105_0007262 | Ga0496105_0007262_331_1317 | 304 |
| 283 | 3300048908 | Ga0496105_0044074 | Ga0496105_0044074_2274_3263 | 304 |
| 284 | 3300048910 | Ga0496107_0224243 | Ga0496107_0224243_16_1005 | 304 |
| 285 | 3300048911 | Ga0496108_0039050 | Ga0496108_0039050_2112_3101 | 304 |
| 286 | 3300048911 | Ga0496108_0207552 | Ga0496108_0207552_21_1019 | 304 |
| 287 | 3300048912 | Ga0496109_0021350 | Ga0496109_0021350_3230_4216 | 304 |
| 288 | 3300048915 | Ga0496112_0154761 | Ga0496112_0154761_1257_2246 | 304 |
| 289 | 3300048916 | Ga0496113_0213124 | Ga0496113_0213124_526_1515 | 304 |
| 290 | 3300048917 | Ga0496114_0061283 | Ga0496114_0061283_1710_2699 | 304 |
| 291 | 3300048917 | Ga0496114_0125156 | Ga0496114_0125156_669_1658 | 304 |
| 292 | 3300048921 | Ga0496118_0037250 | Ga0496118_0037250_213_1262 | 304 |
| 293 | 3300048921 | Ga0496118_0053748 | Ga0496118_0053748_394_1383 | 304 |
| 294 | 3300048922 | Ga0496119_0084115 | Ga0496119_0084115_268_1254 | 304 |
| 295 | 3300048922 | Ga0496119_0093768 | Ga0496119_0093768_266_1255 | 304 |
| 296 | 3300048923 | Ga0496120_0027756 | Ga0496120_0027756_469_1458 | 304 |
| 297 | 3300048924 | Ga0496121_0011996 | Ga0496121_0011996_5833_6822 | 304 |
| 298 | 3300048924 | Ga0496121_0078769 | Ga0496121_0078769_1056_2153 | 304 |
| 299 | 3300048924 | Ga0496121_0083299 | Ga0496121_0083299_1136_2125 | 304 |
| 300 | 3300048927 | Ga0496124_0181722 | Ga0496124_0181722_533_1519 | 304 |
| 301 | 3300048928 | Ga0496125_0109206 | Ga0496125_0109206_941_1927 | 304 |
| 302 | 3300048929 | Ga0496126_0060475 | Ga0496126_0060475_569_1558 | 304 |
| 303 | 3300049460 | Ga0495682_0099429 | Ga0495682_0099429_33_1031 | 304 |
| 304 | 3300050490 | nmdc:mga03n38_448_c1 | nmdc:mga03n38_448_c1_3840_4829 | 304 |
| 305 | 3300050492 | nmdc:mga0yw44_104096_c1 | nmdc:mga0yw44_104096_c1_548_1537 | 304 |
| 306 | 3300050494 | nmdc:mga06z11_11791_c1 | nmdc:mga06z11_11791_c1_1763_2752 | 304 |
| 307 | 3300050494 | nmdc:mga06z11_16892_c1 | nmdc:mga06z11_16892_c1_658_1647 | 304 |
| 308 | 3300050494 | nmdc:mga06z11_26154_c1 | nmdc:mga06z11_26154_c1_1608_2597 | 304 |
| 309 | 3300050496 | nmdc:mga07m45_21914_c1 | nmdc:mga07m45_21914_c1_1330_2319 | 304 |
| 310 | 3300050511 | nmdc:mga08y16_298429_c1 | nmdc:mga08y16_298429_c1_369_1358 | 304 |
| 311 | 3300050511 | nmdc:mga08y16_378851_c1 | nmdc:mga08y16_378851_c1_412_1401 | 304 |
| 312 | 3300050516 | nmdc:mga0sz30_28196_c1 | nmdc:mga0sz30_28196_c1_1181_2173 | 304 |
| 313 | 3300050516 | nmdc:mga0sz30_33849_c1 | nmdc:mga0sz30_33849_c1_1093_2079 | 304 |
| 314 | 3300053080 | Ga0500635_0030865 | Ga0500635_0030865_427_1416 | 304 |
| 315 | 3300053086 | Ga0500578_0137605 | Ga0500578_0137605_234_1223 | 304 |
| 316 | 3300053087 | Ga0500643_000180 | Ga0500643_000180_36760_37749 | 304 |
| 317 | 3300053087 | Ga0500643_036936 | Ga0500643_036936_114_1103 | 304 |
| 318 | 3300053089 | Ga0500581_133791 | Ga0500581_133791_71_1060 | 304 |
| 319 | 3300053092 | Ga0500583_0076954 | Ga0500583_0076954_187_1176 | 304 |
| 320 | 3300053092 | Ga0500583_0144694 | Ga0500583_0144694_83_1072 | 304 |
| 321 | 3300053094 | Ga0500566_0003442 | Ga0500566_0003442_2412_3398 | 304 |
| 322 | 3300053096 | Ga0500641_0006262 | Ga0500641_0006262_63_1052 | 304 |
| 323 | 3300053104 | Ga0500556_0049725 | Ga0500556_0049725_245_1234 | 304 |
| 324 | 3300053108 | Ga0500562_003205 | Ga0500562_003205_1041_2030 | 304 |
| 325 | 3300053119 | Ga0500595_006544 | Ga0500595_006544_916_1905 | 304 |
| 326 | 3300053128 | Ga0500626_066857 | Ga0500626_066857_403_1389 | 304 |
| 327 | 3300053130 | Ga0500642_0119061 | Ga0500642_0119061_22_1011 | 304 |
| 328 | 3300053153 | Ga0500616_0014341 | Ga0500616_0014341_561_1550 | 304 |
| 329 | 3300053156 | Ga0500622_0026880 | Ga0500622_0026880_136_1125 | 304 |
| 330 | 3300053177 | Ga0500636_0005096 | Ga0500636_0005096_5764_6750 | 304 |
| 331 | 3300053731 | Ga0500609_001963 | Ga0500609_001963_1847_2836 | 304 |
| 332 | 3300053737 | Ga0500601_000170 | Ga0500601_000170_11244_12233 | 304 |
| 333 | 3300003659 | JGI25404J52841_10005502 | JGI25404J52841_100055022 | 305 |
| 334 | 3300005614 | Ga0068856_100000046 | Ga0068856_10000004644 | 305 |
| 335 | 3300005983 | Ga0081540_1011111 | Ga0081540_10111115 | 305 |
| 336 | 3300006038 | Ga0075365_10163801 | Ga0075365_101638012 | 305 |
| 337 | 3300006177 | Ga0075362_10062560 | Ga0075362_100625602 | 305 |
| 338 | 3300006353 | Ga0075370_10041656 | Ga0075370_100416562 | 305 |
| 339 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014128 | 305 |
| 340 | 3300026121 | Ga0207683_10240885 | Ga0207683_102408852 | 305 |
| 341 | 3300031711 | Ga0265314_10007706 | Ga0265314_100077066 | 305 |
| 342 | 3300046473 | Ga0495582_0112943 | Ga0495582_0112943_127_1116 | 305 |
| 343 | 3300046475 | Ga0495639_0074969 | Ga0495639_0074969_348_1343 | 305 |
| 344 | 3300046524 | Ga0495648_0001411 | Ga0495648_0001411_10435_11433 | 305 |
| 345 | 3300048924 | Ga0496121_0096056 | Ga0496121_0096056_464_1453 | 305 |
| 346 | 3300048927 | Ga0496124_0025489 | Ga0496124_0025489_3744_4733 | 305 |
| 347 | iso_pu_bacteria | 8019648815 | 8019653500 | 305 |
| 348 | 3300006844 | Ga0075428_100043684 | Ga0075428_1000436845 | 306 |
| 349 | 3300006880 | Ga0075429_100037833 | Ga0075429_1000378333 | 306 |
| 350 | 3300009094 | Ga0111539_10019170 | Ga0111539_100191704 | 306 |
| 351 | 3300027907 | Ga0207428_10023941 | Ga0207428_100239414 | 306 |
| 352 | 3300050511 | nmdc:mga08y16_4970_c1 | nmdc:mga08y16_4970_c1_2443_3423 | 306 |
| 353 | 3300006048 | Ga0075363_100134361 | Ga0075363_1001343612 | 308 |
| 354 | 3300006195 | Ga0075366_10153162 | Ga0075366_101531622 | 308 |
| 355 | 3300006353 | Ga0075370_10101607 | Ga0075370_101016072 | 308 |
| 356 | 3300050491 | nmdc:mga00v17_101476_c1 | nmdc:mga00v17_101476_c1_579_1571 | 308 |
| 357 | 3300050494 | nmdc:mga06z11_86105_c1 | nmdc:mga06z11_86105_c1_108_1106 | 308 |
| 358 | 3300050495 | nmdc:mga04h51_83459_c1 | nmdc:mga04h51_83459_c1_82_1074 | 308 |
| 359 | 3300050496 | nmdc:mga07m45_42134_c1 | nmdc:mga07m45_42134_c1_252_1244 | 308 |
| 360 | 3300050496 | nmdc:mga07m45_66106_c1 | nmdc:mga07m45_66106_c1_797_1795 | 308 |
| 361 | 3300050511 | nmdc:mga08y16_231412_c1 | nmdc:mga08y16_231412_c1_197_1174 | 308 |
| 362 | 3300046492 | Ga0495585_0150073 | Ga0495585_0150073_241_1197 | 309 |
| 363 | iso_pu_bacteria | 8016522445 | 8016525022 | 309 |
| 364 | 3300053108 | Ga0500562_030257 | Ga0500562_030257_187_1179 | 310 |
| 365 | 3300005548 | Ga0070665_100078112 | Ga0070665_1000781123 | 311 |
| 366 | 3300028379 | Ga0268266_10160826 | Ga0268266_101608262 | 311 |
| 367 | 3300030521 | Ga0307511_10053634 | Ga0307511_100536342 | 311 |
| 368 | 3300005545 | Ga0070695_100064525 | Ga0070695_1000645253 | 313 |
| 369 | 3300005330 | Ga0070690_100246931 | Ga0070690_1002469311 | 314 |
| 370 | 3300005719 | Ga0068861_100209307 | Ga0068861_1002093072 | 314 |
| 371 | 3300005844 | Ga0068862_100112253 | Ga0068862_1001122532 | 314 |
| 372 | 3300006042 | Ga0075368_10007168 | Ga0075368_100071683 | 314 |
| 373 | 3300006178 | Ga0075367_10005197 | Ga0075367_100051973 | 314 |
| 374 | 3300006844 | Ga0075428_100031338 | Ga0075428_1000313383 | 314 |
| 375 | 3300006846 | Ga0075430_100032196 | Ga0075430_1000321963 | 314 |
| 376 | 3300025302 | Ga0207426_1000819 | Ga0207426_100081917 | 314 |
| 377 | 3300025972 | Ga0207668_10127790 | Ga0207668_101277903 | 314 |
| 378 | 3300026118 | Ga0207675_100127247 | Ga0207675_1001272472 | 314 |
| 379 | 3300027866 | Ga0209813_10006183 | Ga0209813_100061831 | 314 |
| 380 | 3300028380 | Ga0268265_10047819 | Ga0268265_100478193 | 314 |
| 381 | 3300031247 | Ga0265340_10011845 | Ga0265340_100118456 | 314 |
| 382 | 3300050490 | nmdc:mga03n38_8403_c1 | nmdc:mga03n38_8403_c1_534_1511 | 314 |
| 383 | 3300050494 | nmdc:mga06z11_16094_c1 | nmdc:mga06z11_16094_c1_2209_3186 | 314 |
| 384 | 3300050495 | nmdc:mga04h51_64006_c1 | nmdc:mga04h51_64006_c1_237_1214 | 314 |
| 385 | 3300050510 | nmdc:mga06r32_153643_c1 | nmdc:mga06r32_153643_c1_300_1304 | 314 |
| 386 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_188637_189635 | 314 |
| 387 | 3300003354 | JGI25160J50197_1000678 | JGI25160J50197_100067810 | 315 |
| 388 | 3300025924 | Ga0207694_10074304 | Ga0207694_100743044 | 315 |
| 389 | 3300026035 | Ga0207703_10231295 | Ga0207703_102312952 | 315 |
| 390 | 3300031730 | Ga0307516_10020012 | Ga0307516_100200122 | 315 |
| 391 | 3300048927 | Ga0496124_0045919 | Ga0496124_0045919_2722_3711 | 315 |
| 392 | 3300048928 | Ga0496125_0088394 | Ga0496125_0088394_338_1363 | 315 |
| 393 | iso_pu_bacteria | 2507262055 | 2507512028 | 315 |
| 394 | iso_pu_bacteria | 2508501009 | 2508545687 | 315 |
| 395 | iso_pu_bacteria | 2508501042 | 2508694509 | 315 |
| 396 | iso_pu_bacteria | 2515154112 | 2515624559 | 315 |
| 397 | iso_pu_bacteria | 2874590934 | 2874595798 | 315 |
| 398 | iso_pu_bacteria | 2874645413 | 2874651570 | 315 |
| 399 | iso_pu_bacteria | 2876771140 | 2876775995 | 315 |
| 400 | iso_pu_bacteria | 2876818435 | 2876821203 | 315 |
| 401 | iso_pu_bacteria | 2879074833 | 2879080084 | 315 |
| 402 | iso_pu_bacteria | 2879127579 | 2879132686 | 315 |
| 403 | iso_pu_bacteria | 2879142872 | 2879146471 | 315 |
| 404 | iso_pu_bacteria | 2935608549 | 2935613326 | 315 |
| 405 | iso_pu_bacteria | 2935648319 | 2935653796 | 315 |
| 406 | iso_pu_bacteria | 2935656913 | 2935662545 | 315 |
| 407 | iso_pu_bacteria | 2935769743 | 2935776372 | 315 |
| 408 | iso_pu_bacteria | 2935777560 | 2935784367 | 315 |
| 409 | iso_pu_bacteria | 2935785616 | 2935792403 | 315 |
| 410 | iso_pu_bacteria | 2935793552 | 2935800566 | 315 |
| 411 | iso_pu_bacteria | 2935819856 | 2935824820 | 315 |
| 412 | iso_pu_bacteria | 2935847175 | 2935852040 | 315 |
| 413 | iso_pu_bacteria | 2935908558 | 2935911387 | 315 |
| 414 | iso_pu_bacteria | 2935916978 | 2935920920 | 315 |
| 415 | iso_pu_bacteria | 2935926038 | 2935928416 | 315 |
| 416 | iso_pu_bacteria | 2935934488 | 2935938061 | 315 |
| 417 | iso_pu_bacteria | 2935942939 | 2935945343 | 315 |
| 418 | iso_pu_bacteria | 2935951376 | 2935954151 | 315 |
| 419 | iso_pu_bacteria | 2935959822 | 2935965974 | 315 |
| 420 | iso_pu_bacteria | 2935967501 | 2935971581 | 315 |
| 421 | iso_pu_bacteria | 2935975950 | 2935979978 | 315 |
| 422 | iso_pu_bacteria | 2935984226 | 2935989406 | 315 |
| 423 | iso_pu_bacteria | 2936011229 | 2936016807 | 315 |
| 424 | iso_pu_bacteria | 2936019824 | 2936025440 | 315 |
| 425 | iso_pu_bacteria | 2936028420 | 2936034322 | 315 |
| 426 | iso_pu_bacteria | 2936046547 | 2936052379 | 315 |
| 427 | iso_pu_bacteria | 2936055302 | 2936060659 | 315 |
| 428 | iso_pu_bacteria | 8016539877 | 8016542886 | 315 |
| 429 | iso_pu_bacteria | 8016548790 | 8016550403 | 315 |
| 430 | iso_pu_bacteria | 8016557553 | 8016558817 | 315 |
| 431 | iso_pu_bacteria | 8016566248 | 8016568277 | 315 |
| 432 | iso_pu_bacteria | 8016575299 | 8016580943 | 315 |
| 433 | iso_pu_bacteria | 8016595262 | 8016596785 | 315 |
| 434 | iso_pu_bacteria | 8016613128 | 8016619467 | 315 |
| 435 | iso_pu_bacteria | 8016630954 | 8016637027 | 315 |
| 436 | iso_pu_bacteria | 8019530166 | 8019538268 | 315 |
| 437 | iso_pu_bacteria | 8019538911 | 8019541709 | 315 |
| 438 | iso_pu_bacteria | 8019619141 | 8019623982 | 315 |
| 439 | iso_pu_bacteria | 8019638758 | 8019641585 | 315 |
| 440 | iso_pu_bacteria | 8019659431 | 8019665973 | 315 |
| 441 | iso_pu_bacteria | 8019668869 | 8019675491 | 315 |
| 442 | iso_pu_bacteria | 8019678201 | 8019680608 | 315 |
| 443 | iso_pu_bacteria | 8019687851 | 8019695153 | 315 |
| 444 | 3300005458 | Ga0070681_10096880 | Ga0070681_100968802 | 316 |
| 445 | 3300005539 | Ga0068853_100193905 | Ga0068853_1001939053 | 316 |
| 446 | 3300005563 | Ga0068855_100034345 | Ga0068855_1000343452 | 316 |
| 447 | 3300006846 | Ga0075430_100050201 | Ga0075430_1000502013 | 316 |
| 448 | 3300006847 | Ga0075431_100105259 | Ga0075431_1001052593 | 316 |
| 449 | 3300006880 | Ga0075429_100024575 | Ga0075429_1000245753 | 316 |
| 450 | 3300009147 | Ga0114129_10110710 | Ga0114129_101107103 | 316 |
| 451 | 3300013104 | Ga0157370_10042061 | Ga0157370_100420617 | 316 |
| 452 | 3300025917 | Ga0207660_10343450 | Ga0207660_103434501 | 316 |
| 453 | 3300025921 | Ga0207652_10177099 | Ga0207652_101770992 | 316 |
| 454 | 3300025949 | Ga0207667_10241755 | Ga0207667_102417552 | 316 |
| 455 | 3300028379 | Ga0268266_10132219 | Ga0268266_101322191 | 316 |
| 456 | 3300048924 | Ga0496121_0321808 | Ga0496121_0321808_18_1007 | 316 |
| 457 | 3300050510 | nmdc:mga06r32_349262_c1 | nmdc:mga06r32_349262_c1_32_1012 | 316 |
| 458 | 3300053094 | Ga0500566_0004614 | Ga0500566_0004614_2897_3886 | 316 |
| 459 | 3300053119 | Ga0500595_000615 | Ga0500595_000615_19790_20779 | 316 |
| 460 | 3300053161 | Ga0500634_0021323 | Ga0500634_0021323_996_1994 | 316 |
| 461 | 3300053162 | Ga0500638_015298 | Ga0500638_015298_2093_3082 | 316 |
| 462 | 3300053177 | Ga0500636_0054320 | Ga0500636_0054320_864_1853 | 316 |
| 463 | 3300053178 | Ga0500637_0000445 | Ga0500637_0000445_585_1574 | 316 |
| 464 | 3300055283 | Ga0500661_000331 | Ga0500661_000331_6004_6993 | 316 |
| 465 | iso_pu_bacteria | 2513237092 | 2513624583 | 316 |
| 466 | iso_pu_bacteria | 2513237095 | 2513650058 | 316 |
| 467 | iso_pu_bacteria | 2513237104 | 2513720202 | 316 |
| 468 | iso_pu_bacteria | 2513237139 | 2513874339 | 316 |
| 469 | iso_pu_bacteria | 2513237161 | 2514016834 | 316 |
| 470 | iso_pu_bacteria | 2517093001 | 2517104508 | 316 |
| 471 | iso_pu_bacteria | 2617270735 | 2617353127 | 316 |
| 472 | iso_pu_bacteria | 2617270741 | 2617374546 | 316 |
| 473 | iso_pu_bacteria | 2744054633 | 2745078369 | 316 |
| 474 | iso_pu_bacteria | 2791355196 | 2793059477 | 316 |
| 475 | iso_pu_bacteria | 2802429603 | 2805916106 | 316 |
| 476 | iso_pu_bacteria | 2816332527 | 2818242954 | 316 |
| 477 | iso_pu_bacteria | 2824600985 | 2824604499 | 316 |
| 478 | iso_pu_bacteria | 2824609381 | 2824614960 | 316 |
| 479 | iso_pu_bacteria | 2824653114 | 2824657517 | 316 |
| 480 | iso_pu_bacteria | 2824671348 | 2824673991 | 316 |
| 481 | iso_pu_bacteria | 2824696289 | 2824701377 | 316 |
| 482 | iso_pu_bacteria | 2824732956 | 2824736052 | 316 |
| 483 | iso_pu_bacteria | 2824746037 | 2824750678 | 316 |
| 484 | iso_pu_bacteria | 2824753945 | 2824761576 | 316 |
| 485 | iso_pu_bacteria | 2824763712 | 2824772114 | 316 |
| 486 | iso_pu_bacteria | 2824773399 | 2824778328 | 316 |
| 487 | iso_pu_bacteria | 2838122688 | 2838128544 | 316 |
| 488 | iso_pu_bacteria | 2841941048 | 2841942401 | 316 |
| 489 | iso_pu_bacteria | 2841949485 | 2841953253 | 316 |
| 490 | iso_pu_bacteria | 2841957949 | 2841960782 | 316 |
| 491 | iso_pu_bacteria | 2841966195 | 2841973858 | 316 |
| 492 | iso_pu_bacteria | 2841974524 | 2841982923 | 316 |
| 493 | iso_pu_bacteria | 2841983080 | 2841984417 | 316 |
| 494 | iso_pu_bacteria | 2842038055 | 2842041855 | 316 |
| 495 | iso_pu_bacteria | 2842045827 | 2842049898 | 316 |
| 496 | iso_pu_bacteria | 2847930680 | 2847932156 | 316 |
| 497 | iso_pu_bacteria | 2857509624 | 2857514597 | 316 |
| 498 | iso_pu_bacteria | 2874612657 | 2874614929 | 316 |
| 499 | iso_pu_bacteria | 2876761206 | 2876767580 | 316 |
| 500 | iso_pu_bacteria | 2879083081 | 2879089437 | 316 |
| 501 | iso_pu_bacteria | 2885366525 | 2885374583 | 316 |
| 502 | iso_pu_bacteria | 2885409591 | 2885414042 | 316 |
| 503 | iso_pu_bacteria | 2888378607 | 2888387548 | 316 |
| 504 | iso_pu_bacteria | 2888388044 | 2888391650 | 316 |
| 505 | iso_pu_bacteria | 2888419890 | 2888426771 | 316 |
| 506 | iso_pu_bacteria | 2904711408 | 2904713841 | 316 |
| 507 | iso_pu_bacteria | 2906643746 | 2906645729 | 316 |
| 508 | iso_pu_bacteria | 2908775508 | 2908777026 | 316 |
| 509 | iso_pu_bacteria | 2922393267 | 2922393417 | 316 |
| 510 | iso_pu_bacteria | 2932794094 | 2932796739 | 316 |
| 511 | iso_pu_bacteria | 2932801729 | 2932802481 | 316 |
| 512 | iso_pu_bacteria | 2935883170 | 2935887077 | 316 |
| 513 | iso_pu_bacteria | 3005506211 | 3005506746 | 316 |
| 514 | iso_pu_bacteria | 3005587118 | 3005588869 | 316 |
| 515 | iso_pu_bacteria | 8006926726 | 8006932163 | 316 |
| 516 | 3300005456 | Ga0070678_100048188 | Ga0070678_1000481883 | 317 |
| 517 | 3300005545 | Ga0070695_100108876 | Ga0070695_1001088761 | 317 |
| 518 | 3300005546 | Ga0070696_100017975 | Ga0070696_1000179753 | 317 |
| 519 | 3300005549 | Ga0070704_100018424 | Ga0070704_1000184243 | 317 |
| 520 | 3300005985 | Ga0081539_10036981 | Ga0081539_100369812 | 317 |
| 521 | 3300009148 | Ga0105243_10184435 | Ga0105243_101844353 | 317 |
| 522 | 3300009553 | Ga0105249_10115108 | Ga0105249_101151082 | 317 |
| 523 | 3300025941 | Ga0207711_10011210 | Ga0207711_100112109 | 317 |
| 524 | 3300025961 | Ga0207712_10029108 | Ga0207712_100291082 | 317 |
| 525 | 3300026121 | Ga0207683_10127390 | Ga0207683_101273902 | 317 |
| 526 | 3300048912 | Ga0496109_0014503 | Ga0496109_0014503_4634_5620 | 317 |
| 527 | 3300048914 | Ga0496111_0034817 | Ga0496111_0034817_349_1335 | 317 |
| 528 | 3300048917 | Ga0496114_0041961 | Ga0496114_0041961_2391_3377 | 317 |
| 529 | 3300049569 | Ga0501032_0050900 | Ga0501032_0050900_1594_2571 | 317 |
| 530 | 3300049570 | Ga0501033_0141713 | Ga0501033_0141713_127_1104 | 317 |
| 531 | 3300049572 | Ga0501036_0205855 | Ga0501036_0205855_37_1014 | 317 |
| 532 | 3300049573 | Ga0501037_0144704 | Ga0501037_0144704_103_1080 | 317 |
| 533 | 3300049574 | Ga0501038_0172198 | Ga0501038_0172198_196_1173 | 317 |
| 534 | 3300049575 | Ga0501039_0023343 | Ga0501039_0023343_3267_4244 | 317 |
| 535 | 3300049576 | Ga0501040_0010938 | Ga0501040_0010938_3354_4331 | 317 |
| 536 | 3300049577 | Ga0501041_0007647 | Ga0501041_0007647_3373_4350 | 317 |
| 537 | 3300049578 | Ga0501042_0090331 | Ga0501042_0090331_1189_2166 | 317 |
| 538 | 3300049579 | Ga0501043_0024532 | Ga0501043_0024532_1388_2365 | 317 |
| 539 | 3300049579 | Ga0501043_0033989 | Ga0501043_0033989_2344_3321 | 317 |
| 540 | 3300049582 | Ga0501048_0082653 | Ga0501048_0082653_990_1967 | 317 |
| 541 | 3300049584 | Ga0501068_0020221 | Ga0501068_0020221_565_1542 | 317 |
| 542 | 3300049587 | Ga0501071_0047599 | Ga0501071_0047599_1510_2487 | 317 |
| 543 | 3300049588 | Ga0501072_0056896 | Ga0501072_0056896_1951_2928 | 317 |
| 544 | 3300049589 | Ga0501073_0033574 | Ga0501073_0033574_892_1869 | 317 |
| 545 | 3300049591 | Ga0501075_0007243 | Ga0501075_0007243_3604_4581 | 317 |
| 546 | 3300049592 | Ga0501076_0007427 | Ga0501076_0007427_4697_5674 | 317 |
| 547 | 3300049593 | Ga0501077_0041950 | Ga0501077_0041950_217_1194 | 317 |
| 548 | 3300049741 | Ga0501079_0053796 | Ga0501079_0053796_1697_2674 | 317 |
| 549 | 3300049742 | Ga0501080_0018823 | Ga0501080_0018823_3450_4427 | 317 |
| 550 | 3300049743 | Ga0501081_0005665 | Ga0501081_0005665_4701_5678 | 317 |
| 551 | 3300049744 | Ga0501083_0151715 | Ga0501083_0151715_355_1332 | 317 |
| 552 | 3300049822 | Ga0501035_0097682 | Ga0501035_0097682_1177_2154 | 317 |
| 553 | 3300049824 | Ga0501045_0031338 | Ga0501045_0031338_2069_3046 | 317 |
| 554 | 3300054114 | Ga0501084_0053012 | Ga0501084_0053012_945_1922 | 317 |
| 555 | 3300060353 | Ga0501082_0021916 | Ga0501082_0021916_1384_2361 | 317 |
| 556 | iso_pu_bacteria | 2511231028 | 2511401323 | 317 |
| 557 | iso_pu_bacteria | 2513237096 | 2513655554 | 317 |
| 558 | iso_pu_bacteria | 2513237098 | 2513677192 | 317 |
| 559 | iso_pu_bacteria | 2513237137 | 2513859763 | 317 |
| 560 | iso_pu_bacteria | 2513237145 | 2513916368 | 317 |
| 561 | iso_pu_bacteria | 2517572143 | 2517890017 | 317 |
| 562 | iso_pu_bacteria | 2524023210 | 2524466324 | 317 |
| 563 | iso_pu_bacteria | 2524023228 | 2524534904 | 317 |
| 564 | iso_pu_bacteria | 2528768022 | 2528850236 | 317 |
| 565 | iso_pu_bacteria | 2721755755 | 2723842654 | 317 |
| 566 | iso_pu_bacteria | 2791355199 | 2793080475 | 317 |
| 567 | iso_pu_bacteria | 2824661429 | 2824669386 | 317 |
| 568 | iso_pu_bacteria | 2874604998 | 2874606671 | 317 |
| 569 | iso_pu_bacteria | 2874628541 | 2874630398 | 317 |
| 570 | iso_pu_bacteria | 2876808645 | 2876808730 | 317 |
| 571 | iso_pu_bacteria | 2879099564 | 2879106442 | 317 |
| 572 | iso_pu_bacteria | 2879110137 | 2879111994 | 317 |
| 573 | iso_pu_bacteria | 2885383462 | 2885388865 | 317 |
| 574 | iso_pu_bacteria | 2889033259 | 2889034050 | 317 |
| 575 | iso_pu_bacteria | 2903768456 | 2903772522 | 317 |
| 576 | iso_pu_bacteria | 2904690495 | 2904697648 | 317 |
| 577 | iso_pu_bacteria | 2904699407 | 2904710980 | 317 |
| 578 | iso_pu_bacteria | 2906635258 | 2906638432 | 317 |
| 579 | iso_pu_bacteria | 2906660503 | 2906663283 | 317 |
| 580 | iso_pu_bacteria | 2908756301 | 2908757755 | 317 |
| 581 | iso_pu_bacteria | 2922361189 | 2922367451 | 317 |
| 582 | iso_pu_bacteria | 2922368715 | 2922376523 | 317 |
| 583 | iso_pu_bacteria | 2922386360 | 2922389853 | 317 |
| 584 | iso_pu_bacteria | 2929615660 | 2929619972 | 317 |
| 585 | iso_pu_bacteria | 2929624759 | 2929629284 | 317 |
| 586 | iso_pu_bacteria | 2932784394 | 2932789587 | 317 |
| 587 | iso_pu_bacteria | 2932809354 | 2932814906 | 317 |
| 588 | iso_pu_bacteria | 2932818245 | 2932824238 | 317 |
| 589 | iso_pu_bacteria | 2932828146 | 2932834035 | 317 |
| 590 | iso_pu_bacteria | 2933577622 | 2933581890 | 317 |
| 591 | iso_pu_bacteria | 2935616580 | 2935623575 | 317 |
| 592 | iso_pu_bacteria | 2935638405 | 2935644962 | 317 |
| 593 | iso_pu_bacteria | 2935665750 | 2935672011 | 317 |
| 594 | iso_pu_bacteria | 2935675223 | 2935683061 | 317 |
| 595 | iso_pu_bacteria | 2935684952 | 2935689231 | 317 |
| 596 | iso_pu_bacteria | 2935694250 | 2935697510 | 317 |
| 597 | iso_pu_bacteria | 2935703347 | 2935711086 | 317 |
| 598 | iso_pu_bacteria | 2935713505 | 2935720177 | 317 |
| 599 | iso_pu_bacteria | 2935722832 | 2935728206 | 317 |
| 600 | iso_pu_bacteria | 2935732158 | 2935737197 | 317 |
| 601 | iso_pu_bacteria | 2935741537 | 2935746742 | 317 |
| 602 | iso_pu_bacteria | 2935750917 | 2935757709 | 317 |
| 603 | iso_pu_bacteria | 2935760218 | 2935764087 | 317 |
| 604 | iso_pu_bacteria | 2935801545 | 2935808675 | 317 |
| 605 | iso_pu_bacteria | 2935810662 | 2935817472 | 317 |
| 606 | iso_pu_bacteria | 2935827899 | 2935834192 | 317 |
| 607 | iso_pu_bacteria | 2935837841 | 2935844794 | 317 |
| 608 | iso_pu_bacteria | 2935855204 | 2935861818 | 317 |
| 609 | iso_pu_bacteria | 2935864058 | 2935868546 | 317 |
| 610 | iso_pu_bacteria | 2935873716 | 2935879320 | 317 |
| 611 | iso_pu_bacteria | 2935992306 | 2935998513 | 317 |
| 612 | iso_pu_bacteria | 2936002035 | 2936009027 | 317 |
| 613 | iso_pu_bacteria | 2936037263 | 2936044269 | 317 |
| 614 | iso_pu_bacteria | 2940556831 | 2940563469 | 317 |
| 615 | iso_pu_bacteria | 2941538514 | 2941545311 | 317 |
| 616 | iso_pu_bacteria | 3005710791 | 3005717325 | 317 |
| 617 | iso_pu_bacteria | 8006933436 | 8006937570 | 317 |
| 618 | iso_pu_bacteria | 8006964411 | 8006965961 | 317 |
| 619 | iso_pu_bacteria | 8006973647 | 8006977600 | 317 |
| 620 | iso_pu_bacteria | 8006984368 | 8006989911 | 317 |
| 621 | iso_pu_bacteria | 8006994254 | 8006998267 | 317 |
| 622 | iso_pu_bacteria | 8016511872 | 8016519316 | 317 |
| 623 | iso_pu_bacteria | 8017057580 | 8017066199 | 317 |
| 624 | iso_pu_bacteria | 8019576017 | 8019578428 | 317 |
| 625 | iso_pu_bacteria | 8019586578 | 8019596468 | 317 |
| 626 | iso_pu_bacteria | 8019597564 | 8019605233 | 317 |
| 627 | iso_pu_bacteria | 8019608314 | 8019613315 | 317 |
| 628 | iso_pu_bacteria | 8055742211 | 8055750276 | 317 |
| 629 | iso_pu_bacteria | 8056673599 | 8056677890 | 317 |
| 630 | iso_pu_bacteria | 8056681323 | 8056686054 | 317 |
| 631 | iso_pu_bacteria | 8056689827 | 8056695357 | 317 |
| 632 | 3300003215 | JGI25153J46596_10015409 | JGI25153J46596_100154093 | 318 |
| 633 | 3300005330 | Ga0070690_100023058 | Ga0070690_1000230582 | 318 |
| 634 | 3300005335 | Ga0070666_10345553 | Ga0070666_103455531 | 318 |
| 635 | 3300005336 | Ga0070680_100215949 | Ga0070680_1002159491 | 318 |
| 636 | 3300005340 | Ga0070689_100047251 | Ga0070689_1000472514 | 318 |
| 637 | 3300005355 | Ga0070671_100200995 | Ga0070671_1002009952 | 318 |
| 638 | 3300005456 | Ga0070678_100085113 | Ga0070678_1000851133 | 318 |
| 639 | 3300005530 | Ga0070679_100516046 | Ga0070679_1005160461 | 318 |
| 640 | 3300005841 | Ga0068863_100305745 | Ga0068863_1003057452 | 318 |
| 641 | 3300005843 | Ga0068860_100107190 | Ga0068860_1001071902 | 318 |
| 642 | 3300005937 | Ga0081455_10006371 | Ga0081455_100063719 | 318 |
| 643 | 3300005981 | Ga0081538_10056076 | Ga0081538_100560762 | 318 |
| 644 | 3300006175 | Ga0070712_100058029 | Ga0070712_1000580293 | 318 |
| 645 | 3300006177 | Ga0075362_10019134 | Ga0075362_100191342 | 318 |
| 646 | 3300006195 | Ga0075366_10047427 | Ga0075366_100474274 | 318 |
| 647 | 3300006844 | Ga0075428_100059241 | Ga0075428_1000592413 | 318 |
| 648 | 3300009177 | Ga0105248_10087017 | Ga0105248_100870174 | 318 |
| 649 | 3300009545 | Ga0105237_10041340 | Ga0105237_100413403 | 318 |
| 650 | 3300013306 | Ga0163162_10075484 | Ga0163162_100754842 | 318 |
| 651 | 3300014325 | Ga0163163_10056218 | Ga0163163_100562184 | 318 |
| 652 | 3300014969 | Ga0157376_10321201 | Ga0157376_103212011 | 318 |
| 653 | 3300025297 | Ga0209758_1000619 | Ga0209758_100061936 | 318 |
| 654 | 3300025905 | Ga0207685_10091678 | Ga0207685_100916781 | 318 |
| 655 | 3300025911 | Ga0207654_10057535 | Ga0207654_100575352 | 318 |
| 656 | 3300025915 | Ga0207693_10080795 | Ga0207693_100807953 | 318 |
| 657 | 3300025916 | Ga0207663_10137017 | Ga0207663_101370172 | 318 |
| 658 | 3300025918 | Ga0207662_10016112 | Ga0207662_100161125 | 318 |
| 659 | 3300025923 | Ga0207681_10065803 | Ga0207681_100658032 | 318 |
| 660 | 3300025931 | Ga0207644_10024492 | Ga0207644_100244924 | 318 |
| 661 | 3300025941 | Ga0207711_10005945 | Ga0207711_100059452 | 318 |
| 662 | 3300025972 | Ga0207668_10185070 | Ga0207668_101850702 | 318 |
| 663 | 3300026035 | Ga0207703_10081357 | Ga0207703_100813573 | 318 |
| 664 | 3300026121 | Ga0207683_10018049 | Ga0207683_100180495 | 318 |
| 665 | 3300026142 | Ga0207698_10293517 | Ga0207698_102935172 | 318 |
| 666 | 3300028381 | Ga0268264_10087570 | Ga0268264_100875703 | 318 |
| 667 | 3300031238 | Ga0265332_10071281 | Ga0265332_100712811 | 318 |
| 668 | 3300034816 | Ga0373930_0005629 | Ga0373930_0005629_612_1604 | 318 |
| 669 | 3300035085 | Ga0373929_0005434 | Ga0373929_0005434_634_1623 | 318 |
| 670 | 3300035242 | Ga0373962_0022693 | Ga0373962_0022693_585_1574 | 318 |
| 671 | 3300035691 | Ga0373931_0004821 | Ga0373931_0004821_4513_5502 | 318 |
| 672 | 3300037068 | Ga0373925_0332378 | Ga0373925_0332378_102_1103 | 318 |
| 673 | 3300042436 | Ga0439435_0029194 | Ga0439435_0029194_286_1272 | 318 |
| 674 | 3300046500 | Ga0495596_0074110 | Ga0495596_0074110_243_1235 | 318 |
| 675 | 3300048903 | Ga0496100_0083844 | Ga0496100_0083844_452_1441 | 318 |
| 676 | 3300048904 | Ga0496101_0068460 | Ga0496101_0068460_1063_2052 | 318 |
| 677 | 3300048907 | Ga0496104_0000812 | Ga0496104_0000812_18918_19904 | 318 |
| 678 | 3300048907 | Ga0496104_0001312 | Ga0496104_0001312_20461_21450 | 318 |
| 679 | 3300048912 | Ga0496109_0178337 | Ga0496109_0178337_130_1116 | 318 |
| 680 | 3300048914 | Ga0496111_0021899 | Ga0496111_0021899_1393_2382 | 318 |
| 681 | 3300048915 | Ga0496112_0119669 | Ga0496112_0119669_1021_2010 | 318 |
| 682 | 3300048915 | Ga0496112_0341230 | Ga0496112_0341230_80_1066 | 318 |
| 683 | 3300048916 | Ga0496113_0098949 | Ga0496113_0098949_552_1574 | 318 |
| 684 | 3300048917 | Ga0496114_0006660 | Ga0496114_0006660_1781_2770 | 318 |
| 685 | 3300048918 | Ga0496115_0102143 | Ga0496115_0102143_1016_2005 | 318 |
| 686 | 3300049575 | Ga0501039_0212880 | Ga0501039_0212880_474_1463 | 318 |
| 687 | 3300053077 | Ga0495601_0259974 | Ga0495601_0259974_46_1032 | 318 |
| 688 | 3300053096 | Ga0500641_0038405 | Ga0500641_0038405_437_1429 | 318 |
| 689 | 3300053119 | Ga0500595_031388 | Ga0500595_031388_733_1713 | 318 |
| 690 | 3300054114 | Ga0501084_0158770 | Ga0501084_0158770_371_1423 | 318 |
| 691 | 3300005354 | Ga0070675_100105651 | Ga0070675_1001056511 | 319 |
| 692 | 3300005983 | Ga0081540_1000055 | Ga0081540_1000055120 | 319 |
| 693 | 3300014325 | Ga0163163_10467790 | Ga0163163_104677901 | 319 |
| 694 | 3300014968 | Ga0157379_10058636 | Ga0157379_100586365 | 319 |
| 695 | 3300025926 | Ga0207659_10171187 | Ga0207659_101711872 | 319 |
| 696 | 3300025972 | Ga0207668_10138362 | Ga0207668_101383622 | 319 |
| 697 | 3300035111 | Ga0373923_0080726 | Ga0373923_0080726_377_1372 | 319 |
| 698 | 3300046459 | Ga0495629_0033029 | Ga0495629_0033029_149_1144 | 319 |
| 699 | 3300050489 | nmdc:mga03683_3223_c1 | nmdc:mga03683_3223_c1_2177_3163 | 319 |
| 700 | 3300053080 | Ga0500635_0044516 | Ga0500635_0044516_291_1304 | 319 |
| 701 | 3300005439 | Ga0070711_100005721 | Ga0070711_1000057215 | 320 |
| 702 | 3300006038 | Ga0075365_10026996 | Ga0075365_100269961 | 320 |
| 703 | 3300006173 | Ga0070716_100112173 | Ga0070716_1001121732 | 320 |
| 704 | 3300006175 | Ga0070712_100055917 | Ga0070712_1000559173 | 320 |
| 705 | 3300006178 | Ga0075367_10007145 | Ga0075367_100071452 | 320 |
| 706 | 3300006195 | Ga0075366_10005248 | Ga0075366_100052481 | 320 |
| 707 | 3300009093 | Ga0105240_10004093 | Ga0105240_1000409314 | 320 |
| 708 | 3300009148 | Ga0105243_10170264 | Ga0105243_101702641 | 320 |
| 709 | 3300009545 | Ga0105237_10008240 | Ga0105237_100082404 | 320 |
| 710 | 3300010375 | Ga0105239_10023758 | Ga0105239_100237586 | 320 |
| 711 | 3300013297 | Ga0157378_10015652 | Ga0157378_100156525 | 320 |
| 712 | 3300025272 | Ga0209455_1002543 | Ga0209455_10025435 | 320 |
| 713 | 3300025913 | Ga0207695_10000123 | Ga0207695_10000123178 | 320 |
| 714 | 3300025914 | Ga0207671_10002081 | Ga0207671_1000208114 | 320 |
| 715 | 3300025915 | Ga0207693_10005579 | Ga0207693_100055793 | 320 |
| 716 | 3300025916 | Ga0207663_10115318 | Ga0207663_101153181 | 320 |
| 717 | 3300025933 | Ga0207706_10034621 | Ga0207706_100346212 | 320 |
| 718 | 3300025939 | Ga0207665_10121712 | Ga0207665_101217122 | 320 |
| 719 | 3300033180 | Ga0307510_10264543 | Ga0307510_102645431 | 320 |
| 720 | 3300035695 | Ga0373927_0042604 | Ga0373927_0042604_1019_2005 | 320 |
| 721 | 3300046454 | Ga0495592_0041663 | Ga0495592_0041663_1660_2646 | 320 |
| 722 | 3300046455 | Ga0495603_0093236 | Ga0495603_0093236_669_1691 | 320 |
| 723 | 3300046463 | Ga0495653_0037943 | Ga0495653_0037943_2498_3484 | 320 |
| 724 | 3300046473 | Ga0495582_0106808 | Ga0495582_0106808_345_1331 | 320 |
| 725 | 3300046507 | Ga0495606_0010827 | Ga0495606_0010827_4105_5091 | 320 |
| 726 | 3300046511 | Ga0495608_0105511 | Ga0495608_0105511_293_1279 | 320 |
| 727 | 3300046516 | Ga0495628_0152094 | Ga0495628_0152094_132_1118 | 320 |
| 728 | 3300046524 | Ga0495648_0006902 | Ga0495648_0006902_6352_7338 | 320 |
| 729 | 3300046529 | Ga0495652_0114790 | Ga0495652_0114790_119_1105 | 320 |
| 730 | 3300046529 | Ga0495652_0151102 | Ga0495652_0151102_304_1290 | 320 |
| 731 | 3300046533 | Ga0495640_0039415 | Ga0495640_0039415_2091_3077 | 320 |
| 732 | 3300046543 | Ga0495645_0013988 | Ga0495645_0013988_1551_2537 | 320 |
| 733 | 3300046543 | Ga0495645_0218986 | Ga0495645_0218986_84_1070 | 320 |
| 734 | 3300046559 | Ga0495667_0076114 | Ga0495667_0076114_332_1318 | 320 |
| 735 | 3300046642 | Ga0495634_0018655 | Ga0495634_0018655_3723_4709 | 320 |
| 736 | 3300046642 | Ga0495634_0122835 | Ga0495634_0122835_106_1092 | 320 |
| 737 | 3300046663 | Ga0495635_0013665 | Ga0495635_0013665_1203_2189 | 320 |
| 738 | 3300046674 | Ga0495588_0130449 | Ga0495588_0130449_34_1020 | 320 |
| 739 | 3300046675 | Ga0495657_0021483 | Ga0495657_0021483_1353_2339 | 320 |
| 740 | 3300046675 | Ga0495657_0024161 | Ga0495657_0024161_2891_3877 | 320 |
| 741 | 3300046678 | Ga0495599_0005563 | Ga0495599_0005563_4482_5468 | 320 |
| 742 | 3300046679 | Ga0495623_0002992 | Ga0495623_0002992_4255_5241 | 320 |
| 743 | 3300046680 | Ga0495646_0145751 | Ga0495646_0145751_224_1210 | 320 |
| 744 | 3300046683 | Ga0495658_0139704 | Ga0495658_0139704_287_1273 | 320 |
| 745 | 3300046689 | Ga0495613_0106435 | Ga0495613_0106435_470_1456 | 320 |
| 746 | 3300046694 | Ga0495649_0051812 | Ga0495649_0051812_147_1133 | 320 |
| 747 | 3300047317 | Ga0495604_0014830 | Ga0495604_0014830_4136_5122 | 320 |
| 748 | 3300047317 | Ga0495604_0022506 | Ga0495604_0022506_3890_4876 | 320 |
| 749 | 3300047319 | Ga0495674_0023272 | Ga0495674_0023272_4390_5376 | 320 |
| 750 | 3300047320 | Ga0495672_0085850 | Ga0495672_0085850_589_1575 | 320 |
| 751 | 3300047321 | Ga0495676_0153006 | Ga0495676_0153006_71_1057 | 320 |
| 752 | 3300047322 | Ga0495680_0001426 | Ga0495680_0001426_20672_21658 | 320 |
| 753 | 3300047323 | Ga0495683_0046627 | Ga0495683_0046627_147_1133 | 320 |
| 754 | 3300047471 | Ga0495684_0123791 | Ga0495684_0123791_435_1421 | 320 |
| 755 | 3300047673 | Ga0495593_0040050 | Ga0495593_0040050_603_1589 | 320 |
| 756 | 3300048088 | Ga0495602_0007749 | Ga0495602_0007749_3361_4347 | 320 |
| 757 | 3300048907 | Ga0496104_0009449 | Ga0496104_0009449_155_1141 | 320 |
| 758 | 3300048908 | Ga0496105_0063015 | Ga0496105_0063015_1389_2375 | 320 |
| 759 | 3300048911 | Ga0496108_0362302 | Ga0496108_0362302_121_1107 | 320 |
| 760 | 3300048917 | Ga0496114_0208667 | Ga0496114_0208667_621_1607 | 320 |
| 761 | 3300048922 | Ga0496119_0072162 | Ga0496119_0072162_142_1128 | 320 |
| 762 | 3300048923 | Ga0496120_0011332 | Ga0496120_0011332_1395_2381 | 320 |
| 763 | 3300048924 | Ga0496121_0000753 | Ga0496121_0000753_327_1313 | 320 |
| 764 | 3300050492 | nmdc:mga0yw44_55403_c1 | nmdc:mga0yw44_55403_c1_130_1152 | 320 |
| 765 | 3300050493 | nmdc:mga0k408_39071_c1 | nmdc:mga0k408_39071_c1_1467_2465 | 320 |
| 766 | 3300053083 | Ga0495655_0030398 | Ga0495655_0030398_225_1211 | 320 |
| 767 | 3300053086 | Ga0500578_0115128 | Ga0500578_0115128_40_1026 | 320 |
| 768 | 3300053118 | Ga0500594_0015624 | Ga0500594_0015624_513_1547 | 320 |
| 769 | 3300053119 | Ga0500595_001062 | Ga0500595_001062_12138_13124 | 320 |
| 770 | 3300053119 | Ga0500595_011027 | Ga0500595_011027_1986_2972 | 320 |
| 771 | 3300053130 | Ga0500642_0011795 | Ga0500642_0011795_1319_2353 | 320 |
| 772 | 3300053153 | Ga0500616_0011113 | Ga0500616_0011113_543_1544 | 320 |
| 773 | iso_pu_bacteria | 8056967851 | 8056976054 | 320 |
| 774 | 3300003203 | JGI25406J46586_10000133 | JGI25406J46586_1000013312 | 321 |
| 775 | 3300005329 | Ga0070683_100010541 | Ga0070683_10001054112 | 321 |
| 776 | 3300005329 | Ga0070683_100034098 | Ga0070683_1000340983 | 321 |
| 777 | 3300005336 | Ga0070680_100008274 | Ga0070680_1000082745 | 321 |
| 778 | 3300005336 | Ga0070680_100050122 | Ga0070680_1000501222 | 321 |
| 779 | 3300005355 | Ga0070671_100122250 | Ga0070671_1001222502 | 321 |
| 780 | 3300005364 | Ga0070673_100156740 | Ga0070673_1001567403 | 321 |
| 781 | 3300005366 | Ga0070659_100059480 | Ga0070659_1000594802 | 321 |
| 782 | 3300005434 | Ga0070709_10006064 | Ga0070709_100060645 | 321 |
| 783 | 3300005434 | Ga0070709_10031136 | Ga0070709_100311363 | 321 |
| 784 | 3300005434 | Ga0070709_10052999 | Ga0070709_100529992 | 321 |
| 785 | 3300005435 | Ga0070714_100061439 | Ga0070714_1000614393 | 321 |
| 786 | 3300005435 | Ga0070714_100314018 | Ga0070714_1003140182 | 321 |
| 787 | 3300005436 | Ga0070713_100012380 | Ga0070713_1000123807 | 321 |
| 788 | 3300005436 | Ga0070713_100028548 | Ga0070713_1000285483 | 321 |
| 789 | 3300005437 | Ga0070710_10063955 | Ga0070710_100639552 | 321 |
| 790 | 3300005439 | Ga0070711_100006314 | Ga0070711_1000063147 | 321 |
| 791 | 3300005455 | Ga0070663_100009946 | Ga0070663_1000099467 | 321 |
| 792 | 3300005456 | Ga0070678_100193439 | Ga0070678_1001934391 | 321 |
| 793 | 3300005458 | Ga0070681_10036493 | Ga0070681_100364936 | 321 |
| 794 | 3300005458 | Ga0070681_10070615 | Ga0070681_100706153 | 321 |
| 795 | 3300005467 | Ga0070706_100058712 | Ga0070706_1000587124 | 321 |
| 796 | 3300005468 | Ga0070707_100050135 | Ga0070707_1000501355 | 321 |
| 797 | 3300005468 | Ga0070707_100067293 | Ga0070707_1000672934 | 321 |
| 798 | 3300005471 | Ga0070698_100061688 | Ga0070698_1000616882 | 321 |
| 799 | 3300005530 | Ga0070679_100044206 | Ga0070679_1000442066 | 321 |
| 800 | 3300005535 | Ga0070684_100001737 | Ga0070684_1000017377 | 321 |
| 801 | 3300005535 | Ga0070684_100010579 | Ga0070684_10001057911 | 321 |
| 802 | 3300005536 | Ga0070697_100134239 | Ga0070697_1001342393 | 321 |
| 803 | 3300005539 | Ga0068853_100001167 | Ga0068853_1000011675 | 321 |
| 804 | 3300005563 | Ga0068855_100024736 | Ga0068855_1000247364 | 321 |
| 805 | 3300005564 | Ga0070664_100008147 | Ga0070664_1000081475 | 321 |
| 806 | 3300005577 | Ga0068857_100008553 | Ga0068857_1000085535 | 321 |
| 807 | 3300005834 | Ga0068851_10006569 | Ga0068851_100065694 | 321 |
| 808 | 3300005841 | Ga0068863_100240146 | Ga0068863_1002401462 | 321 |
| 809 | 3300005843 | Ga0068860_100002690 | Ga0068860_1000026909 | 321 |
| 810 | 3300005985 | Ga0081539_10000099 | Ga0081539_1000009979 | 321 |
| 811 | 3300006173 | Ga0070716_100111545 | Ga0070716_1001115452 | 321 |
| 812 | 3300006175 | Ga0070712_100125260 | Ga0070712_1001252601 | 321 |
| 813 | 3300006237 | Ga0097621_100047456 | Ga0097621_1000474564 | 321 |
| 814 | 3300006358 | Ga0068871_100269890 | Ga0068871_1002698902 | 321 |
| 815 | 3300007265 | Ga0099794_10011788 | Ga0099794_100117882 | 321 |
| 816 | 3300009093 | Ga0105240_10558393 | Ga0105240_105583932 | 321 |
| 817 | 3300009098 | Ga0105245_10080814 | Ga0105245_100808143 | 321 |
| 818 | 3300009545 | Ga0105237_10043361 | Ga0105237_100433613 | 321 |
| 819 | 3300009551 | Ga0105238_10006431 | Ga0105238_1000643110 | 321 |
| 820 | 3300010375 | Ga0105239_10019170 | Ga0105239_100191706 | 321 |
| 821 | 3300010375 | Ga0105239_10026562 | Ga0105239_100265626 | 321 |
| 822 | 3300013105 | Ga0157369_10004737 | Ga0157369_100047375 | 321 |
| 823 | 3300013296 | Ga0157374_10007199 | Ga0157374_100071998 | 321 |
| 824 | 3300013307 | Ga0157372_10500092 | Ga0157372_105000921 | 321 |
| 825 | 3300013308 | Ga0157375_10022464 | Ga0157375_100224641 | 321 |
| 826 | 3300014968 | Ga0157379_10201681 | Ga0157379_102016813 | 321 |
| 827 | 3300014969 | Ga0157376_10004438 | Ga0157376_100044388 | 321 |
| 828 | 3300025297 | Ga0209758_1003819 | Ga0209758_10038195 | 321 |
| 829 | 3300025898 | Ga0207692_10012181 | Ga0207692_100121812 | 321 |
| 830 | 3300025900 | Ga0207710_10041890 | Ga0207710_100418902 | 321 |
| 831 | 3300025906 | Ga0207699_10027045 | Ga0207699_100270453 | 321 |
| 832 | 3300025909 | Ga0207705_10015948 | Ga0207705_100159485 | 321 |
| 833 | 3300025910 | Ga0207684_10028686 | Ga0207684_100286864 | 321 |
| 834 | 3300025910 | Ga0207684_10123484 | Ga0207684_101234842 | 321 |
| 835 | 3300025912 | Ga0207707_10001530 | Ga0207707_100015307 | 321 |
| 836 | 3300025912 | Ga0207707_10061226 | Ga0207707_100612262 | 321 |
| 837 | 3300025913 | Ga0207695_10075212 | Ga0207695_100752122 | 321 |
| 838 | 3300025914 | Ga0207671_10012099 | Ga0207671_100120998 | 321 |
| 839 | 3300025915 | Ga0207693_10004353 | Ga0207693_1000435313 | 321 |
| 840 | 3300025917 | Ga0207660_10001829 | Ga0207660_1000182913 | 321 |
| 841 | 3300025921 | Ga0207652_10006474 | Ga0207652_100064749 | 321 |
| 842 | 3300025921 | Ga0207652_10143841 | Ga0207652_101438411 | 321 |
| 843 | 3300025922 | Ga0207646_10031950 | Ga0207646_100319504 | 321 |
| 844 | 3300025929 | Ga0207664_10433793 | Ga0207664_104337931 | 321 |
| 845 | 3300025932 | Ga0207690_10045868 | Ga0207690_100458682 | 321 |
| 846 | 3300025939 | Ga0207665_10081997 | Ga0207665_100819971 | 321 |
| 847 | 3300025944 | Ga0207661_10017444 | Ga0207661_100174442 | 321 |
| 848 | 3300025944 | Ga0207661_10050215 | Ga0207661_100502155 | 321 |
| 849 | 3300025945 | Ga0207679_10051400 | Ga0207679_100514003 | 321 |
| 850 | 3300025949 | Ga0207667_10008657 | Ga0207667_100086577 | 321 |
| 851 | 3300025949 | Ga0207667_10098994 | Ga0207667_100989944 | 321 |
| 852 | 3300026035 | Ga0207703_10218167 | Ga0207703_102181671 | 321 |
| 853 | 3300026041 | Ga0207639_10005343 | Ga0207639_100053439 | 321 |
| 854 | 3300026067 | Ga0207678_10003472 | Ga0207678_100034729 | 321 |
| 855 | 3300026088 | Ga0207641_10240986 | Ga0207641_102409862 | 321 |
| 856 | 3300026116 | Ga0207674_10013973 | Ga0207674_100139738 | 321 |
| 857 | 3300026121 | Ga0207683_10154629 | Ga0207683_101546292 | 321 |
| 858 | 3300026121 | Ga0207683_10218403 | Ga0207683_102184032 | 321 |
| 859 | 3300026142 | Ga0207698_10045704 | Ga0207698_100457043 | 321 |
| 860 | 3300027671 | Ga0209588_1011313 | Ga0209588_10113133 | 321 |
| 861 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042194 | 321 |
| 862 | 3300031241 | Ga0265325_10010610 | Ga0265325_100106102 | 321 |
| 863 | 3300031247 | Ga0265340_10019263 | Ga0265340_100192632 | 321 |
| 864 | 3300031344 | Ga0265316_10087257 | Ga0265316_100872572 | 321 |
| 865 | 3300031507 | Ga0307509_10129452 | Ga0307509_101294523 | 321 |
| 866 | 3300031507 | Ga0307509_10345703 | Ga0307509_103457031 | 321 |
| 867 | 3300031711 | Ga0265314_10016415 | Ga0265314_100164153 | 321 |
| 868 | 3300031711 | Ga0265314_10079251 | Ga0265314_100792513 | 321 |
| 869 | 3300031712 | Ga0265342_10009595 | Ga0265342_100095955 | 321 |
| 870 | 3300031712 | Ga0265342_10023757 | Ga0265342_100237573 | 321 |
| 871 | 3300031712 | Ga0265342_10065180 | Ga0265342_100651802 | 321 |
| 872 | 3300033180 | Ga0307510_10024013 | Ga0307510_100240134 | 321 |
| 873 | 3300033442 | Ga0315911_1000012 | Ga0315911_10000121 | 321 |
| 874 | 3300035083 | Ga0373926_0005379 | Ga0373926_0005379_1506_2501 | 321 |
| 875 | 3300035086 | Ga0373934_0002178 | Ga0373934_0002178_1684_2673 | 321 |
| 876 | 3300035089 | Ga0373944_0008059 | Ga0373944_0008059_90_1079 | 321 |
| 877 | 3300035111 | Ga0373923_0001946 | Ga0373923_0001946_1915_2904 | 321 |
| 878 | 3300035113 | Ga0373936_0008199 | Ga0373936_0008199_2175_3170 | 321 |
| 879 | 3300035113 | Ga0373936_0038186 | Ga0373936_0038186_854_1843 | 321 |
| 880 | 3300035117 | Ga0373953_0039692 | Ga0373953_0039692_659_1648 | 321 |
| 881 | 3300035118 | Ga0373954_0002355 | Ga0373954_0002355_6146_7135 | 321 |
| 882 | 3300035119 | Ga0373956_0002239 | Ga0373956_0002239_4444_5433 | 321 |
| 883 | 3300035119 | Ga0373956_0049325 | Ga0373956_0049325_696_1691 | 321 |
| 884 | 3300035119 | Ga0373956_0053696 | Ga0373956_0053696_520_1509 | 321 |
| 885 | 3300035120 | Ga0373957_0000527 | Ga0373957_0000527_5116_6105 | 321 |
| 886 | 3300035120 | Ga0373957_0049538 | Ga0373957_0049538_147_1136 | 321 |
| 887 | 3300035170 | Ga0373943_0016178 | Ga0373943_0016178_1747_2736 | 321 |
| 888 | 3300035171 | Ga0373946_0016253 | Ga0373946_0016253_626_1615 | 321 |
| 889 | 3300035172 | Ga0373955_0000535 | Ga0373955_0000535_11600_12589 | 321 |
| 890 | 3300035172 | Ga0373955_0054645 | Ga0373955_0054645_964_1953 | 321 |
| 891 | 3300035172 | Ga0373955_0065771 | Ga0373955_0065771_461_1450 | 321 |
| 892 | 3300035172 | Ga0373955_0245171 | Ga0373955_0245171_17_1012 | 321 |
| 893 | 3300035410 | Ga0373924_0004005 | Ga0373924_0004005_76_1065 | 321 |
| 894 | 3300035410 | Ga0373924_0032496 | Ga0373924_0032496_700_1689 | 321 |
| 895 | 3300035691 | Ga0373931_0014148 | Ga0373931_0014148_328_1317 | 321 |
| 896 | 3300035692 | Ga0373935_0002921 | Ga0373935_0002921_5898_6887 | 321 |
| 897 | 3300035724 | Ga0373933_0002165 | Ga0373933_0002165_9616_10605 | 321 |
| 898 | 3300035724 | Ga0373933_0081588 | Ga0373933_0081588_143_1132 | 321 |
| 899 | 3300035724 | Ga0373933_0107022 | Ga0373933_0107022_245_1234 | 321 |
| 900 | 3300035725 | Ga0373947_0007981 | Ga0373947_0007981_4157_5146 | 321 |
| 901 | 3300035725 | Ga0373947_0013638 | Ga0373947_0013638_61_1056 | 321 |
| 902 | 3300036401 | Ga0373937_0022868 | Ga0373937_0022868_1281_2276 | 321 |
| 903 | 3300036401 | Ga0373937_0050675 | Ga0373937_0050675_1661_2650 | 321 |
| 904 | 3300036401 | Ga0373937_0101164 | Ga0373937_0101164_1479_2468 | 321 |
| 905 | 3300036401 | Ga0373937_0315490 | Ga0373937_0315490_426_1415 | 321 |
| 906 | 3300036401 | Ga0373937_0369106 | Ga0373937_0369106_153_1142 | 321 |
| 907 | 3300036401 | Ga0373937_0395220 | Ga0373937_0395220_306_1295 | 321 |
| 908 | 3300037068 | Ga0373925_0002335 | Ga0373925_0002335_10120_11109 | 321 |
| 909 | 3300037418 | Ga0395900_0335819 | Ga0395900_0335819_367_1356 | 321 |
| 910 | 3300037466 | Ga0395898_0183734 | Ga0395898_0183734_205_1200 | 321 |
| 911 | 3300037471 | Ga0395905_0136451 | Ga0395905_0136451_1296_2294 | 321 |
| 912 | 3300045976 | Ga0466967_0178875 | Ga0466967_0178875_407_1396 | 321 |
| 913 | 3300046454 | Ga0495592_0021832 | Ga0495592_0021832_3756_4745 | 321 |
| 914 | 3300046455 | Ga0495603_0000923 | Ga0495603_0000923_4670_5659 | 321 |
| 915 | 3300046455 | Ga0495603_0008603 | Ga0495603_0008603_2113_3102 | 321 |
| 916 | 3300046455 | Ga0495603_0028744 | Ga0495603_0028744_1536_2525 | 321 |
| 917 | 3300046459 | Ga0495629_0001841 | Ga0495629_0001841_8582_9571 | 321 |
| 918 | 3300046459 | Ga0495629_0002400 | Ga0495629_0002400_5079_6068 | 321 |
| 919 | 3300046461 | Ga0495641_0011027 | Ga0495641_0011027_3370_4359 | 321 |
| 920 | 3300046462 | Ga0495651_0087761 | Ga0495651_0087761_25_1014 | 321 |
| 921 | 3300046463 | Ga0495653_0004149 | Ga0495653_0004149_8778_9767 | 321 |
| 922 | 3300046463 | Ga0495653_0085483 | Ga0495653_0085483_686_1675 | 321 |
| 923 | 3300046472 | Ga0495580_0009257 | Ga0495580_0009257_6673_7668 | 321 |
| 924 | 3300046472 | Ga0495580_0010859 | Ga0495580_0010859_641_1630 | 321 |
| 925 | 3300046472 | Ga0495580_0030671 | Ga0495580_0030671_1184_2173 | 321 |
| 926 | 3300046473 | Ga0495582_0000283 | Ga0495582_0000283_5805_6794 | 321 |
| 927 | 3300046475 | Ga0495639_0004800 | Ga0495639_0004800_3277_4266 | 321 |
| 928 | 3300046476 | Ga0495662_0001975 | Ga0495662_0001975_8217_9206 | 321 |
| 929 | 3300046476 | Ga0495662_0027547 | Ga0495662_0027547_550_1545 | 321 |
| 930 | 3300046477 | Ga0495664_0007158 | Ga0495664_0007158_2230_3225 | 321 |
| 931 | 3300046477 | Ga0495664_0013420 | Ga0495664_0013420_1795_2784 | 321 |
| 932 | 3300046477 | Ga0495664_0141800 | Ga0495664_0141800_366_1355 | 321 |
| 933 | 3300046477 | Ga0495664_0239213 | Ga0495664_0239213_60_1049 | 321 |
| 934 | 3300046499 | Ga0495594_0000509 | Ga0495594_0000509_10377_11366 | 321 |
| 935 | 3300046507 | Ga0495606_0000357 | Ga0495606_0000357_39742_40731 | 321 |
| 936 | 3300046507 | Ga0495606_0156888 | Ga0495606_0156888_293_1282 | 321 |
| 937 | 3300046511 | Ga0495608_0020082 | Ga0495608_0020082_3073_4062 | 321 |
| 938 | 3300046514 | Ga0495618_0032005 | Ga0495618_0032005_1270_2259 | 321 |
| 939 | 3300046514 | Ga0495618_0048943 | Ga0495618_0048943_354_1343 | 321 |
| 940 | 3300046514 | Ga0495618_0095039 | Ga0495618_0095039_552_1541 | 321 |
| 941 | 3300046516 | Ga0495628_0063319 | Ga0495628_0063319_423_1412 | 321 |
| 942 | 3300046516 | Ga0495628_0108220 | Ga0495628_0108220_997_1986 | 321 |
| 943 | 3300046517 | Ga0495630_0008393 | Ga0495630_0008393_2319_3317 | 321 |
| 944 | 3300046517 | Ga0495630_0018211 | Ga0495630_0018211_2006_3001 | 321 |
| 945 | 3300046517 | Ga0495630_0162430 | Ga0495630_0162430_501_1490 | 321 |
| 946 | 3300046529 | Ga0495652_0016077 | Ga0495652_0016077_5488_6477 | 321 |
| 947 | 3300046529 | Ga0495652_0040475 | Ga0495652_0040475_1819_2808 | 321 |
| 948 | 3300046529 | Ga0495652_0106314 | Ga0495652_0106314_18_1007 | 321 |
| 949 | 3300046531 | Ga0495665_0000145 | Ga0495665_0000145_18384_19373 | 321 |
| 950 | 3300046533 | Ga0495640_0007751 | Ga0495640_0007751_5478_6467 | 321 |
| 951 | 3300046533 | Ga0495640_0016865 | Ga0495640_0016865_3822_4817 | 321 |
| 952 | 3300046536 | Ga0495587_0018462 | Ga0495587_0018462_397_1386 | 321 |
| 953 | 3300046543 | Ga0495645_0104249 | Ga0495645_0104249_97_1086 | 321 |
| 954 | 3300046557 | Ga0495622_0006137 | Ga0495622_0006137_2078_3067 | 321 |
| 955 | 3300046559 | Ga0495667_0033824 | Ga0495667_0033824_2337_3326 | 321 |
| 956 | 3300046559 | Ga0495667_0066606 | Ga0495667_0066606_1024_2019 | 321 |
| 957 | 3300046559 | Ga0495667_0066888 | Ga0495667_0066888_160_1149 | 321 |
| 958 | 3300046642 | Ga0495634_0001108 | Ga0495634_0001108_4669_5658 | 321 |
| 959 | 3300046642 | Ga0495634_0009918 | Ga0495634_0009918_5910_6899 | 321 |
| 960 | 3300046642 | Ga0495634_0082129 | Ga0495634_0082129_685_1674 | 321 |
| 961 | 3300046660 | Ga0495625_0112735 | Ga0495625_0112735_614_1612 | 321 |
| 962 | 3300046663 | Ga0495635_0002477 | Ga0495635_0002477_5460_6449 | 321 |
| 963 | 3300046663 | Ga0495635_0009937 | Ga0495635_0009937_4034_5023 | 321 |
| 964 | 3300046663 | Ga0495635_0068873 | Ga0495635_0068873_543_1532 | 321 |
| 965 | 3300046674 | Ga0495588_0013234 | Ga0495588_0013234_1494_2483 | 321 |
| 966 | 3300046674 | Ga0495588_0028524 | Ga0495588_0028524_1390_2379 | 321 |
| 967 | 3300046675 | Ga0495657_0204093 | Ga0495657_0204093_190_1179 | 321 |
| 968 | 3300046678 | Ga0495599_0025078 | Ga0495599_0025078_647_1636 | 321 |
| 969 | 3300046679 | Ga0495623_0010731 | Ga0495623_0010731_4725_5714 | 321 |
| 970 | 3300046679 | Ga0495623_0090320 | Ga0495623_0090320_259_1248 | 321 |
| 971 | 3300046680 | Ga0495646_0021267 | Ga0495646_0021267_2603_3592 | 321 |
| 972 | 3300046680 | Ga0495646_0036786 | Ga0495646_0036786_552_1541 | 321 |
| 973 | 3300046680 | Ga0495646_0049099 | Ga0495646_0049099_504_1493 | 321 |
| 974 | 3300046681 | Ga0495647_0007604 | Ga0495647_0007604_1450_2439 | 321 |
| 975 | 3300046683 | Ga0495658_0000547 | Ga0495658_0000547_1178_2167 | 321 |
| 976 | 3300046689 | Ga0495613_0002250 | Ga0495613_0002250_5372_6361 | 321 |
| 977 | 3300046689 | Ga0495613_0068935 | Ga0495613_0068935_1007_1996 | 321 |
| 978 | 3300046690 | Ga0495624_0005060 | Ga0495624_0005060_5580_6569 | 321 |
| 979 | 3300046809 | Ga0495600_0027802 | Ga0495600_0027802_331_1320 | 321 |
| 980 | 3300047315 | Ga0495581_0000529 | Ga0495581_0000529_7249_8238 | 321 |
| 981 | 3300047315 | Ga0495581_0049088 | Ga0495581_0049088_1133_2122 | 321 |
| 982 | 3300047317 | Ga0495604_0040425 | Ga0495604_0040425_2338_3327 | 321 |
| 983 | 3300047317 | Ga0495604_0049547 | Ga0495604_0049547_1048_2037 | 321 |
| 984 | 3300047319 | Ga0495674_0012072 | Ga0495674_0012072_3672_4661 | 321 |
| 985 | 3300047319 | Ga0495674_0032883 | Ga0495674_0032883_328_1323 | 321 |
| 986 | 3300047319 | Ga0495674_0036651 | Ga0495674_0036651_3318_4307 | 321 |
| 987 | 3300047319 | Ga0495674_0141178 | Ga0495674_0141178_85_1074 | 321 |
| 988 | 3300047322 | Ga0495680_0012571 | Ga0495680_0012571_3298_4287 | 321 |
| 989 | 3300047444 | Ga0495675_0136036 | Ga0495675_0136036_397_1386 | 321 |
| 990 | 3300047471 | Ga0495684_0001145 | Ga0495684_0001145_12840_13829 | 321 |
| 991 | 3300047471 | Ga0495684_0078066 | Ga0495684_0078066_99_1088 | 321 |
| 992 | 3300047673 | Ga0495593_0000526 | Ga0495593_0000526_12423_13412 | 321 |
| 993 | 3300047673 | Ga0495593_0000877 | Ga0495593_0000877_5678_6667 | 321 |
| 994 | 3300048088 | Ga0495602_0009427 | Ga0495602_0009427_5295_6284 | 321 |
| 995 | 3300048088 | Ga0495602_0028167 | Ga0495602_0028167_1159_2148 | 321 |
| 996 | 3300048088 | Ga0495602_0170130 | Ga0495602_0170130_586_1575 | 321 |
| 997 | 3300048903 | Ga0496100_0036611 | Ga0496100_0036611_120_1109 | 321 |
| 998 | 3300048904 | Ga0496101_0008287 | Ga0496101_0008287_4221_5210 | 321 |
| 999 | 3300048905 | Ga0496102_0072086 | Ga0496102_0072086_540_1529 | 321 |
| 1000 | 3300048906 | Ga0496103_0047232 | Ga0496103_0047232_250_1239 | 321 |
| 1001 | 3300048907 | Ga0496104_0025169 | Ga0496104_0025169_4361_5413 | 321 |
| 1002 | 3300048907 | Ga0496104_0117418 | Ga0496104_0117418_295_1284 | 321 |
| 1003 | 3300048908 | Ga0496105_0013952 | Ga0496105_0013952_62_1051 | 321 |
| 1004 | 3300048908 | Ga0496105_0078734 | Ga0496105_0078734_1346_2335 | 321 |
| 1005 | 3300048909 | Ga0496106_0081988 | Ga0496106_0081988_481_1470 | 321 |
| 1006 | 3300048910 | Ga0496107_0004840 | Ga0496107_0004840_5678_6667 | 321 |
| 1007 | 3300048911 | Ga0496108_0114638 | Ga0496108_0114638_1238_2227 | 321 |
| 1008 | 3300048912 | Ga0496109_0059361 | Ga0496109_0059361_1282_2334 | 321 |
| 1009 | 3300048912 | Ga0496109_0150548 | Ga0496109_0150548_66_1055 | 321 |
| 1010 | 3300048913 | Ga0496110_0134451 | Ga0496110_0134451_172_1161 | 321 |
| 1011 | 3300048913 | Ga0496110_0173181 | Ga0496110_0173181_64_1053 | 321 |
| 1012 | 3300048913 | Ga0496110_0211501 | Ga0496110_0211501_57_1046 | 321 |
| 1013 | 3300048915 | Ga0496112_0000052 | Ga0496112_0000052_61822_62811 | 321 |
| 1014 | 3300048915 | Ga0496112_0022947 | Ga0496112_0022947_4939_5928 | 321 |
| 1015 | 3300048915 | Ga0496112_0079304 | Ga0496112_0079304_1137_2126 | 321 |
| 1016 | 3300048915 | Ga0496112_0095845 | Ga0496112_0095845_1043_2032 | 321 |
| 1017 | 3300048915 | Ga0496112_0174421 | Ga0496112_0174421_953_1942 | 321 |
| 1018 | 3300048916 | Ga0496113_0019366 | Ga0496113_0019366_3720_4709 | 321 |
| 1019 | 3300048916 | Ga0496113_0136402 | Ga0496113_0136402_523_1512 | 321 |
| 1020 | 3300048917 | Ga0496114_0075094 | Ga0496114_0075094_751_1740 | 321 |
| 1021 | 3300048917 | Ga0496114_0098275 | Ga0496114_0098275_1074_2063 | 321 |
| 1022 | 3300048917 | Ga0496114_0142504 | Ga0496114_0142504_742_1731 | 321 |
| 1023 | 3300048918 | Ga0496115_0000981 | Ga0496115_0000981_4404_5393 | 321 |
| 1024 | 3300048918 | Ga0496115_0049802 | Ga0496115_0049802_1504_2493 | 321 |
| 1025 | 3300048918 | Ga0496115_0071871 | Ga0496115_0071871_188_1177 | 321 |
| 1026 | 3300048918 | Ga0496115_0120672 | Ga0496115_0120672_157_1149 | 321 |
| 1027 | 3300048918 | Ga0496115_0268417 | Ga0496115_0268417_339_1328 | 321 |
| 1028 | 3300048923 | Ga0496120_0050193 | Ga0496120_0050193_1314_2303 | 321 |
| 1029 | 3300048924 | Ga0496121_0001173 | Ga0496121_0001173_26376_27374 | 321 |
| 1030 | 3300048924 | Ga0496121_0097922 | Ga0496121_0097922_671_1660 | 321 |
| 1031 | 3300048926 | Ga0496123_0022865 | Ga0496123_0022865_3356_4354 | 321 |
| 1032 | 3300048929 | Ga0496126_0004189 | Ga0496126_0004189_2773_3771 | 321 |
| 1033 | 3300048929 | Ga0496126_0004375 | Ga0496126_0004375_7880_8869 | 321 |
| 1034 | 3300048929 | Ga0496126_0010575 | Ga0496126_0010575_894_1886 | 321 |
| 1035 | 3300048929 | Ga0496126_0216461 | Ga0496126_0216461_117_1115 | 321 |
| 1036 | 3300050509 | nmdc:mga0qj67_83578_c1 | nmdc:mga0qj67_83578_c1_1173_2174 | 321 |
| 1037 | 3300050510 | nmdc:mga06r32_166682_c1 | nmdc:mga06r32_166682_c1_785_1786 | 321 |
| 1038 | 3300053077 | Ga0495601_0026489 | Ga0495601_0026489_2353_3342 | 321 |
| 1039 | 3300053078 | Ga0495612_0025418 | Ga0495612_0025418_492_1481 | 321 |
| 1040 | 3300053084 | Ga0495595_0001351 | Ga0495595_0001351_3525_4514 | 321 |
| 1041 | 3300053085 | Ga0495619_0001695 | Ga0495619_0001695_8714_9703 | 321 |
| 1042 | 3300053085 | Ga0495619_0106527 | Ga0495619_0106527_288_1277 | 321 |
| 1043 | 3300053094 | Ga0500566_0005672 | Ga0500566_0005672_1331_2320 | 321 |
| 1044 | 3300053095 | Ga0500640_005231 | Ga0500640_005231_2473_3462 | 321 |
| 1045 | 3300053102 | Ga0500554_027341 | Ga0500554_027341_182_1171 | 321 |
| 1046 | 3300053111 | Ga0500572_004446 | Ga0500572_004446_838_1827 | 321 |
| 1047 | 3300053136 | Ga0500559_0005719 | Ga0500559_0005719_1362_2351 | 321 |
| 1048 | 3300053139 | Ga0500568_0006530 | Ga0500568_0006530_2792_3790 | 321 |
| 1049 | 3300053150 | Ga0500603_001321 | Ga0500603_001321_1328_2317 | 321 |
| 1050 | 3300053159 | Ga0500630_033291 | Ga0500630_033291_128_1117 | 321 |
| 1051 | 3300053163 | Ga0500639_000125 | Ga0500639_000125_1421_2410 | 321 |
| 1052 | 3300053163 | Ga0500639_049653 | Ga0500639_049653_719_1708 | 321 |
| 1053 | 3300053178 | Ga0500637_0015830 | Ga0500637_0015830_2959_3948 | 321 |
| 1054 | 3300053735 | Ga0500596_002626 | Ga0500596_002626_1328_2317 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9567 | 25 | 315 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.948 | 22 | 316 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.93 | 22 | 315 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9237 | 22 | 316 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9133 | 22 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9639 | 124 | 243 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9433 | 124 | 246 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9369 | 126 | 246 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9329 | 124 | 243 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9325 | 124 | 247 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y1S0I1-F1-model_v4 | ABC transporter substrate-binding protein | 0.967 | 22 | 317 |
|
| AF-A0A1F4DQL8-F1-model_v4 | LacI family transcriptional regulator | 0.9619 | 21 | 315 |
|
| AF-I3UDY1-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9596 | 19 | 316 |
|
| AF-A0A1B2QZA4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9568 | 22 | 316 |
|
| AF-V7I8H6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9566 | 22 | 309 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar