F489062

General Info

Members Datasets Scaffolds Average Seq Length
1050 820 2100 369

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0024593|Ga0496111_0024593_1790_3031
Length 413
Sequence VQAVFGKTPAMEKLCLGRPKKENAALAPRTKLSIVCRLSTGHAAMPAFSRFTPLISSLPSTVPFVGPETLERNSGAPVKARIGANENGFGPAPSVIAAMADAAAGIWKYADPENFDLKAALAVHLGCAPENLAIGEGIDSLLGQIVRLVIDPGLPVVTSFGAYPTFNFHVAGHGGKLVTVPYVSDREDLNGLLDAVRRDNTPLVYFANPDNPMGSWWDADSIVSFAKALPETTLMILDEAYCETGPAGAMPAIDALIDMPNVIRTRTFSKAYGLAGARVGYAITTAGTAKAFDKIRNHFGMNRVAVAAATAALKDQAYLAEVVGRIQGSRERIAAIAAANGLQALPSATNFVAIDCGRDAVYARAIVDGLLKHGVFIRMPGVAPLNRCIRISAGPVSDMALLEDALPQVLKSL

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
47 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
102 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
121 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
203 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
209 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
212 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
213 2509276019 Ensifer aridi TW10 Isolate Nodule
214 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
215 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
216 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
217 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
218 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
219 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
220 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
221 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
222 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
223 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
224 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
225 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
226 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
227 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
228 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
229 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
230 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
231 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
232 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
233 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
234 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
235 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
236 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
237 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
238 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
239 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
240 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
241 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
242 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
243 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
244 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
245 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
246 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
247 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
248 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
249 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
250 2516143018 Ensifer sp. BR816 Isolate Nodule
251 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
252 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
253 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
254 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
255 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
256 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
257 2519899620 Rhizobium sp. Pop5 Isolate Nodule
258 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
259 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
260 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
261 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
262 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
263 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
264 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
265 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
266 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
267 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
268 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
269 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
270 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
271 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
272 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
273 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
274 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
275 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
276 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
277 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
278 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
279 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
280 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
281 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
282 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
283 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
284 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
285 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
286 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
287 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
288 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
289 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
290 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
291 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
292 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
293 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
294 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
295 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
296 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
297 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
298 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
299 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
300 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
301 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
302 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
303 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
304 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
305 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
306 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
307 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
308 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
309 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
310 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
311 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
312 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
313 2643221557 Ensifer sp. Root558 Isolate Unclassified
314 2643221558 Rhizobium sp. Root149 Isolate Unclassified
315 2643221568 Rhizobium sp. Root564 Isolate Unclassified
316 2643221582 Rhizobium sp. Root651 Isolate Unclassified
317 2643221599 Rhizobium sp. Root708 Isolate Unclassified
318 2643221607 Rhizobium sp. Root73 Isolate Unclassified
319 2643221610 Ensifer sp. Root74 Isolate Unclassified
320 2643221618 Ensifer sp. Root231 Isolate Unclassified
321 2643221626 Ensifer sp. Root31 Isolate Unclassified
322 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
323 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
324 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
325 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
326 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
327 2643221655 Ensifer sp. Root1252 Isolate Unclassified
328 2643221659 Ensifer sp. Root127 Isolate Unclassified
329 2643221668 Ensifer sp. Root423 Isolate Unclassified
330 2643221675 Ensifer sp. Root1298 Isolate Unclassified
331 2643221680 Ensifer sp. Root1312 Isolate Unclassified
332 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
333 2643221688 Rhizobium sp. Root482 Isolate Unclassified
334 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
335 2643221693 Rhizobium sp. Root491 Isolate Unclassified
336 2643221698 Ensifer sp. Root142 Isolate Unclassified
337 2643221712 Ensifer sp. Root258 Isolate Unclassified
338 2643221718 Rhizobium sp. Root268 Isolate Unclassified
339 2643221719 Rhizobium sp. Root274 Isolate Unclassified
340 2643221723 Ensifer sp. Root278 Isolate Unclassified
341 2643221726 Ensifer sp. Root954 Isolate Unclassified
342 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
343 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
344 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
345 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
346 2718217927 Rhizobium sp. N324 Isolate Nodule
347 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
348 2718218009 Rhizobium sp. N561 Isolate Nodule
349 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
350 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
351 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
352 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
353 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
354 2718218365 Rhizobium sp. N731 Isolate Nodule
355 2718218366 Rhizobium sp. N621 Isolate Nodule
356 2718218423 Rhizobium sp. N941 Isolate Nodule
357 2721755514 Rhizobium sp. N6212 Isolate Nodule
358 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
359 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
360 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
361 2721755809 Rhizobium sp. N541 Isolate Nodule
362 2721755810 Rhizobium sp. N871 Isolate Nodule
363 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
364 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
365 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
366 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
367 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
368 2728369365 Rhizobium sp. N1341 Isolate Nodule
369 2728369397 Rhizobium sp. N1314 Isolate Nodule
370 2738541293 Rhizobium sp. GV031 Isolate Unclassified
371 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
372 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
373 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
374 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
375 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
376 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
377 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
378 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
379 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
380 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
381 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
382 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
383 2791355256 Rhizobium sp. M10 Isolate Nodule
384 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
385 2791355260 Rhizobium sp. L9 Isolate Nodule
386 2791355261 Rhizobium sp. J15 Isolate Nodule
387 2791355262 Rhizobium sp. M1 Isolate Nodule
388 2791355263 Rhizobium chutanense C5 Isolate Nodule
389 2791355264 Rhizobium sp. S9 Isolate Nodule
390 2791355265 Rhizobium sp. H4 Isolate Nodule
391 2791355266 Rhizobium sp. L43 Isolate Nodule
392 2791355267 Rhizobium sp. L18 Isolate Nodule
393 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
394 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
395 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
396 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
397 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
398 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
399 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
400 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
401 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
402 2802429633 Rhizobium anhuiense J3 Isolate Nodule
403 2802429634 Rhizobium anhuiense S10 Isolate Nodule
404 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
405 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
406 2802429637 Rhizobium anhuiense C15 Isolate Nodule
407 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
408 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
409 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
410 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
411 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
412 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
413 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
414 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
415 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
416 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
417 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
418 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
419 2838048938 Rhizobium pisi 27/80 Isolate Nodule
420 2838061910 Rhizobium phaseoli L15 Isolate Nodule
421 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
422 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
423 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
424 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
425 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
426 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
427 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
428 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
429 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
430 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
431 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
432 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
433 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
434 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
435 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
436 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
437 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
438 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
439 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
440 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
441 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
442 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
443 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
444 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
445 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
446 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
447 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
448 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
449 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
450 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
451 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
452 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
453 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
454 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
455 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
456 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
457 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
458 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
459 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
460 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
461 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
462 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
463 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
464 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
465 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
466 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
467 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
468 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
469 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
470 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
471 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
472 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
473 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
474 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
475 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
476 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
477 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
478 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
479 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
480 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
481 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
482 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
483 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
484 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
485 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
486 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
487 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
488 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
489 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
490 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
491 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
492 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
493 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
494 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
495 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
496 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
497 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
498 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
499 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
500 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
501 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
502 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
503 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
504 2844163670 Ensifer sp. 1H6 Isolate Unclassified
505 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
506 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
507 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
508 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
509 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
510 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
511 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
512 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
513 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
514 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
515 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
516 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
517 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
518 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
519 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
520 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
521 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
522 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
523 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
524 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
525 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
526 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
527 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
528 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
529 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
530 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
531 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
532 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
533 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
534 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
535 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
536 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
537 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
538 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
539 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
540 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
541 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
542 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
543 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
544 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
545 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
546 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
547 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
548 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
549 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
550 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
551 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
552 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
553 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
554 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
555 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
556 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
557 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
558 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
559 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
560 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
561 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
562 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
563 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
564 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
565 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
566 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
567 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
568 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
569 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
570 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
571 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
572 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
573 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
574 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
575 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
576 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
577 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
578 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
579 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
580 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
581 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
582 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
583 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
584 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
585 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
586 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
587 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
588 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
589 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
590 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
591 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
592 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
593 2933599457 Rhizobium phaseoli M3 Isolate Nodule
594 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
595 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
596 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
597 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
598 2936381700 Rhizobium chutanense C16 Isolate Unclassified
599 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
600 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
601 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
602 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
603 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
604 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
605 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
606 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
607 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
608 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
609 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
610 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
611 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
612 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
613 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
614 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
615 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
616 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
617 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
618 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
619 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
620 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
621 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
622 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
623 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
624 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
625 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
626 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
627 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
628 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
629 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
630 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
631 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
632 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
633 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
634 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
635 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
636 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
637 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
638 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
639 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
640 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
641 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
642 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
643 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
644 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
645 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
646 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
647 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
648 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
649 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
650 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
651 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
652 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
653 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
654 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
655 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
656 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
657 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
658 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
659 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
660 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
661 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
662 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
663 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
664 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
665 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
666 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
667 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
668 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
669 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
670 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
671 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
672 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
673 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
674 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
675 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
676 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
677 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
678 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
679 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
680 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
681 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
682 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
683 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
684 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
685 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
686 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
687 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
688 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
689 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
690 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
691 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
692 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
693 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
694 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
695 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
696 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
697 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
698 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
699 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
700 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
701 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
702 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
703 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
704 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
705 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
706 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
707 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
708 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
709 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
710 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
711 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
712 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
713 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
714 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
715 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
716 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
717 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
718 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
719 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
720 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
721 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
722 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
723 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
724 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
725 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
726 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
727 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
728 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
729 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
730 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
731 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
732 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
733 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
734 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
735 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
736 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
737 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
738 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
739 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
740 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
741 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
742 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
743 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
744 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
745 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
746 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
747 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
748 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
749 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
750 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
751 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
752 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
753 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
754 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
755 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
756 2996887358 Rhizobium sp. R711 Isolate Nodule
757 2996893221 Rhizobium sp. R635 Isolate Nodule
758 3004167301 Mesorhizobium loti 582 Isolate Unclassified
759 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
760 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
761 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
762 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
763 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
764 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
765 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
766 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
767 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
768 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
769 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
770 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
771 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
772 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
773 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
774 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
775 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
776 8005258706 Rhizobium sp. R693 Isolate Nodule
777 8005275841 Rhizobium sp. N4311 Isolate Nodule
778 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
779 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
780 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
781 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
782 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
783 8005321885 Rhizobium sp. R72 Isolate Nodule
784 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
785 8005382845 Rhizobium sp. R634 Isolate Nodule
786 8005395548 Rhizobium sp. R339 Isolate Nodule
787 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
788 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
789 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
790 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
791 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
792 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
793 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
794 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
795 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
796 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
797 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
798 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
799 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
800 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
801 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
802 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
803 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
804 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
805 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
806 8018176218 Rhizobium sp. N122 Isolate Nodule
807 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
808 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
809 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
810 8024501048 Rhizobium sp. H4 Isolate Nodule
811 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
812 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
813 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
814 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
815 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
816 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
817 8056382006 Rhizobium croatiense 13T Isolate Nodule
818 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
819 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
820 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.71
Metatranscriptomes 0
Isolates 58.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 17.43
Nodule 44.76
Rhizoplane 1.33
Rhizosphere 17.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0024593 3300048914 Bacteria 4243
2 JGI25155J39150_1000072 3300002704 Bacteria 64012
3 JGI25156J39149_1000086 3300002705 Bacteria 69106
4 JGI25162J39368_1000463 3300002737 Bacteria 31575
5 JGI25154J39366_1000449 3300002738 Bacteria 21682
6 JGI25158J39367_1000141 3300002739 Bacteria 16827
7 JGI25157J39369_1000113 3300002741 Bacteria 69106
8 JGI25152J39213_1001001 3300002773 Bacteria 13676
9 JGI25152J39213_1003225 3300002773 Bacteria 5674
10 JGI25152J39213_1012758 3300002773 Bacteria 1784
11 JGI25150J39212_1000031 3300002774 Bacteria 100456
12 JGI25150J39212_1001947 3300002774 Bacteria 5416
13 JGI25159J45721_1000064 3300002987 Bacteria 51766
14 JGI25159J45721_1000422 3300002987 Bacteria 19538
15 JGI25159J45721_1001589 3300002987 Bacteria 9284
16 JGI25151J46595_10000062 3300003187 Bacteria 146687
17 JGI25151J46595_10009994 3300003187 Bacteria 4448
18 JGI25151J46595_10011934 3300003187 Bacteria 3969
19 JGI25151J46595_10028871 3300003187 Bacteria 2204
20 JGI25406J46586_10004236 3300003203 Bacteria 6700
21 JGI25165J46597_1000582 3300003214 Bacteria 31988
22 JGI25165J46597_1001530 3300003214 Bacteria 11556
23 JGI25165J46597_1003546 3300003214 Bacteria 3810
24 JGI25153J46596_10006447 3300003215 Bacteria 5925
25 JGI25153J46596_10010124 3300003215 Bacteria 4296
26 JGI25153J46596_10015146 3300003215 Bacteria 3161
27 rootL2_10017824 3300003322 Bacteria 9340
28 JGI25160J50197_1000052 3300003354 Bacteria 127795
29 JGI25160J50197_1000638 3300003354 Bacteria 19538
30 JGI25160J50197_1002059 3300003354 Bacteria 9572
31 JGI25160J50197_1010657 3300003354 Bacteria 3308
32 JGI25160J50197_1032001 3300003354 Bacteria 1343
33 JGI25161J50226_1000073 3300003374 Bacteria 86555
34 JGI25161J50226_1000153 3300003374 Bacteria 47896
35 JGI25161J50226_1000439 3300003374 Bacteria 19530
36 JGI25161J50226_1004658 3300003374 Bacteria 2821
37 Ga0055526_1002265 3300003771 Bacteria 13148
38 Ga0055526_1005053 3300003771 Bacteria 7704
39 Ga0055526_1008569 3300003771 Bacteria 5071
40 Ga0055526_1015498 3300003771 Bacteria 3058
41 Ga0055524_1000744 3300003775 Bacteria 22157
42 Ga0055524_1002453 3300003775 Bacteria 9541
43 Ga0055524_1004985 3300003775 Bacteria 6016
44 Ga0055524_1012283 3300003775 Bacteria 3295
45 Ga0055536_1001014 3300003781 Bacteria 17831
46 Ga0055536_1002940 3300003781 Bacteria 9358
47 Ga0055536_1007669 3300003781 Bacteria 4783
48 Ga0055528_1000097 3300003790 Bacteria 70021
49 Ga0055528_1000443 3300003790 Bacteria 33228
50 Ga0055528_1003314 3300003790 Bacteria 8163
51 Ga0055530_10004386 3300003791 Bacteria 7295
52 Ga0055540_1000914 3300003792 Bacteria 19278
53 Ga0055540_1003207 3300003792 Bacteria 8036
54 Ga0055531_10001123 3300003794 Bacteria 20718
55 Ga0055531_10005803 3300003794 Bacteria 7147
56 Ga0055543_1000035 3300004625 Bacteria 127833
57 Ga0055543_1000048 3300004625 Bacteria 109807
58 Ga0055543_1001249 3300004625 Bacteria 10530
59 Ga0055543_1002146 3300004625 Bacteria 6819
60 Ga0065165_1000253 3300005262 Bacteria 92969
61 Ga0065165_1001950 3300005262 Bacteria 19576
62 Ga0065165_1016484 3300005262 Bacteria 2765
63 Ga0065165_1024210 3300005262 Bacteria 2043
64 Ga0070670_100001192 3300005331 Bacteria 20626
65 Ga0070661_100099487 3300005344 Bacteria 2161
66 Ga0070671_100031955 3300005355 Bacteria 4351
67 Ga0070714_100011464 3300005435 Bacteria 7029
68 Ga0070665_100011473 3300005548 Bacteria 8961
69 Ga0070665_100018231 3300005548 Bacteria 7042
70 Ga0068855_100148091 3300005563 Bacteria 2671
71 Ga0068856_100038217 3300005614 Bacteria 4712
72 Ga0081539_10005104 3300005985 Bacteria 13746
73 Ga0075365_10010771 3300006038 Bacteria 5344
74 Ga0075365_10048440 3300006038 Bacteria 2797
75 Ga0075365_10127292 3300006038 Bacteria 1761
76 Ga0075362_10000585 3300006177 Bacteria 10673
77 Ga0075367_10000155 3300006178 Bacteria 21476
78 Ga0075369_10009357 3300006186 Bacteria 3805
79 Ga0075369_10019034 3300006186 Bacteria 2800
80 Ga0075370_10018558 3300006353 Bacteria 3776
81 Ga0079104_1000010 3300006946 Bacteria 366021
82 Ga0099826_10000983 3300006948 Bacteria 15908
83 Ga0105251_10006290 3300009011 Bacteria 7599
84 Ga0105240_10000027 3300009093 Bacteria 348486
85 Ga0105248_10055886 3300009177 Bacteria 4428
86 Ga0105248_10087396 3300009177 Bacteria 3508
87 Ga0105248_10283040 3300009177 Bacteria 1867
88 Ga0105237_10009004 3300009545 Bacteria 10737
89 Ga0123341_1000513 3300009765 Bacteria 23861
90 Ga0123342_1015271 3300009766 Bacteria 7041
91 Ga0105246_10054603 3300011119 Bacteria 2754
92 Ga0157371_10000655 3300013102 Bacteria 41018
93 Ga0157371_10002849 3300013102 Bacteria 16156
94 Ga0157370_10002286 3300013104 Bacteria 23232
95 Ga0157370_10003889 3300013104 Bacteria 17400
96 Ga0157369_10149927 3300013105 Bacteria 2465
97 Ga0171463_1001 3300013249 Bacteria 1406070
98 Ga0182007_10001095 3300015262 Bacteria 14734
99 Ga0183363_1105 3300015690 Bacteria 24000
100 Ga0214544_1000008 3300021320 Bacteria 326027
101 Ga0214542_1035918 3300021321 Bacteria 1500
102 Ga0214543_1000003 3300021327 Bacteria 692327
103 Ga0214543_1000004 3300021327 Bacteria 527190
104 Ga0213875_10002405 3300021388 Bacteria 11255
105 Ga0213875_10004006 3300021388 Bacteria 8216
106 Ga0213875_10011978 3300021388 Bacteria 4297
107 Ga0228710_1000001 3300022740 Bacteria 314328
108 Ga0209435_100036 3300025206 Bacteria 126970
109 Ga0209436_100047 3300025208 Bacteria 68393
110 Ga0209436_101060 3300025208 Bacteria 10414
111 Ga0209437_100033 3300025233 Bacteria 512520
112 Ga0209437_100036 3300025233 Bacteria 469153
113 Ga0207425_1000031 3300025245 Bacteria 261181
114 Ga0207425_1000891 3300025245 Bacteria 14499
115 Ga0207425_1003713 3300025245 Bacteria 4790
116 Ga0207425_1009693 3300025245 Bacteria 2383
117 Ga0209646_1000132 3300025246 Bacteria 126859
118 Ga0209026_1000236 3300025250 Bacteria 73740
119 Ga0209677_101419 3300025253 Bacteria 10372
120 Ga0209148_1008609 3300025254 Bacteria 2041
121 Ga0209759_1000269 3300025256 Bacteria 73740
122 Ga0209129_1000053 3300025258 Bacteria 262823
123 Ga0209129_1000125 3300025258 Bacteria 133506
124 Ga0209129_1000310 3300025258 Bacteria 44160
125 Ga0209129_1000585 3300025258 Bacteria 25039
126 Ga0209129_1000772 3300025258 Bacteria 20285
127 Ga0209129_1001648 3300025258 Bacteria 12106
128 Ga0209233_1000056 3300025261 Bacteria 438104
129 Ga0209233_1000064 3300025261 Bacteria 392156
130 Ga0209233_1000519 3300025261 Bacteria 22325
131 Ga0209565_1016405 3300025263 Bacteria 1647
132 Ga0209673_1000254 3300025273 Bacteria 101508
133 Ga0209673_1000946 3300025273 Bacteria 36287
134 Ga0209673_1001299 3300025273 Bacteria 25473
135 Ga0209673_1001710 3300025273 Bacteria 18597
136 Ga0209673_1002387 3300025273 Bacteria 13187
137 Ga0209673_1008489 3300025273 Bacteria 4565
138 Ga0209130_1000006 3300025284 Bacteria 596528
139 Ga0209130_1000008 3300025284 Bacteria 581232
140 Ga0209130_1000018 3300025284 Bacteria 388301
141 Ga0209130_1014045 3300025284 Bacteria 2027
142 Ga0209130_1023981 3300025284 Bacteria 1338
143 Ga0209676_1001570 3300025292 Bacteria 20410
144 Ga0209676_1002579 3300025292 Bacteria 12503
145 Ga0209676_1013691 3300025292 Bacteria 3103
146 Ga0209025_1000074 3300025294 Bacteria 277445
147 Ga0209025_1000080 3300025294 Bacteria 267244
148 Ga0209025_1000087 3300025294 Bacteria 261181
149 Ga0209025_1000100 3300025294 Bacteria 229182
150 Ga0209025_1000165 3300025294 Bacteria 164692
151 Ga0209025_1000284 3300025294 Bacteria 114754
152 Ga0209025_1000900 3300025294 Bacteria 46091
153 Ga0209025_1001720 3300025294 Bacteria 26508
154 Ga0209025_1005547 3300025294 Bacteria 10231
155 Ga0209025_1012512 3300025294 Bacteria 5429
156 Ga0209025_1019260 3300025294 Bacteria 3804
157 Ga0209564_1000233 3300025295 Bacteria 121692
158 Ga0209564_1000399 3300025295 Bacteria 77444
159 Ga0209564_1000846 3300025295 Bacteria 41021
160 Ga0209564_1002545 3300025295 Bacteria 14045
161 Ga0209564_1012387 3300025295 Bacteria 3722
162 Ga0209564_1023443 3300025295 Bacteria 2144
163 Ga0209758_1000081 3300025297 Bacteria 261181
164 Ga0209758_1000121 3300025297 Bacteria 192028
165 Ga0209758_1000313 3300025297 Bacteria 93883
166 Ga0209758_1000420 3300025297 Bacteria 71919
167 Ga0209758_1005053 3300025297 Bacteria 10474
168 Ga0209758_1040498 3300025297 Bacteria 1756
169 Ga0209758_1043536 3300025297 Bacteria 1652
170 Ga0209050_1001881 3300025298 Bacteria 20158
171 Ga0209256_1000882 3300025299 Bacteria 37027
172 Ga0209256_1001394 3300025299 Bacteria 25182
173 Ga0209256_1001907 3300025299 Bacteria 19075
174 Ga0209256_1002206 3300025299 Bacteria 16675
175 Ga0209256_1004715 3300025299 Bacteria 8350
176 Ga0209256_1004864 3300025299 Bacteria 8107
177 Ga0209256_1005960 3300025299 Bacteria 6699
178 Ga0209256_1022120 3300025299 Bacteria 1934
179 Ga0207426_1000016 3300025302 Bacteria 581232
180 Ga0207426_1000044 3300025302 Bacteria 428043
181 Ga0207426_1000106 3300025302 Bacteria 244368
182 Ga0207426_1000265 3300025302 Bacteria 110545
183 Ga0207426_1000417 3300025302 Bacteria 70223
184 Ga0209051_1000339 3300025303 Bacteria 70136
185 Ga0209051_1001902 3300025303 Bacteria 16280
186 Ga0209051_1002337 3300025303 Bacteria 13740
187 Ga0209051_1027560 3300025303 Bacteria 2261
188 Ga0209051_1036604 3300025303 Bacteria 1810
189 Ga0209051_1047469 3300025303 Bacteria 1466
190 Ga0209257_1002142 3300025304 Bacteria 20550
191 Ga0209257_1002341 3300025304 Bacteria 19075
192 Ga0209257_1010558 3300025304 Bacteria 4645
193 Ga0209257_1015576 3300025304 Bacteria 3152
194 Ga0207695_10000024 3300025913 Bacteria 632311
195 Ga0207671_10001725 3300025914 Bacteria 24611
196 Ga0207650_10002047 3300025925 Bacteria 14109
197 Ga0207644_10192725 3300025931 Bacteria 1603
198 Ga0207667_10122376 3300025949 Bacteria 2681
199 Ga0207702_10015626 3300026078 Bacteria 6283
200 Ga0209281_1000053 3300027111 Bacteria 309587
201 Ga0209281_1000164 3300027111 Bacteria 157372
202 Ga0209371_1000009 3300027312 Bacteria 963030
203 Ga0209371_1002475 3300027312 Bacteria 10281
204 Ga0209282_1000007 3300027666 Bacteria 254917
205 Ga0209282_1000898 3300027666 Bacteria 15484
206 Ga0209813_10027815 3300027866 Bacteria 1645
207 Ga0307515_10000115 3300028794 Bacteria 193697
208 Ga0307515_10001359 3300028794 Bacteria 55373
209 Ga0307515_10089792 3300028794 Bacteria 3863
210 Ga0307515_10222112 3300028794 Bacteria 1704
211 Ga0268256_1000010 3300030500 Bacteria 963034
212 Ga0316181_1239067 3300030744 Bacteria 3717
213 Ga0307513_10011887 3300031456 Bacteria 10784
214 Ga0307513_10038647 3300031456 Bacteria 5297
215 Ga0307406_10003779 3300031901 Bacteria 8237
216 Ga0307412_10003099 3300031911 Bacteria 9229
217 Ga0315914_1000006 3300031967 Bacteria 239817
218 Ga0307416_100150879 3300032002 Bacteria 2131
219 Ga0315913_1000002 3300033430 Bacteria 241452
220 Ga0315915_1000001 3300033464 Bacteria 481518
221 Ga0373927_0002733 3300035695 Bacteria 12868
222 Ga0373925_0031066 3300037068 Bacteria 3922
223 Ga0395905_0005671 3300037471 Bacteria 12700
224 Ga0436364_0390735 3300037853 Bacteria 24243
225 Ga0436364_1204360 3300037853 Bacteria 17456
226 Ga0436364_1438425 3300037853 Bacteria 6111
227 Ga0436365_1554358 3300039437 Bacteria 1632
228 Ga0436360_0149751 3300039438 Bacteria 5732
229 Ga0436360_0288706 3300039438 Bacteria 2249
230 Ga0436360_0408422 3300039438 Bacteria 3180
231 Ga0436360_0505528 3300039438 Bacteria 6801
232 Ga0436361_0319009 3300039447 Bacteria 4318
233 Ga0436363_1060966 3300039450 Bacteria 1267
234 Ga0436363_1197407 3300039450 Bacteria 7133
235 Ga0436363_1230673 3300039450 Bacteria 2662
236 Ga0439466_0028183 3300041411 Bacteria 1940
237 Ga0439465_0031467 3300041413 Bacteria 1690
238 Ga0439465_0053245 3300041413 Bacteria 1329
239 Ga0451807_1817935 3300041486 Bacteria 1784
240 Ga0451839_0010134 3300041496 Bacteria 1447
241 Ga0451841_0033619 3300041498 Bacteria 3371
242 Ga0451845_0243198 3300041501 Bacteria 2286
243 Ga0451851_0604339 3300041507 Bacteria 1755
244 Ga0451843_1238200 3300041509 Bacteria 1333
245 Ga0439449_0003826 3300042007 Bacteria 5829
246 Ga0439449_0022152 3300042007 Bacteria 2378
247 Ga0450920_002848 3300042122 Bacteria 2973
248 Ga0450907_010125 3300042146 Bacteria 1565
249 Ga0439434_0022682 3300042435 Bacteria 1887
250 Ga0466970_0001709 3300044765 Bacteria 10556
251 Ga0495617_043749 3300046452 Bacteria 1495
252 Ga0495592_0043901 3300046454 Bacteria 3342
253 Ga0495629_0003563 3300046459 Bacteria 11763
254 Ga0495638_0000909 3300046460 Bacteria 30235
255 Ga0495638_0006992 3300046460 Bacteria 8144
256 Ga0495638_0032652 3300046460 Bacteria 3335
257 Ga0495651_0156601 3300046462 Bacteria 1637
258 Ga0495650_0077477 3300046471 Bacteria 1290
259 Ga0495605_0002885 3300046474 Bacteria 10439
260 Ga0495605_0020092 3300046474 Bacteria 3553
261 Ga0495605_0101946 3300046474 Bacteria 1318
262 Ga0495585_0005637 3300046492 Bacteria 7862
263 Ga0495585_0027284 3300046492 Bacteria 3259
264 Ga0495585_0075520 3300046492 Bacteria 1832
265 Ga0495596_0056736 3300046500 Bacteria 1529
266 Ga0495607_0019058 3300046501 Bacteria 4362
267 Ga0495583_0109904 3300046506 Bacteria 1169
268 Ga0495606_0001156 3300046507 Bacteria 37435
269 Ga0495606_0029052 3300046507 Bacteria 3889
270 Ga0495606_0029148 3300046507 Bacteria 3880
271 Ga0495610_0003480 3300046512 Bacteria 12251
272 Ga0495610_0013822 3300046512 Bacteria 4773
273 Ga0495610_0018401 3300046512 Bacteria 3949
274 Ga0495616_0018049 3300046513 Bacteria 3883
275 Ga0495620_0034867 3300046515 Bacteria 2269
276 Ga0495631_0000552 3300046518 Bacteria 25095
277 Ga0495631_0054484 3300046518 Bacteria 1744
278 Ga0495632_0027851 3300046519 Bacteria 2954
279 Ga0495632_0038141 3300046519 Bacteria 2434
280 Ga0495643_0022357 3300046522 Bacteria 3609
281 Ga0495643_0026416 3300046522 Bacteria 3277
282 Ga0495643_0048373 3300046522 Bacteria 2298
283 Ga0495643_0049433 3300046522 Bacteria 2268
284 Ga0495648_0020286 3300046524 Bacteria 4639
285 Ga0495648_0025458 3300046524 Bacteria 4005
286 Ga0495654_0001318 3300046530 Bacteria 17336
287 Ga0495654_0024297 3300046530 Bacteria 3133
288 Ga0495597_0077897 3300046542 Bacteria 1420
289 Ga0495622_0007629 3300046557 Bacteria 5024
290 Ga0495633_0009944 3300046558 Bacteria 5223
291 Ga0495668_0100754 3300046616 Bacteria 1580
292 Ga0495611_0010012 3300046648 Bacteria 4011
293 Ga0495625_0006284 3300046660 Bacteria 10626
294 Ga0495625_0029283 3300046660 Bacteria 4120
295 Ga0495625_0071854 3300046660 Bacteria 2427
296 Ga0495625_0139829 3300046660 Bacteria 1634
297 Ga0495661_0073202 3300046665 Bacteria 1997
298 Ga0495588_0001062 3300046674 Bacteria 11915
299 Ga0495588_0036021 3300046674 Bacteria 2509
300 Ga0495657_0015664 3300046675 Bacteria 5541
301 Ga0495670_0103076 3300046691 Bacteria 1471
302 Ga0495649_0044228 3300046694 Bacteria 2431
303 Ga0495600_0002896 3300046809 Bacteria 9996
304 Ga0495660_0049706 3300046810 Bacteria 2287
305 Ga0495604_0025552 3300047317 Bacteria 4705
306 Ga0495687_039835 3300047443 Bacteria 2076
307 Ga0495687_051550 3300047443 Bacteria 1745
308 Ga0495673_0061854 3300047469 Bacteria 1601
309 Ga0495681_0004574 3300047470 Bacteria 9421
310 Ga0495686_0001669 3300047472 Bacteria 23075
311 Ga0495686_0004735 3300047472 Bacteria 11018
312 Ga0495686_0057703 3300047472 Bacteria 2422
313 Ga0495686_0060053 3300047472 Bacteria 2364
314 Ga0495686_0070817 3300047472 Bacteria 2148
315 Ga0495686_0099745 3300047472 Bacteria 1753
316 Ga0496101_0141164 3300048904 Bacteria 1836
317 Ga0496106_0000290 3300048909 Bacteria 35498
318 Ga0496114_0153077 3300048917 Bacteria 2001
319 Ga0496116_0000036 3300048919 Bacteria 388508
320 Ga0496116_0002110 3300048919 Bacteria 21206
321 Ga0496116_0003830 3300048919 Bacteria 14693
322 Ga0496116_0015688 3300048919 Bacteria 5975
323 Ga0496116_0066243 3300048919 Bacteria 2312
324 Ga0496116_0139078 3300048919 Bacteria 1369
325 Ga0496117_0000002 3300048920 Bacteria 2483758
326 Ga0496117_0001435 3300048920 Bacteria 34375
327 Ga0496117_0004851 3300048920 Bacteria 14534
328 Ga0496117_0013560 3300048920 Bacteria 7102
329 Ga0496117_0021217 3300048920 Bacteria 5264
330 Ga0496117_0098484 3300048920 Bacteria 1858
331 Ga0496118_0000084 3300048921 Bacteria 181733
332 Ga0496118_0003531 3300048921 Bacteria 19584
333 Ga0496118_0021868 3300048921 Bacteria 5611
334 Ga0496118_0062243 3300048921 Bacteria 2757
335 Ga0496118_0162261 3300048921 Bacteria 1380
336 Ga0496119_0009456 3300048922 Bacteria 8363
337 Ga0496119_0015425 3300048922 Bacteria 5884
338 Ga0496119_0032679 3300048922 Bacteria 3464
339 Ga0496120_0002064 3300048923 Bacteria 21668
340 Ga0496120_0034619 3300048923 Bacteria 3023
341 Ga0496120_0061532 3300048923 Bacteria 2095
342 Ga0496121_0000001 3300048924 Bacteria 1830318
343 Ga0496121_0001579 3300048924 Bacteria 37950
344 Ga0496121_0009025 3300048924 Bacteria 11553
345 Ga0496121_0015537 3300048924 Bacteria 7960
346 Ga0496121_0018227 3300048924 Bacteria 7097
347 Ga0496121_0023889 3300048924 Bacteria 5865
348 Ga0496121_0049075 3300048924 Bacteria 3584
349 Ga0496121_0131546 3300048924 Bacteria 1871
350 Ga0496121_0235891 3300048924 Bacteria 1278
351 Ga0496122_0000001 3300048925 Bacteria 1827766
352 Ga0496122_0000009 3300048925 Bacteria 584024
353 Ga0496122_0000205 3300048925 Bacteria 131755
354 Ga0496122_0030166 3300048925 Bacteria 4552
355 Ga0496122_0043468 3300048925 Bacteria 3519
356 Ga0496122_0153434 3300048925 Bacteria 1417
357 Ga0496123_0000001 3300048926 Bacteria 1831497
358 Ga0496123_0000034 3300048926 Bacteria 274836
359 Ga0496123_0000103 3300048926 Bacteria 168232
360 Ga0496123_0004660 3300048926 Bacteria 14232
361 Ga0496123_0013686 3300048926 Bacteria 6787
362 Ga0496123_0017042 3300048926 Bacteria 5866
363 Ga0496123_0135552 3300048926 Bacteria 1355
364 Ga0496124_0000133 3300048927 Bacteria 154328
365 Ga0496124_0000854 3300048927 Bacteria 49730
366 Ga0496124_0001267 3300048927 Bacteria 38458
367 Ga0496124_0010491 3300048927 Bacteria 9373
368 Ga0496124_0016202 3300048927 Bacteria 7102
369 Ga0496124_0042473 3300048927 Bacteria 3915
370 Ga0496124_0088868 3300048927 Bacteria 2524
371 Ga0496124_0090341 3300048927 Bacteria 2498
372 Ga0496124_0100397 3300048927 Bacteria 2346
373 Ga0496124_0110942 3300048927 Bacteria 2207
374 Ga0496124_0160134 3300048927 Bacteria 1755
375 Ga0496124_0227943 3300048927 Bacteria 1395
376 Ga0496125_0000001 3300048928 Bacteria 1766138
377 Ga0496125_0000385 3300048928 Bacteria 82113
378 Ga0496125_0009020 3300048928 Bacteria 10331
379 Ga0496125_0030391 3300048928 Bacteria 4834
380 Ga0496125_0103777 3300048928 Bacteria 2085
381 Ga0496125_0119483 3300048928 Bacteria 1884
382 Ga0496125_0133197 3300048928 Bacteria 1745
383 Ga0496126_0000597 3300048929 Bacteria 68119
384 Ga0496126_0004085 3300048929 Bacteria 17698
385 Ga0496126_0021823 3300048929 Bacteria 6247
386 Ga0496126_0061511 3300048929 Bacteria 3373
387 Ga0496126_0083019 3300048929 Bacteria 2828
388 Ga0496126_0131479 3300048929 Bacteria 2162
389 Ga0495678_013663 3300049459 Bacteria 3801
390 Ga0495678_035452 3300049459 Bacteria 2045
391 Ga0501033_0000038 3300049570 Bacteria 144438
392 Ga0501034_0003468 3300049571 Bacteria 17940
393 Ga0501034_0060906 3300049571 Bacteria 3791
394 Ga0501034_0414058 3300049571 Bacteria 1269
395 Ga0501039_0276783 3300049575 Bacteria 1319
396 Ga0501043_0114550 3300049579 Bacteria 2116
397 Ga0501043_0122013 3300049579 Bacteria 2044
398 Ga0501043_0173131 3300049579 Bacteria 1684
399 Ga0501083_0026686 3300049744 Bacteria 3990
400 Ga0501035_0000326 3300049822 Bacteria 55174
401 Ga0501044_0086647 3300049823 Bacteria 3163
402 nmdc:mga03683_1774_c1 3300050489 Bacteria 6525
403 nmdc:mga03n38_4300_c1 3300050490 Bacteria 4696
404 nmdc:mga00v17_1277_c1 3300050491 Bacteria 13208
405 nmdc:mga0yw44_15345_c1 3300050492 Bacteria 4100
406 nmdc:mga0yw44_186126_c1 3300050492 Bacteria 1368
407 nmdc:mga0yw44_198377_c1 3300050492 Bacteria 1325
408 nmdc:mga06z11_124506_c1 3300050494 Bacteria 1441
409 nmdc:mga07m45_27554_c1 3300050496 Bacteria 3132
410 nmdc:mga0sz30_1606_c1 3300050516 Bacteria 8061
411 nmdc:mga0sz30_3627_c1 3300050516 Bacteria 5567
412 Ga0495601_0028117 3300053077 Bacteria 3481
413 Ga0500610_0005983 3300053079 Bacteria 5050
414 Ga0500578_0070518 3300053086 Bacteria 2228
415 Ga0500556_0018204 3300053104 Bacteria 2213
416 Ga0500560_046261 3300053107 Bacteria 1383
417 Ga0500594_0000544 3300053118 Bacteria 8167
418 Ga0500618_000055 3300053125 Bacteria 99876
419 Ga0500618_000272 3300053125 Bacteria 39600
420 Ga0500618_014285 3300053125 Bacteria 2031
421 Ga0500658_0002594 3300053134 Bacteria 6986
422 Ga0500561_0000159 3300053137 Bacteria 12696
423 Ga0500568_0000998 3300053139 Bacteria 19367
424 Ga0500568_0002382 3300053139 Bacteria 11118
425 Ga0500573_0005900 3300053140 Bacteria 6586
426 Ga0500590_002471 3300053148 Bacteria 8219
427 Ga0500604_0007590 3300053151 Bacteria 2874
428 Ga0500616_0000224 3300053153 Bacteria 88293
429 Ga0500616_0001692 3300053153 Bacteria 20304
430 Ga0500622_0001161 3300053156 Bacteria 21882
431 Ga0500622_0002387 3300053156 Bacteria 13602
432 Ga0500624_000682 3300053157 Bacteria 8627
433 Ga0500627_0041929 3300053158 Bacteria 1969
434 Ga0500633_0000582 3300053160 Bacteria 5986
435 Ga0500634_0003699 3300053161 Bacteria 6891
436 Ga0500634_0021606 3300053161 Bacteria 3489
437 Ga0500636_0000004 3300053177 Bacteria 202392
438 Ga0500636_0007681 3300053177 Bacteria 6236
439 2509108432 2508501122 Bacteria 6292184
440 2509141557 2508501127 Bacteria 7037543
441 2509374527 2509276019 Bacteria 6802256
442 2509387798 2509276021 Bacteria 7634384
443 2509443399 2509276033 Bacteria 7180565
444 2510132222 2510065019 Bacteria 6903379
445 2510316400 2510065059 Bacteria 6847884
446 2510840266 2510461069 Bacteria 5505000
447 2510898559 2510461076 Bacteria 8618824
448 2511133572 2510917022 Bacteria 6504556
449 2511171091 2510917026 Bacteria 7046020
450 2511187358 2510917028 Bacteria 6185411
451 2511197925 2510917030 Bacteria 7460662
452 2511500935 2511231052 Bacteria 6974333
453 2512532358 2512047086 Bacteria 6850303
454 2512972314 2512875026 Bacteria 6861065
455 2513569058 2513237084 Bacteria 7231967
456 2513580799 2513237085 Bacteria 7695351
457 2513583527 2513237086 Bacteria 7265287
458 2513596167 2513237088 Bacteria 6927906
459 2513603393 2513237089 Bacteria 6553624
460 2513617546 2513237091 Bacteria 6900273
461 2513630874 2513237093 Bacteria 7545552
462 2513709285 2513237103 Bacteria 7647401
463 2513865704 2513237138 Bacteria 7368160
464 2513882740 2513237140 Bacteria 7076289
465 2513905285 2513237143 Bacteria 6664116
466 2513907603 2513237144 Bacteria 7530820
467 2513925631 2513237146 Bacteria 7166346
468 2513988211 2513237156 Bacteria 6402557
469 2513999480 2513237159 Bacteria 6810126
470 2514004848 2513237160 Bacteria 6650282
471 2514024450 2513237162 Bacteria 7468464
472 2515111204 2515075009 Bacteria 7288508
473 2515608058 2515154107 Bacteria 6795637
474 2515636010 2515154113 Bacteria 7807172
475 2515642662 2515154114 Bacteria 7848616
476 2515658823 2515154116 Bacteria 7552979
477 2515740383 2515154134 Bacteria 7220242
478 2516208813 2516143018 Bacteria 6951533
479 2516892212 2516653046 Bacteria 6989037
480 2517039847 2516653077 Bacteria 7555578
481 2517075388 2516653085 Bacteria 7346596
482 2517093977 2517093000 Bacteria 7412387
483 2517405792 2517287029 Bacteria 6905599
484 2517569021 2517487022 Bacteria 7227575
485 2520375326 2519899620 Bacteria 6499161
486 2524451210 2524023207 Bacteria 6813453
487 2524460727 2524023209 Bacteria 6679728
488 2530643971 2529292951 Bacteria 6916614
489 2535515639 2534681796 Bacteria 7146037
490 2537877088 2537561587 Bacteria 5425293
491 2551676395 2551306084 Bacteria 8942552
492 2551687502 2551306085 Bacteria 7347181
493 2551699205 2551306087 Bacteria 7351905
494 2551714807 2551306089 Bacteria 7162724
495 2551717917 2551306090 Bacteria 7953713
496 2551723824 2551306090 Bacteria 7953713
497 2551737802 2551306092 Bacteria 6992595
498 2551740886 2551306093 Bacteria 7064773
499 2554247038 2554235003 Bacteria 5877155
500 2558862509 2558860100 Bacteria 8458965
501 2558863554 2558860100 Bacteria 8458965
502 2559294263 2558860242 Bacteria 5568029
503 2561465997 2558860983 Bacteria 4133860
504 2585165475 2582581283 Bacteria 6030556
505 2585203004 2582581294 Bacteria 6626667
506 2585220912 2582581298 Bacteria 7315509
507 2585230492 2582581299 Bacteria 6518058
508 2585256688 2582581304 Bacteria 5831370
509 2585266261 2582581306 Bacteria 6450535
510 2585273341 2582581307 Bacteria 6597605
511 2585278829 2582581308 Bacteria 7413247
512 2585325556 2582581315 Bacteria 7318924
513 2585329713 2582581316 Bacteria 7774528
514 2585387263 2582581865 Bacteria 6644329
515 2585392636 2582581866 Bacteria 6859583
516 2585400226 2582581867 Bacteria 7184437
517 2585527885 2585427526 Bacteria 7258840
518 2585537296 2585427527 Bacteria 7273426
519 2585541512 2585427528 Bacteria 6842387
520 2585549989 2585427529 Bacteria 7395659
521 2585556360 2585427530 Bacteria 7383882
522 2585559358 2585427531 Bacteria 6992870
523 2585822767 2585427590 Bacteria 6824633
524 2585839355 2585427593 Bacteria 7141551
525 2585847292 2585427594 Bacteria 6180594
526 2585902030 2585427608 Bacteria 6544331
527 2585905265 2585427609 Bacteria 6667127
528 2585995024 2585427633 Bacteria 6413184
529 2585999567 2585427634 Bacteria 6455027
530 2587979620 2585428125 Bacteria 6662905
531 2599333872 2599185156 Bacteria 5403036
532 2599418670 2599185170 Bacteria 7295545
533 2599602673 2599185210 Bacteria 5624189
534 2599723161 2599185236 Bacteria 6875203
535 2600191859 2599185352 Bacteria 7228948
536 2600375195 2600254933 Bacteria 4750527
537 2601608752 2600255279 Bacteria 5605316
538 2601745526 2600255308 Bacteria 5611129
539 2616296714 2615840624 Bacteria 6557588
540 2616305897 2615840626 Bacteria 7921970
541 2616553858 2615840698 Bacteria 7319877
542 2617381897 2617270742 Bacteria 6808054
543 2643807276 2643221557 Bacteria 7184309
544 2643810072 2643221558 Bacteria 5460675
545 2643855946 2643221568 Bacteria 5187270
546 2643918635 2643221582 Bacteria 5804683
547 2644007844 2643221599 Bacteria 6292121
548 2644046657 2643221607 Bacteria 6314006
549 2644069457 2643221610 Bacteria 7480339
550 2644109069 2643221618 Bacteria 7717186
551 2644151589 2643221626 Bacteria 8069654
552 2644196439 2643221634 Bacteria 6705461
553 2644202364 2643221636 Bacteria 6583769
554 2644206254 2643221637 Bacteria 5345260
555 2644242810 2643221643 Bacteria 5749658
556 2644296912 2643221653 Bacteria 4569637
557 2644311724 2643221655 Bacteria 7722067
558 2644329994 2643221659 Bacteria 7890716
559 2644380658 2643221668 Bacteria 7306521
560 2644420611 2643221675 Bacteria 7473456
561 2644454136 2643221680 Bacteria 7473610
562 2644479446 2643221686 Bacteria 6310811
563 2644493472 2643221688 Bacteria 5260751
564 2644502488 2643221689 Bacteria 6042950
565 2644518820 2643221693 Bacteria 5513853
566 2644544869 2643221698 Bacteria 7756764
567 2644617523 2643221712 Bacteria 7729434
568 2644649901 2643221718 Bacteria 5345506
569 2644655166 2643221719 Bacteria 4568197
570 2644675726 2643221723 Bacteria 7095460
571 2644689473 2643221726 Bacteria 7455827
572 2657683343 2657244999 Bacteria 5946535
573 2671112784 2667528174 Bacteria 6435400
574 2688600234 2687453392 Bacteria 6880454
575 2692316893 2690316117 Bacteria 6800650
576 2719384774 2718217927 Bacteria 6972593
577 2719664535 2718217997 Bacteria 6740740
578 2719730926 2718218009 Bacteria 6478651
579 2720490955 2718218199 Bacteria 6740745
580 2720612319 2718218232 Bacteria 6720332
581 2720619157 2718218233 Bacteria 6662049
582 2720630559 2718218235 Bacteria 6630699
583 2720774252 2718218269 Bacteria 6906114
584 2721157791 2718218365 Bacteria 6274507
585 2721163150 2718218366 Bacteria 6425255
586 2721398485 2718218423 Bacteria 6438183
587 2722839320 2721755514 Bacteria 6424414
588 2723025976 2721755556 Bacteria 6745503
589 2723559523 2721755684 Bacteria 6859907
590 2723566140 2721755685 Bacteria 6704835
591 2724037298 2721755809 Bacteria 6438790
592 2724043682 2721755810 Bacteria 6479005
593 2724088859 2721755819 Bacteria 6906405
594 2724103405 2721755822 Bacteria 6726041
595 2724109245 2721755823 Bacteria 6752556
596 2725951046 2724679232 Bacteria 7646494
597 2730106912 2728369352 Bacteria 6745171
598 2730163414 2728369365 Bacteria 6555560
599 2730297423 2728369397 Bacteria 6274511
600 2738803659 2738541293 Bacteria 7065685
601 2738948803 2738541317 Bacteria 5340176
602 2739035816 2738541333 Bacteria 7106503
603 2753460744 2751185821 Bacteria 6189929
604 2756673207 2756170246 Bacteria 7451806
605 2766067682 2765235942 Bacteria 7445910
606 2776912690 2775507049 Bacteria 6284736
607 2778177386 2775507266 Bacteria 7392367
608 2792584096 2791355082 Bacteria 5973319
609 2792624876 2791355091 Bacteria 6135441
610 2792628330 2791355092 Bacteria 6248105
611 2792638412 2791355094 Bacteria 7011481
612 2792749217 2791355123 Bacteria 8049106
613 2793296128 2791355256 Bacteria 6798008
614 2793316870 2791355259 Bacteria 7254731
615 2793322697 2791355260 Bacteria 6598818
616 2793330956 2791355261 Bacteria 6661293
617 2793333534 2791355262 Bacteria 6774204
618 2793339879 2791355263 Bacteria 6872478
619 2793350110 2791355264 Bacteria 6429314
620 2793353493 2791355265 Bacteria 6539969
621 2793358834 2791355266 Bacteria 7116587
622 2793370525 2791355267 Bacteria 7222458
623 2802717664 2802428858 Bacteria 6636079
624 2802723408 2802428859 Bacteria 6667919
625 2802731141 2802428860 Bacteria 6525526
626 2802736148 2802428861 Bacteria 6534206
627 2802743642 2802428862 Bacteria 6633353
628 2802750646 2802428863 Bacteria 6410669
629 2804751267 2802429268 Bacteria 6094027
630 2805926651 2802429605 Bacteria 6875453
631 2805937506 2802429606 Bacteria 6346811
632 2806047004 2802429633 Bacteria 7341974
633 2806052588 2802429634 Bacteria 7083200
634 2806058641 2802429635 Bacteria 7650140
635 2806067590 2802429636 Bacteria 7597525
636 2806073882 2802429637 Bacteria 7067217
637 2808985963 2808606387 Bacteria 5697198
638 2819242626 2818991272 Bacteria 4622173
639 2819556084 2818991439 Bacteria 6907412
640 2819612289 2818991448 Bacteria 6772224
641 2819639326 2818991453 Bacteria 7181617
642 2819684230 2818991461 Bacteria 7026071
643 2821124173 2821123053 Bacteria 7836056
644 2838017204 2838016132 Bacteria 6577831
645 2838023275 2838022645 Bacteria 6494267
646 2838031337 2838029111 Bacteria 6603031
647 2838037640 2838035591 Bacteria 7166484
648 2838047014 2838042994 Bacteria 6046894
649 2838049313 2838048938 Bacteria 6044578
650 2838063240 2838061910 Bacteria 6794874
651 2838074622 2838068647 Bacteria 6208656
652 2838076372 2838074704 Bacteria 6785777
653 2838662647 2838661181 Bacteria 7385261
654 2838670772 2838668709 Bacteria 6671819
655 2838676810 2838675328 Bacteria 4909118
656 2838681259 2838680041 Bacteria 6545511
657 2838688697 2838686498 Bacteria 7807632
658 2838694707 2838694306 Bacteria 6853137
659 2838703143 2838701080 Bacteria 6669771
660 2838708084 2838707686 Bacteria 6619912
661 2838715694 2838714209 Bacteria 5525906
662 2838720505 2838719591 Bacteria 5523910
663 2838726450 2838724970 Bacteria 4908691
664 2838730992 2838729681 Bacteria 7400765
665 2838738804 2838736955 Bacteria 5760694
666 2838744114 2838742623 Bacteria 7396178
667 2841842703 2841840854 Bacteria 5761912
668 2841847440 2841846520 Bacteria 5345850
669 2841856795 2841851746 Bacteria 7532261
670 2841860024 2841859092 Bacteria 5436171
671 2841870374 2841864319 Bacteria 6742987
672 2842080684 2842077413 Bacteria 6508645
673 2842117648 2842110456 Bacteria 7656360
674 2842121303 2842118031 Bacteria 7033875
675 2842126530 2842124991 Bacteria 5346824
676 2842131703 2842130223 Bacteria 4909145
677 2842142483 2842140634 Bacteria 5759631
678 2842147633 2842146304 Bacteria 5957337
679 2842153128 2842152218 Bacteria 4908957
680 2842159965 2842156927 Bacteria 6894975
681 2842168208 2842163707 Bacteria 6916235
682 2842171938 2842170452 Bacteria 5525737
683 2842176747 2842175837 Bacteria 4908771
684 2842183418 2842180545 Bacteria 6888678
685 2842188803 2842187318 Bacteria 5524014
686 2842197875 2842192696 Bacteria 6147454
687 2842199703 2842198810 Bacteria 6608673
688 2842207776 2842205361 Bacteria 6340321
689 2842213114 2842211629 Bacteria 5523832
690 2842221123 2842217011 Bacteria 7497767
691 2842225267 2842224351 Bacteria 5524473
692 2842234981 2842229732 Bacteria 7475766
693 2842237496 2842237096 Bacteria 6620661
694 2842245578 2842243621 Bacteria 7421798
695 2842252699 2842250916 Bacteria 6579627
696 2842259772 2842257432 Bacteria 7401195
697 2842270172 2842264693 Bacteria 6472963
698 2842274611 2842271015 Bacteria 7807131
699 2842281429 2842278818 Bacteria 6340002
700 2842287195 2842285085 Bacteria 6011953
701 2842294341 2842291075 Bacteria 7076806
702 2842302532 2842298080 Bacteria 6123127
703 2842306855 2842304105 Bacteria 7023636
704 2842314534 2842311132 Bacteria 6616990
705 2842318727 2842317721 Bacteria 6793725
706 2842343682 2842341865 Bacteria 7003929
707 2842360735 2842357229 Bacteria 6485165
708 2842365090 2842363717 Bacteria 6844742
709 2842371722 2842370503 Bacteria 7038661
710 2842380738 2842377471 Bacteria 7140707
711 2842387809 2842384541 Bacteria 7057858
712 2842398348 2842395702 Bacteria 6780583
713 2842404463 2842402390 Bacteria 6681310
714 2842410852 2842409023 Bacteria 6687331
715 2842417692 2842415677 Bacteria 6596907
716 2842427276 2842422224 Bacteria 6239196
717 2842433994 2842428310 Bacteria 6767288
718 2842440370 2842434925 Bacteria 6502746
719 2842446919 2842441272 Bacteria 6769273
720 2842453453 2842447887 Bacteria 6754142
721 2842468413 2842462802 Bacteria 6588055
722 2842474931 2842469257 Bacteria 6752936
723 2842478068 2842475841 Bacteria 6603183
724 2842482774 2842482326 Bacteria 7212537
725 2842493682 2842489311 Bacteria 6620893
726 2842497362 2842495871 Bacteria 6820686
727 2842504877 2842502639 Bacteria 6604161
728 2842509648 2842509118 Bacteria 6850950
729 2842516809 2842515876 Bacteria 5436280
730 2842525273 2842521101 Bacteria 6569494
731 2842923729 2842922631 Bacteria 5824079
732 2844005662 2844002411 Bacteria 7168230
733 2844015549 2844009547 Bacteria 6728125
734 2844169572 2844163670 Bacteria 7266046
735 2844455222 2844454524 Bacteria 7952546
736 2847418040 2847417321 Bacteria 6913799
737 2848993015 2848992105 Bacteria 6810864
738 2850080406 2850079185 Bacteria 6848280
739 2852388992 2852387548 Bacteria 8025568
740 2854898809 2854896431 Bacteria 5869725
741 2854921608 2854916844 Bacteria 5725939
742 2855831286 2855825444 Bacteria 6785811
743 2855840411 2855839649 Bacteria 7135830
744 2855879077 2855872281 Bacteria 6964271
745 2856328534 2856328259 Bacteria 6528202
746 2856345543 2856342000 Bacteria 7176905
747 2857520371 2857516855 Bacteria 7787325
748 2857531752 2857531043 Bacteria 6754041
749 2858800940 2858800743 Bacteria 6603254
750 2869261267 2869256925 Bacteria 6981691
751 2871439440 2871435913 Bacteria 6880295
752 2871455338 2871451962 Bacteria 7336357
753 2871470897 2871466892 Bacteria 6923287
754 2874111421 2874109183 Bacteria 6517025
755 2874165720 2874162495 Bacteria 6174670
756 2874175351 2874168670 Bacteria 8062617
757 2876400526 2876399893 Bacteria 6927900
758 2876409901 2876406927 Bacteria 6191900
759 2878732526 2878730984 Bacteria 6380721
760 2878775254 2878774303 Bacteria 6108671
761 2891376605 2891373044 Bacteria 5202277
762 2896386574 2896384573 Bacteria 7700774
763 2899792090 2899792073 Bacteria 4926588
764 2899803697 2899803654 Bacteria 5577784
765 2899847208 2899845264 Bacteria 5672268
766 2906389911 2906386501 Bacteria 5977019
767 2906408334 2906408224 Bacteria 6162342
768 2913297511 2913295892 Bacteria 6333755
769 2913311057 2913308742 Bacteria 5350706
770 2915986144 2915980308 Bacteria 6624279
771 2915987275 2915986958 Bacteria 6739310
772 2915996298 2915993759 Bacteria 7016183
773 2916005867 2916000859 Bacteria 6865702
774 2916010890 2916007675 Bacteria 6898660
775 2916016525 2916014648 Bacteria 6946486
776 2916027483 2916021584 Bacteria 6854472
777 2916034764 2916028427 Bacteria 6748433
778 2916035382 2916035215 Bacteria 6755766
779 2916042659 2916041962 Bacteria 6820487
780 2916054725 2916048683 Bacteria 6543552
781 2916055395 2916055098 Bacteria 6758838
782 2916068043 2916061851 Bacteria 6737736
783 2916070316 2916068649 Bacteria 6943657
784 2916079363 2916076590 Bacteria 6596108
785 2919103749 2919100787 Bacteria 7710546
786 2919115897 2919114240 Bacteria 5700270
787 2919167288 2919166419 Bacteria 4952238
788 2919171517 2919171160 Bacteria 6499771
789 2919409223 2919408235 Bacteria 6149349
790 2920762940 2920760137 Bacteria 7427611
791 2920823776 2920822456 Bacteria 6897201
792 2921204903 2921201388 Bacteria 6926299
793 2921215179 2921208531 Bacteria 6745326
794 2921243959 2921237296 Bacteria 6876710
795 2921245996 2921244191 Bacteria 6568419
796 2921250926 2921250672 Bacteria 6677771
797 2921261573 2921257292 Bacteria 6808382
798 2921270400 2921263974 Bacteria 6864552
799 2921288007 2921282425 Bacteria 6826397
800 2921290166 2921289301 Bacteria 7316391
801 2921301498 2921296804 Bacteria 7176999
802 2923557654 2923556063 Bacteria 6793593
803 2924146892 2924144063 Bacteria 6883928
804 2924157235 2924150972 Bacteria 7169444
805 2924160536 2924158325 Bacteria 7188855
806 2924179515 2924172951 Bacteria 6749356
807 2924181462 2924179722 Bacteria 6843264
808 2924189476 2924186466 Bacteria 6876637
809 2924195923 2924193448 Bacteria 6955718
810 2924204359 2924200457 Bacteria 6757188
811 2924209873 2924207177 Bacteria 6917007
812 2924224405 2924221636 Bacteria 7113495
813 2924234899 2924228884 Bacteria 6633132
814 2924740450 2924733363 Bacteria 7574837
815 2924754150 2924748358 Bacteria 6154725
816 2926756851 2926754445 Bacteria 5964435
817 2926761076 2926760298 Bacteria 5505990
818 2933007771 2933006813 Bacteria 4912075
819 2933012549 2933011516 Bacteria 5439334
820 2933573031 2933570622 Bacteria 7023390
821 2933593682 2933586486 Bacteria 7667493
822 2933594990 2933594066 Bacteria 5594265
823 2933605070 2933599457 Bacteria 5858799
824 2935895229 2935894831 Bacteria 6620579
825 2935904218 2935901341 Bacteria 7341747
826 2936368206 2936367885 Bacteria 7324495
827 2936378860 2936375103 Bacteria 6652732
828 2936388070 2936381700 Bacteria 7006523
829 2937000488 2936996657 Bacteria 6298727
830 2937009552 2937002841 Bacteria 6934057
831 2937010850 2937009748 Bacteria 6746052
832 2937022028 2937016420 Bacteria 6782579
833 2937027961 2937023124 Bacteria 6815156
834 2937029895 2937029754 Bacteria 6424026
835 2937042534 2937036028 Bacteria 6846469
836 2937044287 2937042894 Bacteria 6741576
837 2937050275 2937049772 Bacteria 6757901
838 2937063493 2937056579 Bacteria 7107896
839 2937065074 2937063883 Bacteria 7199456
840 2937073843 2937071275 Bacteria 6984483
841 2937083002 2937078374 Bacteria 6610289
842 2937091595 2937084907 Bacteria 6618516
843 2937097480 2937091812 Bacteria 6979387
844 2937103672 2937098957 Bacteria 7249374
845 2937112991 2937106411 Bacteria 6947143
846 2937118210 2937113482 Bacteria 6505872
847 2937121149 2937119839 Bacteria 6597547
848 2937130122 2937126314 Bacteria 6771275
849 2941500290 2941499720 Bacteria 7599444
850 2957380054 2957375807 Bacteria 6425588
851 2957385105 2957382221 Bacteria 6737050
852 2957389168 2957388812 Bacteria 6778072
853 2957398668 2957395598 Bacteria 6822399
854 2957405484 2957402308 Bacteria 6741770
855 2957415243 2957408893 Bacteria 6558585
856 2957418050 2957415311 Bacteria 6991633
857 2957423673 2957422303 Bacteria 7172205
858 2957430494 2957430029 Bacteria 7022557
859 2957441992 2957437181 Bacteria 6568994
860 2957446688 2957443900 Bacteria 6869977
861 2957453476 2957450854 Bacteria 6765715
862 2957457796 2957457609 Bacteria 6967680
863 2957466478 2957464669 Bacteria 6568877
864 2957473950 2957471148 Bacteria 6797643
865 2957480665 2957478035 Bacteria 6756658
866 2957485826 2957484790 Bacteria 6703082
867 2957495959 2957491536 Bacteria 6695180
868 2957499843 2957498199 Bacteria 7126688
869 2957511471 2957505466 Bacteria 7253085
870 2958141182 2958137437 Bacteria 6050276
871 2958162720 2958158011 Bacteria 6058449
872 2960590053 2960584000 Bacteria 6864594
873 2960595544 2960591022 Bacteria 6622873
874 2960600611 2960597568 Bacteria 6550735
875 2960609388 2960603979 Bacteria 6898737
876 2960617092 2960610863 Bacteria 6691244
877 2960617669 2960617483 Bacteria 6727748
878 2960629805 2960624210 Bacteria 6875384
879 2960633255 2960631154 Bacteria 6732508
880 2960645353 2960637947 Bacteria 7296468
881 2960648764 2960645483 Bacteria 7211087
882 2960653560 2960652885 Bacteria 7083688
883 2960666370 2960660292 Bacteria 7041660
884 2960673889 2960667422 Bacteria 6763020
885 2960675347 2960674078 Bacteria 6609048
886 2960684133 2960680706 Bacteria 6624464
887 2960692042 2960687367 Bacteria 6535474
888 2960696344 2960693952 Bacteria 6749742
889 2961142238 2961136820 Bacteria 6775228
890 2964613018 2964607997 Bacteria 7101408
891 2964620737 2964615318 Bacteria 6809089
892 2964627911 2964621998 Bacteria 6834995
893 2964633153 2964628898 Bacteria 7083044
894 2964642225 2964636051 Bacteria 7091832
895 2964646125 2964643177 Bacteria 6820887
896 2964653066 2964649959 Bacteria 6675118
897 2964661921 2964656573 Bacteria 7100150
898 2964666009 2964663802 Bacteria 7019362
899 2964671722 2964670856 Bacteria 6851364
900 2964684492 2964678106 Bacteria 6792020
901 2964685426 2964685014 Bacteria 6839111
902 2964695805 2964691889 Bacteria 6802758
903 2964705292 2964698721 Bacteria 6765331
904 2964712358 2964705432 Bacteria 7114648
905 2964718499 2964712639 Bacteria 6695970
906 2964725759 2964719344 Bacteria 7286602
907 2965026155 2965025482 Bacteria 6532201
908 2965115652 2965110997 Bacteria 6693150
909 2967667334 2967664464 Bacteria 6948836
910 2967672180 2967671571 Bacteria 7021409
911 2967678888 2967678726 Bacteria 7264382
912 2967686386 2967686174 Bacteria 6678622
913 2967693209 2967693043 Bacteria 6804451
914 2967703903 2967699805 Bacteria 6854538
915 2967709203 2967706974 Bacteria 7186053
916 2967716566 2967714385 Bacteria 7000047
917 2967722200 2967721400 Bacteria 7073753
918 2967734764 2967728569 Bacteria 6641507
919 2967740934 2967735183 Bacteria 6827012
920 2967744083 2967742019 Bacteria 6794534
921 2967752141 2967748971 Bacteria 6733771
922 2967757698 2967755722 Bacteria 6814706
923 2967763783 2967762386 Bacteria 6923502
924 2967774396 2967769361 Bacteria 6587838
925 2967782140 2967775926 Bacteria 6738189
926 2968144065 2968138860 Bacteria 6605449
927 2970026034 2970019648 Bacteria 7072033
928 2970031818 2970026789 Bacteria 6785236
929 2970037199 2970033650 Bacteria 7118744
930 2970043321 2970040964 Bacteria 6731123
931 2970049955 2970047711 Bacteria 7088379
932 2970059644 2970054988 Bacteria 6611507
933 2970065331 2970061556 Bacteria 7099761
934 2970074045 2970068827 Bacteria 7123112
935 2970077004 2970076120 Bacteria 6697332
936 2970085683 2970082768 Bacteria 6183754
937 2970093272 2970088815 Bacteria 6933825
938 2970096979 2970095765 Bacteria 6936963
939 2970108528 2970102677 Bacteria 6812532
940 2970109855 2970109326 Bacteria 6863976
941 2970118004 2970116247 Bacteria 6501857
942 2970128208 2970122695 Bacteria 6625855
943 2970129482 2970129317 Bacteria 6806560
944 2970136991 2970136068 Bacteria 7207982
945 2970148675 2970143518 Bacteria 6446480
946 2970153850 2970149975 Bacteria 6779706
947 2970162844 2970156795 Bacteria 7168044
948 2970167468 2970164137 Bacteria 6861252
949 2970171757 2970170962 Bacteria 6876229
950 2970178369 2970177841 Bacteria 6768001
951 2970187921 2970184632 Bacteria 7054431
952 2970198360 2970191845 Bacteria 7032787
953 2970494842 2970489779 Bacteria 6517260
954 2970513264 2970510686 Bacteria 7006402
955 2970529620 2970524798 Bacteria 6840927
956 2970554364 2970547951 Bacteria 6931819
957 2970619613 2970619444 Bacteria 6986144
958 2977520921 2977516862 Bacteria 6940108
959 2977527239 2977523885 Bacteria 6960446
960 2977531870 2977530762 Bacteria 6951399
961 2977537953 2977537788 Bacteria 6929320
962 2977544903 2977544691 Bacteria 6875412
963 2977551950 2977551784 Bacteria 7125765
964 2977563162 2977558990 Bacteria 6863948
965 2977568879 2977565890 Bacteria 6901543
966 2977578997 2977572785 Bacteria 6763888
967 2977581530 2977579622 Bacteria 6772100
968 2977905303 2977898635 Bacteria 6675551
969 2977939767 2977935797 Bacteria 6252826
970 2978973721 2978969890 Bacteria 5400756
971 2979093645 2979089926 Bacteria 5670289
972 2979098970 2979095461 Bacteria 5669583
973 2979105621 2979100975 Bacteria 5423623
974 2984512532 2984509177 Bacteria 5274802
975 2984521107 2984518228 Bacteria 5277463
976 2984540401 2984537506 Bacteria 5277481
977 2984591993 2984587000 Bacteria 5263363
978 2984602598 2984601300 Bacteria 5455244
979 2987648754 2987645492 Bacteria 6117018
980 2987678837 2987673487 Bacteria 6884027
981 2989354261 2989349275 Bacteria 6349068
982 2989771968 2989771324 Bacteria 5605128
983 2989778103 2989776772 Bacteria 4843317
984 2996340241 2996336353 Bacteria 5511628
985 2996392064 2996386984 Bacteria 6978667
986 2996890887 2996887358 Bacteria 5795980
987 2996896599 2996893221 Bacteria 5823108
988 3004171011 3004167301 Bacteria 8330599
989 3004235378 3004232784 Bacteria 6662140
990 3004273455 3004268573 Bacteria 7043476
991 3005412323 3005409236 Bacteria 7188837
992 3005417064 3005416602 Bacteria 7064308
993 3005446684 3005445848 Bacteria 6906074
994 3005453363 3005452660 Bacteria 5889319
995 639647358 639633055 Bacteria 7751309
996 643825017 643692032 Bacteria 6891900
997 648740567 648276728 Bacteria 6968865
998 649874706 649633066 Bacteria 6690028
999 650739457 650716007 Bacteria 5573770
1000 8003570501 8003570095 Bacteria 5747666
1001 8003992827 8003992118 Bacteria 7266902
1002 8004000154 8003999396 Bacteria 7063185
1003 8004302614 8004300914 Bacteria 6132239
1004 8004315314 8004312739 Bacteria 7444653
1005 8005246648 8005246636 Bacteria 4933972
1006 8005262141 8005258706 Bacteria 6184835
1007 8005279492 8005275841 Bacteria 6929066
1008 8005286474 8005282627 Bacteria 6675747
1009 8005292716 8005289223 Bacteria 6634003
1010 8005304488 8005301065 Bacteria 6614431
1011 8005309086 8005307578 Bacteria 7395396
1012 8005315125 8005314921 Bacteria 7072929
1013 8005325414 8005321885 Bacteria 5795980
1014 8005376693 8005376324 Bacteria 6590079
1015 8005386080 8005382845 Bacteria 6732062
1016 8005397526 8005395548 Bacteria 6806915
1017 8005432182 8005430974 Bacteria 6689030
1018 8005461845 8005460587 Bacteria 7157962
1019 8005485705 8005484373 Bacteria 6297373
1020 8005499249 8005497431 Bacteria 6477605
1021 8005544269 8005542996 Bacteria 7077758
1022 8005559005 8005556819 Bacteria 6908598
1023 8005570357 8005563573 Bacteria 7153261
1024 8005572601 8005570704 Bacteria 6957481
1025 8005620443 8005619151 Bacteria 7030230
1026 8005628831 8005626139 Bacteria 6534237
1027 8005648274 8005645114 Bacteria 6950293
1028 8005660045 8005658619 Bacteria 4500593
1029 8005670665 8005668836 Bacteria 6953162
1030 8005684677 8005682033 Bacteria 6726518
1031 8005690909 8005688590 Bacteria 6610080
1032 8005698873 8005695170 Bacteria 6912330
1033 8018131228 8018127388 Bacteria 7351159
1034 8018152173 8018150411 Bacteria 5549903
1035 8018169078 8018163183 Bacteria 7277977
1036 8018177332 8018176218 Bacteria 6896178
1037 8023687062 8023680758 Bacteria 7729763
1038 8024481025 8024479707 Bacteria 6954785
1039 8024489829 8024486573 Bacteria 6540512
1040 8024503339 8024501048 Bacteria 6427847
1041 8046767598 8046767195 Bacteria 7547379
1042 8049293849 8049293176 Bacteria 6128433
1043 8054461826 8054460903 Bacteria 4872905
1044 8054563737 8054558443 Bacteria 5204801
1045 8055434107 8055431914 Bacteria 4551896
1046 8056379486 8056375014 Bacteria 7006639
1047 8056384834 8056382006 Bacteria 6408074
1048 8056880047 8056875544 Bacteria 4355797
1049 8057579060 8057575449 Bacteria 7367519
1050 8057879662 8057874678 Bacteria 7494653
1051 Ga0496111_0024593
1052 JGI25155J39150_1000072
1053 JGI25156J39149_1000086
1054 JGI25162J39368_1000463
1055 JGI25154J39366_1000449
1056 JGI25158J39367_1000141
1057 JGI25157J39369_1000113
1058 JGI25152J39213_1001001
1059 JGI25152J39213_1003225
1060 JGI25152J39213_1012758
1061 JGI25150J39212_1000031
1062 JGI25150J39212_1001947
1063 JGI25159J45721_1000064
1064 JGI25159J45721_1000422
1065 JGI25159J45721_1001589
1066 JGI25151J46595_10000062
1067 JGI25151J46595_10009994
1068 JGI25151J46595_10011934
1069 JGI25151J46595_10028871
1070 JGI25406J46586_10004236
1071 JGI25165J46597_1000582
1072 JGI25165J46597_1001530
1073 JGI25165J46597_1003546
1074 JGI25153J46596_10006447
1075 JGI25153J46596_10010124
1076 JGI25153J46596_10015146
1077 rootL2_10017824
1078 JGI25160J50197_1000052
1079 JGI25160J50197_1000638
1080 JGI25160J50197_1002059
1081 JGI25160J50197_1010657
1082 JGI25160J50197_1032001
1083 JGI25161J50226_1000073
1084 JGI25161J50226_1000153
1085 JGI25161J50226_1000439
1086 JGI25161J50226_1004658
1087 Ga0055526_1002265
1088 Ga0055526_1005053
1089 Ga0055526_1008569
1090 Ga0055526_1015498
1091 Ga0055524_1000744
1092 Ga0055524_1002453
1093 Ga0055524_1004985
1094 Ga0055524_1012283
1095 Ga0055536_1001014
1096 Ga0055536_1002940
1097 Ga0055536_1007669
1098 Ga0055528_1000097
1099 Ga0055528_1000443
1100 Ga0055528_1003314
1101 Ga0055530_10004386
1102 Ga0055540_1000914
1103 Ga0055540_1003207
1104 Ga0055531_10001123
1105 Ga0055531_10005803
1106 Ga0055543_1000035
1107 Ga0055543_1000048
1108 Ga0055543_1001249
1109 Ga0055543_1002146
1110 Ga0065165_1000253
1111 Ga0065165_1001950
1112 Ga0065165_1016484
1113 Ga0065165_1024210
1114 Ga0070670_100001192
1115 Ga0070661_100099487
1116 Ga0070671_100031955
1117 Ga0070714_100011464
1118 Ga0070665_100011473
1119 Ga0070665_100018231
1120 Ga0068855_100148091
1121 Ga0068856_100038217
1122 Ga0081539_10005104
1123 Ga0075365_10010771
1124 Ga0075365_10048440
1125 Ga0075365_10127292
1126 Ga0075362_10000585
1127 Ga0075367_10000155
1128 Ga0075369_10009357
1129 Ga0075369_10019034
1130 Ga0075370_10018558
1131 Ga0079104_1000010
1132 Ga0099826_10000983
1133 Ga0105251_10006290
1134 Ga0105240_10000027
1135 Ga0105248_10055886
1136 Ga0105248_10087396
1137 Ga0105248_10283040
1138 Ga0105237_10009004
1139 Ga0123341_1000513
1140 Ga0123342_1015271
1141 Ga0105246_10054603
1142 Ga0157371_10000655
1143 Ga0157371_10002849
1144 Ga0157370_10002286
1145 Ga0157370_10003889
1146 Ga0157369_10149927
1147 Ga0171463_1001
1148 Ga0182007_10001095
1149 Ga0183363_1105
1150 Ga0214544_1000008
1151 Ga0214542_1035918
1152 Ga0214543_1000003
1153 Ga0214543_1000004
1154 Ga0213875_10002405
1155 Ga0213875_10004006
1156 Ga0213875_10011978
1157 Ga0228710_1000001
1158 Ga0209435_100036
1159 Ga0209436_100047
1160 Ga0209436_101060
1161 Ga0209437_100033
1162 Ga0209437_100036
1163 Ga0207425_1000031
1164 Ga0207425_1000891
1165 Ga0207425_1003713
1166 Ga0207425_1009693
1167 Ga0209646_1000132
1168 Ga0209026_1000236
1169 Ga0209677_101419
1170 Ga0209148_1008609
1171 Ga0209759_1000269
1172 Ga0209129_1000053
1173 Ga0209129_1000125
1174 Ga0209129_1000310
1175 Ga0209129_1000585
1176 Ga0209129_1000772
1177 Ga0209129_1001648
1178 Ga0209233_1000056
1179 Ga0209233_1000064
1180 Ga0209233_1000519
1181 Ga0209565_1016405
1182 Ga0209673_1000254
1183 Ga0209673_1000946
1184 Ga0209673_1001299
1185 Ga0209673_1001710
1186 Ga0209673_1002387
1187 Ga0209673_1008489
1188 Ga0209130_1000006
1189 Ga0209130_1000008
1190 Ga0209130_1000018
1191 Ga0209130_1014045
1192 Ga0209130_1023981
1193 Ga0209676_1001570
1194 Ga0209676_1002579
1195 Ga0209676_1013691
1196 Ga0209025_1000074
1197 Ga0209025_1000080
1198 Ga0209025_1000087
1199 Ga0209025_1000100
1200 Ga0209025_1000165
1201 Ga0209025_1000284
1202 Ga0209025_1000900
1203 Ga0209025_1001720
1204 Ga0209025_1005547
1205 Ga0209025_1012512
1206 Ga0209025_1019260
1207 Ga0209564_1000233
1208 Ga0209564_1000399
1209 Ga0209564_1000846
1210 Ga0209564_1002545
1211 Ga0209564_1012387
1212 Ga0209564_1023443
1213 Ga0209758_1000081
1214 Ga0209758_1000121
1215 Ga0209758_1000313
1216 Ga0209758_1000420
1217 Ga0209758_1005053
1218 Ga0209758_1040498
1219 Ga0209758_1043536
1220 Ga0209050_1001881
1221 Ga0209256_1000882
1222 Ga0209256_1001394
1223 Ga0209256_1001907
1224 Ga0209256_1002206
1225 Ga0209256_1004715
1226 Ga0209256_1004864
1227 Ga0209256_1005960
1228 Ga0209256_1022120
1229 Ga0207426_1000016
1230 Ga0207426_1000044
1231 Ga0207426_1000106
1232 Ga0207426_1000265
1233 Ga0207426_1000417
1234 Ga0209051_1000339
1235 Ga0209051_1001902
1236 Ga0209051_1002337
1237 Ga0209051_1027560
1238 Ga0209051_1036604
1239 Ga0209051_1047469
1240 Ga0209257_1002142
1241 Ga0209257_1002341
1242 Ga0209257_1010558
1243 Ga0209257_1015576
1244 Ga0207695_10000024
1245 Ga0207671_10001725
1246 Ga0207650_10002047
1247 Ga0207644_10192725
1248 Ga0207667_10122376
1249 Ga0207702_10015626
1250 Ga0209281_1000053
1251 Ga0209281_1000164
1252 Ga0209371_1000009
1253 Ga0209371_1002475
1254 Ga0209282_1000007
1255 Ga0209282_1000898
1256 Ga0209813_10027815
1257 Ga0307515_10000115
1258 Ga0307515_10001359
1259 Ga0307515_10089792
1260 Ga0307515_10222112
1261 Ga0268256_1000010
1262 Ga0316181_1239067
1263 Ga0307513_10011887
1264 Ga0307513_10038647
1265 Ga0307406_10003779
1266 Ga0307412_10003099
1267 Ga0315914_1000006
1268 Ga0307416_100150879
1269 Ga0315913_1000002
1270 Ga0315915_1000001
1271 Ga0373927_0002733
1272 Ga0373925_0031066
1273 Ga0395905_0005671
1274 Ga0436364_0390735
1275 Ga0436364_1204360
1276 Ga0436364_1438425
1277 Ga0436365_1554358
1278 Ga0436360_0149751
1279 Ga0436360_0288706
1280 Ga0436360_0408422
1281 Ga0436360_0505528
1282 Ga0436361_0319009
1283 Ga0436363_1060966
1284 Ga0436363_1197407
1285 Ga0436363_1230673
1286 Ga0439466_0028183
1287 Ga0439465_0031467
1288 Ga0439465_0053245
1289 Ga0451807_1817935
1290 Ga0451839_0010134
1291 Ga0451841_0033619
1292 Ga0451845_0243198
1293 Ga0451851_0604339
1294 Ga0451843_1238200
1295 Ga0439449_0003826
1296 Ga0439449_0022152
1297 Ga0450920_002848
1298 Ga0450907_010125
1299 Ga0439434_0022682
1300 Ga0466970_0001709
1301 Ga0495617_043749
1302 Ga0495592_0043901
1303 Ga0495629_0003563
1304 Ga0495638_0000909
1305 Ga0495638_0006992
1306 Ga0495638_0032652
1307 Ga0495651_0156601
1308 Ga0495650_0077477
1309 Ga0495605_0002885
1310 Ga0495605_0020092
1311 Ga0495605_0101946
1312 Ga0495585_0005637
1313 Ga0495585_0027284
1314 Ga0495585_0075520
1315 Ga0495596_0056736
1316 Ga0495607_0019058
1317 Ga0495583_0109904
1318 Ga0495606_0001156
1319 Ga0495606_0029052
1320 Ga0495606_0029148
1321 Ga0495610_0003480
1322 Ga0495610_0013822
1323 Ga0495610_0018401
1324 Ga0495616_0018049
1325 Ga0495620_0034867
1326 Ga0495631_0000552
1327 Ga0495631_0054484
1328 Ga0495632_0027851
1329 Ga0495632_0038141
1330 Ga0495643_0022357
1331 Ga0495643_0026416
1332 Ga0495643_0048373
1333 Ga0495643_0049433
1334 Ga0495648_0020286
1335 Ga0495648_0025458
1336 Ga0495654_0001318
1337 Ga0495654_0024297
1338 Ga0495597_0077897
1339 Ga0495622_0007629
1340 Ga0495633_0009944
1341 Ga0495668_0100754
1342 Ga0495611_0010012
1343 Ga0495625_0006284
1344 Ga0495625_0029283
1345 Ga0495625_0071854
1346 Ga0495625_0139829
1347 Ga0495661_0073202
1348 Ga0495588_0001062
1349 Ga0495588_0036021
1350 Ga0495657_0015664
1351 Ga0495670_0103076
1352 Ga0495649_0044228
1353 Ga0495600_0002896
1354 Ga0495660_0049706
1355 Ga0495604_0025552
1356 Ga0495687_039835
1357 Ga0495687_051550
1358 Ga0495673_0061854
1359 Ga0495681_0004574
1360 Ga0495686_0001669
1361 Ga0495686_0004735
1362 Ga0495686_0057703
1363 Ga0495686_0060053
1364 Ga0495686_0070817
1365 Ga0495686_0099745
1366 Ga0496101_0141164
1367 Ga0496106_0000290
1368 Ga0496114_0153077
1369 Ga0496116_0000036
1370 Ga0496116_0002110
1371 Ga0496116_0003830
1372 Ga0496116_0015688
1373 Ga0496116_0066243
1374 Ga0496116_0139078
1375 Ga0496117_0000002
1376 Ga0496117_0001435
1377 Ga0496117_0004851
1378 Ga0496117_0013560
1379 Ga0496117_0021217
1380 Ga0496117_0098484
1381 Ga0496118_0000084
1382 Ga0496118_0003531
1383 Ga0496118_0021868
1384 Ga0496118_0062243
1385 Ga0496118_0162261
1386 Ga0496119_0009456
1387 Ga0496119_0015425
1388 Ga0496119_0032679
1389 Ga0496120_0002064
1390 Ga0496120_0034619
1391 Ga0496120_0061532
1392 Ga0496121_0000001
1393 Ga0496121_0001579
1394 Ga0496121_0009025
1395 Ga0496121_0015537
1396 Ga0496121_0018227
1397 Ga0496121_0023889
1398 Ga0496121_0049075
1399 Ga0496121_0131546
1400 Ga0496121_0235891
1401 Ga0496122_0000001
1402 Ga0496122_0000009
1403 Ga0496122_0000205
1404 Ga0496122_0030166
1405 Ga0496122_0043468
1406 Ga0496122_0153434
1407 Ga0496123_0000001
1408 Ga0496123_0000034
1409 Ga0496123_0000103
1410 Ga0496123_0004660
1411 Ga0496123_0013686
1412 Ga0496123_0017042
1413 Ga0496123_0135552
1414 Ga0496124_0000133
1415 Ga0496124_0000854
1416 Ga0496124_0001267
1417 Ga0496124_0010491
1418 Ga0496124_0016202
1419 Ga0496124_0042473
1420 Ga0496124_0088868
1421 Ga0496124_0090341
1422 Ga0496124_0100397
1423 Ga0496124_0110942
1424 Ga0496124_0160134
1425 Ga0496124_0227943
1426 Ga0496125_0000001
1427 Ga0496125_0000385
1428 Ga0496125_0009020
1429 Ga0496125_0030391
1430 Ga0496125_0103777
1431 Ga0496125_0119483
1432 Ga0496125_0133197
1433 Ga0496126_0000597
1434 Ga0496126_0004085
1435 Ga0496126_0021823
1436 Ga0496126_0061511
1437 Ga0496126_0083019
1438 Ga0496126_0131479
1439 Ga0495678_013663
1440 Ga0495678_035452
1441 Ga0501033_0000038
1442 Ga0501034_0003468
1443 Ga0501034_0060906
1444 Ga0501034_0414058
1445 Ga0501039_0276783
1446 Ga0501043_0114550
1447 Ga0501043_0122013
1448 Ga0501043_0173131
1449 Ga0501083_0026686
1450 Ga0501035_0000326
1451 Ga0501044_0086647
1452 nmdc:mga03683_1774_c1
1453 nmdc:mga03n38_4300_c1
1454 nmdc:mga00v17_1277_c1
1455 nmdc:mga0yw44_15345_c1
1456 nmdc:mga0yw44_186126_c1
1457 nmdc:mga0yw44_198377_c1
1458 nmdc:mga06z11_124506_c1
1459 nmdc:mga07m45_27554_c1
1460 nmdc:mga0sz30_1606_c1
1461 nmdc:mga0sz30_3627_c1
1462 Ga0495601_0028117
1463 Ga0500610_0005983
1464 Ga0500578_0070518
1465 Ga0500556_0018204
1466 Ga0500560_046261
1467 Ga0500594_0000544
1468 Ga0500618_000055
1469 Ga0500618_000272
1470 Ga0500618_014285
1471 Ga0500658_0002594
1472 Ga0500561_0000159
1473 Ga0500568_0000998
1474 Ga0500568_0002382
1475 Ga0500573_0005900
1476 Ga0500590_002471
1477 Ga0500604_0007590
1478 Ga0500616_0000224
1479 Ga0500616_0001692
1480 Ga0500622_0001161
1481 Ga0500622_0002387
1482 Ga0500624_000682
1483 Ga0500627_0041929
1484 Ga0500633_0000582
1485 Ga0500634_0003699
1486 Ga0500634_0021606
1487 Ga0500636_0000004
1488 Ga0500636_0007681
1489 2509108432
1490 2509141557
1491 2509374527
1492 2509387798
1493 2509443399
1494 2510132222
1495 2510316400
1496 2510840266
1497 2510898559
1498 2511133572
1499 2511171091
1500 2511187358
1501 2511197925
1502 2511500935
1503 2512532358
1504 2512972314
1505 2513569058
1506 2513580799
1507 2513583527
1508 2513596167
1509 2513603393
1510 2513617546
1511 2513630874
1512 2513709285
1513 2513865704
1514 2513882740
1515 2513905285
1516 2513907603
1517 2513925631
1518 2513988211
1519 2513999480
1520 2514004848
1521 2514024450
1522 2515111204
1523 2515608058
1524 2515636010
1525 2515642662
1526 2515658823
1527 2515740383
1528 2516208813
1529 2516892212
1530 2517039847
1531 2517075388
1532 2517093977
1533 2517405792
1534 2517569021
1535 2520375326
1536 2524451210
1537 2524460727
1538 2530643971
1539 2535515639
1540 2537877088
1541 2551676395
1542 2551687502
1543 2551699205
1544 2551714807
1545 2551717917
1546 2551723824
1547 2551737802
1548 2551740886
1549 2554247038
1550 2558862509
1551 2558863554
1552 2559294263
1553 2561465997
1554 2585165475
1555 2585203004
1556 2585220912
1557 2585230492
1558 2585256688
1559 2585266261
1560 2585273341
1561 2585278829
1562 2585325556
1563 2585329713
1564 2585387263
1565 2585392636
1566 2585400226
1567 2585527885
1568 2585537296
1569 2585541512
1570 2585549989
1571 2585556360
1572 2585559358
1573 2585822767
1574 2585839355
1575 2585847292
1576 2585902030
1577 2585905265
1578 2585995024
1579 2585999567
1580 2587979620
1581 2599333872
1582 2599418670
1583 2599602673
1584 2599723161
1585 2600191859
1586 2600375195
1587 2601608752
1588 2601745526
1589 2616296714
1590 2616305897
1591 2616553858
1592 2617381897
1593 2643807276
1594 2643810072
1595 2643855946
1596 2643918635
1597 2644007844
1598 2644046657
1599 2644069457
1600 2644109069
1601 2644151589
1602 2644196439
1603 2644202364
1604 2644206254
1605 2644242810
1606 2644296912
1607 2644311724
1608 2644329994
1609 2644380658
1610 2644420611
1611 2644454136
1612 2644479446
1613 2644493472
1614 2644502488
1615 2644518820
1616 2644544869
1617 2644617523
1618 2644649901
1619 2644655166
1620 2644675726
1621 2644689473
1622 2657683343
1623 2671112784
1624 2688600234
1625 2692316893
1626 2719384774
1627 2719664535
1628 2719730926
1629 2720490955
1630 2720612319
1631 2720619157
1632 2720630559
1633 2720774252
1634 2721157791
1635 2721163150
1636 2721398485
1637 2722839320
1638 2723025976
1639 2723559523
1640 2723566140
1641 2724037298
1642 2724043682
1643 2724088859
1644 2724103405
1645 2724109245
1646 2725951046
1647 2730106912
1648 2730163414
1649 2730297423
1650 2738803659
1651 2738948803
1652 2739035816
1653 2753460744
1654 2756673207
1655 2766067682
1656 2776912690
1657 2778177386
1658 2792584096
1659 2792624876
1660 2792628330
1661 2792638412
1662 2792749217
1663 2793296128
1664 2793316870
1665 2793322697
1666 2793330956
1667 2793333534
1668 2793339879
1669 2793350110
1670 2793353493
1671 2793358834
1672 2793370525
1673 2802717664
1674 2802723408
1675 2802731141
1676 2802736148
1677 2802743642
1678 2802750646
1679 2804751267
1680 2805926651
1681 2805937506
1682 2806047004
1683 2806052588
1684 2806058641
1685 2806067590
1686 2806073882
1687 2808985963
1688 2819242626
1689 2819556084
1690 2819612289
1691 2819639326
1692 2819684230
1693 2821124173
1694 2838017204
1695 2838023275
1696 2838031337
1697 2838037640
1698 2838047014
1699 2838049313
1700 2838063240
1701 2838074622
1702 2838076372
1703 2838662647
1704 2838670772
1705 2838676810
1706 2838681259
1707 2838688697
1708 2838694707
1709 2838703143
1710 2838708084
1711 2838715694
1712 2838720505
1713 2838726450
1714 2838730992
1715 2838738804
1716 2838744114
1717 2841842703
1718 2841847440
1719 2841856795
1720 2841860024
1721 2841870374
1722 2842080684
1723 2842117648
1724 2842121303
1725 2842126530
1726 2842131703
1727 2842142483
1728 2842147633
1729 2842153128
1730 2842159965
1731 2842168208
1732 2842171938
1733 2842176747
1734 2842183418
1735 2842188803
1736 2842197875
1737 2842199703
1738 2842207776
1739 2842213114
1740 2842221123
1741 2842225267
1742 2842234981
1743 2842237496
1744 2842245578
1745 2842252699
1746 2842259772
1747 2842270172
1748 2842274611
1749 2842281429
1750 2842287195
1751 2842294341
1752 2842302532
1753 2842306855
1754 2842314534
1755 2842318727
1756 2842343682
1757 2842360735
1758 2842365090
1759 2842371722
1760 2842380738
1761 2842387809
1762 2842398348
1763 2842404463
1764 2842410852
1765 2842417692
1766 2842427276
1767 2842433994
1768 2842440370
1769 2842446919
1770 2842453453
1771 2842468413
1772 2842474931
1773 2842478068
1774 2842482774
1775 2842493682
1776 2842497362
1777 2842504877
1778 2842509648
1779 2842516809
1780 2842525273
1781 2842923729
1782 2844005662
1783 2844015549
1784 2844169572
1785 2844455222
1786 2847418040
1787 2848993015
1788 2850080406
1789 2852388992
1790 2854898809
1791 2854921608
1792 2855831286
1793 2855840411
1794 2855879077
1795 2856328534
1796 2856345543
1797 2857520371
1798 2857531752
1799 2858800940
1800 2869261267
1801 2871439440
1802 2871455338
1803 2871470897
1804 2874111421
1805 2874165720
1806 2874175351
1807 2876400526
1808 2876409901
1809 2878732526
1810 2878775254
1811 2891376605
1812 2896386574
1813 2899792090
1814 2899803697
1815 2899847208
1816 2906389911
1817 2906408334
1818 2913297511
1819 2913311057
1820 2915986144
1821 2915987275
1822 2915996298
1823 2916005867
1824 2916010890
1825 2916016525
1826 2916027483
1827 2916034764
1828 2916035382
1829 2916042659
1830 2916054725
1831 2916055395
1832 2916068043
1833 2916070316
1834 2916079363
1835 2919103749
1836 2919115897
1837 2919167288
1838 2919171517
1839 2919409223
1840 2920762940
1841 2920823776
1842 2921204903
1843 2921215179
1844 2921243959
1845 2921245996
1846 2921250926
1847 2921261573
1848 2921270400
1849 2921288007
1850 2921290166
1851 2921301498
1852 2923557654
1853 2924146892
1854 2924157235
1855 2924160536
1856 2924179515
1857 2924181462
1858 2924189476
1859 2924195923
1860 2924204359
1861 2924209873
1862 2924224405
1863 2924234899
1864 2924740450
1865 2924754150
1866 2926756851
1867 2926761076
1868 2933007771
1869 2933012549
1870 2933573031
1871 2933593682
1872 2933594990
1873 2933605070
1874 2935895229
1875 2935904218
1876 2936368206
1877 2936378860
1878 2936388070
1879 2937000488
1880 2937009552
1881 2937010850
1882 2937022028
1883 2937027961
1884 2937029895
1885 2937042534
1886 2937044287
1887 2937050275
1888 2937063493
1889 2937065074
1890 2937073843
1891 2937083002
1892 2937091595
1893 2937097480
1894 2937103672
1895 2937112991
1896 2937118210
1897 2937121149
1898 2937130122
1899 2941500290
1900 2957380054
1901 2957385105
1902 2957389168
1903 2957398668
1904 2957405484
1905 2957415243
1906 2957418050
1907 2957423673
1908 2957430494
1909 2957441992
1910 2957446688
1911 2957453476
1912 2957457796
1913 2957466478
1914 2957473950
1915 2957480665
1916 2957485826
1917 2957495959
1918 2957499843
1919 2957511471
1920 2958141182
1921 2958162720
1922 2960590053
1923 2960595544
1924 2960600611
1925 2960609388
1926 2960617092
1927 2960617669
1928 2960629805
1929 2960633255
1930 2960645353
1931 2960648764
1932 2960653560
1933 2960666370
1934 2960673889
1935 2960675347
1936 2960684133
1937 2960692042
1938 2960696344
1939 2961142238
1940 2964613018
1941 2964620737
1942 2964627911
1943 2964633153
1944 2964642225
1945 2964646125
1946 2964653066
1947 2964661921
1948 2964666009
1949 2964671722
1950 2964684492
1951 2964685426
1952 2964695805
1953 2964705292
1954 2964712358
1955 2964718499
1956 2964725759
1957 2965026155
1958 2965115652
1959 2967667334
1960 2967672180
1961 2967678888
1962 2967686386
1963 2967693209
1964 2967703903
1965 2967709203
1966 2967716566
1967 2967722200
1968 2967734764
1969 2967740934
1970 2967744083
1971 2967752141
1972 2967757698
1973 2967763783
1974 2967774396
1975 2967782140
1976 2968144065
1977 2970026034
1978 2970031818
1979 2970037199
1980 2970043321
1981 2970049955
1982 2970059644
1983 2970065331
1984 2970074045
1985 2970077004
1986 2970085683
1987 2970093272
1988 2970096979
1989 2970108528
1990 2970109855
1991 2970118004
1992 2970128208
1993 2970129482
1994 2970136991
1995 2970148675
1996 2970153850
1997 2970162844
1998 2970167468
1999 2970171757
2000 2970178369
2001 2970187921
2002 2970198360
2003 2970494842
2004 2970513264
2005 2970529620
2006 2970554364
2007 2970619613
2008 2977520921
2009 2977527239
2010 2977531870
2011 2977537953
2012 2977544903
2013 2977551950
2014 2977563162
2015 2977568879
2016 2977578997
2017 2977581530
2018 2977905303
2019 2977939767
2020 2978973721
2021 2979093645
2022 2979098970
2023 2979105621
2024 2984512532
2025 2984521107
2026 2984540401
2027 2984591993
2028 2984602598
2029 2987648754
2030 2987678837
2031 2989354261
2032 2989771968
2033 2989778103
2034 2996340241
2035 2996392064
2036 2996890887
2037 2996896599
2038 3004171011
2039 3004235378
2040 3004273455
2041 3005412323
2042 3005417064
2043 3005446684
2044 3005453363
2045 639647358
2046 643825017
2047 648740567
2048 649874706
2049 650739457
2050 8003570501
2051 8003992827
2052 8004000154
2053 8004302614
2054 8004315314
2055 8005246648
2056 8005262141
2057 8005279492
2058 8005286474
2059 8005292716
2060 8005304488
2061 8005309086
2062 8005315125
2063 8005325414
2064 8005376693
2065 8005386080
2066 8005397526
2067 8005432182
2068 8005461845
2069 8005485705
2070 8005499249
2071 8005544269
2072 8005559005
2073 8005570357
2074 8005572601
2075 8005620443
2076 8005628831
2077 8005648274
2078 8005660045
2079 8005670665
2080 8005684677
2081 8005690909
2082 8005698873
2083 8018131228
2084 8018152173
2085 8018169078
2086 8018177332
2087 8023687062
2088 8024481025
2089 8024489829
2090 8024503339
2091 8046767598
2092 8049293849
2093 8054461826
2094 8054563737
2095 8055434107
2096 8056379486
2097 8056384834
2098 8056880047
2099 8057579060
2100 8057879662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

78

408

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbt-assembly1.cif.gz_C-2 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9903 2 370
4wbt-assembly2.cif.gz_B-3 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9889 2 370
4wbt-assembly1.cif.gz_C-2 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9823 2 370
4wbt-assembly2.cif.gz_B-3 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9809 2 370
3hdo-assembly1.cif.gz_B crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens 0.9151 7 365
ID Description Score Start End Superfamily
4wbtB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9955 47 271 3.40.640.10
4wbtB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9911 47 271 3.40.640.10
4wbtA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9799 272 370 3.90.1150.10
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9557 74 265 3.40.640.10
4r5zC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9515 47 269 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A317PG56-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9942 1 368 GO:0008483
GO:0009058
GO:0030170
AF-A0A530BED5-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9937 137 334 GO:0008483
GO:0009058
GO:0030170
AF-A0A529FC94-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9932 108 225 GO:0008483
GO:0009058
GO:0030170
AF-A0A7Y0E0Q2-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9888 5 368 GO:0008483
GO:0009058
GO:0030170
AF-A0A530BED5-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9887 137 334 GO:0008483
GO:0009058
GO:0030170

Map