F488961

General Info

Members Datasets Scaffolds Average Seq Length
1046 320 2092 114

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100053291|Ga0307408_1000532912
Length 131
Sequence MFGASPPTRRAERRMFDKESGLLQGTLDLLVLKTLSWGPMHGYGIASWIEGATGDVLRVEEGSLYPALYRMARKGWIKGEWGVSENNRKAKYYQLTAEGRRQLREQTSGWERFAAAVTRAVGSTQAPAWAK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
294 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
295 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
296 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
297 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
298 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
301 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0.67
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 17.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100053291 3300031548 Bacteria 2920
2 JGI24750J21931_1071170 3300002070 Bacteria 568
3 JGI24751J29686_10013646 3300002459 Bacteria 1677
4 Ga0065714_10104939 3300005288 Bacteria 1573
5 Ga0065704_10300883 3300005289 Bacteria 885
6 Ga0065712_10142546 3300005290 Unclassified 1437
7 Ga0065712_10240530 3300005290 Bacteria 985
8 Ga0065715_10013536 3300005293 Bacteria 2926
9 Ga0065715_10154628 3300005293 Bacteria 1691
10 Ga0065715_10262222 3300005293 Bacteria 1134
11 Ga0065707_10169318 3300005295 Bacteria 1496
12 Ga0070658_10022726 3300005327 Bacteria 5032
13 Ga0070658_10466293 3300005327 Bacteria 1089
14 Ga0070658_11200686 3300005327 Unclassified 659
15 Ga0070676_10017226 3300005328 Bacteria 3998
16 Ga0070676_10438847 3300005328 Bacteria 916
17 Ga0070676_10598069 3300005328 Unclassified 795
18 Ga0070683_100007082 3300005329 Bacteria 9445
19 Ga0070683_100043073 3300005329 Bacteria 4159
20 Ga0070683_100054583 3300005329 Unclassified 3705
21 Ga0070683_100054884 3300005329 Bacteria 3695
22 Ga0070683_100213615 3300005329 Unclassified 1833
23 Ga0070683_100259727 3300005329 Bacteria 1652
24 Ga0070690_100006351 3300005330 Bacteria 6701
25 Ga0070690_100198770 3300005330 Bacteria 1394
26 Ga0070690_100495904 3300005330 Bacteria 913
27 Ga0070670_100000931 3300005331 Bacteria 22956
28 Ga0070670_100010958 3300005331 Bacteria 7744
29 Ga0070670_100018455 3300005331 Bacteria 5985
30 Ga0070670_100028183 3300005331 Bacteria 4833
31 Ga0070670_100083619 3300005331 Bacteria 2742
32 Ga0070670_100157952 3300005331 Bacteria 1965
33 Ga0070670_100215869 3300005331 Bacteria 1669
34 Ga0068869_100001060 3300005334 Bacteria 16029
35 Ga0068869_100005352 3300005334 Bacteria 8070
36 Ga0068869_100139315 3300005334 Unclassified 1872
37 Ga0068869_100157562 3300005334 Bacteria 1765
38 Ga0068869_101810342 3300005334 Unclassified 546
39 Ga0070680_100002136 3300005336 Bacteria 14616
40 Ga0070680_100002990 3300005336 Bacteria 12553
41 Ga0070680_100015797 3300005336 Bacteria 5927
42 Ga0070680_100254557 3300005336 Bacteria 1485
43 Ga0070680_100416283 3300005336 Bacteria 1146
44 Ga0070680_100467663 3300005336 Bacteria 1077
45 Ga0070680_100683969 3300005336 Bacteria 883
46 Ga0070682_100006389 3300005337 Bacteria 6618
47 Ga0070682_100204659 3300005337 Bacteria 1394
48 Ga0070682_101599925 3300005337 Bacteria 563
49 Ga0068868_100034691 3300005338 Unclassified 3896
50 Ga0068868_100076503 3300005338 Bacteria 2676
51 Ga0068868_100137380 3300005338 Bacteria 2004
52 Ga0068868_101425128 3300005338 Bacteria 647
53 Ga0070660_100016010 3300005339 Bacteria 5431
54 Ga0070660_100029493 3300005339 Bacteria 4112
55 Ga0070660_100063637 3300005339 Bacteria 2868
56 Ga0070660_100069056 3300005339 Bacteria 2755
57 Ga0070660_100769980 3300005339 Bacteria 809
58 Ga0070689_100010764 3300005340 Bacteria 6532
59 Ga0070689_100025827 3300005340 Unclassified 4416
60 Ga0070689_100042602 3300005340 Bacteria 3485
61 Ga0070689_100053714 3300005340 Bacteria 3118
62 Ga0070689_100059840 3300005340 Bacteria 2961
63 Ga0070689_100108789 3300005340 Bacteria 2202
64 Ga0070689_100565702 3300005340 Unclassified 981
65 Ga0070689_101969194 3300005340 Unclassified 534
66 Ga0070691_10555596 3300005341 Unclassified 671
67 Ga0070687_100001827 3300005343 Bacteria 7699
68 Ga0070687_100001863 3300005343 Bacteria 7644
69 Ga0070687_100005753 3300005343 Bacteria 5032
70 Ga0070687_100017158 3300005343 Bacteria 3321
71 Ga0070687_100030986 3300005343 Unclassified 2619
72 Ga0070687_100419539 3300005343 Bacteria 882
73 Ga0070687_100438380 3300005343 Bacteria 866
74 Ga0070661_100002737 3300005344 Bacteria 12083
75 Ga0070661_100003265 3300005344 Bacteria 11190
76 Ga0070661_100054702 3300005344 Bacteria 2923
77 Ga0070661_100079331 3300005344 Bacteria 2422
78 Ga0070661_100142842 3300005344 Bacteria 1805
79 Ga0070661_100705887 3300005344 Unclassified 822
80 Ga0070661_101211360 3300005344 Bacteria 632
81 Ga0070692_10000979 3300005345 Bacteria 9767
82 Ga0070692_10022352 3300005345 Bacteria 3088
83 Ga0070692_10117872 3300005345 Bacteria 1477
84 Ga0070668_100005400 3300005347 Bacteria 9486
85 Ga0070668_100097375 3300005347 Bacteria 2326
86 Ga0070668_100991044 3300005347 Bacteria 755
87 Ga0070669_100008622 3300005353 Bacteria 7274
88 Ga0070669_100071270 3300005353 Bacteria 2571
89 Ga0070669_100076559 3300005353 Bacteria 2483
90 Ga0070669_100334366 3300005353 Unclassified 1226
91 Ga0070669_100362891 3300005353 Bacteria 1178
92 Ga0070669_100996674 3300005353 Unclassified 719
93 Ga0070675_100002705 3300005354 Bacteria 13320
94 Ga0070675_100006978 3300005354 Bacteria 8677
95 Ga0070675_100027571 3300005354 Bacteria 4565
96 Ga0070675_100043854 3300005354 Bacteria 3657
97 Ga0070675_100064466 3300005354 Bacteria 3029
98 Ga0070675_100078611 3300005354 Bacteria 2748
99 Ga0070675_100179580 3300005354 Bacteria 1829
100 Ga0070675_100554060 3300005354 Bacteria 1040
101 Ga0070675_100961948 3300005354 Unclassified 783
102 Ga0070671_100204385 3300005355 Bacteria 1675
103 Ga0070671_100204396 3300005355 Bacteria 1675
104 Ga0070671_100300866 3300005355 Bacteria 1366
105 Ga0070671_100360765 3300005355 Bacteria 1241
106 Ga0070671_100496910 3300005355 Bacteria 1049
107 Ga0070674_101132913 3300005356 Bacteria 692
108 Ga0070674_101957935 3300005356 Unclassified 533
109 Ga0070673_100018255 3300005364 Bacteria 5007
110 Ga0070673_100087832 3300005364 Bacteria 2535
111 Ga0070673_100470438 3300005364 Unclassified 1133
112 Ga0070673_100628808 3300005364 Unclassified 981
113 Ga0070673_100632501 3300005364 Bacteria 978
114 Ga0070673_101879749 3300005364 Unclassified 568
115 Ga0070688_100012559 3300005365 Bacteria 4747
116 Ga0070688_100048353 3300005365 Bacteria 2642
117 Ga0070688_100067984 3300005365 Unclassified 2271
118 Ga0070688_100076446 3300005365 Bacteria 2155
119 Ga0070688_100139264 3300005365 Bacteria 1646
120 Ga0070688_100374084 3300005365 Bacteria 1049
121 Ga0070659_100001511 3300005366 Bacteria 16769
122 Ga0070659_100005764 3300005366 Bacteria 8913
123 Ga0070659_100201182 3300005366 Bacteria 1640
124 Ga0070659_100205395 3300005366 Bacteria 1622
125 Ga0070659_100360746 3300005366 Bacteria 1221
126 Ga0070659_100382816 3300005366 Bacteria 1185
127 Ga0070659_100420587 3300005366 Bacteria 1130
128 Ga0070667_100126037 3300005367 Bacteria 2231
129 Ga0070667_100320515 3300005367 Bacteria 1398
130 Ga0070667_100657477 3300005367 Bacteria 968
131 Ga0070667_100889540 3300005367 Unclassified 829
132 Ga0070709_10012116 3300005434 Bacteria 4821
133 Ga0070709_10058383 3300005434 Bacteria 2447
134 Ga0070709_10376775 3300005434 Unclassified 1054
135 Ga0070714_100003824 3300005435 Bacteria 11308
136 Ga0070714_100021039 3300005435 Bacteria 5334
137 Ga0070714_100105740 3300005435 Bacteria 2485
138 Ga0070714_100170389 3300005435 Bacteria 1975
139 Ga0070714_100624386 3300005435 Bacteria 1036
140 Ga0070713_100000025 3300005436 Bacteria 96581
141 Ga0070713_100003691 3300005436 Bacteria 10133
142 Ga0070713_100017011 3300005436 Bacteria 5485
143 Ga0070713_100347345 3300005436 Bacteria 1376
144 Ga0070713_101185860 3300005436 Bacteria 739
145 Ga0070701_10094163 3300005438 Bacteria 1647
146 Ga0070701_10438115 3300005438 Bacteria 836
147 Ga0070701_11094592 3300005438 Bacteria 560
148 Ga0070701_11291852 3300005438 Archaea 521
149 Ga0070705_100007971 3300005440 Bacteria 5235
150 Ga0070705_100279122 3300005440 Bacteria 1187
151 Ga0070700_100040419 3300005441 Bacteria 2855
152 Ga0070700_101394340 3300005441 Bacteria 592
153 Ga0070694_100085839 3300005444 Unclassified 2199
154 Ga0070708_100000150 3300005445 Bacteria 48256
155 Ga0070708_100726782 3300005445 Bacteria 934
156 Ga0070708_101332863 3300005445 Unclassified 670
157 Ga0070663_100088935 3300005455 Unclassified 2285
158 Ga0070663_100150323 3300005455 Bacteria 1785
159 Ga0070663_100171442 3300005455 Bacteria 1678
160 Ga0070678_100177345 3300005456 Bacteria 1741
161 Ga0070678_100686840 3300005456 Bacteria 921
162 Ga0070678_101342649 3300005456 Bacteria 666
163 Ga0070678_101364344 3300005456 Bacteria 661
164 Ga0070662_100001762 3300005457 Bacteria 13325
165 Ga0070662_100058268 3300005457 Bacteria 2810
166 Ga0070681_10001841 3300005458 Bacteria 19148
167 Ga0070681_10004249 3300005458 Bacteria 13577
168 Ga0070681_10016713 3300005458 Bacteria 7324
169 Ga0070681_10017329 3300005458 Bacteria 7197
170 Ga0070681_10065137 3300005458 Bacteria 3613
171 Ga0070681_10086421 3300005458 Bacteria 3089
172 Ga0068867_100068712 3300005459 Bacteria 2644
173 Ga0068867_100166200 3300005459 Bacteria 1743
174 Ga0070685_10020652 3300005466 Bacteria 3565
175 Ga0070685_10029395 3300005466 Bacteria 3053
176 Ga0070685_10116626 3300005466 Unclassified 1653
177 Ga0070706_100704816 3300005467 Unclassified 936
178 Ga0070698_101098853 3300005471 Unclassified 744
179 Ga0070698_101387969 3300005471 Bacteria 653
180 Ga0070679_100001387 3300005530 Bacteria 21320
181 Ga0070679_100013336 3300005530 Bacteria 7868
182 Ga0070679_100024483 3300005530 Bacteria 5915
183 Ga0070679_100033424 3300005530 Bacteria 5093
184 Ga0070679_100054755 3300005530 Bacteria 3973
185 Ga0070679_100058217 3300005530 Bacteria 3850
186 Ga0070679_100067053 3300005530 Bacteria 3579
187 Ga0070679_100286546 3300005530 Bacteria 1599
188 Ga0070679_100529926 3300005530 Unclassified 1122
189 Ga0070679_100874976 3300005530 Bacteria 842
190 Ga0070679_101483509 3300005530 Unclassified 625
191 Ga0070684_100007083 3300005535 Bacteria 8715
192 Ga0070684_100011516 3300005535 Bacteria 7044
193 Ga0070684_100012791 3300005535 Bacteria 6740
194 Ga0070684_100095492 3300005535 Bacteria 2649
195 Ga0070684_100241545 3300005535 Bacteria 1650
196 Ga0070684_100649965 3300005535 Bacteria 982
197 Ga0070684_101608007 3300005535 Bacteria 613
198 Ga0068853_100003920 3300005539 Bacteria 11419
199 Ga0068853_100051629 3300005539 Unclassified 3539
200 Ga0070672_100005963 3300005543 Bacteria 8132
201 Ga0070672_100019410 3300005543 Bacteria 4934
202 Ga0070672_100039311 3300005543 Bacteria 3623
203 Ga0070686_100059558 3300005544 Bacteria 2460
204 Ga0070686_100155930 3300005544 Bacteria 1603
205 Ga0070686_100292348 3300005544 Bacteria 1206
206 Ga0070686_100340412 3300005544 Unclassified 1124
207 Ga0070695_100033436 3300005545 Bacteria 3217
208 Ga0070695_101500261 3300005545 Bacteria 561
209 Ga0070695_101902937 3300005545 Bacteria 500
210 Ga0070693_100001478 3300005547 Bacteria 10580
211 Ga0070693_100009924 3300005547 Bacteria 4754
212 Ga0070693_100042820 3300005547 Bacteria 2553
213 Ga0070693_100114797 3300005547 Bacteria 1662
214 Ga0070665_100165515 3300005548 Bacteria 2214
215 Ga0070665_100343765 3300005548 Unclassified 1497
216 Ga0070704_101204969 3300005549 Bacteria 691
217 Ga0068855_100010893 3300005563 Bacteria 10976
218 Ga0068855_100037691 3300005563 Bacteria 5747
219 Ga0068855_100126638 3300005563 Bacteria 2920
220 Ga0068855_100175720 3300005563 Bacteria 2423
221 Ga0068855_100209400 3300005563 Bacteria 2192
222 Ga0068855_100261497 3300005563 Unclassified 1927
223 Ga0068855_100399013 3300005563 Bacteria 1507
224 Ga0070664_100003653 3300005564 Bacteria 12389
225 Ga0070664_100134938 3300005564 Bacteria 2170
226 Ga0070664_100208907 3300005564 Bacteria 1744
227 Ga0070664_100502009 3300005564 Bacteria 1118
228 Ga0070664_100587815 3300005564 Bacteria 1032
229 Ga0070664_100882929 3300005564 Bacteria 838
230 Ga0070664_100910285 3300005564 Unclassified 825
231 Ga0068857_100006828 3300005577 Bacteria 9824
232 Ga0068857_100013779 3300005577 Bacteria 7044
233 Ga0068857_100129190 3300005577 Unclassified 2278
234 Ga0068857_100217299 3300005577 Bacteria 1745
235 Ga0068857_100504953 3300005577 Bacteria 1135
236 Ga0068857_101018496 3300005577 Bacteria 797
237 Ga0068857_102178181 3300005577 Unclassified 544
238 Ga0068857_102504807 3300005577 Bacteria 507
239 Ga0068854_100038402 3300005578 Bacteria 3367
240 Ga0068854_100043502 3300005578 Bacteria 3183
241 Ga0068854_100264820 3300005578 Bacteria 1378
242 Ga0068856_100006507 3300005614 Bacteria 11457
243 Ga0068856_100019410 3300005614 Bacteria 6597
244 Ga0068856_100101526 3300005614 Bacteria 2869
245 Ga0068856_100132970 3300005614 Bacteria 2493
246 Ga0068856_101401061 3300005614 Bacteria 713
247 Ga0070702_100001616 3300005615 Bacteria 9325
248 Ga0070702_100131845 3300005615 Bacteria 1580
249 Ga0070702_100413036 3300005615 Bacteria 969
250 Ga0068852_100021451 3300005616 Bacteria 5158
251 Ga0068852_100031615 3300005616 Bacteria 4371
252 Ga0068852_100082281 3300005616 Unclassified 2860
253 Ga0068852_100090771 3300005616 Bacteria 2732
254 Ga0068852_100137868 3300005616 Bacteria 2254
255 Ga0068852_100228046 3300005616 Bacteria 1775
256 Ga0068852_100735167 3300005616 Unclassified 998
257 Ga0068859_100030462 3300005617 Bacteria 5414
258 Ga0068859_100134077 3300005617 Bacteria 2548
259 Ga0068859_100284165 3300005617 Bacteria 1747
260 Ga0068859_100297763 3300005617 Bacteria 1706
261 Ga0068859_100341975 3300005617 Archaea 1590
262 Ga0068859_100424757 3300005617 Bacteria 1425
263 Ga0068859_100795598 3300005617 Unclassified 1033
264 Ga0068859_101160875 3300005617 Bacteria 850
265 Ga0068864_100002505 3300005618 Bacteria 15186
266 Ga0068864_100012482 3300005618 Bacteria 7024
267 Ga0068864_100508803 3300005618 Bacteria 1160
268 Ga0068864_100597512 3300005618 Bacteria 1070
269 Ga0068864_101196134 3300005618 Bacteria 758
270 Ga0068864_102184822 3300005618 Unclassified 560
271 Ga0068864_102666122 3300005618 Bacteria 506
272 Ga0068866_10007846 3300005718 Bacteria 4479
273 Ga0068861_100242367 3300005719 Bacteria 1534
274 Ga0068861_100928348 3300005719 Unclassified 826
275 Ga0068851_10044560 3300005834 Bacteria 2240
276 Ga0068851_10049609 3300005834 Bacteria 2130
277 Ga0068851_10600993 3300005834 Unclassified 669
278 Ga0068870_10024914 3300005840 Bacteria 2965
279 Ga0068870_10083154 3300005840 Bacteria 1774
280 Ga0068863_100008383 3300005841 Bacteria 10093
281 Ga0068863_100034302 3300005841 Bacteria 4834
282 Ga0068863_100130169 3300005841 Bacteria 2402
283 Ga0068863_102052454 3300005841 Bacteria 582
284 Ga0068863_102278532 3300005841 Unclassified 551
285 Ga0068858_100274370 3300005842 Bacteria 1605
286 Ga0068858_100484221 3300005842 Bacteria 1194
287 Ga0068858_100725701 3300005842 Bacteria 967
288 Ga0068858_101108635 3300005842 Unclassified 777
289 Ga0068860_100013040 3300005843 Bacteria 8159
290 Ga0068860_100131262 3300005843 Bacteria 2404
291 Ga0068860_100353490 3300005843 Unclassified 1446
292 Ga0068860_100449892 3300005843 Unclassified 1280
293 Ga0068860_101928788 3300005843 Unclassified 612
294 Ga0068862_100043734 3300005844 Unclassified 3818
295 Ga0068862_100071876 3300005844 Archaea 2988
296 Ga0068862_100134843 3300005844 Bacteria 2187
297 Ga0068862_100446475 3300005844 Unclassified 1218
298 Ga0068862_101150066 3300005844 Unclassified 773
299 Ga0081455_10205281 3300005937 Unclassified 1472
300 Ga0081455_10332491 3300005937 Bacteria 1078
301 Ga0081539_10000863 3300005985 Bacteria 58055
302 Ga0070717_10004042 3300006028 Bacteria 10565
303 Ga0070717_10092916 3300006028 Bacteria 2549
304 Ga0070717_10196094 3300006028 Bacteria 1766
305 Ga0075365_10400778 3300006038 Bacteria 968
306 Ga0075363_100173106 3300006048 Bacteria 1226
307 Ga0070716_100432006 3300006173 Bacteria 955
308 Ga0070712_100000921 3300006175 Bacteria 17654
309 Ga0075367_10347685 3300006178 Bacteria 936
310 Ga0097621_100003501 3300006237 Bacteria 10838
311 Ga0097621_100045898 3300006237 Bacteria 3531
312 Ga0097621_101282596 3300006237 Bacteria 691
313 Ga0068871_100011428 3300006358 Bacteria 6513
314 Ga0068871_101980668 3300006358 Bacteria 554
315 Ga0075428_100097856 3300006844 Bacteria 3199
316 Ga0075428_100192553 3300006844 Bacteria 2205
317 Ga0075430_100015935 3300006846 Bacteria 6401
318 Ga0075430_100019271 3300006846 Bacteria 5799
319 Ga0075430_100947779 3300006846 Bacteria 709
320 Ga0075431_100018100 3300006847 Bacteria 7166
321 Ga0075431_100235470 3300006847 Unclassified 1864
322 Ga0075431_100388666 3300006847 Bacteria 1398
323 Ga0075431_100815435 3300006847 Bacteria 906
324 Ga0075431_101634054 3300006847 Unclassified 602
325 Ga0075433_10010264 3300006852 Bacteria 7512
326 Ga0075434_100016394 3300006871 Bacteria 7123
327 Ga0075434_100363828 3300006871 Bacteria 1467
328 Ga0075429_100130487 3300006880 Unclassified 2198
329 Ga0075429_100232997 3300006880 Bacteria 1613
330 Ga0075429_100952985 3300006880 Unclassified 751
331 Ga0068865_100159824 3300006881 Bacteria 1718
332 Ga0068865_100172862 3300006881 Unclassified 1658
333 Ga0068865_100554725 3300006881 Unclassified 965
334 Ga0068865_100749091 3300006881 Bacteria 839
335 Ga0068865_101136372 3300006881 Unclassified 689
336 Ga0075436_100001306 3300006914 Bacteria 16932
337 Ga0075436_100072680 3300006914 Bacteria 2380
338 Ga0075436_100753832 3300006914 Unclassified 723
339 Ga0097620_100030463 3300006931 Bacteria 5414
340 Ga0097620_100134076 3300006931 Bacteria 2548
341 Ga0097620_100284147 3300006931 Bacteria 1747
342 Ga0097620_100297752 3300006931 Bacteria 1706
343 Ga0097620_100341990 3300006931 Archaea 1590
344 Ga0097620_100424757 3300006931 Bacteria 1425
345 Ga0097620_100795623 3300006931 Unclassified 1033
346 Ga0097620_101160646 3300006931 Bacteria 850
347 Ga0105240_10019123 3300009093 Bacteria 9159
348 Ga0105240_10074952 3300009093 Bacteria 4175
349 Ga0105240_10094078 3300009093 Bacteria 3657
350 Ga0105240_10097917 3300009093 Bacteria 3573
351 Ga0105240_11628468 3300009093 Bacteria 675
352 Ga0105240_12357952 3300009093 Unclassified 551
353 Ga0111539_10011677 3300009094 Bacteria 11018
354 Ga0111539_10157595 3300009094 Bacteria 2656
355 Ga0111539_10191327 3300009094 Bacteria 2388
356 Ga0111539_10831037 3300009094 Unclassified 1075
357 Ga0111539_11158211 3300009094 Bacteria 898
358 Ga0111539_12526540 3300009094 Bacteria 596
359 Ga0111539_12529623 3300009094 Bacteria 595
360 Ga0105245_10000862 3300009098 Bacteria 27532
361 Ga0105245_10008032 3300009098 Bacteria 9229
362 Ga0105245_10069903 3300009098 Bacteria 3185
363 Ga0105245_10560956 3300009098 Bacteria 1165
364 Ga0105245_10577795 3300009098 Bacteria 1148
365 Ga0105245_11073352 3300009098 Bacteria 851
366 Ga0114129_10037947 3300009147 Bacteria 6797
367 Ga0114129_10140391 3300009147 Bacteria 3312
368 Ga0114129_10165856 3300009147 Bacteria 3014
369 Ga0114129_10208333 3300009147 Bacteria 2644
370 Ga0114129_10300660 3300009147 Unclassified 2139
371 Ga0114129_10588185 3300009147 Unclassified 1443
372 Ga0114129_12083632 3300009147 Bacteria 685
373 Ga0105243_10509356 3300009148 Unclassified 1142
374 Ga0105243_10572272 3300009148 Bacteria 1083
375 Ga0105243_10728758 3300009148 Unclassified 970
376 Ga0105243_11089625 3300009148 Unclassified 806
377 Ga0105243_12432171 3300009148 Bacteria 562
378 Ga0105241_10004856 3300009174 Bacteria 9915
379 Ga0105241_10025003 3300009174 Bacteria 4437
380 Ga0105241_10030599 3300009174 Bacteria 4025
381 Ga0105241_10229895 3300009174 Bacteria 1563
382 Ga0105241_10606039 3300009174 Bacteria 990
383 Ga0105241_12024215 3300009174 Bacteria 567
384 Ga0105241_12436912 3300009174 Bacteria 523
385 Ga0105242_10018010 3300009176 Bacteria 5517
386 Ga0105242_10035609 3300009176 Bacteria 3991
387 Ga0105242_10105945 3300009176 Bacteria 2389
388 Ga0105242_10185787 3300009176 Bacteria 1837
389 Ga0105242_10231132 3300009176 Bacteria 1657
390 Ga0105242_10245449 3300009176 Bacteria 1611
391 Ga0105242_10356929 3300009176 Bacteria 1352
392 Ga0105242_11666531 3300009176 Bacteria 673
393 Ga0105248_10009466 3300009177 Bacteria 10723
394 Ga0105248_10028001 3300009177 Bacteria 6276
395 Ga0105248_10046810 3300009177 Unclassified 4849
396 Ga0105248_10222750 3300009177 Bacteria 2123
397 Ga0105248_10342455 3300009177 Bacteria 1683
398 Ga0105248_10511359 3300009177 Bacteria 1354
399 Ga0105248_12667673 3300009177 Bacteria 570
400 Ga0105237_10060373 3300009545 Unclassified 3793
401 Ga0105237_10095256 3300009545 Bacteria 2966
402 Ga0105237_10170444 3300009545 Bacteria 2176
403 Ga0105237_10881695 3300009545 Bacteria 902
404 Ga0105238_10014160 3300009551 Bacteria 8066
405 Ga0105238_10036718 3300009551 Bacteria 4982
406 Ga0105238_10091902 3300009551 Bacteria 3022
407 Ga0105238_10392581 3300009551 Bacteria 1380
408 Ga0105238_11949554 3300009551 Bacteria 621
409 Ga0105249_10008224 3300009553 Bacteria 9084
410 Ga0105249_10473584 3300009553 Unclassified 1294
411 Ga0105249_10550808 3300009553 Bacteria 1204
412 Ga0105249_10690882 3300009553 Bacteria 1080
413 Ga0105249_10778668 3300009553 Bacteria 1020
414 Ga0105249_11095223 3300009553 Bacteria 867
415 Ga0105249_12108568 3300009553 Bacteria 637
416 Ga0105239_10016532 3300010375 Bacteria 8157
417 Ga0105239_10043299 3300010375 Bacteria 4934
418 Ga0105239_10671971 3300010375 Bacteria 1183
419 Ga0105246_10000894 3300011119 Bacteria 17115
420 Ga0105246_10025979 3300011119 Bacteria 3819
421 Ga0105246_10351099 3300011119 Bacteria 1208
422 Ga0105246_10934483 3300011119 Unclassified 780
423 Ga0105246_12161588 3300011119 Unclassified 541
424 Ga0157373_10011868 3300013100 Bacteria 6401
425 Ga0157373_10026438 3300013100 Bacteria 4191
426 Ga0157373_10055087 3300013100 Bacteria 2825
427 Ga0157373_10072335 3300013100 Bacteria 2434
428 Ga0157373_10209631 3300013100 Bacteria 1374
429 Ga0157373_10498943 3300013100 Bacteria 879
430 Ga0157371_10005257 3300013102 Bacteria 10983
431 Ga0157371_10016287 3300013102 Bacteria 5552
432 Ga0157371_10089184 3300013102 Bacteria 2184
433 Ga0157370_10005910 3300013104 Bacteria 13641
434 Ga0157370_10006626 3300013104 Bacteria 12727
435 Ga0157370_10027605 3300013104 Bacteria 5597
436 Ga0157370_10144166 3300013104 Bacteria 2219
437 Ga0157370_10210067 3300013104 Bacteria 1804
438 Ga0157370_11377982 3300013104 Bacteria 635
439 Ga0157369_10007102 3300013105 Bacteria 12913
440 Ga0157369_10011694 3300013105 Bacteria 9965
441 Ga0157369_10042300 3300013105 Bacteria 4971
442 Ga0157369_10561163 3300013105 Unclassified 1180
443 Ga0157369_10657917 3300013105 Bacteria 1080
444 Ga0157369_10872725 3300013105 Bacteria 923
445 Ga0157374_10003277 3300013296 Bacteria 13601
446 Ga0157374_10057504 3300013296 Bacteria 3633
447 Ga0157374_10086784 3300013296 Bacteria 2978
448 Ga0157374_10364980 3300013296 Bacteria 1436
449 Ga0157374_11585322 3300013296 Bacteria 679
450 Ga0157374_12666203 3300013296 Bacteria 527
451 Ga0157378_10023400 3300013297 Bacteria 5437
452 Ga0157378_10037379 3300013297 Bacteria 4299
453 Ga0157378_11004372 3300013297 Bacteria 869
454 Ga0163162_10011417 3300013306 Bacteria 8663
455 Ga0163162_10019361 3300013306 Bacteria 6675
456 Ga0163162_10091376 3300013306 Unclassified 3127
457 Ga0163162_10806583 3300013306 Bacteria 1056
458 Ga0157372_10003786 3300013307 Bacteria 16243
459 Ga0157372_10004744 3300013307 Bacteria 14430
460 Ga0157372_10004978 3300013307 Bacteria 14114
461 Ga0157372_10023223 3300013307 Bacteria 6720
462 Ga0157372_10051337 3300013307 Bacteria 4589
463 Ga0157372_10051976 3300013307 Bacteria 4562
464 Ga0157372_10139079 3300013307 Bacteria 2797
465 Ga0157372_10526578 3300013307 Bacteria 1378
466 Ga0157372_13254368 3300013307 Unclassified 518
467 Ga0157375_10048113 3300013308 Bacteria 4169
468 Ga0157375_10086705 3300013308 Unclassified 3182
469 Ga0157375_10154054 3300013308 Bacteria 2436
470 Ga0157375_10215325 3300013308 Bacteria 2078
471 Ga0157375_10247455 3300013308 Bacteria 1943
472 Ga0157375_11056967 3300013308 Bacteria 949
473 Ga0157375_12234063 3300013308 Bacteria 652
474 Ga0163163_10025642 3300014325 Bacteria 5621
475 Ga0163163_10042323 3300014325 Bacteria 4460
476 Ga0163163_10097700 3300014325 Bacteria 2957
477 Ga0163163_10601210 3300014325 Bacteria 1163
478 Ga0157380_10085949 3300014326 Bacteria 2583
479 Ga0157380_10454849 3300014326 Unclassified 1231
480 Ga0182008_10010422 3300014497 Bacteria 4975
481 Ga0157377_10000310 3300014745 Bacteria 22453
482 Ga0157377_10028404 3300014745 Unclassified 3010
483 Ga0157377_10039178 3300014745 Bacteria 2620
484 Ga0157377_10060859 3300014745 Bacteria 2156
485 Ga0157377_10475132 3300014745 Unclassified 868
486 Ga0157377_10951542 3300014745 Unclassified 646
487 Ga0157379_10130725 3300014968 Bacteria 2260
488 Ga0157379_10404298 3300014968 Bacteria 1255
489 Ga0157376_10016632 3300014969 Bacteria 5590
490 Ga0157376_10027416 3300014969 Bacteria 4515
491 Ga0157376_10112637 3300014969 Bacteria 2397
492 Ga0157376_10576851 3300014969 Bacteria 1116
493 Ga0157376_10995805 3300014969 Bacteria 860
494 Ga0157376_12613554 3300014969 Bacteria 545
495 Ga0182007_10072274 3300015262 Bacteria 1130
496 Ga0163161_10143220 3300017792 Unclassified 1811
497 Ga0163161_10296554 3300017792 Unclassified 1272
498 Ga0163161_10861308 3300017792 Unclassified 765
499 Ga0163161_11002536 3300017792 Unclassified 713
500 Ga0206356_10613338 3300020070 Bacteria 672
501 Ga0206356_11677615 3300020070 Bacteria 711
502 Ga0206356_11775321 3300020070 Bacteria 721
503 Ga0206353_12046695 3300020082 Bacteria 1269
504 Ga0213876_10166900 3300021384 Bacteria 1171
505 Ga0213875_10016943 3300021388 Bacteria 3527
506 Ga0207697_10018355 3300025315 Bacteria 2869
507 Ga0207697_10201560 3300025315 Bacteria 875
508 Ga0207697_10268393 3300025315 Bacteria 756
509 Ga0207656_10098082 3300025321 Bacteria 1340
510 Ga0207682_10078302 3300025893 Bacteria 1412
511 Ga0207682_10106374 3300025893 Bacteria 1231
512 Ga0207642_10084369 3300025899 Bacteria 1551
513 Ga0207642_10514036 3300025899 Unclassified 735
514 Ga0207642_10529159 3300025899 Bacteria 725
515 Ga0207680_10253732 3300025903 Bacteria 1216
516 Ga0207647_10098512 3300025904 Bacteria 1737
517 Ga0207699_10001059 3300025906 Bacteria 12988
518 Ga0207699_10041188 3300025906 Bacteria 2666
519 Ga0207699_10776463 3300025906 Bacteria 704
520 Ga0207699_10892666 3300025906 Unclassified 655
521 Ga0207645_10003890 3300025907 Bacteria 11162
522 Ga0207645_10032847 3300025907 Bacteria 3336
523 Ga0207645_10400582 3300025907 Unclassified 923
524 Ga0207645_10776539 3300025907 Bacteria 651
525 Ga0207643_10029715 3300025908 Bacteria 3040
526 Ga0207643_10395571 3300025908 Bacteria 873
527 Ga0207705_10545618 3300025909 Bacteria 901
528 Ga0207705_10701173 3300025909 Bacteria 787
529 Ga0207684_10520397 3300025910 Unclassified 1019
530 Ga0207654_10033886 3300025911 Bacteria 2834
531 Ga0207707_10000688 3300025912 Bacteria 33606
532 Ga0207707_10012311 3300025912 Bacteria 7435
533 Ga0207707_10032491 3300025912 Bacteria 4568
534 Ga0207707_10136742 3300025912 Bacteria 2142
535 Ga0207707_10349436 3300025912 Bacteria 1274
536 Ga0207707_10461885 3300025912 Bacteria 1086
537 Ga0207707_10524777 3300025912 Bacteria 1008
538 Ga0207707_10818020 3300025912 Bacteria 775
539 Ga0207707_11165715 3300025912 Bacteria 625
540 Ga0207695_10057868 3300025913 Bacteria 4026
541 Ga0207695_10061534 3300025913 Bacteria 3880
542 Ga0207695_10164498 3300025913 Unclassified 2148
543 Ga0207695_10409191 3300025913 Bacteria 1241
544 Ga0207671_10054725 3300025914 Bacteria 2956
545 Ga0207671_10246351 3300025914 Bacteria 1404
546 Ga0207671_10330039 3300025914 Bacteria 1208
547 Ga0207693_10005048 3300025915 Bacteria 11078
548 Ga0207693_10148552 3300025915 Bacteria 1843
549 Ga0207693_10215360 3300025915 Bacteria 1509
550 Ga0207693_10221759 3300025915 Bacteria 1485
551 Ga0207663_10191988 3300025916 Bacteria 1467
552 Ga0207663_11010122 3300025916 Unclassified 667
553 Ga0207660_10002545 3300025917 Bacteria 11976
554 Ga0207660_10031487 3300025917 Bacteria 3654
555 Ga0207660_10052099 3300025917 Bacteria 2912
556 Ga0207660_10245175 3300025917 Unclassified 1413
557 Ga0207660_10346385 3300025917 Bacteria 1190
558 Ga0207660_10445809 3300025917 Bacteria 1046
559 Ga0207660_10540043 3300025917 Bacteria 948
560 Ga0207660_11334638 3300025917 Unclassified 582
561 Ga0207662_10003519 3300025918 Bacteria 8072
562 Ga0207662_10004849 3300025918 Bacteria 7117
563 Ga0207662_10024421 3300025918 Bacteria 3478
564 Ga0207662_10028698 3300025918 Bacteria 3219
565 Ga0207662_10046778 3300025918 Unclassified 2561
566 Ga0207662_10094666 3300025918 Bacteria 1843
567 Ga0207662_10525630 3300025918 Unclassified 817
568 Ga0207657_10018343 3300025919 Bacteria 6683
569 Ga0207657_10068015 3300025919 Bacteria 3027
570 Ga0207657_10123350 3300025919 Unclassified 2130
571 Ga0207657_10293843 3300025919 Bacteria 1288
572 Ga0207657_10379387 3300025919 Bacteria 1113
573 Ga0207649_10004134 3300025920 Bacteria 7905
574 Ga0207649_10008730 3300025920 Bacteria 5533
575 Ga0207649_10094990 3300025920 Bacteria 1960
576 Ga0207649_10134057 3300025920 Bacteria 1686
577 Ga0207649_10620374 3300025920 Bacteria 833
578 Ga0207652_10022315 3300025921 Bacteria 5235
579 Ga0207652_10095790 3300025921 Bacteria 2615
580 Ga0207652_10095891 3300025921 Bacteria 2613
581 Ga0207652_10099237 3300025921 Bacteria 2569
582 Ga0207652_10107691 3300025921 Bacteria 2469
583 Ga0207652_10141740 3300025921 Bacteria 2149
584 Ga0207652_10209423 3300025921 Bacteria 1755
585 Ga0207652_10430542 3300025921 Bacteria 1190
586 Ga0207652_10646945 3300025921 Bacteria 946
587 Ga0207646_10188498 3300025922 Bacteria 1863
588 Ga0207681_10030885 3300025923 Bacteria 3496
589 Ga0207681_10052576 3300025923 Bacteria 2762
590 Ga0207681_10076823 3300025923 Bacteria 2346
591 Ga0207681_11453830 3300025923 Bacteria 575
592 Ga0207694_10015298 3300025924 Bacteria 5789
593 Ga0207694_10095905 3300025924 Bacteria 2345
594 Ga0207694_10139771 3300025924 Bacteria 1947
595 Ga0207694_10704353 3300025924 Bacteria 852
596 Ga0207694_10884658 3300025924 Unclassified 755
597 Ga0207694_11316040 3300025924 Bacteria 611
598 Ga0207650_10015831 3300025925 Bacteria 5259
599 Ga0207650_10034539 3300025925 Bacteria 3668
600 Ga0207650_10130361 3300025925 Bacteria 1967
601 Ga0207650_10183478 3300025925 Bacteria 1669
602 Ga0207650_10298911 3300025925 Bacteria 1314
603 Ga0207650_10319559 3300025925 Bacteria 1271
604 Ga0207650_11146449 3300025925 Bacteria 662
605 Ga0207650_11475476 3300025925 Bacteria 578
606 Ga0207659_10003172 3300025926 Bacteria 9831
607 Ga0207659_10073552 3300025926 Bacteria 2502
608 Ga0207659_10086478 3300025926 Bacteria 2331
609 Ga0207659_10521835 3300025926 Bacteria 1007
610 Ga0207659_10568318 3300025926 Bacteria 965
611 Ga0207659_10862844 3300025926 Unclassified 778
612 Ga0207659_11689380 3300025926 Unclassified 539
613 Ga0207687_10044164 3300025927 Bacteria 3074
614 Ga0207687_10245102 3300025927 Bacteria 1422
615 Ga0207687_10586931 3300025927 Bacteria 938
616 Ga0207687_10744348 3300025927 Unclassified 834
617 Ga0207687_11508403 3300025927 Bacteria 577
618 Ga0207700_10002730 3300025928 Bacteria 10175
619 Ga0207700_10007854 3300025928 Bacteria 6561
620 Ga0207700_10008742 3300025928 Bacteria 6290
621 Ga0207700_10148793 3300025928 Bacteria 1933
622 Ga0207664_10009682 3300025929 Bacteria 6774
623 Ga0207664_10014587 3300025929 Bacteria 5680
624 Ga0207664_10137420 3300025929 Unclassified 2064
625 Ga0207664_10151947 3300025929 Unclassified 1967
626 Ga0207664_10512584 3300025929 Bacteria 1075
627 Ga0207644_10029437 3300025931 Bacteria 3811
628 Ga0207644_10123190 3300025931 Bacteria 1976
629 Ga0207644_10262685 3300025931 Bacteria 1381
630 Ga0207690_10003966 3300025932 Bacteria 8752
631 Ga0207690_10014776 3300025932 Bacteria 4722
632 Ga0207690_10539519 3300025932 Bacteria 947
633 Ga0207706_10000484 3300025933 Bacteria 42586
634 Ga0207706_10003332 3300025933 Bacteria 15364
635 Ga0207706_10006006 3300025933 Bacteria 11291
636 Ga0207686_10042067 3300025934 Bacteria 2790
637 Ga0207686_10046893 3300025934 Bacteria 2668
638 Ga0207686_10069262 3300025934 Bacteria 2263
639 Ga0207686_10209631 3300025934 Bacteria 1400
640 Ga0207686_10621536 3300025934 Bacteria 852
641 Ga0207686_11019339 3300025934 Unclassified 672
642 Ga0207686_11723254 3300025934 Bacteria 518
643 Ga0207709_10178158 3300025935 Bacteria 1498
644 Ga0207709_10223575 3300025935 Bacteria 1359
645 Ga0207709_10424231 3300025935 Bacteria 1022
646 Ga0207670_10006386 3300025936 Bacteria 6532
647 Ga0207670_10029811 3300025936 Bacteria 3479
648 Ga0207670_10038567 3300025936 Bacteria 3121
649 Ga0207670_10132174 3300025936 Bacteria 1830
650 Ga0207670_10149247 3300025936 Bacteria 1733
651 Ga0207670_10417888 3300025936 Bacteria 1075
652 Ga0207670_11216597 3300025936 Unclassified 638
653 Ga0207669_10385550 3300025937 Bacteria 1093
654 Ga0207669_11369106 3300025937 Bacteria 602
655 Ga0207704_10073109 3300025938 Bacteria 2182
656 Ga0207704_11259348 3300025938 Bacteria 632
657 Ga0207691_10008065 3300025940 Bacteria 10117
658 Ga0207691_10046706 3300025940 Bacteria 3977
659 Ga0207691_10059934 3300025940 Bacteria 3460
660 Ga0207691_11125654 3300025940 Bacteria 652
661 Ga0207711_10019900 3300025941 Bacteria 5593
662 Ga0207711_10022137 3300025941 Bacteria 5313
663 Ga0207711_10046014 3300025941 Bacteria 3729
664 Ga0207711_10048545 3300025941 Bacteria 3631
665 Ga0207711_10387975 3300025941 Bacteria 1296
666 Ga0207711_10936032 3300025941 Bacteria 805
667 Ga0207689_10003390 3300025942 Bacteria 14558
668 Ga0207689_10010237 3300025942 Bacteria 8078
669 Ga0207689_10053880 3300025942 Bacteria 3314
670 Ga0207689_10070093 3300025942 Bacteria 2880
671 Ga0207689_10142538 3300025942 Bacteria 1974
672 Ga0207689_10237702 3300025942 Unclassified 1506
673 Ga0207689_10304211 3300025942 Bacteria 1322
674 Ga0207661_10006832 3300025944 Bacteria 8087
675 Ga0207661_10008947 3300025944 Bacteria 7170
676 Ga0207661_10021337 3300025944 Bacteria 4851
677 Ga0207661_10058997 3300025944 Unclassified 3091
678 Ga0207661_10079088 3300025944 Bacteria 2709
679 Ga0207679_10002804 3300025945 Bacteria 10806
680 Ga0207679_10005660 3300025945 Bacteria 7838
681 Ga0207679_10021443 3300025945 Bacteria 4380
682 Ga0207679_10156167 3300025945 Bacteria 1863
683 Ga0207679_10330272 3300025945 Bacteria 1323
684 Ga0207679_10415815 3300025945 Bacteria 1186
685 Ga0207679_10783545 3300025945 Bacteria 869
686 Ga0207679_11514133 3300025945 Unclassified 615
687 Ga0207667_10021009 3300025949 Bacteria 7239
688 Ga0207667_10132424 3300025949 Bacteria 2568
689 Ga0207667_10272074 3300025949 Unclassified 1732
690 Ga0207667_10469136 3300025949 Bacteria 1278
691 Ga0207667_10768801 3300025949 Bacteria 962
692 Ga0207667_11455495 3300025949 Bacteria 657
693 Ga0207667_11665686 3300025949 Bacteria 605
694 Ga0207651_10098564 3300025960 Bacteria 2162
695 Ga0207651_10499464 3300025960 Bacteria 1051
696 Ga0207651_11454185 3300025960 Unclassified 617
697 Ga0207651_11690932 3300025960 Bacteria 570
698 Ga0207712_10151798 3300025961 Unclassified 1790
699 Ga0207712_10404772 3300025961 Unclassified 1148
700 Ga0207712_10497266 3300025961 Bacteria 1042
701 Ga0207712_11474376 3300025961 Bacteria 609
702 Ga0207668_10218246 3300025972 Bacteria 1530
703 Ga0207668_10547552 3300025972 Bacteria 1002
704 Ga0207640_10019678 3300025981 Bacteria 3993
705 Ga0207640_10216835 3300025981 Bacteria 1462
706 Ga0207640_11058155 3300025981 Bacteria 716
707 Ga0207658_10184307 3300025986 Bacteria 1730
708 Ga0207658_11785562 3300025986 Bacteria 561
709 Ga0207677_10006467 3300026023 Bacteria 6432
710 Ga0207677_10144256 3300026023 Bacteria 1827
711 Ga0207677_10189133 3300026023 Bacteria 1627
712 Ga0207677_11323947 3300026023 Unclassified 662
713 Ga0207703_10100040 3300026035 Bacteria 2456
714 Ga0207703_10454756 3300026035 Bacteria 1197
715 Ga0207703_10715188 3300026035 Unclassified 953
716 Ga0207703_11281574 3300026035 Unclassified 705
717 Ga0207639_10596460 3300026041 Bacteria 1018
718 Ga0207678_10013878 3300026067 Bacteria 7078
719 Ga0207678_10044580 3300026067 Unclassified 3836
720 Ga0207678_10101242 3300026067 Bacteria 2460
721 Ga0207708_10039035 3300026075 Bacteria 3617
722 Ga0207708_10074454 3300026075 Bacteria 2602
723 Ga0207702_10010084 3300026078 Bacteria 7917
724 Ga0207702_10133131 3300026078 Bacteria 2239
725 Ga0207702_10572587 3300026078 Bacteria 1106
726 Ga0207702_11099480 3300026078 Bacteria 789
727 Ga0207641_10010078 3300026088 Bacteria 7770
728 Ga0207641_10171912 3300026088 Bacteria 1978
729 Ga0207641_10330489 3300026088 Bacteria 1448
730 Ga0207641_10476040 3300026088 Bacteria 1210
731 Ga0207641_12134630 3300026088 Unclassified 561
732 Ga0207648_10025214 3300026089 Bacteria 5300
733 Ga0207648_10060369 3300026089 Bacteria 3307
734 Ga0207648_10211099 3300026089 Bacteria 1723
735 Ga0207648_10855309 3300026089 Unclassified 848
736 Ga0207676_10001453 3300026095 Bacteria 17628
737 Ga0207676_10027783 3300026095 Bacteria 4218
738 Ga0207676_10042608 3300026095 Bacteria 3492
739 Ga0207676_10425819 3300026095 Bacteria 1246
740 Ga0207676_11854275 3300026095 Bacteria 602
741 Ga0207674_10000541 3300026116 Bacteria 49546
742 Ga0207674_10001092 3300026116 Bacteria 35309
743 Ga0207674_10004637 3300026116 Bacteria 16503
744 Ga0207674_10415891 3300026116 Unclassified 1299
745 Ga0207674_10478807 3300026116 Bacteria 1203
746 Ga0207674_11888246 3300026116 Bacteria 563
747 Ga0207675_100000290 3300026118 Bacteria 48423
748 Ga0207675_100078397 3300026118 Bacteria 3095
749 Ga0207675_102502515 3300026118 Unclassified 527
750 Ga0207683_10166191 3300026121 Bacteria 1996
751 Ga0207683_10208193 3300026121 Bacteria 1779
752 Ga0207683_10393284 3300026121 Bacteria 1275
753 Ga0207683_10549229 3300026121 Bacteria 1068
754 Ga0207683_12064560 3300026121 Bacteria 518
755 Ga0207698_10015494 3300026142 Bacteria 5105
756 Ga0207698_10024707 3300026142 Bacteria 4222
757 Ga0207698_10146460 3300026142 Bacteria 2043
758 Ga0207698_10197353 3300026142 Unclassified 1799
759 Ga0207698_10248307 3300026142 Bacteria 1626
760 Ga0207698_11001648 3300026142 Bacteria 846
761 Ga0207698_11840717 3300026142 Bacteria 620
762 Ga0207428_10033527 3300027907 Bacteria 4216
763 Ga0207428_10610661 3300027907 Bacteria 785
764 Ga0207428_10781157 3300027907 Bacteria 679
765 Ga0268266_10116517 3300028379 Unclassified 2373
766 Ga0268266_10549322 3300028379 Bacteria 1107
767 Ga0268266_10575428 3300028379 Bacteria 1081
768 Ga0268266_10697021 3300028379 Bacteria 979
769 Ga0268265_10029323 3300028380 Unclassified 3948
770 Ga0268265_10084070 3300028380 Bacteria 2522
771 Ga0268265_10152304 3300028380 Bacteria 1952
772 Ga0268265_10597396 3300028380 Bacteria 1054
773 Ga0268265_10678313 3300028380 Unclassified 993
774 Ga0268265_11193603 3300028380 Bacteria 758
775 Ga0268265_11637546 3300028380 Unclassified 649
776 Ga0268265_11923327 3300028380 Bacteria 598
777 Ga0268264_10020504 3300028381 Bacteria 5401
778 Ga0268264_10052234 3300028381 Bacteria 3407
779 Ga0268264_10153158 3300028381 Bacteria 2069
780 Ga0268264_11365296 3300028381 Unclassified 719
781 Ga0307408_100056790 3300031548 Bacteria 2839
782 Ga0307408_100072150 3300031548 Bacteria 2555
783 Ga0307408_100574209 3300031548 Bacteria 998
784 Ga0307408_100996708 3300031548 Unclassified 772
785 Ga0307408_101128554 3300031548 Bacteria 728
786 Ga0307408_101901754 3300031548 Bacteria 571
787 Ga0307405_10000770 3300031731 Bacteria 12548
788 Ga0307405_10107211 3300031731 Bacteria 1885
789 Ga0307405_10125572 3300031731 Bacteria 1763
790 Ga0307405_11465264 3300031731 Bacteria 599
791 Ga0307413_10001084 3300031824 Bacteria 9946
792 Ga0307413_10016313 3300031824 Bacteria 3833
793 Ga0307413_10061643 3300031824 Bacteria 2315
794 Ga0307410_10007976 3300031852 Bacteria 5838
795 Ga0307410_10045617 3300031852 Unclassified 2920
796 Ga0307410_10229415 3300031852 Bacteria 1433
797 Ga0307410_10864192 3300031852 Bacteria 773
798 Ga0307410_10971499 3300031852 Bacteria 731
799 Ga0307410_10976667 3300031852 Bacteria 729
800 Ga0307406_10001060 3300031901 Bacteria 15303
801 Ga0307406_10015356 3300031901 Bacteria 4429
802 Ga0307406_10021744 3300031901 Bacteria 3798
803 Ga0307406_11350331 3300031901 Bacteria 623
804 Ga0307406_11958525 3300031901 Bacteria 523
805 Ga0307407_10017311 3300031903 Bacteria 3612
806 Ga0307407_10436978 3300031903 Bacteria 947
807 Ga0307407_11391990 3300031903 Bacteria 552
808 Ga0307407_11600958 3300031903 Unclassified 517
809 Ga0307412_10021525 3300031911 Bacteria 3940
810 Ga0307412_10314868 3300031911 Bacteria 1243
811 Ga0307412_11953562 3300031911 Bacteria 542
812 Ga0307412_12093540 3300031911 Bacteria 525
813 Ga0307409_100009207 3300031995 Bacteria 6053
814 Ga0307409_100024520 3300031995 Bacteria 4208
815 Ga0307409_100195149 3300031995 Bacteria 1806
816 Ga0307409_100219582 3300031995 Bacteria 1715
817 Ga0307409_100243114 3300031995 Bacteria 1640
818 Ga0307409_100748082 3300031995 Bacteria 981
819 Ga0307409_101007769 3300031995 Bacteria 851
820 Ga0307416_100000626 3300032002 Bacteria 18241
821 Ga0307416_100020188 3300032002 Bacteria 4747
822 Ga0307416_100075775 3300032002 Bacteria 2816
823 Ga0307416_100123109 3300032002 Bacteria 2317
824 Ga0307416_100203990 3300032002 Bacteria 1879
825 Ga0307416_100256646 3300032002 Unclassified 1705
826 Ga0307416_100346458 3300032002 Unclassified 1501
827 Ga0307416_100396418 3300032002 Bacteria 1416
828 Ga0307416_101056778 3300032002 Unclassified 916
829 Ga0307416_102100468 3300032002 Bacteria 667
830 Ga0307416_103502031 3300032002 Bacteria 525
831 Ga0307414_10054957 3300032004 Bacteria 2785
832 Ga0307414_10095103 3300032004 Bacteria 2225
833 Ga0307414_10710501 3300032004 Bacteria 911
834 Ga0307411_10002520 3300032005 Bacteria 8150
835 Ga0307411_10019501 3300032005 Bacteria 3918
836 Ga0307411_10508116 3300032005 Bacteria 1020
837 Ga0307411_10812572 3300032005 Bacteria 824
838 Ga0307411_11316593 3300032005 Bacteria 659
839 Ga0307411_12074032 3300032005 Bacteria 532
840 Ga0307415_100010134 3300032126 Bacteria 5321
841 Ga0307415_100026652 3300032126 Bacteria 3649
842 Ga0307415_100158168 3300032126 Unclassified 1753
843 Ga0307415_100739004 3300032126 Bacteria 892
844 Ga0307415_101022033 3300032126 Bacteria 769
845 Ga0307415_101196065 3300032126 Bacteria 716
846 Ga0307415_101669246 3300032126 Bacteria 614
847 Ga0373958_0052152 3300034819 Unclassified 866
848 Ga0373959_0089269 3300034820 Bacteria 721
849 Ga0373926_0059184 3300035083 Bacteria 1394
850 Ga0373934_0168693 3300035086 Bacteria 898
851 Ga0373944_0130645 3300035089 Unclassified 873
852 Ga0373923_0150963 3300035111 Bacteria 1055
853 Ga0373953_0009385 3300035117 Bacteria 3365
854 Ga0373954_0014306 3300035118 Bacteria 3539
855 Ga0373954_0248844 3300035118 Bacteria 875
856 Ga0373954_0520625 3300035118 Bacteria 589
857 Ga0373956_0069490 3300035119 Unclassified 1605
858 Ga0373956_0260098 3300035119 Bacteria 825
859 Ga0373956_0349231 3300035119 Unclassified 705
860 Ga0373957_0006187 3300035120 Bacteria 3760
861 Ga0373957_0449257 3300035120 Bacteria 558
862 Ga0373943_0117565 3300035170 Unclassified 1410
863 Ga0373955_0088862 3300035172 Unclassified 1758
864 Ga0373955_0116756 3300035172 Unclassified 1547
865 Ga0373955_0159667 3300035172 Bacteria 1330
866 Ga0373924_0027445 3300035410 Bacteria 2264
867 Ga0373924_0448433 3300035410 Unclassified 578
868 Ga0373931_0709976 3300035691 Bacteria 665
869 Ga0373927_0468180 3300035695 Bacteria 832
870 Ga0373933_0002582 3300035724 Bacteria 10146
871 Ga0373933_0045154 3300035724 Bacteria 2612
872 Ga0373933_0766050 3300035724 Unclassified 635
873 Ga0373947_0418412 3300035725 Bacteria 905
874 Ga0373947_0487914 3300035725 Bacteria 836
875 Ga0373937_0000748 3300036401 Bacteria 28085
876 Ga0373937_0050014 3300036401 Bacteria 3828
877 Ga0373937_0407390 3300036401 Bacteria 1290
878 Ga0373937_0529478 3300036401 Unclassified 1120
879 Ga0373937_0942080 3300036401 Unclassified 812
880 Ga0373925_0118685 3300037068 Bacteria 2051
881 Ga0373925_0227568 3300037068 Unclassified 1490
882 Ga0373925_0297261 3300037068 Bacteria 1303
883 Ga0395900_1785096 3300037418 Bacteria 526
884 Ga0395905_0128350 3300037471 Bacteria 2385
885 Ga0395905_0194900 3300037471 Bacteria 1900
886 Ga0436364_0116274 3300037853 Bacteria 8404
887 Ga0436364_0551931 3300037853 Bacteria 803
888 Ga0436365_0462076 3300039437 Bacteria 7871
889 Ga0436365_1691355 3300039437 Bacteria 5490
890 Ga0436365_1784765 3300039437 Bacteria 881
891 Ga0436365_1812463 3300039437 Bacteria 1006
892 Ga0439461_0099116 3300041410 Bacteria 708
893 Ga0439433_0083731 3300041999 Bacteria 778
894 Ga0439448_0315636 3300042005 Bacteria 556
895 Ga0439462_0070785 3300042015 Unclassified 947
896 Ga0439434_0185137 3300042435 Bacteria 698
897 Ga0439435_0214650 3300042436 Bacteria 638
898 Ga0439464_0144019 3300042439 Bacteria 743
899 Ga0466964_0596758 3300044706 Bacteria 605
900 Ga0451576_0060587 3300045051 Bacteria 3948
901 Ga0451576_0097525 3300045051 Bacteria 3057
902 Ga0451576_0756952 3300045051 Bacteria 1020
903 Ga0466958_0086088 3300045836 Bacteria 1939
904 Ga0466958_0529270 3300045836 Bacteria 765
905 Ga0466967_0032376 3300045976 Bacteria 4414
906 Ga0495592_0316296 3300046454 Bacteria 1010
907 Ga0495592_0769152 3300046454 Unclassified 574
908 Ga0495590_0411843 3300046457 Unclassified 519
909 Ga0495629_0066937 3300046459 Bacteria 2507
910 Ga0495651_0002896 3300046462 Bacteria 13283
911 Ga0495651_0008970 3300046462 Bacteria 7678
912 Ga0495651_0614437 3300046462 Bacteria 684
913 Ga0495653_0076774 3300046463 Bacteria 2482
914 Ga0495580_0018253 3300046472 Bacteria 5225
915 Ga0495580_0146512 3300046472 Bacteria 1636
916 Ga0495580_0271857 3300046472 Bacteria 1157
917 Ga0495582_0151183 3300046473 Unclassified 1318
918 Ga0495582_0613448 3300046473 Bacteria 630
919 Ga0495582_0810676 3300046473 Bacteria 542
920 Ga0495594_0008741 3300046499 Bacteria 5221
921 Ga0495594_0623666 3300046499 Bacteria 611
922 Ga0495608_0251285 3300046511 Unclassified 1102
923 Ga0495618_0321883 3300046514 Bacteria 958
924 Ga0495628_1000136 3300046516 Bacteria 575
925 Ga0495628_1031909 3300046516 Unclassified 564
926 Ga0495630_0108600 3300046517 Bacteria 2102
927 Ga0495630_0218814 3300046517 Bacteria 1454
928 Ga0495665_0001106 3300046531 Bacteria 14258
929 Ga0495640_0373715 3300046533 Unclassified 878
930 Ga0495586_0097511 3300046535 Unclassified 1629
931 Ga0495587_0000482 3300046536 Bacteria 27682
932 Ga0495587_0144931 3300046536 Bacteria 1354
933 Ga0495645_0000281 3300046543 Bacteria 37502
934 Ga0495645_0043342 3300046543 Unclassified 3282
935 Ga0495645_0278482 3300046543 Bacteria 1101
936 Ga0495667_0011011 3300046559 Bacteria 6114
937 Ga0495667_0030784 3300046559 Bacteria 3605
938 Ga0495667_0120979 3300046559 Unclassified 1690
939 Ga0495635_0014422 3300046663 Bacteria 5529
940 Ga0495659_0167647 3300046664 Bacteria 889
941 Ga0495588_0075602 3300046674 Bacteria 1755
942 Ga0495588_0720393 3300046674 Bacteria 522
943 Ga0495657_0021558 3300046675 Bacteria 4623
944 Ga0495657_0033293 3300046675 Bacteria 3589
945 Ga0495657_0251438 3300046675 Bacteria 1064
946 Ga0495599_0013463 3300046678 Bacteria 5054
947 Ga0495599_0129384 3300046678 Bacteria 1568
948 Ga0495623_0002762 3300046679 Bacteria 11595
949 Ga0495623_0022090 3300046679 Bacteria 4109
950 Ga0495646_0046802 3300046680 Bacteria 2635
951 Ga0495646_0124875 3300046680 Unclassified 1453
952 Ga0495658_0138431 3300046683 Bacteria 1487
953 Ga0495600_0022993 3300046809 Bacteria 4008
954 Ga0495600_0027414 3300046809 Bacteria 3681
955 Ga0495581_0116696 3300047315 Unclassified 1552
956 Ga0495581_0284798 3300047315 Bacteria 966
957 Ga0495604_0154009 3300047317 Unclassified 1630
958 Ga0495604_0262713 3300047317 Bacteria 1173
959 Ga0495636_0320499 3300047318 Unclassified 728
960 Ga0495674_0016536 3300047319 Bacteria 6884
961 Ga0495674_0380352 3300047319 Unclassified 1142
962 Ga0495680_0038295 3300047322 Bacteria 3834
963 Ga0495680_0770867 3300047322 Bacteria 630
964 Ga0495675_0000541 3300047444 Bacteria 24456
965 Ga0495675_0362508 3300047444 Bacteria 850
966 Ga0495684_0012331 3300047471 Bacteria 6593
967 Ga0495684_0023899 3300047471 Bacteria 4700
968 Ga0495684_0243896 3300047471 Bacteria 1309
969 Ga0495602_0071284 3300048088 Unclassified 2968
970 Ga0495602_0150380 3300048088 Bacteria 1831
971 Ga0495602_0325896 3300048088 Bacteria 1116
972 Ga0495615_0038362 3300048090 Unclassified 1184
973 Ga0495615_0150895 3300048090 Bacteria 692
974 Ga0496104_0064159 3300048907 Bacteria 3485
975 Ga0496105_0343570 3300048908 Bacteria 1193
976 Ga0496105_0547733 3300048908 Bacteria 903
977 Ga0496108_0034415 3300048911 Bacteria 4210
978 Ga0496109_0096288 3300048912 Bacteria 2742
979 Ga0496112_0089131 3300048915 Unclassified 3053
980 Ga0496112_0779607 3300048915 Bacteria 881
981 Ga0501296_019781 3300049519 Unclassified 855
982 Ga0501034_1661771 3300049571 Unclassified 511
983 Ga0501038_0436511 3300049574 Bacteria 1009
984 Ga0501042_1022788 3300049578 Unclassified 602
985 Ga0501043_0424599 3300049579 Bacteria 1002
986 Ga0501048_1030562 3300049582 Unclassified 592
987 Ga0501067_0034037 3300049583 Bacteria 2827
988 Ga0501069_0681024 3300049585 Bacteria 620
989 Ga0501071_1311178 3300049587 Unclassified 559
990 Ga0501072_0391676 3300049588 Bacteria 1102
991 Ga0501072_0505646 3300049588 Bacteria 956
992 Ga0501075_0572541 3300049591 Bacteria 862
993 Ga0501076_0876548 3300049592 Bacteria 740
994 Ga0501076_1739820 3300049592 Bacteria 511
995 Ga0501077_0069005 3300049593 Bacteria 2241
996 Ga0501207_031971 3300049654 Unclassified 888
997 Ga0501217_114225 3300049661 Unclassified 778
998 Ga0501240_053214 3300049673 Unclassified 699
999 Ga0501243_084715 3300049675 Bacteria 622
1000 Ga0501257_117593 3300049686 Bacteria 710
1001 Ga0501234_045982 3300049707 Unclassified 721
1002 Ga0501081_0026942 3300049743 Bacteria 3878
1003 Ga0501081_1515506 3300049743 Unclassified 509
1004 Ga0501269_058361 3300049766 Bacteria 542
1005 Ga0501274_019290 3300049771 Bacteria 697
1006 Ga0501044_0010481 3300049823 Bacteria 10058
1007 nmdc:mga0yw44_288258_c1 3300050492 Bacteria 1098
1008 nmdc:mga06z11_183407_c1 3300050494 Bacteria 1208
1009 nmdc:mga05p37_189046_c1 3300050507 Unclassified 2502
1010 nmdc:mga05p37_350934_c1 3300050507 Bacteria 1737
1011 nmdc:mga05p37_401904_c1 3300050507 Unclassified 1599
1012 nmdc:mga05p37_53960_c1 3300050507 Unclassified 4945
1013 nmdc:mga05p37_557786_c1 3300050507 Bacteria 1302
1014 nmdc:mga09592_122613_c1 3300050508 Bacteria 2233
1015 nmdc:mga09592_485234_c1 3300050508 Bacteria 1064
1016 nmdc:mga09592_69938_c1 3300050508 Bacteria 2978
1017 nmdc:mga09592_807550_c1 3300050508 Unclassified 793
1018 nmdc:mga09592_837423_c1 3300050508 Unclassified 776
1019 nmdc:mga0qj67_230015_c1 3300050509 Bacteria 1505
1020 nmdc:mga0qj67_28907_c1 3300050509 Bacteria 4303
1021 nmdc:mga06r32_14420_c1 3300050510 Bacteria 7173
1022 nmdc:mga06r32_1461657_c1 3300050510 Bacteria 624
1023 nmdc:mga06r32_1549375_c1 3300050510 Unclassified 602
1024 nmdc:mga06r32_246859_c1 3300050510 Unclassified 1773
1025 nmdc:mga06r32_537758_c1 3300050510 Bacteria 845
1026 nmdc:mga08y16_124126_c1 3300050511 Bacteria 2686
1027 nmdc:mga08y16_1452192_c1 3300050511 Bacteria 648
1028 nmdc:mga08y16_334185_c1 3300050511 Archaea 1558
1029 nmdc:mga08y16_361130_c1 3300050511 Bacteria 1491
1030 nmdc:mga08y16_8775_c1 3300050511 Bacteria 10608
1031 nmdc:mga0n895_1995_c1 3300050512 Bacteria 15662
1032 nmdc:mga0n895_20234_c1 3300050512 Bacteria 6202
1033 nmdc:mga0n895_53020_c1 3300050512 Bacteria 3983
1034 nmdc:mga0rr50_1269689_c1 3300050513 Bacteria 625
1035 nmdc:mga0rr50_585366_c1 3300050513 Bacteria 951
1036 nmdc:mga08x19_61025_c1 3300050514 Bacteria 2443
1037 nmdc:mga08x19_692199_c1 3300050514 Unclassified 723
1038 nmdc:mga08x19_78722_c1 3300050514 Bacteria 2161
1039 nmdc:mga0a205_24930_c1 3300050515 Bacteria 5693
1040 Ga0495595_0062145 3300053084 Bacteria 1750
1041 Ga0495619_0181440 3300053085 Bacteria 1456
1042 Ga0500555_085549 3300053103 Bacteria 816
1043 Ga0500568_0004325 3300053139 Bacteria 7617
1044 Ga0501084_0024642 3300054114 Bacteria 5021
1045 Ga0590075_184331 3300059424 Bacteria 552
1046 Ga0501082_0363566 3300060353 Bacteria 1262
1047 Ga0307408_100053291
1048 JGI24750J21931_1071170
1049 JGI24751J29686_10013646
1050 Ga0065714_10104939
1051 Ga0065704_10300883
1052 Ga0065712_10142546
1053 Ga0065712_10240530
1054 Ga0065715_10013536
1055 Ga0065715_10154628
1056 Ga0065715_10262222
1057 Ga0065707_10169318
1058 Ga0070658_10022726
1059 Ga0070658_10466293
1060 Ga0070658_11200686
1061 Ga0070676_10017226
1062 Ga0070676_10438847
1063 Ga0070676_10598069
1064 Ga0070683_100007082
1065 Ga0070683_100043073
1066 Ga0070683_100054583
1067 Ga0070683_100054884
1068 Ga0070683_100213615
1069 Ga0070683_100259727
1070 Ga0070690_100006351
1071 Ga0070690_100198770
1072 Ga0070690_100495904
1073 Ga0070670_100000931
1074 Ga0070670_100010958
1075 Ga0070670_100018455
1076 Ga0070670_100028183
1077 Ga0070670_100083619
1078 Ga0070670_100157952
1079 Ga0070670_100215869
1080 Ga0068869_100001060
1081 Ga0068869_100005352
1082 Ga0068869_100139315
1083 Ga0068869_100157562
1084 Ga0068869_101810342
1085 Ga0070680_100002136
1086 Ga0070680_100002990
1087 Ga0070680_100015797
1088 Ga0070680_100254557
1089 Ga0070680_100416283
1090 Ga0070680_100467663
1091 Ga0070680_100683969
1092 Ga0070682_100006389
1093 Ga0070682_100204659
1094 Ga0070682_101599925
1095 Ga0068868_100034691
1096 Ga0068868_100076503
1097 Ga0068868_100137380
1098 Ga0068868_101425128
1099 Ga0070660_100016010
1100 Ga0070660_100029493
1101 Ga0070660_100063637
1102 Ga0070660_100069056
1103 Ga0070660_100769980
1104 Ga0070689_100010764
1105 Ga0070689_100025827
1106 Ga0070689_100042602
1107 Ga0070689_100053714
1108 Ga0070689_100059840
1109 Ga0070689_100108789
1110 Ga0070689_100565702
1111 Ga0070689_101969194
1112 Ga0070691_10555596
1113 Ga0070687_100001827
1114 Ga0070687_100001863
1115 Ga0070687_100005753
1116 Ga0070687_100017158
1117 Ga0070687_100030986
1118 Ga0070687_100419539
1119 Ga0070687_100438380
1120 Ga0070661_100002737
1121 Ga0070661_100003265
1122 Ga0070661_100054702
1123 Ga0070661_100079331
1124 Ga0070661_100142842
1125 Ga0070661_100705887
1126 Ga0070661_101211360
1127 Ga0070692_10000979
1128 Ga0070692_10022352
1129 Ga0070692_10117872
1130 Ga0070668_100005400
1131 Ga0070668_100097375
1132 Ga0070668_100991044
1133 Ga0070669_100008622
1134 Ga0070669_100071270
1135 Ga0070669_100076559
1136 Ga0070669_100334366
1137 Ga0070669_100362891
1138 Ga0070669_100996674
1139 Ga0070675_100002705
1140 Ga0070675_100006978
1141 Ga0070675_100027571
1142 Ga0070675_100043854
1143 Ga0070675_100064466
1144 Ga0070675_100078611
1145 Ga0070675_100179580
1146 Ga0070675_100554060
1147 Ga0070675_100961948
1148 Ga0070671_100204385
1149 Ga0070671_100204396
1150 Ga0070671_100300866
1151 Ga0070671_100360765
1152 Ga0070671_100496910
1153 Ga0070674_101132913
1154 Ga0070674_101957935
1155 Ga0070673_100018255
1156 Ga0070673_100087832
1157 Ga0070673_100470438
1158 Ga0070673_100628808
1159 Ga0070673_100632501
1160 Ga0070673_101879749
1161 Ga0070688_100012559
1162 Ga0070688_100048353
1163 Ga0070688_100067984
1164 Ga0070688_100076446
1165 Ga0070688_100139264
1166 Ga0070688_100374084
1167 Ga0070659_100001511
1168 Ga0070659_100005764
1169 Ga0070659_100201182
1170 Ga0070659_100205395
1171 Ga0070659_100360746
1172 Ga0070659_100382816
1173 Ga0070659_100420587
1174 Ga0070667_100126037
1175 Ga0070667_100320515
1176 Ga0070667_100657477
1177 Ga0070667_100889540
1178 Ga0070709_10012116
1179 Ga0070709_10058383
1180 Ga0070709_10376775
1181 Ga0070714_100003824
1182 Ga0070714_100021039
1183 Ga0070714_100105740
1184 Ga0070714_100170389
1185 Ga0070714_100624386
1186 Ga0070713_100000025
1187 Ga0070713_100003691
1188 Ga0070713_100017011
1189 Ga0070713_100347345
1190 Ga0070713_101185860
1191 Ga0070701_10094163
1192 Ga0070701_10438115
1193 Ga0070701_11094592
1194 Ga0070701_11291852
1195 Ga0070705_100007971
1196 Ga0070705_100279122
1197 Ga0070700_100040419
1198 Ga0070700_101394340
1199 Ga0070694_100085839
1200 Ga0070708_100000150
1201 Ga0070708_100726782
1202 Ga0070708_101332863
1203 Ga0070663_100088935
1204 Ga0070663_100150323
1205 Ga0070663_100171442
1206 Ga0070678_100177345
1207 Ga0070678_100686840
1208 Ga0070678_101342649
1209 Ga0070678_101364344
1210 Ga0070662_100001762
1211 Ga0070662_100058268
1212 Ga0070681_10001841
1213 Ga0070681_10004249
1214 Ga0070681_10016713
1215 Ga0070681_10017329
1216 Ga0070681_10065137
1217 Ga0070681_10086421
1218 Ga0068867_100068712
1219 Ga0068867_100166200
1220 Ga0070685_10020652
1221 Ga0070685_10029395
1222 Ga0070685_10116626
1223 Ga0070706_100704816
1224 Ga0070698_101098853
1225 Ga0070698_101387969
1226 Ga0070679_100001387
1227 Ga0070679_100013336
1228 Ga0070679_100024483
1229 Ga0070679_100033424
1230 Ga0070679_100054755
1231 Ga0070679_100058217
1232 Ga0070679_100067053
1233 Ga0070679_100286546
1234 Ga0070679_100529926
1235 Ga0070679_100874976
1236 Ga0070679_101483509
1237 Ga0070684_100007083
1238 Ga0070684_100011516
1239 Ga0070684_100012791
1240 Ga0070684_100095492
1241 Ga0070684_100241545
1242 Ga0070684_100649965
1243 Ga0070684_101608007
1244 Ga0068853_100003920
1245 Ga0068853_100051629
1246 Ga0070672_100005963
1247 Ga0070672_100019410
1248 Ga0070672_100039311
1249 Ga0070686_100059558
1250 Ga0070686_100155930
1251 Ga0070686_100292348
1252 Ga0070686_100340412
1253 Ga0070695_100033436
1254 Ga0070695_101500261
1255 Ga0070695_101902937
1256 Ga0070693_100001478
1257 Ga0070693_100009924
1258 Ga0070693_100042820
1259 Ga0070693_100114797
1260 Ga0070665_100165515
1261 Ga0070665_100343765
1262 Ga0070704_101204969
1263 Ga0068855_100010893
1264 Ga0068855_100037691
1265 Ga0068855_100126638
1266 Ga0068855_100175720
1267 Ga0068855_100209400
1268 Ga0068855_100261497
1269 Ga0068855_100399013
1270 Ga0070664_100003653
1271 Ga0070664_100134938
1272 Ga0070664_100208907
1273 Ga0070664_100502009
1274 Ga0070664_100587815
1275 Ga0070664_100882929
1276 Ga0070664_100910285
1277 Ga0068857_100006828
1278 Ga0068857_100013779
1279 Ga0068857_100129190
1280 Ga0068857_100217299
1281 Ga0068857_100504953
1282 Ga0068857_101018496
1283 Ga0068857_102178181
1284 Ga0068857_102504807
1285 Ga0068854_100038402
1286 Ga0068854_100043502
1287 Ga0068854_100264820
1288 Ga0068856_100006507
1289 Ga0068856_100019410
1290 Ga0068856_100101526
1291 Ga0068856_100132970
1292 Ga0068856_101401061
1293 Ga0070702_100001616
1294 Ga0070702_100131845
1295 Ga0070702_100413036
1296 Ga0068852_100021451
1297 Ga0068852_100031615
1298 Ga0068852_100082281
1299 Ga0068852_100090771
1300 Ga0068852_100137868
1301 Ga0068852_100228046
1302 Ga0068852_100735167
1303 Ga0068859_100030462
1304 Ga0068859_100134077
1305 Ga0068859_100284165
1306 Ga0068859_100297763
1307 Ga0068859_100341975
1308 Ga0068859_100424757
1309 Ga0068859_100795598
1310 Ga0068859_101160875
1311 Ga0068864_100002505
1312 Ga0068864_100012482
1313 Ga0068864_100508803
1314 Ga0068864_100597512
1315 Ga0068864_101196134
1316 Ga0068864_102184822
1317 Ga0068864_102666122
1318 Ga0068866_10007846
1319 Ga0068861_100242367
1320 Ga0068861_100928348
1321 Ga0068851_10044560
1322 Ga0068851_10049609
1323 Ga0068851_10600993
1324 Ga0068870_10024914
1325 Ga0068870_10083154
1326 Ga0068863_100008383
1327 Ga0068863_100034302
1328 Ga0068863_100130169
1329 Ga0068863_102052454
1330 Ga0068863_102278532
1331 Ga0068858_100274370
1332 Ga0068858_100484221
1333 Ga0068858_100725701
1334 Ga0068858_101108635
1335 Ga0068860_100013040
1336 Ga0068860_100131262
1337 Ga0068860_100353490
1338 Ga0068860_100449892
1339 Ga0068860_101928788
1340 Ga0068862_100043734
1341 Ga0068862_100071876
1342 Ga0068862_100134843
1343 Ga0068862_100446475
1344 Ga0068862_101150066
1345 Ga0081455_10205281
1346 Ga0081455_10332491
1347 Ga0081539_10000863
1348 Ga0070717_10004042
1349 Ga0070717_10092916
1350 Ga0070717_10196094
1351 Ga0075365_10400778
1352 Ga0075363_100173106
1353 Ga0070716_100432006
1354 Ga0070712_100000921
1355 Ga0075367_10347685
1356 Ga0097621_100003501
1357 Ga0097621_100045898
1358 Ga0097621_101282596
1359 Ga0068871_100011428
1360 Ga0068871_101980668
1361 Ga0075428_100097856
1362 Ga0075428_100192553
1363 Ga0075430_100015935
1364 Ga0075430_100019271
1365 Ga0075430_100947779
1366 Ga0075431_100018100
1367 Ga0075431_100235470
1368 Ga0075431_100388666
1369 Ga0075431_100815435
1370 Ga0075431_101634054
1371 Ga0075433_10010264
1372 Ga0075434_100016394
1373 Ga0075434_100363828
1374 Ga0075429_100130487
1375 Ga0075429_100232997
1376 Ga0075429_100952985
1377 Ga0068865_100159824
1378 Ga0068865_100172862
1379 Ga0068865_100554725
1380 Ga0068865_100749091
1381 Ga0068865_101136372
1382 Ga0075436_100001306
1383 Ga0075436_100072680
1384 Ga0075436_100753832
1385 Ga0097620_100030463
1386 Ga0097620_100134076
1387 Ga0097620_100284147
1388 Ga0097620_100297752
1389 Ga0097620_100341990
1390 Ga0097620_100424757
1391 Ga0097620_100795623
1392 Ga0097620_101160646
1393 Ga0105240_10019123
1394 Ga0105240_10074952
1395 Ga0105240_10094078
1396 Ga0105240_10097917
1397 Ga0105240_11628468
1398 Ga0105240_12357952
1399 Ga0111539_10011677
1400 Ga0111539_10157595
1401 Ga0111539_10191327
1402 Ga0111539_10831037
1403 Ga0111539_11158211
1404 Ga0111539_12526540
1405 Ga0111539_12529623
1406 Ga0105245_10000862
1407 Ga0105245_10008032
1408 Ga0105245_10069903
1409 Ga0105245_10560956
1410 Ga0105245_10577795
1411 Ga0105245_11073352
1412 Ga0114129_10037947
1413 Ga0114129_10140391
1414 Ga0114129_10165856
1415 Ga0114129_10208333
1416 Ga0114129_10300660
1417 Ga0114129_10588185
1418 Ga0114129_12083632
1419 Ga0105243_10509356
1420 Ga0105243_10572272
1421 Ga0105243_10728758
1422 Ga0105243_11089625
1423 Ga0105243_12432171
1424 Ga0105241_10004856
1425 Ga0105241_10025003
1426 Ga0105241_10030599
1427 Ga0105241_10229895
1428 Ga0105241_10606039
1429 Ga0105241_12024215
1430 Ga0105241_12436912
1431 Ga0105242_10018010
1432 Ga0105242_10035609
1433 Ga0105242_10105945
1434 Ga0105242_10185787
1435 Ga0105242_10231132
1436 Ga0105242_10245449
1437 Ga0105242_10356929
1438 Ga0105242_11666531
1439 Ga0105248_10009466
1440 Ga0105248_10028001
1441 Ga0105248_10046810
1442 Ga0105248_10222750
1443 Ga0105248_10342455
1444 Ga0105248_10511359
1445 Ga0105248_12667673
1446 Ga0105237_10060373
1447 Ga0105237_10095256
1448 Ga0105237_10170444
1449 Ga0105237_10881695
1450 Ga0105238_10014160
1451 Ga0105238_10036718
1452 Ga0105238_10091902
1453 Ga0105238_10392581
1454 Ga0105238_11949554
1455 Ga0105249_10008224
1456 Ga0105249_10473584
1457 Ga0105249_10550808
1458 Ga0105249_10690882
1459 Ga0105249_10778668
1460 Ga0105249_11095223
1461 Ga0105249_12108568
1462 Ga0105239_10016532
1463 Ga0105239_10043299
1464 Ga0105239_10671971
1465 Ga0105246_10000894
1466 Ga0105246_10025979
1467 Ga0105246_10351099
1468 Ga0105246_10934483
1469 Ga0105246_12161588
1470 Ga0157373_10011868
1471 Ga0157373_10026438
1472 Ga0157373_10055087
1473 Ga0157373_10072335
1474 Ga0157373_10209631
1475 Ga0157373_10498943
1476 Ga0157371_10005257
1477 Ga0157371_10016287
1478 Ga0157371_10089184
1479 Ga0157370_10005910
1480 Ga0157370_10006626
1481 Ga0157370_10027605
1482 Ga0157370_10144166
1483 Ga0157370_10210067
1484 Ga0157370_11377982
1485 Ga0157369_10007102
1486 Ga0157369_10011694
1487 Ga0157369_10042300
1488 Ga0157369_10561163
1489 Ga0157369_10657917
1490 Ga0157369_10872725
1491 Ga0157374_10003277
1492 Ga0157374_10057504
1493 Ga0157374_10086784
1494 Ga0157374_10364980
1495 Ga0157374_11585322
1496 Ga0157374_12666203
1497 Ga0157378_10023400
1498 Ga0157378_10037379
1499 Ga0157378_11004372
1500 Ga0163162_10011417
1501 Ga0163162_10019361
1502 Ga0163162_10091376
1503 Ga0163162_10806583
1504 Ga0157372_10003786
1505 Ga0157372_10004744
1506 Ga0157372_10004978
1507 Ga0157372_10023223
1508 Ga0157372_10051337
1509 Ga0157372_10051976
1510 Ga0157372_10139079
1511 Ga0157372_10526578
1512 Ga0157372_13254368
1513 Ga0157375_10048113
1514 Ga0157375_10086705
1515 Ga0157375_10154054
1516 Ga0157375_10215325
1517 Ga0157375_10247455
1518 Ga0157375_11056967
1519 Ga0157375_12234063
1520 Ga0163163_10025642
1521 Ga0163163_10042323
1522 Ga0163163_10097700
1523 Ga0163163_10601210
1524 Ga0157380_10085949
1525 Ga0157380_10454849
1526 Ga0182008_10010422
1527 Ga0157377_10000310
1528 Ga0157377_10028404
1529 Ga0157377_10039178
1530 Ga0157377_10060859
1531 Ga0157377_10475132
1532 Ga0157377_10951542
1533 Ga0157379_10130725
1534 Ga0157379_10404298
1535 Ga0157376_10016632
1536 Ga0157376_10027416
1537 Ga0157376_10112637
1538 Ga0157376_10576851
1539 Ga0157376_10995805
1540 Ga0157376_12613554
1541 Ga0182007_10072274
1542 Ga0163161_10143220
1543 Ga0163161_10296554
1544 Ga0163161_10861308
1545 Ga0163161_11002536
1546 Ga0206356_10613338
1547 Ga0206356_11677615
1548 Ga0206356_11775321
1549 Ga0206353_12046695
1550 Ga0213876_10166900
1551 Ga0213875_10016943
1552 Ga0207697_10018355
1553 Ga0207697_10201560
1554 Ga0207697_10268393
1555 Ga0207656_10098082
1556 Ga0207682_10078302
1557 Ga0207682_10106374
1558 Ga0207642_10084369
1559 Ga0207642_10514036
1560 Ga0207642_10529159
1561 Ga0207680_10253732
1562 Ga0207647_10098512
1563 Ga0207699_10001059
1564 Ga0207699_10041188
1565 Ga0207699_10776463
1566 Ga0207699_10892666
1567 Ga0207645_10003890
1568 Ga0207645_10032847
1569 Ga0207645_10400582
1570 Ga0207645_10776539
1571 Ga0207643_10029715
1572 Ga0207643_10395571
1573 Ga0207705_10545618
1574 Ga0207705_10701173
1575 Ga0207684_10520397
1576 Ga0207654_10033886
1577 Ga0207707_10000688
1578 Ga0207707_10012311
1579 Ga0207707_10032491
1580 Ga0207707_10136742
1581 Ga0207707_10349436
1582 Ga0207707_10461885
1583 Ga0207707_10524777
1584 Ga0207707_10818020
1585 Ga0207707_11165715
1586 Ga0207695_10057868
1587 Ga0207695_10061534
1588 Ga0207695_10164498
1589 Ga0207695_10409191
1590 Ga0207671_10054725
1591 Ga0207671_10246351
1592 Ga0207671_10330039
1593 Ga0207693_10005048
1594 Ga0207693_10148552
1595 Ga0207693_10215360
1596 Ga0207693_10221759
1597 Ga0207663_10191988
1598 Ga0207663_11010122
1599 Ga0207660_10002545
1600 Ga0207660_10031487
1601 Ga0207660_10052099
1602 Ga0207660_10245175
1603 Ga0207660_10346385
1604 Ga0207660_10445809
1605 Ga0207660_10540043
1606 Ga0207660_11334638
1607 Ga0207662_10003519
1608 Ga0207662_10004849
1609 Ga0207662_10024421
1610 Ga0207662_10028698
1611 Ga0207662_10046778
1612 Ga0207662_10094666
1613 Ga0207662_10525630
1614 Ga0207657_10018343
1615 Ga0207657_10068015
1616 Ga0207657_10123350
1617 Ga0207657_10293843
1618 Ga0207657_10379387
1619 Ga0207649_10004134
1620 Ga0207649_10008730
1621 Ga0207649_10094990
1622 Ga0207649_10134057
1623 Ga0207649_10620374
1624 Ga0207652_10022315
1625 Ga0207652_10095790
1626 Ga0207652_10095891
1627 Ga0207652_10099237
1628 Ga0207652_10107691
1629 Ga0207652_10141740
1630 Ga0207652_10209423
1631 Ga0207652_10430542
1632 Ga0207652_10646945
1633 Ga0207646_10188498
1634 Ga0207681_10030885
1635 Ga0207681_10052576
1636 Ga0207681_10076823
1637 Ga0207681_11453830
1638 Ga0207694_10015298
1639 Ga0207694_10095905
1640 Ga0207694_10139771
1641 Ga0207694_10704353
1642 Ga0207694_10884658
1643 Ga0207694_11316040
1644 Ga0207650_10015831
1645 Ga0207650_10034539
1646 Ga0207650_10130361
1647 Ga0207650_10183478
1648 Ga0207650_10298911
1649 Ga0207650_10319559
1650 Ga0207650_11146449
1651 Ga0207650_11475476
1652 Ga0207659_10003172
1653 Ga0207659_10073552
1654 Ga0207659_10086478
1655 Ga0207659_10521835
1656 Ga0207659_10568318
1657 Ga0207659_10862844
1658 Ga0207659_11689380
1659 Ga0207687_10044164
1660 Ga0207687_10245102
1661 Ga0207687_10586931
1662 Ga0207687_10744348
1663 Ga0207687_11508403
1664 Ga0207700_10002730
1665 Ga0207700_10007854
1666 Ga0207700_10008742
1667 Ga0207700_10148793
1668 Ga0207664_10009682
1669 Ga0207664_10014587
1670 Ga0207664_10137420
1671 Ga0207664_10151947
1672 Ga0207664_10512584
1673 Ga0207644_10029437
1674 Ga0207644_10123190
1675 Ga0207644_10262685
1676 Ga0207690_10003966
1677 Ga0207690_10014776
1678 Ga0207690_10539519
1679 Ga0207706_10000484
1680 Ga0207706_10003332
1681 Ga0207706_10006006
1682 Ga0207686_10042067
1683 Ga0207686_10046893
1684 Ga0207686_10069262
1685 Ga0207686_10209631
1686 Ga0207686_10621536
1687 Ga0207686_11019339
1688 Ga0207686_11723254
1689 Ga0207709_10178158
1690 Ga0207709_10223575
1691 Ga0207709_10424231
1692 Ga0207670_10006386
1693 Ga0207670_10029811
1694 Ga0207670_10038567
1695 Ga0207670_10132174
1696 Ga0207670_10149247
1697 Ga0207670_10417888
1698 Ga0207670_11216597
1699 Ga0207669_10385550
1700 Ga0207669_11369106
1701 Ga0207704_10073109
1702 Ga0207704_11259348
1703 Ga0207691_10008065
1704 Ga0207691_10046706
1705 Ga0207691_10059934
1706 Ga0207691_11125654
1707 Ga0207711_10019900
1708 Ga0207711_10022137
1709 Ga0207711_10046014
1710 Ga0207711_10048545
1711 Ga0207711_10387975
1712 Ga0207711_10936032
1713 Ga0207689_10003390
1714 Ga0207689_10010237
1715 Ga0207689_10053880
1716 Ga0207689_10070093
1717 Ga0207689_10142538
1718 Ga0207689_10237702
1719 Ga0207689_10304211
1720 Ga0207661_10006832
1721 Ga0207661_10008947
1722 Ga0207661_10021337
1723 Ga0207661_10058997
1724 Ga0207661_10079088
1725 Ga0207679_10002804
1726 Ga0207679_10005660
1727 Ga0207679_10021443
1728 Ga0207679_10156167
1729 Ga0207679_10330272
1730 Ga0207679_10415815
1731 Ga0207679_10783545
1732 Ga0207679_11514133
1733 Ga0207667_10021009
1734 Ga0207667_10132424
1735 Ga0207667_10272074
1736 Ga0207667_10469136
1737 Ga0207667_10768801
1738 Ga0207667_11455495
1739 Ga0207667_11665686
1740 Ga0207651_10098564
1741 Ga0207651_10499464
1742 Ga0207651_11454185
1743 Ga0207651_11690932
1744 Ga0207712_10151798
1745 Ga0207712_10404772
1746 Ga0207712_10497266
1747 Ga0207712_11474376
1748 Ga0207668_10218246
1749 Ga0207668_10547552
1750 Ga0207640_10019678
1751 Ga0207640_10216835
1752 Ga0207640_11058155
1753 Ga0207658_10184307
1754 Ga0207658_11785562
1755 Ga0207677_10006467
1756 Ga0207677_10144256
1757 Ga0207677_10189133
1758 Ga0207677_11323947
1759 Ga0207703_10100040
1760 Ga0207703_10454756
1761 Ga0207703_10715188
1762 Ga0207703_11281574
1763 Ga0207639_10596460
1764 Ga0207678_10013878
1765 Ga0207678_10044580
1766 Ga0207678_10101242
1767 Ga0207708_10039035
1768 Ga0207708_10074454
1769 Ga0207702_10010084
1770 Ga0207702_10133131
1771 Ga0207702_10572587
1772 Ga0207702_11099480
1773 Ga0207641_10010078
1774 Ga0207641_10171912
1775 Ga0207641_10330489
1776 Ga0207641_10476040
1777 Ga0207641_12134630
1778 Ga0207648_10025214
1779 Ga0207648_10060369
1780 Ga0207648_10211099
1781 Ga0207648_10855309
1782 Ga0207676_10001453
1783 Ga0207676_10027783
1784 Ga0207676_10042608
1785 Ga0207676_10425819
1786 Ga0207676_11854275
1787 Ga0207674_10000541
1788 Ga0207674_10001092
1789 Ga0207674_10004637
1790 Ga0207674_10415891
1791 Ga0207674_10478807
1792 Ga0207674_11888246
1793 Ga0207675_100000290
1794 Ga0207675_100078397
1795 Ga0207675_102502515
1796 Ga0207683_10166191
1797 Ga0207683_10208193
1798 Ga0207683_10393284
1799 Ga0207683_10549229
1800 Ga0207683_12064560
1801 Ga0207698_10015494
1802 Ga0207698_10024707
1803 Ga0207698_10146460
1804 Ga0207698_10197353
1805 Ga0207698_10248307
1806 Ga0207698_11001648
1807 Ga0207698_11840717
1808 Ga0207428_10033527
1809 Ga0207428_10610661
1810 Ga0207428_10781157
1811 Ga0268266_10116517
1812 Ga0268266_10549322
1813 Ga0268266_10575428
1814 Ga0268266_10697021
1815 Ga0268265_10029323
1816 Ga0268265_10084070
1817 Ga0268265_10152304
1818 Ga0268265_10597396
1819 Ga0268265_10678313
1820 Ga0268265_11193603
1821 Ga0268265_11637546
1822 Ga0268265_11923327
1823 Ga0268264_10020504
1824 Ga0268264_10052234
1825 Ga0268264_10153158
1826 Ga0268264_11365296
1827 Ga0307408_100056790
1828 Ga0307408_100072150
1829 Ga0307408_100574209
1830 Ga0307408_100996708
1831 Ga0307408_101128554
1832 Ga0307408_101901754
1833 Ga0307405_10000770
1834 Ga0307405_10107211
1835 Ga0307405_10125572
1836 Ga0307405_11465264
1837 Ga0307413_10001084
1838 Ga0307413_10016313
1839 Ga0307413_10061643
1840 Ga0307410_10007976
1841 Ga0307410_10045617
1842 Ga0307410_10229415
1843 Ga0307410_10864192
1844 Ga0307410_10971499
1845 Ga0307410_10976667
1846 Ga0307406_10001060
1847 Ga0307406_10015356
1848 Ga0307406_10021744
1849 Ga0307406_11350331
1850 Ga0307406_11958525
1851 Ga0307407_10017311
1852 Ga0307407_10436978
1853 Ga0307407_11391990
1854 Ga0307407_11600958
1855 Ga0307412_10021525
1856 Ga0307412_10314868
1857 Ga0307412_11953562
1858 Ga0307412_12093540
1859 Ga0307409_100009207
1860 Ga0307409_100024520
1861 Ga0307409_100195149
1862 Ga0307409_100219582
1863 Ga0307409_100243114
1864 Ga0307409_100748082
1865 Ga0307409_101007769
1866 Ga0307416_100000626
1867 Ga0307416_100020188
1868 Ga0307416_100075775
1869 Ga0307416_100123109
1870 Ga0307416_100203990
1871 Ga0307416_100256646
1872 Ga0307416_100346458
1873 Ga0307416_100396418
1874 Ga0307416_101056778
1875 Ga0307416_102100468
1876 Ga0307416_103502031
1877 Ga0307414_10054957
1878 Ga0307414_10095103
1879 Ga0307414_10710501
1880 Ga0307411_10002520
1881 Ga0307411_10019501
1882 Ga0307411_10508116
1883 Ga0307411_10812572
1884 Ga0307411_11316593
1885 Ga0307411_12074032
1886 Ga0307415_100010134
1887 Ga0307415_100026652
1888 Ga0307415_100158168
1889 Ga0307415_100739004
1890 Ga0307415_101022033
1891 Ga0307415_101196065
1892 Ga0307415_101669246
1893 Ga0373958_0052152
1894 Ga0373959_0089269
1895 Ga0373926_0059184
1896 Ga0373934_0168693
1897 Ga0373944_0130645
1898 Ga0373923_0150963
1899 Ga0373953_0009385
1900 Ga0373954_0014306
1901 Ga0373954_0248844
1902 Ga0373954_0520625
1903 Ga0373956_0069490
1904 Ga0373956_0260098
1905 Ga0373956_0349231
1906 Ga0373957_0006187
1907 Ga0373957_0449257
1908 Ga0373943_0117565
1909 Ga0373955_0088862
1910 Ga0373955_0116756
1911 Ga0373955_0159667
1912 Ga0373924_0027445
1913 Ga0373924_0448433
1914 Ga0373931_0709976
1915 Ga0373927_0468180
1916 Ga0373933_0002582
1917 Ga0373933_0045154
1918 Ga0373933_0766050
1919 Ga0373947_0418412
1920 Ga0373947_0487914
1921 Ga0373937_0000748
1922 Ga0373937_0050014
1923 Ga0373937_0407390
1924 Ga0373937_0529478
1925 Ga0373937_0942080
1926 Ga0373925_0118685
1927 Ga0373925_0227568
1928 Ga0373925_0297261
1929 Ga0395900_1785096
1930 Ga0395905_0128350
1931 Ga0395905_0194900
1932 Ga0436364_0116274
1933 Ga0436364_0551931
1934 Ga0436365_0462076
1935 Ga0436365_1691355
1936 Ga0436365_1784765
1937 Ga0436365_1812463
1938 Ga0439461_0099116
1939 Ga0439433_0083731
1940 Ga0439448_0315636
1941 Ga0439462_0070785
1942 Ga0439434_0185137
1943 Ga0439435_0214650
1944 Ga0439464_0144019
1945 Ga0466964_0596758
1946 Ga0451576_0060587
1947 Ga0451576_0097525
1948 Ga0451576_0756952
1949 Ga0466958_0086088
1950 Ga0466958_0529270
1951 Ga0466967_0032376
1952 Ga0495592_0316296
1953 Ga0495592_0769152
1954 Ga0495590_0411843
1955 Ga0495629_0066937
1956 Ga0495651_0002896
1957 Ga0495651_0008970
1958 Ga0495651_0614437
1959 Ga0495653_0076774
1960 Ga0495580_0018253
1961 Ga0495580_0146512
1962 Ga0495580_0271857
1963 Ga0495582_0151183
1964 Ga0495582_0613448
1965 Ga0495582_0810676
1966 Ga0495594_0008741
1967 Ga0495594_0623666
1968 Ga0495608_0251285
1969 Ga0495618_0321883
1970 Ga0495628_1000136
1971 Ga0495628_1031909
1972 Ga0495630_0108600
1973 Ga0495630_0218814
1974 Ga0495665_0001106
1975 Ga0495640_0373715
1976 Ga0495586_0097511
1977 Ga0495587_0000482
1978 Ga0495587_0144931
1979 Ga0495645_0000281
1980 Ga0495645_0043342
1981 Ga0495645_0278482
1982 Ga0495667_0011011
1983 Ga0495667_0030784
1984 Ga0495667_0120979
1985 Ga0495635_0014422
1986 Ga0495659_0167647
1987 Ga0495588_0075602
1988 Ga0495588_0720393
1989 Ga0495657_0021558
1990 Ga0495657_0033293
1991 Ga0495657_0251438
1992 Ga0495599_0013463
1993 Ga0495599_0129384
1994 Ga0495623_0002762
1995 Ga0495623_0022090
1996 Ga0495646_0046802
1997 Ga0495646_0124875
1998 Ga0495658_0138431
1999 Ga0495600_0022993
2000 Ga0495600_0027414
2001 Ga0495581_0116696
2002 Ga0495581_0284798
2003 Ga0495604_0154009
2004 Ga0495604_0262713
2005 Ga0495636_0320499
2006 Ga0495674_0016536
2007 Ga0495674_0380352
2008 Ga0495680_0038295
2009 Ga0495680_0770867
2010 Ga0495675_0000541
2011 Ga0495675_0362508
2012 Ga0495684_0012331
2013 Ga0495684_0023899
2014 Ga0495684_0243896
2015 Ga0495602_0071284
2016 Ga0495602_0150380
2017 Ga0495602_0325896
2018 Ga0495615_0038362
2019 Ga0495615_0150895
2020 Ga0496104_0064159
2021 Ga0496105_0343570
2022 Ga0496105_0547733
2023 Ga0496108_0034415
2024 Ga0496109_0096288
2025 Ga0496112_0089131
2026 Ga0496112_0779607
2027 Ga0501296_019781
2028 Ga0501034_1661771
2029 Ga0501038_0436511
2030 Ga0501042_1022788
2031 Ga0501043_0424599
2032 Ga0501048_1030562
2033 Ga0501067_0034037
2034 Ga0501069_0681024
2035 Ga0501071_1311178
2036 Ga0501072_0391676
2037 Ga0501072_0505646
2038 Ga0501075_0572541
2039 Ga0501076_0876548
2040 Ga0501076_1739820
2041 Ga0501077_0069005
2042 Ga0501207_031971
2043 Ga0501217_114225
2044 Ga0501240_053214
2045 Ga0501243_084715
2046 Ga0501257_117593
2047 Ga0501234_045982
2048 Ga0501081_0026942
2049 Ga0501081_1515506
2050 Ga0501269_058361
2051 Ga0501274_019290
2052 Ga0501044_0010481
2053 nmdc:mga0yw44_288258_c1
2054 nmdc:mga06z11_183407_c1
2055 nmdc:mga05p37_189046_c1
2056 nmdc:mga05p37_350934_c1
2057 nmdc:mga05p37_401904_c1
2058 nmdc:mga05p37_53960_c1
2059 nmdc:mga05p37_557786_c1
2060 nmdc:mga09592_122613_c1
2061 nmdc:mga09592_485234_c1
2062 nmdc:mga09592_69938_c1
2063 nmdc:mga09592_807550_c1
2064 nmdc:mga09592_837423_c1
2065 nmdc:mga0qj67_230015_c1
2066 nmdc:mga0qj67_28907_c1
2067 nmdc:mga06r32_14420_c1
2068 nmdc:mga06r32_1461657_c1
2069 nmdc:mga06r32_1549375_c1
2070 nmdc:mga06r32_246859_c1
2071 nmdc:mga06r32_537758_c1
2072 nmdc:mga08y16_124126_c1
2073 nmdc:mga08y16_1452192_c1
2074 nmdc:mga08y16_334185_c1
2075 nmdc:mga08y16_361130_c1
2076 nmdc:mga08y16_8775_c1
2077 nmdc:mga0n895_1995_c1
2078 nmdc:mga0n895_20234_c1
2079 nmdc:mga0n895_53020_c1
2080 nmdc:mga0rr50_1269689_c1
2081 nmdc:mga0rr50_585366_c1
2082 nmdc:mga08x19_61025_c1
2083 nmdc:mga08x19_692199_c1
2084 nmdc:mga08x19_78722_c1
2085 nmdc:mga0a205_24930_c1
2086 Ga0495595_0062145
2087 Ga0495619_0181440
2088 Ga0500555_085549
2089 Ga0500568_0004325
2090 Ga0501084_0024642
2091 Ga0590075_184331
2092 Ga0501082_0363566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

31

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8872 12 113
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8769 20 120
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8736 12 113
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8706 13 113
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.8577 14 119
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8834 20 97 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8754 20 120 1.10.10.10
5x13A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8584 18 97 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8546 20 96 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8432 15 115 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R1LC83-F1-model_v4 PadR family transcriptional regulator 0.9951 17 116
AF-A0A2V9ASX9-F1-model_v4 PadR family transcriptional regulator 0.9855 17 117
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9849 23 117
AF-A0A6L4ZKY0-F1-model_v4 Transcriptional regulator PadR-family 0.9792 17 117
AF-A0A843S070-F1-model_v4 PadR family transcriptional regulator 0.9765 16 117

Map