F488941

General Info

Members Datasets Scaffolds Average Seq Length
1045 772 491 293

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0081509|Ga0495606_0081509_316_1164
Length 282
Sequence MVKTLVPAEMRNFEMFEILEPATQTIPFVYNSPHSGRIYPPDFIAQSRLEGAAIRRSEDHYVDELFKAAADLGAPLLFANFPRAYIDVNREPYELDPRMFDGALPPYANINSIRVAGGLGTIPRIVAENMEIYARRVPVEDALIASTHVQFGFGVLIDCHSMPGNIRVAGSSAHPDIIVGDRYGTSASAELSRAAMCILEDLGFTAVRNKPYAGGFITEHYGRPSRGLHALQIEVNRSLYVDEATLEKRPDFAAVANAITDFMQQMSDYVANFASDRALAAE

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
61 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
62 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
63 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
86 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
87 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
88 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
89 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
90 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
91 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
92 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
93 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
96 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221557 Ensifer sp. Root558 Isolate Unclassified
104 2643221582 Rhizobium sp. Root651 Isolate Unclassified
105 2643221599 Rhizobium sp. Root708 Isolate Unclassified
106 2643221607 Rhizobium sp. Root73 Isolate Unclassified
107 2643221610 Ensifer sp. Root74 Isolate Unclassified
108 2643221618 Ensifer sp. Root231 Isolate Unclassified
109 2643221626 Ensifer sp. Root31 Isolate Unclassified
110 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
111 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
112 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
113 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
114 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
115 2643221655 Ensifer sp. Root1252 Isolate Unclassified
116 2643221659 Ensifer sp. Root127 Isolate Unclassified
117 2643221668 Ensifer sp. Root423 Isolate Unclassified
118 2643221675 Ensifer sp. Root1298 Isolate Unclassified
119 2643221680 Ensifer sp. Root1312 Isolate Unclassified
120 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
121 2643221688 Rhizobium sp. Root482 Isolate Unclassified
122 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
123 2643221693 Rhizobium sp. Root491 Isolate Unclassified
124 2643221698 Ensifer sp. Root142 Isolate Unclassified
125 2643221712 Ensifer sp. Root258 Isolate Unclassified
126 2643221718 Rhizobium sp. Root268 Isolate Unclassified
127 2643221719 Rhizobium sp. Root274 Isolate Unclassified
128 2643221723 Ensifer sp. Root278 Isolate Unclassified
129 2643221726 Ensifer sp. Root954 Isolate Unclassified
130 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
131 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
132 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
133 2718217882 Rhizobium sp. N741 Isolate Nodule
134 2718217927 Rhizobium sp. N324 Isolate Nodule
135 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
136 2718218009 Rhizobium sp. N561 Isolate Nodule
137 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
138 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
139 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
140 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
141 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
142 2718218363 Rhizobium sp. N113 Isolate Nodule
143 2718218365 Rhizobium sp. N731 Isolate Nodule
144 2718218366 Rhizobium sp. N621 Isolate Nodule
145 2718218423 Rhizobium sp. N941 Isolate Nodule
146 2721755514 Rhizobium sp. N6212 Isolate Nodule
147 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
148 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
149 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
150 2721755809 Rhizobium sp. N541 Isolate Nodule
151 2721755810 Rhizobium sp. N871 Isolate Nodule
152 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
153 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
154 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
155 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
156 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
157 2728369365 Rhizobium sp. N1341 Isolate Nodule
158 2728369397 Rhizobium sp. N1314 Isolate Nodule
159 2738541293 Rhizobium sp. GV031 Isolate Unclassified
160 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
161 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
162 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
163 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
164 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
165 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
166 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
167 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
168 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
169 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
170 2791355256 Rhizobium sp. M10 Isolate Nodule
171 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
172 2791355260 Rhizobium sp. L9 Isolate Nodule
173 2791355261 Rhizobium sp. J15 Isolate Nodule
174 2791355262 Rhizobium sp. M1 Isolate Nodule
175 2791355263 Rhizobium chutanense C5 Isolate Nodule
176 2791355264 Rhizobium sp. S9 Isolate Nodule
177 2791355265 Rhizobium sp. H4 Isolate Nodule
178 2791355266 Rhizobium sp. L43 Isolate Nodule
179 2791355267 Rhizobium sp. L18 Isolate Nodule
180 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
181 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
182 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
183 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
184 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
185 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
186 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
187 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
188 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
189 2802429633 Rhizobium anhuiense J3 Isolate Nodule
190 2802429634 Rhizobium anhuiense S10 Isolate Nodule
191 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
192 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
193 2802429637 Rhizobium anhuiense C15 Isolate Nodule
194 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
195 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
196 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
197 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
198 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
199 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
200 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
201 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
202 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
203 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
204 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
205 2838048938 Rhizobium pisi 27/80 Isolate Nodule
206 2838061910 Rhizobium phaseoli L15 Isolate Nodule
207 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
208 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
209 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
210 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
211 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
212 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
213 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
214 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
215 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
216 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
217 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
218 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
219 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
220 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
221 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
222 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
223 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
224 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
225 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
226 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
227 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
230 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
231 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
232 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
233 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
234 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
235 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
236 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
237 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
238 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
239 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
240 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
241 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
242 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
243 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
244 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
245 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
246 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
247 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
248 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
249 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
250 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
251 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
252 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
253 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
254 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
255 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
256 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
257 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
258 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
259 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
260 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
261 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
262 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
263 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
264 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
265 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
266 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
267 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
268 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
269 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
270 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
271 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
272 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
273 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
274 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
275 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
276 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
277 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
278 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
279 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
280 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
281 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
282 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
283 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
284 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
285 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
286 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
287 2844163670 Ensifer sp. 1H6 Isolate Unclassified
288 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
289 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
290 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
291 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
292 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
293 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
294 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
295 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
296 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
297 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
298 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
299 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
300 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
301 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
302 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
303 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
304 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
305 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
306 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
307 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
308 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
309 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
310 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
311 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
312 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
313 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
314 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
315 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
316 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
317 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
318 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
319 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
320 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
321 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
322 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
323 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
324 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
325 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
326 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
327 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
328 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
329 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
330 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
331 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
332 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
333 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
334 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
335 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
336 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
337 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
338 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
339 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
340 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
341 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
342 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
343 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
344 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
345 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
346 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
347 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
348 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
349 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
350 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
351 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
352 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
353 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
354 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
355 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
356 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
357 2933599457 Rhizobium phaseoli M3 Isolate Nodule
358 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
359 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
360 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
361 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
362 2936381700 Rhizobium chutanense C16 Isolate Unclassified
363 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
364 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
365 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
366 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
367 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
368 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
369 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
370 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
371 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
372 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
373 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
374 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
375 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
376 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
377 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
378 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
379 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
380 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
381 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
382 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
383 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
384 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
385 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
386 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
387 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
388 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
389 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
390 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
391 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
392 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
393 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
394 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
395 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
396 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
397 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
398 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
399 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
400 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
401 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
402 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
403 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
404 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
405 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
406 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
407 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
408 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
409 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
410 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
411 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
412 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
413 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
414 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
415 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
416 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
417 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
418 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
419 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
420 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
421 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
422 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
423 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
424 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
425 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
426 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
427 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
428 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
429 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
430 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
431 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
432 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
433 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
434 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
435 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
436 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
437 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
438 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
439 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
440 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
441 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
442 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
443 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
444 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
445 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
446 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
447 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
448 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
449 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
450 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
451 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
452 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
453 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
454 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
455 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
456 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
457 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
458 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
459 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
460 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
461 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
462 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
463 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
464 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
465 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
466 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
467 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
468 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
469 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
470 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
471 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
472 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
473 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
474 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
475 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
476 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
477 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
478 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
479 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
480 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
481 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
482 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
483 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
484 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
485 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
486 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
487 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
488 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
489 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
490 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
491 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
492 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
493 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
494 2996887358 Rhizobium sp. R711 Isolate Nodule
495 2996893221 Rhizobium sp. R635 Isolate Nodule
496 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
497 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
498 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
499 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
500 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
501 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
502 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
503 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
504 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
505 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
506 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
507 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
508 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
509 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
510 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
511 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
512 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
513 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
514 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
515 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
516 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
517 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
518 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
519 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
520 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
521 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
522 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
523 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
524 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
525 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
526 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
527 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
528 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
529 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
530 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
531 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
532 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
533 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
534 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
535 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
536 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
537 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
538 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
539 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
540 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
541 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
542 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
543 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
544 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
545 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
546 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
547 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
548 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
549 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
550 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
551 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
552 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
553 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
554 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
555 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
556 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
557 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
558 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
559 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
560 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
561 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
562 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
563 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
564 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
565 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
566 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
567 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
569 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
570 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
571 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
572 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
574 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
575 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
576 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
578 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
579 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
581 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
582 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
583 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
584 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
585 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
586 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
587 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
595 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
596 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
598 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
599 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
600 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
601 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
602 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
603 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
604 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
605 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
606 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
607 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
608 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
609 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
610 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
611 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
612 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
613 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
614 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
615 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
616 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
617 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
618 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
619 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
620 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
621 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
622 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
623 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
624 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
625 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
626 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
627 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
628 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
629 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
630 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
631 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
632 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
633 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
634 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
635 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
636 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
637 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
638 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
639 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
640 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
641 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
642 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
643 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
644 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
645 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
646 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
647 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
648 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
649 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
650 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
651 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
652 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
653 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
654 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
655 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
656 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
657 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
658 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
659 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
660 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
661 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
662 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
663 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
664 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
665 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
666 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
667 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
668 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
669 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
670 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
671 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
672 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
673 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
674 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
675 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
676 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
677 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
678 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
679 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
680 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
681 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
682 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
683 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
684 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
685 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
689 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
690 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
691 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
692 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
693 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
694 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
695 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
696 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
697 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
698 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
699 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
700 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
701 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
702 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
703 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
704 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
705 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
706 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
707 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
708 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
709 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
710 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
711 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
712 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
713 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
714 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
715 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
716 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
717 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
718 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
719 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
720 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
722 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
723 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
724 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
725 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
726 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
727 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
728 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
729 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
730 8005258706 Rhizobium sp. R693 Isolate Nodule
731 8005275841 Rhizobium sp. N4311 Isolate Nodule
732 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
733 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
734 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
735 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
736 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
737 8005321885 Rhizobium sp. R72 Isolate Nodule
738 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
739 8005382845 Rhizobium sp. R634 Isolate Nodule
740 8005395548 Rhizobium sp. R339 Isolate Nodule
741 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
742 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
743 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
744 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
745 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
746 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
747 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
748 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
749 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
750 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
751 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
752 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
753 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
754 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
755 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
756 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
757 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
758 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
759 8018176218 Rhizobium sp. N122 Isolate Nodule
760 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
761 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
762 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
763 8024501048 Rhizobium sp. H4 Isolate Nodule
764 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
765 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
766 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
767 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
768 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
769 8056382006 Rhizobium croatiense 13T Isolate Nodule
770 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
771 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
772 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.79
Metatranscriptomes 0.19
Isolates 53.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.57
Nodule 40.86
Rhizoplane 1.44
Rhizosphere 18.76
Stem 0
Stem Tuber 0
Unclassified 18.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000007 3300002704 Bacteria 238857
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1001609 3300002705 Bacteria 9231
4 JGI25162J39368_1000449 3300002737 Bacteria 32568
5 JGI25162J39368_1000471 3300002737 Bacteria 31064
6 JGI25154J39366_1001077 3300002738 Bacteria 10749
7 JGI25154J39366_1001309 3300002738 Bacteria 9240
8 JGI25158J39367_1000349 3300002739 Bacteria 10100
9 JGI25158J39367_1010726 3300002739 Bacteria 1233
10 JGI25157J39369_1000124 3300002741 Bacteria 65844
11 JGI25152J39213_1001533 3300002773 Bacteria 9815
12 JGI25152J39213_1002032 3300002773 Bacteria 7981
13 JGI25152J39213_1003616 3300002773 Bacteria 5226
14 JGI25152J39213_1003776 3300002773 Bacteria 5037
15 JGI25152J39213_1013279 3300002773 Bacteria 1723
16 JGI25152J39213_1014056 3300002773 Bacteria 1638
17 JGI25152J39213_1014066 3300002773 Bacteria 1638
18 JGI25150J39212_1000230 3300002774 Bacteria 30285
19 JGI25150J39212_1002298 3300002774 Bacteria 4826
20 JGI25150J39212_1008858 3300002774 Bacteria 1946
21 JGI25159J45721_1000018 3300002987 Bacteria 132603
22 JGI25159J45721_1000663 3300002987 Bacteria 15229
23 JGI25159J45721_1002318 3300002987 Bacteria 7308
24 JGI25151J46595_10000031 3300003187 Bacteria 197865
25 JGI25151J46595_10001231 3300003187 Bacteria 18298
26 JGI25151J46595_10001414 3300003187 Bacteria 16416
27 JGI25151J46595_10017466 3300003187 Bacteria 3108
28 JGI25151J46595_10034862 3300003187 Bacteria 1918
29 JGI25165J46597_1000443 3300003214 Bacteria 41663
30 JGI25165J46597_1000845 3300003214 Bacteria 22396
31 JGI25153J46596_10000937 3300003215 Bacteria 17751
32 JGI25153J46596_10004558 3300003215 Bacteria 7439
33 JGI25153J46596_10008345 3300003215 Bacteria 4967
34 JGI25153J46596_10013198 3300003215 Bacteria 3509
35 JGI25153J46596_10020921 3300003215 Bacteria 2455
36 JGI25153J46596_10034876 3300003215 Bacteria 1638
37 JGI25153J46596_10034878 3300003215 Bacteria 1638
38 JGI25160J50197_1000009 3300003354 Bacteria 282862
39 JGI25160J50197_1000114 3300003354 Bacteria 75947
40 JGI25160J50197_1001417 3300003354 Bacteria 12009
41 JGI25160J50197_1012549 3300003354 Bacteria 2934
42 JGI25161J50226_1000089 3300003374 Bacteria 73775
43 JGI25161J50226_1000901 3300003374 Bacteria 10703
44 JGI25161J50226_1002710 3300003374 Bacteria 4386
45 JGI25161J50226_1004105 3300003374 Bacteria 3128
46 Ga0055526_1000979 3300003771 Bacteria 21027
47 Ga0055526_1003292 3300003771 Bacteria 10355
48 Ga0055526_1006440 3300003771 Bacteria 6366
49 Ga0055526_1015198 3300003771 Bacteria 3103
50 Ga0055526_1015714 3300003771 Bacteria 3019
51 Ga0055524_1002889 3300003775 Bacteria 8588
52 Ga0055524_1003460 3300003775 Bacteria 7657
53 Ga0055524_1005154 3300003775 Bacteria 5894
54 Ga0055524_1011210 3300003775 Bacteria 3522
55 Ga0055524_1017766 3300003775 Bacteria 2496
56 Ga0055536_1000582 3300003781 Bacteria 24895
57 Ga0055528_1000704 3300003790 Bacteria 23717
58 Ga0055528_1002226 3300003790 Bacteria 10577
59 Ga0055528_1006711 3300003790 Bacteria 5187
60 Ga0055528_1006918 3300003790 Bacteria 5084
61 Ga0055530_10000287 3300003791 Bacteria 45977
62 Ga0055530_10011799 3300003791 Bacteria 3103
63 Ga0055540_1000537 3300003792 Bacteria 28483
64 Ga0055540_1004346 3300003792 Bacteria 6435
65 Ga0055531_10002239 3300003794 Bacteria 13094
66 Ga0055531_10002396 3300003794 Bacteria 12589
67 Ga0058692_1016793 3300003856 Bacteria 1618
68 Ga0055543_1000002 3300004625 Bacteria 390020
69 Ga0055543_1000055 3300004625 Bacteria 103837
70 Ga0055543_1000077 3300004625 Bacteria 86457
71 Ga0055543_1000724 3300004625 Bacteria 16747
72 Ga0065165_1000020 3300005262 Bacteria 265570
73 Ga0065165_1000537 3300005262 Bacteria 57544
74 Ga0065165_1002901 3300005262 Bacteria 13155
75 Ga0065165_1004459 3300005262 Bacteria 8658
76 Ga0065165_1010015 3300005262 Bacteria 4166
77 Ga0070670_100000577 3300005331 Bacteria 28993
78 Ga0070671_100066028 3300005355 Bacteria 3015
79 Ga0070667_100073952 3300005367 Bacteria 2906
80 Ga0070663_100078389 3300005455 Bacteria 2421
81 Ga0070662_100408109 3300005457 Bacteria 1122
82 Ga0070665_100003560 3300005548 Bacteria 16520
83 Ga0070665_100130182 3300005548 Bacteria 2518
84 Ga0068856_100351846 3300005614 Bacteria 1492
85 Ga0068852_100115404 3300005616 Bacteria 2448
86 Ga0075365_10004800 3300006038 Bacteria 7210
87 Ga0075365_10031222 3300006038 Bacteria 3417
88 Ga0075368_10001630 3300006042 Bacteria 7207
89 Ga0075368_10018029 3300006042 Bacteria 2648
90 Ga0075363_100071258 3300006048 Bacteria 1889
91 Ga0075364_10000009 3300006051 Bacteria 64760
92 Ga0075364_10162552 3300006051 Bacteria 1507
93 Ga0075362_10009877 3300006177 Bacteria 3706
94 Ga0075362_10014139 3300006177 Bacteria 3215
95 Ga0075367_10007124 3300006178 Bacteria 5703
96 Ga0075367_10020813 3300006178 Bacteria 3659
97 Ga0075367_10081074 3300006178 Bacteria 1963
98 Ga0075367_10096813 3300006178 Bacteria 1800
99 Ga0075369_10001520 3300006186 Bacteria 7936
100 Ga0075369_10006231 3300006186 Bacteria 4505
101 Ga0075366_10162942 3300006195 Bacteria 1351
102 Ga0075370_10000872 3300006353 Bacteria 12280
103 Ga0075370_10115253 3300006353 Bacteria 1562
104 Ga0079104_1000042 3300006946 Bacteria 185991
105 Ga0079104_1006567 3300006946 Bacteria 4370
106 Ga0099826_10000270 3300006948 Bacteria 23085
107 Ga0105251_10006217 3300009011 Bacteria 7659
108 Ga0105250_10028882 3300009092 Bacteria 2232
109 Ga0105240_10000019 3300009093 Bacteria 406211
110 Ga0105243_10247981 3300009148 Bacteria 1588
111 Ga0105237_10001085 3300009545 Bacteria 36406
112 Ga0105238_10256518 3300009551 Bacteria 1728
113 Ga0123341_1000016 3300009765 Bacteria 85309
114 Ga0123342_1011116 3300009766 Bacteria 10003
115 Ga0123342_1044877 3300009766 Bacteria 1478
116 Ga0105239_10030478 3300010375 Bacteria 5930
117 Ga0105246_10035508 3300011119 Bacteria 3333
118 Ga0157322_1002157 3300012490 Bacteria 1077
119 Ga0157373_10006893 3300013100 Bacteria 8454
120 Ga0157373_10108052 3300013100 Bacteria 1956
121 Ga0157371_10000304 3300013102 Bacteria 64521
122 Ga0157370_10000824 3300013104 Bacteria 39223
123 Ga0157370_10010711 3300013104 Bacteria 9647
124 Ga0157370_10029226 3300013104 Bacteria 5414
125 Ga0171463_1006 3300013249 Bacteria 336402
126 Ga0182007_10004588 3300015262 Bacteria 6239
127 Ga0182005_1007509 3300015265 Bacteria 3267
128 Ga0183363_1123 3300015690 Bacteria 20240
129 Ga0214544_1000063 3300021320 Bacteria 129929
130 Ga0214542_1010067 3300021321 Bacteria 14119
131 Ga0214543_1010170 3300021327 Bacteria 14126
132 Ga0209435_100005 3300025206 Bacteria 573745
133 Ga0209436_100072 3300025208 Bacteria 51104
134 Ga0209436_100601 3300025208 Bacteria 15395
135 Ga0209436_105953 3300025208 Bacteria 2731
136 Ga0209672_109696 3300025228 Bacteria 1343
137 Ga0209437_100078 3300025233 Bacteria 278088
138 Ga0209437_100291 3300025233 Bacteria 72764
139 Ga0207425_1000070 3300025245 Bacteria 116438
140 Ga0207425_1003108 3300025245 Bacteria 5482
141 Ga0207425_1004995 3300025245 Bacteria 3861
142 Ga0209646_1000011 3300025246 Bacteria 573745
143 Ga0209646_1007664 3300025246 Bacteria 1752
144 Ga0209026_1000008 3300025250 Bacteria 573745
145 Ga0209677_100640 3300025253 Bacteria 18579
146 Ga0209759_1000004 3300025256 Bacteria 573745
147 Ga0209129_1000080 3300025258 Bacteria 186416
148 Ga0209129_1000172 3300025258 Bacteria 95144
149 Ga0209129_1000232 3300025258 Bacteria 61645
150 Ga0209129_1000681 3300025258 Bacteria 22426
151 Ga0209129_1000773 3300025258 Bacteria 20269
152 Ga0209129_1001915 3300025258 Bacteria 10961
153 Ga0209129_1002970 3300025258 Bacteria 7729
154 Ga0209129_1007179 3300025258 Bacteria 3386
155 Ga0209233_1000157 3300025261 Bacteria 164269
156 Ga0209233_1000192 3300025261 Bacteria 127171
157 Ga0209233_1000194 3300025261 Bacteria 126185
158 Ga0209455_1015810 3300025272 Bacteria 1642
159 Ga0209673_1000037 3300025273 Bacteria 313804
160 Ga0209673_1000060 3300025273 Bacteria 263602
161 Ga0209673_1000312 3300025273 Bacteria 89594
162 Ga0209673_1000439 3300025273 Bacteria 71645
163 Ga0209673_1000649 3300025273 Bacteria 51399
164 Ga0209673_1001880 3300025273 Bacteria 16931
165 Ga0209673_1004749 3300025273 Bacteria 7146
166 Ga0209673_1006702 3300025273 Bacteria 5495
167 Ga0209130_1000030 3300025284 Bacteria 323323
168 Ga0209130_1000037 3300025284 Bacteria 284019
169 Ga0209130_1000083 3300025284 Bacteria 162582
170 Ga0209130_1029986 3300025284 Bacteria 1128
171 Ga0209676_1001698 3300025292 Bacteria 19051
172 Ga0209676_1009885 3300025292 Bacteria 4050
173 Ga0209676_1036147 3300025292 Bacteria 1441
174 Ga0209025_1000052 3300025294 Bacteria 324648
175 Ga0209025_1000083 3300025294 Bacteria 265556
176 Ga0209025_1000196 3300025294 Bacteria 147356
177 Ga0209025_1000389 3300025294 Bacteria 90997
178 Ga0209025_1000607 3300025294 Bacteria 64560
179 Ga0209025_1004571 3300025294 Bacteria 11892
180 Ga0209025_1011198 3300025294 Bacteria 5953
181 Ga0209025_1015269 3300025294 Bacteria 4645
182 Ga0209564_1000086 3300025295 Bacteria 251385
183 Ga0209564_1000116 3300025295 Bacteria 207889
184 Ga0209564_1000125 3300025295 Bacteria 201709
185 Ga0209564_1000281 3300025295 Bacteria 104019
186 Ga0209564_1003058 3300025295 Bacteria 11889
187 Ga0209564_1014851 3300025295 Bacteria 3208
188 Ga0209564_1019396 3300025295 Bacteria 2543
189 Ga0209758_1000090 3300025297 Bacteria 246564
190 Ga0209758_1000357 3300025297 Bacteria 82792
191 Ga0209758_1000657 3300025297 Bacteria 51923
192 Ga0209758_1000892 3300025297 Bacteria 40679
193 Ga0209758_1001670 3300025297 Bacteria 25082
194 Ga0209758_1002964 3300025297 Bacteria 16280
195 Ga0209758_1004285 3300025297 Bacteria 12034
196 Ga0209758_1013680 3300025297 Bacteria 4398
197 Ga0209758_1015070 3300025297 Bacteria 4039
198 Ga0209758_1055329 3300025297 Bacteria 1348
199 Ga0209050_1001713 3300025298 Bacteria 21893
200 Ga0209050_1014318 3300025298 Bacteria 3428
201 Ga0209050_1048529 3300025298 Bacteria 1096
202 Ga0209256_1000321 3300025299 Bacteria 82735
203 Ga0209256_1000854 3300025299 Bacteria 37992
204 Ga0209256_1001561 3300025299 Bacteria 22609
205 Ga0209256_1001567 3300025299 Bacteria 22489
206 Ga0209256_1001901 3300025299 Bacteria 19097
207 Ga0209256_1004259 3300025299 Bacteria 9147
208 Ga0209256_1023559 3300025299 Bacteria 1833
209 Ga0207426_1000047 3300025302 Bacteria 417011
210 Ga0207426_1000048 3300025302 Bacteria 409127
211 Ga0207426_1000173 3300025302 Bacteria 162697
212 Ga0207426_1000268 3300025302 Bacteria 109321
213 Ga0207426_1001666 3300025302 Bacteria 17230
214 Ga0209051_1000371 3300025303 Bacteria 64402
215 Ga0209051_1002253 3300025303 Bacteria 14170
216 Ga0209051_1004310 3300025303 Bacteria 8833
217 Ga0209051_1008182 3300025303 Bacteria 5577
218 Ga0209051_1021849 3300025303 Bacteria 2709
219 Ga0209257_1002934 3300025304 Bacteria 15715
220 Ga0209257_1005862 3300025304 Bacteria 8308
221 Ga0209257_1005871 3300025304 Bacteria 8295
222 Ga0209257_1040705 3300025304 Bacteria 1384
223 Ga0207695_10000049 3300025913 Bacteria 406233
224 Ga0207671_10001282 3300025914 Bacteria 29524
225 Ga0207650_10004194 3300025925 Bacteria 9847
226 Ga0207644_10019252 3300025931 Bacteria 4628
227 Ga0207709_10087673 3300025935 Bacteria 2024
228 Ga0207702_10387045 3300026078 Bacteria 1346
229 Ga0209281_1000068 3300027111 Bacteria 280238
230 Ga0209281_1000141 3300027111 Bacteria 175634
231 Ga0209371_1002415 3300027312 Bacteria 10488
232 Ga0268266_10003136 3300028379 Bacteria 16800
233 Ga0268266_10101428 3300028379 Bacteria 2537
234 Ga0268266_10145867 3300028379 Bacteria 2128
235 Ga0307515_10000263 3300028794 Bacteria 130303
236 Ga0307515_10004358 3300028794 Bacteria 29343
237 Ga0307515_10011563 3300028794 Bacteria 16739
238 Ga0307515_10040917 3300028794 Bacteria 7311
239 Ga0307515_10295593 3300028794 Bacteria 1310
240 Ga0268256_1002345 3300030500 Bacteria 9760
241 Ga0268256_1005024 3300030500 Bacteria 5307
242 Ga0316181_1213661 3300030744 Bacteria 6969
243 Ga0307513_10002589 3300031456 Bacteria 24996
244 Ga0307513_10056159 3300031456 Bacteria 4206
245 Ga0307513_10060399 3300031456 Bacteria 4019
246 Ga0307405_10000994 3300031731 Bacteria 11415
247 Ga0307413_10181017 3300031824 Bacteria 1503
248 Ga0307410_10199425 3300031852 Bacteria 1527
249 Ga0307412_10003267 3300031911 Bacteria 8998
250 Ga0307412_10135531 3300031911 Bacteria 1796
251 Ga0307412_10158243 3300031911 Bacteria 1680
252 Ga0307412_10441012 3300031911 Bacteria 1070
253 Ga0307414_10087343 3300032004 Bacteria 2304
254 Ga0373927_0001739 3300035695 Bacteria 16274
255 Ga0373925_0012096 3300037068 Bacteria 6247
256 Ga0395905_0004700 3300037471 Bacteria 14116
257 Ga0395905_0005359 3300037471 Bacteria 13104
258 Ga0439436_0058730 3300041404 Bacteria 1078
259 Ga0439465_0003521 3300041413 Bacteria 5102
260 Ga0439465_0007359 3300041413 Bacteria 3497
261 Ga0439465_0028355 3300041413 Bacteria 1775
262 Ga0439465_0041893 3300041413 Bacteria 1483
263 Ga0451833_0051479 3300041491 Bacteria 1926
264 Ga0451835_0302626 3300041492 Bacteria 4319
265 Ga0451837_0060979 3300041494 Bacteria 1303
266 Ga0451839_0718998 3300041496 Bacteria 1924
267 Ga0451839_0917332 3300041496 Bacteria 1560
268 Ga0451845_0681531 3300041501 Bacteria 2580
269 Ga0451847_0508924 3300041503 Bacteria 1035
270 Ga0451850_50252 3300041506 Bacteria 1045
271 Ga0451851_1216410 3300041507 Bacteria 4077
272 Ga0451843_0986684 3300041509 Bacteria 1196
273 Ga0451855_1356713 3300041511 Bacteria 1376
274 Ga0451853_0980795 3300041512 Bacteria 2071
275 Ga0439449_0016157 3300042007 Bacteria 2806
276 Ga0439462_0030023 3300042015 Bacteria 1438
277 Ga0450907_007846 3300042146 Bacteria 1777
278 Ga0450909_016653 3300042185 Bacteria 1086
279 Ga0439434_0009734 3300042435 Bacteria 2827
280 Ga0450918_012085 3300042531 Bacteria 1504
281 Ga0466970_0005750 3300044765 Bacteria 6161
282 Ga0495629_0039434 3300046459 Bacteria 3324
283 Ga0495638_0002245 3300046460 Bacteria 16025
284 Ga0495638_0032082 3300046460 Bacteria 3370
285 Ga0495638_0081074 3300046460 Bacteria 1970
286 Ga0495651_0056767 3300046462 Bacteria 3007
287 Ga0495650_0098029 3300046471 Bacteria 1104
288 Ga0495662_0008770 3300046476 Bacteria 4974
289 Ga0495585_0062116 3300046492 Bacteria 2052
290 Ga0495585_0089691 3300046492 Bacteria 1657
291 Ga0495607_0051193 3300046501 Bacteria 2400
292 Ga0495607_0079425 3300046501 Bacteria 1807
293 Ga0495607_0097619 3300046501 Bacteria 1579
294 Ga0495583_0006132 3300046506 Bacteria 7927
295 Ga0495606_0005438 3300046507 Bacteria 12202
296 Ga0495606_0027058 3300046507 Bacteria 4073
297 Ga0495606_0081509 3300046507 Bacteria 2011
298 Ga0495610_0003921 3300046512 Bacteria 11275
299 Ga0495610_0124406 3300046512 Bacteria 1126
300 Ga0495610_0174513 3300046512 Bacteria 899
301 Ga0495616_0014904 3300046513 Bacteria 4338
302 Ga0495616_0099911 3300046513 Bacteria 1362
303 Ga0495616_0105253 3300046513 Bacteria 1317
304 Ga0495620_0035007 3300046515 Bacteria 2263
305 Ga0495620_0064260 3300046515 Bacteria 1518
306 Ga0495631_0001536 3300046518 Bacteria 13881
307 Ga0495632_0002903 3300046519 Bacteria 12596
308 Ga0495632_0011408 3300046519 Bacteria 5186
309 Ga0495632_0094918 3300046519 Bacteria 1410
310 Ga0495643_0015771 3300046522 Bacteria 4457
311 Ga0495643_0028426 3300046522 Bacteria 3135
312 Ga0495643_0049203 3300046522 Bacteria 2274
313 Ga0495643_0124401 3300046522 Bacteria 1300
314 Ga0495648_0076026 3300046524 Bacteria 1929
315 Ga0495654_0000401 3300046530 Bacteria 37059
316 Ga0495654_0021069 3300046530 Bacteria 3394
317 Ga0495640_0042763 3300046533 Bacteria 3159
318 Ga0495609_0016177 3300046538 Bacteria 3478
319 Ga0495597_0023913 3300046542 Bacteria 2824
320 Ga0495622_0015658 3300046557 Bacteria 3525
321 Ga0495611_0005032 3300046648 Bacteria 5664
322 Ga0495625_0003752 3300046660 Bacteria 14760
323 Ga0495625_0060586 3300046660 Bacteria 2681
324 Ga0495661_0075275 3300046665 Bacteria 1962
325 Ga0495588_0004270 3300046674 Bacteria 6302
326 Ga0495657_0031373 3300046675 Bacteria 3715
327 Ga0495658_0035776 3300046683 Bacteria 2735
328 Ga0495670_0017514 3300046691 Bacteria 3526
329 Ga0495671_0061466 3300046692 Bacteria 1853
330 Ga0495649_0034661 3300046694 Bacteria 2777
331 Ga0495600_0053585 3300046809 Bacteria 2634
332 Ga0495660_0088553 3300046810 Bacteria 1612
333 Ga0495636_0058652 3300047318 Bacteria 1623
334 Ga0495676_0202724 3300047321 Bacteria 1378
335 Ga0495687_031132 3300047443 Bacteria 2450
336 Ga0495687_034233 3300047443 Bacteria 2297
337 Ga0495673_0125702 3300047469 Bacteria 1012
338 Ga0495681_0011425 3300047470 Bacteria 5288
339 Ga0495681_0054588 3300047470 Bacteria 1866
340 Ga0495686_0006222 3300047472 Bacteria 9200
341 Ga0495686_0019963 3300047472 Bacteria 4472
342 Ga0495686_0025145 3300047472 Bacteria 3904
343 Ga0495686_0259158 3300047472 Bacteria 974
344 Ga0495626_0041805 3300048091 Bacteria 2156
345 Ga0495626_0085445 3300048091 Bacteria 1395
346 Ga0496102_0021717 3300048905 Bacteria 5679
347 Ga0496104_0040272 3300048907 Bacteria 4379
348 Ga0496106_0000326 3300048909 Bacteria 33680
349 Ga0496106_0153230 3300048909 Bacteria 1819
350 Ga0496111_0001131 3300048914 Bacteria 14787
351 Ga0496114_0088108 3300048917 Bacteria 2633
352 Ga0496116_0013575 3300048919 Bacteria 6553
353 Ga0496116_0025407 3300048919 Bacteria 4354
354 Ga0496116_0053121 3300048919 Bacteria 2678
355 Ga0496116_0100069 3300048919 Bacteria 1735
356 Ga0496116_0132087 3300048919 Bacteria 1421
357 Ga0496116_0161513 3300048919 Bacteria 1228
358 Ga0496117_0000052 3300048920 Bacteria 280463
359 Ga0496117_0000814 3300048920 Bacteria 48319
360 Ga0496117_0005480 3300048920 Bacteria 13300
361 Ga0496117_0017733 3300048920 Bacteria 5936
362 Ga0496117_0139948 3300048920 Bacteria 1451
363 Ga0496117_0174737 3300048920 Bacteria 1242
364 Ga0496117_0208383 3300048920 Bacteria 1098
365 Ga0496118_0001701 3300048921 Bacteria 32176
366 Ga0496118_0002033 3300048921 Bacteria 28616
367 Ga0496118_0044052 3300048921 Bacteria 3498
368 Ga0496119_0007227 3300048922 Bacteria 10054
369 Ga0496119_0008625 3300048922 Bacteria 8921
370 Ga0496119_0026534 3300048922 Bacteria 4014
371 Ga0496119_0074156 3300048922 Bacteria 1982
372 Ga0496120_0000019 3300048923 Bacteria 260115
373 Ga0496120_0043823 3300048923 Bacteria 2604
374 Ga0496121_0000003 3300048924 Bacteria 1191431
375 Ga0496121_0001407 3300048924 Bacteria 40738
376 Ga0496121_0001871 3300048924 Bacteria 33787
377 Ga0496121_0009541 3300048924 Bacteria 11117
378 Ga0496121_0017896 3300048924 Bacteria 7191
379 Ga0496121_0018198 3300048924 Bacteria 7101
380 Ga0496121_0037911 3300048924 Bacteria 4276
381 Ga0496121_0048898 3300048924 Bacteria 3593
382 Ga0496121_0111031 3300048924 Bacteria 2091
383 Ga0496121_0115924 3300048924 Bacteria 2033
384 Ga0496121_0201253 3300048924 Bacteria 1419
385 Ga0496122_0000024 3300048925 Bacteria 372400
386 Ga0496122_0000053 3300048925 Bacteria 260120
387 Ga0496122_0000107 3300048925 Bacteria 193163
388 Ga0496122_0008439 3300048925 Bacteria 11115
389 Ga0496122_0008929 3300048925 Bacteria 10664
390 Ga0496122_0015748 3300048925 Bacteria 7207
391 Ga0496122_0067215 3300048925 Bacteria 2583
392 Ga0496122_0089305 3300048925 Bacteria 2107
393 Ga0496122_0093950 3300048925 Bacteria 2032
394 Ga0496122_0135156 3300048925 Bacteria 1556
395 Ga0496122_0316296 3300048925 Bacteria 833
396 Ga0496123_0000038 3300048926 Bacteria 260120
397 Ga0496123_0000063 3300048926 Bacteria 216072
398 Ga0496123_0000086 3300048926 Bacteria 183266
399 Ga0496123_0009011 3300048926 Bacteria 9052
400 Ga0496123_0011406 3300048926 Bacteria 7705
401 Ga0496123_0032582 3300048926 Bacteria 3769
402 Ga0496123_0063904 3300048926 Bacteria 2348
403 Ga0496123_0065804 3300048926 Bacteria 2300
404 Ga0496123_0074475 3300048926 Bacteria 2101
405 Ga0496124_0000413 3300048927 Bacteria 76781
406 Ga0496124_0002161 3300048927 Bacteria 26367
407 Ga0496124_0002342 3300048927 Bacteria 25007
408 Ga0496124_0102667 3300048927 Bacteria 2313
409 Ga0496124_0107757 3300048927 Bacteria 2247
410 Ga0496124_0121992 3300048927 Bacteria 2081
411 Ga0496124_0139774 3300048927 Bacteria 1912
412 Ga0496124_0258564 3300048927 Bacteria 1283
413 Ga0496124_0262981 3300048927 Bacteria 1268
414 Ga0496124_0263578 3300048927 Bacteria 1266
415 Ga0496124_0280210 3300048927 Bacteria 1216
416 Ga0496124_0360467 3300048927 Bacteria 1025
417 Ga0496125_0000345 3300048928 Bacteria 88357
418 Ga0496125_0000651 3300048928 Bacteria 58001
419 Ga0496125_0006752 3300048928 Bacteria 12327
420 Ga0496125_0013018 3300048928 Bacteria 8211
421 Ga0496125_0033327 3300048928 Bacteria 4559
422 Ga0496125_0290283 3300048928 Bacteria 1008
423 Ga0496126_0002468 3300048929 Bacteria 24901
424 Ga0496126_0021729 3300048929 Bacteria 6260
425 Ga0496126_0082360 3300048929 Bacteria 2843
426 Ga0496126_0128089 3300048929 Bacteria 2195
427 Ga0496126_0131579 3300048929 Bacteria 2161
428 Ga0496126_0138432 3300048929 Bacteria 2097
429 Ga0496126_0194513 3300048929 Bacteria 1716
430 Ga0495678_021016 3300049459 Bacteria 2881
431 Ga0495678_041453 3300049459 Bacteria 1842
432 Ga0501031_0019801 3300049568 Bacteria 4385
433 Ga0501032_0126854 3300049569 Bacteria 1685
434 Ga0501033_0004143 3300049570 Bacteria 11677
435 Ga0501034_0052265 3300049571 Bacteria 4116
436 Ga0501034_0224955 3300049571 Bacteria 1827
437 Ga0501034_0242704 3300049571 Bacteria 1747
438 Ga0501037_0076208 3300049573 Bacteria 2435
439 Ga0501038_0025453 3300049574 Bacteria 5275
440 Ga0501038_0170638 3300049574 Bacteria 1761
441 Ga0501039_0059846 3300049575 Bacteria 2950
442 Ga0501039_0115254 3300049575 Bacteria 2103
443 Ga0501080_0513309 3300049742 Bacteria 1070
444 Ga0501083_0190490 3300049744 Bacteria 1338
445 Ga0501280_004492 3300049776 Bacteria 2049
446 Ga0501035_0000707 3300049822 Bacteria 36103
447 Ga0501044_0034844 3300049823 Bacteria 5276
448 nmdc:mga03683_11702_c1 3300050489 Bacteria 3186
449 nmdc:mga03683_54147_c1 3300050489 Bacteria 1682
450 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
451 nmdc:mga00v17_130168_c1 3300050491 Bacteria 1608
452 nmdc:mga00v17_244730_c1 3300050491 Bacteria 1163
453 nmdc:mga00v17_609_c1 3300050491 Bacteria 19791
454 nmdc:mga0yw44_1642_c1 3300050492 Bacteria 9004
455 nmdc:mga0yw44_41859_c1 3300050492 Bacteria 2729
456 nmdc:mga0yw44_65_c1 3300050492 Bacteria 38061
457 nmdc:mga0k408_126577_c1 3300050493 Bacteria 1516
458 nmdc:mga0k408_7034_c1 3300050493 Bacteria 5801
459 nmdc:mga06z11_17309_c1 3300050494 Bacteria 3269
460 nmdc:mga06z11_7904_c2 3300050494 Bacteria 2615
461 nmdc:mga04h51_1588_c1 3300050495 Bacteria 5290
462 nmdc:mga07m45_14585_c1 3300050496 Bacteria 4190
463 nmdc:mga07m45_80704_c1 3300050496 Bacteria 1857
464 nmdc:mga0sz30_1144_c1 3300050516 Bacteria 9516
465 nmdc:mga0sz30_13690_c1 3300050516 Bacteria 3181
466 nmdc:mga0sz30_6648_c1 3300050516 Bacteria 4307
467 Ga0500644_0003536 3300053088 Bacteria 3877
468 Ga0500560_097676 3300053107 Bacteria 983
469 Ga0500618_000891 3300053125 Bacteria 15758
470 Ga0500618_001118 3300053125 Bacteria 13110
471 Ga0500655_002005 3300053133 Bacteria 3785
472 Ga0500658_0000868 3300053134 Bacteria 12408
473 Ga0500559_0015626 3300053136 Bacteria 3205
474 Ga0500561_0000931 3300053137 Bacteria 4678
475 Ga0500568_0003075 3300053139 Bacteria 9524
476 Ga0500568_0079018 3300053139 Bacteria 1251
477 Ga0500573_0002542 3300053140 Bacteria 9159
478 Ga0500573_0072051 3300053140 Bacteria 1970
479 Ga0500590_000352 3300053148 Bacteria 15073
480 Ga0500604_0051822 3300053151 Bacteria 1268
481 Ga0500616_0002052 3300053153 Bacteria 17695
482 Ga0500616_0006118 3300053153 Bacteria 7963
483 Ga0500616_0039225 3300053153 Bacteria 2554
484 Ga0500622_0000918 3300053156 Bacteria 25056
485 Ga0500622_0001540 3300053156 Bacteria 18261
486 Ga0500622_0152819 3300053156 Bacteria 1089
487 Ga0500624_000692 3300053157 Bacteria 8527
488 Ga0500624_004903 3300053157 Bacteria 1770
489 Ga0500627_0097611 3300053158 Bacteria 1318
490 Ga0587073_0036208 3300059492 Bacteria 1051
491 Ga0501082_0029595 3300060353 Bacteria 4718

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0316296 Ga0496122_0316296_38_808 255
2 iso_pu_bacteria 2896384573 2896386423 265
3 3300046507 Ga0495606_0081509 Ga0495606_0081509_316_1164 277
4 iso_pu_bacteria 2913295892 2913299819 279
5 3300046512 Ga0495610_0174513 Ga0495610_0174513_10_861 282
6 iso_pu_bacteria 2519899620 2520377911 282
7 iso_pu_bacteria 2585427608 2585898915 286
8 iso_pu_bacteria 2508501122 2509109811 287
9 iso_pu_bacteria 2509276019 2509379037 287
10 iso_pu_bacteria 2510065057 2510303674 287
11 iso_pu_bacteria 2510461069 2510839401 287
12 iso_pu_bacteria 2511231052 2511502969 287
13 iso_pu_bacteria 2512047086 2512534232 287
14 iso_pu_bacteria 2512875026 2512973946 287
15 iso_pu_bacteria 2513237086 2513585296 287
16 iso_pu_bacteria 2513237089 2513602336 287
17 iso_pu_bacteria 2513237091 2513617140 287
18 iso_pu_bacteria 2513237140 2513882881 287
19 iso_pu_bacteria 2513237143 2513902909 287
20 iso_pu_bacteria 2513237156 2513985881 287
21 iso_pu_bacteria 2513237160 2514003979 287
22 iso_pu_bacteria 2515154107 2515610358 287
23 iso_pu_bacteria 2516143018 2516205214 287
24 iso_pu_bacteria 2516653046 2516894374 287
25 iso_pu_bacteria 2517487022 2517570991 287
26 iso_pu_bacteria 2524023207 2524451853 287
27 iso_pu_bacteria 2551306084 2551679842 287
28 iso_pu_bacteria 2551306085 2551685967 287
29 iso_pu_bacteria 2551306086 2551694544 287
30 iso_pu_bacteria 2551306087 2551698062 287
31 iso_pu_bacteria 2551306089 2551710427 287
32 iso_pu_bacteria 2551306089 2551711865 287
33 iso_pu_bacteria 2551306090 2551715702 287
34 iso_pu_bacteria 2551306091 2551726332 287
35 iso_pu_bacteria 2551306092 2551733515 287
36 iso_pu_bacteria 2551306093 2551740284 287
37 iso_pu_bacteria 2551306093 2551746374 287
38 iso_pu_bacteria 2558860100 2558860385 287
39 iso_pu_bacteria 2599185352 2600194061 287
40 iso_pu_bacteria 2643221557 2643809798 287
41 iso_pu_bacteria 2643221610 2644063979 287
42 iso_pu_bacteria 2643221618 2644108509 287
43 iso_pu_bacteria 2643221626 2644145555 287
44 iso_pu_bacteria 2643221653 2644299224 287
45 iso_pu_bacteria 2643221655 2644312368 287
46 iso_pu_bacteria 2643221659 2644335996 287
47 iso_pu_bacteria 2643221668 2644381500 287
48 iso_pu_bacteria 2643221675 2644415812 287
49 iso_pu_bacteria 2643221680 2644448852 287
50 iso_pu_bacteria 2643221698 2644546853 287
51 iso_pu_bacteria 2643221712 2644618051 287
52 iso_pu_bacteria 2643221719 2644657452 287
53 iso_pu_bacteria 2643221723 2644676772 287
54 iso_pu_bacteria 2643221726 2644686754 287
55 iso_pu_bacteria 2657244999 2657684007 287
56 iso_pu_bacteria 2690316117 2692314523 287
57 iso_pu_bacteria 2751185821 2753458639 287
58 iso_pu_bacteria 2791355082 2792582572 287
59 iso_pu_bacteria 2791355091 2792622975 287
60 iso_pu_bacteria 2791355092 2792629230 287
61 iso_pu_bacteria 2791355094 2792640423 287
62 iso_pu_bacteria 2802428858 2802717920 287
63 iso_pu_bacteria 2802428859 2802725229 287
64 iso_pu_bacteria 2802428860 2802730647 287
65 iso_pu_bacteria 2802428861 2802737994 287
66 iso_pu_bacteria 2802428862 2802744136 287
67 iso_pu_bacteria 2802428863 2802753179 287
68 iso_pu_bacteria 2802429268 2804753301 287
69 iso_pu_bacteria 2818991272 2819243795 287
70 iso_pu_bacteria 2848992105 2848995232 287
71 iso_pu_bacteria 2855872281 2855878447 287
72 iso_pu_bacteria 2920822456 2920828514 287
73 iso_pu_bacteria 2989776772 2989780326 287
74 iso_pu_bacteria 643692032 643827065 287
75 iso_pu_bacteria 648276728 648735866 287
76 iso_pu_bacteria 8005246636 8005249587 287
77 iso_pu_bacteria 2599185156 2599334761 288
78 3300048928 Ga0496125_0290283 Ga0496125_0290283_97_978 289
79 iso_pu_bacteria 2509276021 2509386455 289
80 iso_pu_bacteria 2509276021 2509389868 289
81 iso_pu_bacteria 2509276033 2509447881 289
82 iso_pu_bacteria 2510065019 2510134815 289
83 iso_pu_bacteria 2510461076 2510896223 289
84 iso_pu_bacteria 2510917030 2511198429 289
85 iso_pu_bacteria 2513237084 2513572580 289
86 iso_pu_bacteria 2513237085 2513580191 289
87 iso_pu_bacteria 2513237088 2513597148 289
88 iso_pu_bacteria 2513237093 2513631345 289
89 iso_pu_bacteria 2513237103 2513710736 289
90 iso_pu_bacteria 2513237138 2513868129 289
91 iso_pu_bacteria 2513237144 2513908216 289
92 iso_pu_bacteria 2513237146 2513926917 289
93 iso_pu_bacteria 2513237162 2514022362 289
94 iso_pu_bacteria 2515075009 2515113900 289
95 iso_pu_bacteria 2515154113 2515638777 289
96 iso_pu_bacteria 2515154114 2515643081 289
97 iso_pu_bacteria 2515154116 2515656804 289
98 iso_pu_bacteria 2515154134 2515743746 289
99 iso_pu_bacteria 2516653077 2517037531 289
100 iso_pu_bacteria 2516653085 2517077816 289
101 iso_pu_bacteria 2517093000 2517096615 289
102 iso_pu_bacteria 2517287029 2517410330 289
103 iso_pu_bacteria 2529292951 2530646927 289
104 iso_pu_bacteria 2534681796 2535519469 289
105 iso_pu_bacteria 2558860983 2561468164 289
106 iso_pu_bacteria 2582581294 2585202497 289
107 iso_pu_bacteria 2582581298 2585224809 289
108 iso_pu_bacteria 2582581299 2585227795 289
109 iso_pu_bacteria 2582581304 2585257795 289
110 iso_pu_bacteria 2582581867 2585402193 289
111 iso_pu_bacteria 2585427526 2585529106 289
112 iso_pu_bacteria 2585427528 2585541045 289
113 iso_pu_bacteria 2585427529 2585547365 289
114 iso_pu_bacteria 2585427590 2585822507 289
115 iso_pu_bacteria 2585427593 2585839807 289
116 iso_pu_bacteria 2585427594 2585845327 289
117 iso_pu_bacteria 2585427633 2585997116 289
118 iso_pu_bacteria 2599185170 2599420589 289
119 iso_pu_bacteria 2615840624 2616295529 289
120 iso_pu_bacteria 2643221599 2644006380 289
121 iso_pu_bacteria 2643221643 2644241835 289
122 iso_pu_bacteria 2718217882 2719182571 289
123 iso_pu_bacteria 2718217927 2719387246 289
124 iso_pu_bacteria 2718217997 2719666883 289
125 iso_pu_bacteria 2718218009 2719733290 289
126 iso_pu_bacteria 2718218199 2720493303 289
127 iso_pu_bacteria 2718218232 2720614777 289
128 iso_pu_bacteria 2718218233 2720621550 289
129 iso_pu_bacteria 2718218235 2720632878 289
130 iso_pu_bacteria 2718218269 2720776602 289
131 iso_pu_bacteria 2718218363 2721148684 289
132 iso_pu_bacteria 2718218365 2721160070 289
133 iso_pu_bacteria 2718218366 2721165498 289
134 iso_pu_bacteria 2718218423 2721400881 289
135 iso_pu_bacteria 2721755514 2722841668 289
136 iso_pu_bacteria 2721755556 2723028190 289
137 iso_pu_bacteria 2721755684 2723561821 289
138 iso_pu_bacteria 2721755685 2723568450 289
139 iso_pu_bacteria 2721755809 2724039694 289
140 iso_pu_bacteria 2721755810 2724046046 289
141 iso_pu_bacteria 2721755819 2724091209 289
142 iso_pu_bacteria 2721755822 2724105715 289
143 iso_pu_bacteria 2721755823 2724111544 289
144 iso_pu_bacteria 2724679232 2725945495 289
145 iso_pu_bacteria 2728369352 2730109126 289
146 iso_pu_bacteria 2728369365 2730165806 289
147 iso_pu_bacteria 2728369397 2730299702 289
148 iso_pu_bacteria 2738541293 2738800467 289
149 iso_pu_bacteria 2738541333 2739035599 289
150 iso_pu_bacteria 2765235942 2766065348 289
151 iso_pu_bacteria 2791355256 2793293676 289
152 iso_pu_bacteria 2791355259 2793313100 289
153 iso_pu_bacteria 2791355260 2793319747 289
154 iso_pu_bacteria 2791355261 2793327747 289
155 iso_pu_bacteria 2791355262 2793333338 289
156 iso_pu_bacteria 2791355263 2793342116 289
157 iso_pu_bacteria 2791355264 2793347345 289
158 iso_pu_bacteria 2791355265 2793353668 289
159 iso_pu_bacteria 2791355266 2793359743 289
160 iso_pu_bacteria 2791355267 2793369480 289
161 iso_pu_bacteria 2802429605 2805930524 289
162 iso_pu_bacteria 2802429606 2805934296 289
163 iso_pu_bacteria 2802429633 2806044587 289
164 iso_pu_bacteria 2802429634 2806052787 289
165 iso_pu_bacteria 2802429635 2806059087 289
166 iso_pu_bacteria 2802429636 2806068250 289
167 iso_pu_bacteria 2802429637 2806074370 289
168 iso_pu_bacteria 2838016132 2838019079 289
169 iso_pu_bacteria 2838022645 2838024325 289
170 iso_pu_bacteria 2838035591 2838040737 289
171 iso_pu_bacteria 2838042994 2838046275 289
172 iso_pu_bacteria 2838048938 2838051203 289
173 iso_pu_bacteria 2838061910 2838063821 289
174 iso_pu_bacteria 2838068647 2838073304 289
175 iso_pu_bacteria 2838661181 2838664875 289
176 iso_pu_bacteria 2838668709 2838671172 289
177 iso_pu_bacteria 2838680041 2838684987 289
178 iso_pu_bacteria 2838686498 2838691350 289
179 iso_pu_bacteria 2838694306 2838699176 289
180 iso_pu_bacteria 2838701080 2838703648 289
181 iso_pu_bacteria 2838707686 2838712657 289
182 iso_pu_bacteria 2838729681 2838733309 289
183 iso_pu_bacteria 2838742623 2838746119 289
184 iso_pu_bacteria 2841851746 2841853831 289
185 iso_pu_bacteria 2841864319 2841868197 289
186 iso_pu_bacteria 2842077413 2842082134 289
187 iso_pu_bacteria 2842110456 2842113464 289
188 iso_pu_bacteria 2842118031 2842123056 289
189 iso_pu_bacteria 2842146304 2842149350 289
190 iso_pu_bacteria 2842156927 2842162162 289
191 iso_pu_bacteria 2842163707 2842169920 289
192 iso_pu_bacteria 2842180545 2842185088 289
193 iso_pu_bacteria 2842192696 2842198288 289
194 iso_pu_bacteria 2842198810 2842199868 289
195 iso_pu_bacteria 2842205361 2842208276 289
196 iso_pu_bacteria 2842217011 2842220107 289
197 iso_pu_bacteria 2842229732 2842233526 289
198 iso_pu_bacteria 2842237096 2842242041 289
199 iso_pu_bacteria 2842243621 2842247619 289
200 iso_pu_bacteria 2842250916 2842254012 289
201 iso_pu_bacteria 2842257432 2842262113 289
202 iso_pu_bacteria 2842264693 2842266584 289
203 iso_pu_bacteria 2842271015 2842275824 289
204 iso_pu_bacteria 2842278818 2842281715 289
205 iso_pu_bacteria 2842285085 2842288825 289
206 iso_pu_bacteria 2842291075 2842296134 289
207 iso_pu_bacteria 2842304105 2842308192 289
208 iso_pu_bacteria 2842311132 2842315571 289
209 iso_pu_bacteria 2842317721 2842321424 289
210 iso_pu_bacteria 2842341865 2842344976 289
211 iso_pu_bacteria 2842363717 2842370024 289
212 iso_pu_bacteria 2842370503 2842375665 289
213 iso_pu_bacteria 2842377471 2842382533 289
214 iso_pu_bacteria 2842384541 2842389934 289
215 iso_pu_bacteria 2842395702 2842398544 289
216 iso_pu_bacteria 2842402390 2842406508 289
217 iso_pu_bacteria 2842409023 2842413065 289
218 iso_pu_bacteria 2842415677 2842419708 289
219 iso_pu_bacteria 2842422224 2842426939 289
220 iso_pu_bacteria 2842428310 2842429903 289
221 iso_pu_bacteria 2842434925 2842436437 289
222 iso_pu_bacteria 2842441272 2842444140 289
223 iso_pu_bacteria 2842447887 2842451002 289
224 iso_pu_bacteria 2842462802 2842464324 289
225 iso_pu_bacteria 2842469257 2842470766 289
226 iso_pu_bacteria 2842489311 2842493242 289
227 iso_pu_bacteria 2842495871 2842499190 289
228 iso_pu_bacteria 2844454524 2844457524 289
229 iso_pu_bacteria 2857516855 2857518931 289
230 iso_pu_bacteria 2919100787 2919104537 289
231 iso_pu_bacteria 2923556063 2923562877 289
232 iso_pu_bacteria 2933016740 2933020534 289
233 iso_pu_bacteria 2933570622 2933574641 289
234 iso_pu_bacteria 2933586486 2933589246 289
235 iso_pu_bacteria 2933599457 2933603566 289
236 iso_pu_bacteria 2935894831 2935899762 289
237 iso_pu_bacteria 2935901341 2935907585 289
238 iso_pu_bacteria 2936367885 2936374899 289
239 iso_pu_bacteria 2936375103 2936380590 289
240 iso_pu_bacteria 2936381700 2936382239 289
241 iso_pu_bacteria 2960652885 2960656748 289
242 iso_pu_bacteria 2996893221 2996896347 289
243 iso_pu_bacteria 3005409236 3005415519 289
244 iso_pu_bacteria 3005445848 3005449249 289
245 iso_pu_bacteria 3005452660 3005455529 289
246 iso_pu_bacteria 639633055 639649970 289
247 iso_pu_bacteria 8005275841 8005281977 289
248 iso_pu_bacteria 8005282627 8005288960 289
249 iso_pu_bacteria 8005289223 8005294299 289
250 iso_pu_bacteria 8005301065 8005306704 289
251 iso_pu_bacteria 8005307578 8005309356 289
252 iso_pu_bacteria 8005376324 8005382818 289
253 iso_pu_bacteria 8005382845 8005383870 289
254 iso_pu_bacteria 8005395548 8005401195 289
255 iso_pu_bacteria 8005430974 8005434148 289
256 iso_pu_bacteria 8005460587 8005464587 289
257 iso_pu_bacteria 8005497431 8005501635 289
258 iso_pu_bacteria 8005542996 8005547160 289
259 iso_pu_bacteria 8005556819 8005558411 289
260 iso_pu_bacteria 8005563573 8005566745 289
261 iso_pu_bacteria 8005570704 8005574973 289
262 iso_pu_bacteria 8005619151 8005622991 289
263 iso_pu_bacteria 8005626139 8005631706 289
264 iso_pu_bacteria 8005658619 8005662472 289
265 iso_pu_bacteria 8005668836 8005673057 289
266 iso_pu_bacteria 8005688590 8005693600 289
267 iso_pu_bacteria 8005695170 8005700832 289
268 iso_pu_bacteria 8018127388 8018133643 289
269 iso_pu_bacteria 8018163183 8018170189 289
270 iso_pu_bacteria 8018176218 8018178489 289
271 iso_pu_bacteria 8023680758 8023687579 289
272 iso_pu_bacteria 8024479707 8024481752 289
273 iso_pu_bacteria 8024501048 8024505975 289
274 iso_pu_bacteria 8055431914 8055432052 289
275 iso_pu_bacteria 8056375014 8056381554 289
276 iso_pu_bacteria 8056382006 8056386987 289
277 iso_pu_bacteria 8057874678 8057876795 289
278 3300053125 Ga0500618_000891 Ga0500618_000891_11017_11892 290
279 iso_pu_bacteria 2513237159 2513998069 290
280 iso_pu_bacteria 2537561587 2537873064 290
281 iso_pu_bacteria 2554235003 2554245090 290
282 iso_pu_bacteria 2558860242 2559297079 290
283 iso_pu_bacteria 2582581283 2585168013 290
284 iso_pu_bacteria 2582581306 2585265388 290
285 iso_pu_bacteria 2582581865 2585388531 290
286 iso_pu_bacteria 2582581866 2585392406 290
287 iso_pu_bacteria 2585427634 2586001717 290
288 iso_pu_bacteria 2599185210 2599604956 290
289 iso_pu_bacteria 2599185236 2599723929 290
290 iso_pu_bacteria 2600254933 2600373676 290
291 iso_pu_bacteria 2600255279 2601611080 290
292 iso_pu_bacteria 2600255308 2601747853 290
293 iso_pu_bacteria 2643221582 2643916758 290
294 iso_pu_bacteria 2643221607 2644051100 290
295 iso_pu_bacteria 2643221636 2644205580 290
296 iso_pu_bacteria 2643221637 2644209893 290
297 iso_pu_bacteria 2643221686 2644484004 290
298 iso_pu_bacteria 2643221688 2644496351 290
299 iso_pu_bacteria 2643221689 2644500216 290
300 iso_pu_bacteria 2643221693 2644521322 290
301 iso_pu_bacteria 2643221718 2644653444 290
302 iso_pu_bacteria 2738541317 2738944481 290
303 iso_pu_bacteria 2775507049 2776914534 290
304 iso_pu_bacteria 2808606387 2808988960 290
305 iso_pu_bacteria 2818991461 2819686377 290
306 iso_pu_bacteria 2821123053 2821126129 290
307 iso_pu_bacteria 2838675328 2838678426 290
308 iso_pu_bacteria 2838714209 2838716666 290
309 iso_pu_bacteria 2838719591 2838722722 290
310 iso_pu_bacteria 2838724970 2838727417 290
311 iso_pu_bacteria 2838736955 2838737396 290
312 iso_pu_bacteria 2841840854 2841842235 290
313 iso_pu_bacteria 2841846520 2841849035 290
314 iso_pu_bacteria 2841859092 2841861945 290
315 iso_pu_bacteria 2842124991 2842128216 290
316 iso_pu_bacteria 2842130223 2842133319 290
317 iso_pu_bacteria 2842140634 2842142014 290
318 iso_pu_bacteria 2842152218 2842155312 290
319 iso_pu_bacteria 2842170452 2842173812 290
320 iso_pu_bacteria 2842175837 2842178933 290
321 iso_pu_bacteria 2842187318 2842189774 290
322 iso_pu_bacteria 2842211629 2842214088 290
323 iso_pu_bacteria 2842224351 2842226808 290
324 iso_pu_bacteria 2842298080 2842298686 290
325 iso_pu_bacteria 2842357229 2842359447 290
326 iso_pu_bacteria 2842509118 2842510709 290
327 iso_pu_bacteria 2842515876 2842517789 290
328 iso_pu_bacteria 2842521101 2842523174 290
329 iso_pu_bacteria 2852387548 2852391173 290
330 iso_pu_bacteria 2854896431 2854900265 290
331 iso_pu_bacteria 2854916844 2854919136 290
332 iso_pu_bacteria 2857531043 2857532690 290
333 iso_pu_bacteria 2891373044 2891377538 290
334 iso_pu_bacteria 2899792073 2899794728 290
335 iso_pu_bacteria 2899803654 2899806450 290
336 iso_pu_bacteria 2899845264 2899845319 290
337 iso_pu_bacteria 2913308742 2913309100 290
338 iso_pu_bacteria 2919114240 2919116883 290
339 iso_pu_bacteria 2919171160 2919173367 290
340 iso_pu_bacteria 2926754445 2926758396 290
341 iso_pu_bacteria 2926760298 2926764046 290
342 iso_pu_bacteria 2929138655 2929141358 290
343 iso_pu_bacteria 2933006813 2933009309 290
344 iso_pu_bacteria 2933011516 2933013418 290
345 iso_pu_bacteria 2933594066 2933598244 290
346 iso_pu_bacteria 2979089926 2979090856 290
347 iso_pu_bacteria 2979095461 2979096381 290
348 iso_pu_bacteria 2989349275 2989354671 290
349 iso_pu_bacteria 3003930520 3003934904 290
350 iso_pu_bacteria 650716007 650843508 290
351 iso_pu_bacteria 8003570095 8003573180 290
352 iso_pu_bacteria 8054558443 8054560549 290
353 iso_pu_bacteria 8056875544 8056876141 290
354 3300002739 JGI25158J39367_1010726 JGI25158J39367_10107261 291
355 3300002987 JGI25159J45721_1000018 JGI25159J45721_1000018122 291
356 3300003187 JGI25151J46595_10034862 JGI25151J46595_100348622 291
357 3300003354 JGI25160J50197_1000009 JGI25160J50197_100000986 291
358 3300003374 JGI25161J50226_1004105 JGI25161J50226_10041053 291
359 3300003771 Ga0055526_1003292 Ga0055526_10032923 291
360 3300003775 Ga0055524_1003460 Ga0055524_10034608 291
361 3300003775 Ga0055524_1017766 Ga0055524_10177661 291
362 3300003781 Ga0055536_1000582 Ga0055536_100058217 291
363 3300003791 Ga0055530_10000287 Ga0055530_100002878 291
364 3300003794 Ga0055531_10002396 Ga0055531_100023962 291
365 3300004625 Ga0055543_1000055 Ga0055543_100005587 291
366 3300005262 Ga0065165_1000020 Ga0065165_1000020184 291
367 3300006051 Ga0075364_10000009 Ga0075364_100000099 291
368 3300006946 Ga0079104_1006567 Ga0079104_10065672 291
369 3300013249 Ga0171463_1006 Ga0171463_1006237 291
370 3300015690 Ga0183363_1123 Ga0183363_112312 291
371 3300021320 Ga0214544_1000063 Ga0214544_10000637 291
372 3300021321 Ga0214542_1010067 Ga0214542_10100674 291
373 3300021327 Ga0214543_1010170 Ga0214543_10101707 291
374 3300025208 Ga0209436_100601 Ga0209436_1006016 291
375 3300025284 Ga0209130_1000037 Ga0209130_1000037184 291
376 3300025292 Ga0209676_1001698 Ga0209676_10016988 291
377 3300025294 Ga0209025_1000196 Ga0209025_100019665 291
378 3300025295 Ga0209564_1000086 Ga0209564_100008686 291
379 3300025298 Ga0209050_1001713 Ga0209050_100171315 291
380 3300025299 Ga0209256_1000321 Ga0209256_100032157 291
381 3300025299 Ga0209256_1001561 Ga0209256_100156111 291
382 3300025302 Ga0207426_1000048 Ga0207426_1000048224 291
383 3300025303 Ga0209051_1021849 Ga0209051_10218494 291
384 3300025304 Ga0209257_1002934 Ga0209257_10029345 291
385 3300027111 Ga0209281_1000141 Ga0209281_100014114 291
386 3300031852 Ga0307410_10199425 Ga0307410_101994252 291
387 3300041413 Ga0439465_0041893 Ga0439465_0041893_467_1348 291
388 3300042007 Ga0439449_0016157 Ga0439449_0016157_1649_2530 291
389 3300042015 Ga0439462_0030023 Ga0439462_0030023_99_980 291
390 3300046513 Ga0495616_0105253 Ga0495616_0105253_409_1293 291
391 3300048927 Ga0496124_0258564 Ga0496124_0258564_269_1153 291
392 3300049776 Ga0501280_004492 Ga0501280_004492_703_1578 291
393 3300050491 nmdc:mga00v17_609_c1 nmdc:mga00v17_609_c1_5901_6776 291
394 iso_pu_bacteria 2842922631 2842925888 292
395 iso_pu_bacteria 2844163670 2844169221 292
396 iso_pu_bacteria 2855839649 2855842405 292
397 iso_pu_bacteria 2858800743 2858803221 292
398 iso_pu_bacteria 2915986958 2915991016 292
399 iso_pu_bacteria 2915993759 2915996674 292
400 iso_pu_bacteria 2916000859 2916005084 292
401 iso_pu_bacteria 2916007675 2916013418 292
402 iso_pu_bacteria 2916014648 2916016940 292
403 iso_pu_bacteria 2916021584 2916028197 292
404 iso_pu_bacteria 2916028427 2916029288 292
405 iso_pu_bacteria 2916035215 2916038336 292
406 iso_pu_bacteria 2916041962 2916044918 292
407 iso_pu_bacteria 2916048683 2916049272 292
408 iso_pu_bacteria 2916055098 2916058225 292
409 iso_pu_bacteria 2916061851 2916066261 292
410 iso_pu_bacteria 2916076590 2916083120 292
411 iso_pu_bacteria 2920760137 2920760801 292
412 iso_pu_bacteria 2921201388 2921203282 292
413 iso_pu_bacteria 2921208531 2921213308 292
414 iso_pu_bacteria 2921237296 2921242309 292
415 iso_pu_bacteria 2921244191 2921244196 292
416 iso_pu_bacteria 2921250672 2921252476 292
417 iso_pu_bacteria 2921257292 2921260113 292
418 iso_pu_bacteria 2921263974 2921266108 292
419 iso_pu_bacteria 2921282425 2921287789 292
420 iso_pu_bacteria 2921289301 2921289560 292
421 iso_pu_bacteria 2921296804 2921299884 292
422 iso_pu_bacteria 2924144063 2924148841 292
423 iso_pu_bacteria 2924150972 2924152116 292
424 iso_pu_bacteria 2924158325 2924164052 292
425 iso_pu_bacteria 2924165586 2924168690 292
426 iso_pu_bacteria 2924172951 2924175338 292
427 iso_pu_bacteria 2924179722 2924183840 292
428 iso_pu_bacteria 2924186466 2924189959 292
429 iso_pu_bacteria 2924193448 2924193752 292
430 iso_pu_bacteria 2924200457 2924206721 292
431 iso_pu_bacteria 2924207177 2924213153 292
432 iso_pu_bacteria 2924214083 2924220647 292
433 iso_pu_bacteria 2924221636 2924221788 292
434 iso_pu_bacteria 2924228884 2924232421 292
435 iso_pu_bacteria 2936996657 2937000029 292
436 iso_pu_bacteria 2937002841 2937007011 292
437 iso_pu_bacteria 2937009748 2937015480 292
438 iso_pu_bacteria 2937016420 2937018200 292
439 iso_pu_bacteria 2937023124 2937026729 292
440 iso_pu_bacteria 2937029754 2937033022 292
441 iso_pu_bacteria 2937036028 2937042196 292
442 iso_pu_bacteria 2937042894 2937047836 292
443 iso_pu_bacteria 2937049772 2937052367 292
444 iso_pu_bacteria 2937056579 2937062214 292
445 iso_pu_bacteria 2937063883 2937067611 292
446 iso_pu_bacteria 2937071275 2937071425 292
447 iso_pu_bacteria 2937078374 2937078603 292
448 iso_pu_bacteria 2937084907 2937087280 292
449 iso_pu_bacteria 2937091812 2937093419 292
450 iso_pu_bacteria 2937098957 2937102289 292
451 iso_pu_bacteria 2937106411 2937111387 292
452 iso_pu_bacteria 2937113482 2937114852 292
453 iso_pu_bacteria 2937119839 2937123674 292
454 iso_pu_bacteria 2937126314 2937129348 292
455 iso_pu_bacteria 2941499720 2941501722 292
456 iso_pu_bacteria 2957375807 2957376958 292
457 iso_pu_bacteria 2957382221 2957386109 292
458 iso_pu_bacteria 2957388812 2957392088 292
459 iso_pu_bacteria 2957402308 2957406290 292
460 iso_pu_bacteria 2957408893 2957409043 292
461 iso_pu_bacteria 2957415311 2957416350 292
462 iso_pu_bacteria 2957422303 2957426792 292
463 iso_pu_bacteria 2957430029 2957436806 292
464 iso_pu_bacteria 2957437181 2957437361 292
465 iso_pu_bacteria 2957443900 2957449528 292
466 iso_pu_bacteria 2957450854 2957452804 292
467 iso_pu_bacteria 2957457609 2957459079 292
468 iso_pu_bacteria 2957464669 2957468171 292
469 iso_pu_bacteria 2957471148 2957472257 292
470 iso_pu_bacteria 2957478035 2957481126 292
471 iso_pu_bacteria 2957484790 2957487585 292
472 iso_pu_bacteria 2957491536 2957495297 292
473 iso_pu_bacteria 2957498199 2957498676 292
474 iso_pu_bacteria 2957505466 2957508678 292
475 iso_pu_bacteria 2960584000 2960585339 292
476 iso_pu_bacteria 2960591022 2960591251 292
477 iso_pu_bacteria 2960597568 2960598802 292
478 iso_pu_bacteria 2960603979 2960605019 292
479 iso_pu_bacteria 2960610863 2960617226 292
480 iso_pu_bacteria 2960617483 2960622832 292
481 iso_pu_bacteria 2960624210 2960628120 292
482 iso_pu_bacteria 2960631154 2960632502 292
483 iso_pu_bacteria 2960637947 2960638994 292
484 iso_pu_bacteria 2960645483 2960650131 292
485 iso_pu_bacteria 2960660292 2960665295 292
486 iso_pu_bacteria 2960667422 2960671522 292
487 iso_pu_bacteria 2960674078 2960677398 292
488 iso_pu_bacteria 2960680706 2960681333 292
489 iso_pu_bacteria 2960687367 2960692369 292
490 iso_pu_bacteria 2960693952 2960696438 292
491 iso_pu_bacteria 2964607997 2964612985 292
492 iso_pu_bacteria 2964615318 2964620427 292
493 iso_pu_bacteria 2964621998 2964622427 292
494 iso_pu_bacteria 2964628898 2964629985 292
495 iso_pu_bacteria 2964636051 2964637601 292
496 iso_pu_bacteria 2964643177 2964647267 292
497 iso_pu_bacteria 2964649959 2964652291 292
498 iso_pu_bacteria 2964656573 2964657774 292
499 iso_pu_bacteria 2964663802 2964668883 292
500 iso_pu_bacteria 2964670856 2964673827 292
501 iso_pu_bacteria 2964678106 2964681817 292
502 iso_pu_bacteria 2964685014 2964687005 292
503 iso_pu_bacteria 2964691889 2964697678 292
504 iso_pu_bacteria 2964698721 2964702984 292
505 iso_pu_bacteria 2964705432 2964712445 292
506 iso_pu_bacteria 2964712639 2964717465 292
507 iso_pu_bacteria 2964719344 2964720080 292
508 iso_pu_bacteria 2967664464 2967670849 292
509 iso_pu_bacteria 2967671571 2967674424 292
510 iso_pu_bacteria 2967678726 2967685929 292
511 iso_pu_bacteria 2967686174 2967686481 292
512 iso_pu_bacteria 2967693043 2967696185 292
513 iso_pu_bacteria 2967699805 2967705640 292
514 iso_pu_bacteria 2967706974 2967710080 292
515 iso_pu_bacteria 2967714385 2967720053 292
516 iso_pu_bacteria 2967721400 2967724867 292
517 iso_pu_bacteria 2967728569 2967732514 292
518 iso_pu_bacteria 2967735183 2967735361 292
519 iso_pu_bacteria 2967742019 2967746848 292
520 iso_pu_bacteria 2967748971 2967752416 292
521 iso_pu_bacteria 2967755722 2967758864 292
522 iso_pu_bacteria 2967762386 2967769246 292
523 iso_pu_bacteria 2967769361 2967774613 292
524 iso_pu_bacteria 2967775926 2967776383 292
525 iso_pu_bacteria 2970019648 2970022204 292
526 iso_pu_bacteria 2970026789 2970028277 292
527 iso_pu_bacteria 2970033650 2970040576 292
528 iso_pu_bacteria 2970040964 2970043475 292
529 iso_pu_bacteria 2970047711 2970050567 292
530 iso_pu_bacteria 2970054988 2970058449 292
531 iso_pu_bacteria 2970061556 2970067041 292
532 iso_pu_bacteria 2970068827 2970075741 292
533 iso_pu_bacteria 2970076120 2970079142 292
534 iso_pu_bacteria 2970082768 2970083450 292
535 iso_pu_bacteria 2970088815 2970090060 292
536 iso_pu_bacteria 2970095765 2970100379 292
537 iso_pu_bacteria 2970102677 2970108890 292
538 iso_pu_bacteria 2970109326 2970112719 292
539 iso_pu_bacteria 2970116247 2970121322 292
540 iso_pu_bacteria 2970122695 2970126491 292
541 iso_pu_bacteria 2970129317 2970134360 292
542 iso_pu_bacteria 2970136068 2970141286 292
543 iso_pu_bacteria 2970143518 2970146606 292
544 iso_pu_bacteria 2970149975 2970152742 292
545 iso_pu_bacteria 2970156795 2970157911 292
546 iso_pu_bacteria 2970164137 2970166749 292
547 iso_pu_bacteria 2970170962 2970173408 292
548 iso_pu_bacteria 2970177841 2970179167 292
549 iso_pu_bacteria 2970184632 2970187730 292
550 iso_pu_bacteria 2970191845 2970195089 292
551 iso_pu_bacteria 2977516862 2977522546 292
552 iso_pu_bacteria 2977523885 2977528721 292
553 iso_pu_bacteria 2977530762 2977532503 292
554 iso_pu_bacteria 2977537788 2977541030 292
555 iso_pu_bacteria 2977544691 2977551057 292
556 iso_pu_bacteria 2977551784 2977556910 292
557 iso_pu_bacteria 2977558990 2977561154 292
558 iso_pu_bacteria 2977565890 2977567188 292
559 iso_pu_bacteria 2977572785 2977576092 292
560 iso_pu_bacteria 2977579622 2977579773 292
561 iso_pu_bacteria 8003992118 8003994946 292
562 iso_pu_bacteria 8003999396 8004002705 292
563 iso_pu_bacteria 8049293176 8049295914 292
564 3300002739 JGI25158J39367_1000349 JGI25158J39367_10003498 293
565 3300002773 JGI25152J39213_1001533 JGI25152J39213_10015335 293
566 3300002773 JGI25152J39213_1002032 JGI25152J39213_10020327 293
567 3300002773 JGI25152J39213_1003616 JGI25152J39213_10036162 293
568 3300002773 JGI25152J39213_1003776 JGI25152J39213_10037769 293
569 3300002773 JGI25152J39213_1013279 JGI25152J39213_10132791 293
570 3300002773 JGI25152J39213_1014056 JGI25152J39213_10140562 293
571 3300002773 JGI25152J39213_1014066 JGI25152J39213_10140662 293
572 3300002774 JGI25150J39212_1000230 JGI25150J39212_100023019 293
573 3300002774 JGI25150J39212_1002298 JGI25150J39212_10022982 293
574 3300002774 JGI25150J39212_1008858 JGI25150J39212_10088581 293
575 3300002987 JGI25159J45721_1000663 JGI25159J45721_100066311 293
576 3300003187 JGI25151J46595_10001231 JGI25151J46595_1000123116 293
577 3300003187 JGI25151J46595_10001414 JGI25151J46595_100014143 293
578 3300003215 JGI25153J46596_10004558 JGI25153J46596_100045587 293
579 3300003215 JGI25153J46596_10008345 JGI25153J46596_100083453 293
580 3300003215 JGI25153J46596_10013198 JGI25153J46596_100131982 293
581 3300003215 JGI25153J46596_10020921 JGI25153J46596_100209212 293
582 3300003215 JGI25153J46596_10034876 JGI25153J46596_100348762 293
583 3300003215 JGI25153J46596_10034878 JGI25153J46596_100348782 293
584 3300003354 JGI25160J50197_1001417 JGI25160J50197_10014178 293
585 3300003354 JGI25160J50197_1012549 JGI25160J50197_10125492 293
586 3300003374 JGI25161J50226_1000901 JGI25161J50226_10009018 293
587 3300003374 JGI25161J50226_1002710 JGI25161J50226_10027102 293
588 3300003771 Ga0055526_1000979 Ga0055526_100097914 293
589 3300003771 Ga0055526_1006440 Ga0055526_10064403 293
590 3300003771 Ga0055526_1015198 Ga0055526_10151984 293
591 3300003771 Ga0055526_1015714 Ga0055526_10157143 293
592 3300003775 Ga0055524_1002889 Ga0055524_10028893 293
593 3300003775 Ga0055524_1005154 Ga0055524_10051546 293
594 3300003775 Ga0055524_1011210 Ga0055524_10112102 293
595 3300003790 Ga0055528_1000704 Ga0055528_10007044 293
596 3300003790 Ga0055528_1002226 Ga0055528_10022269 293
597 3300003790 Ga0055528_1006711 Ga0055528_10067115 293
598 3300003790 Ga0055528_1006918 Ga0055528_10069187 293
599 3300003792 Ga0055540_1000537 Ga0055540_10005373 293
600 3300004625 Ga0055543_1000077 Ga0055543_100007765 293
601 3300004625 Ga0055543_1000724 Ga0055543_100072412 293
602 3300005262 Ga0065165_1002901 Ga0065165_100290119 293
603 3300005262 Ga0065165_1010015 Ga0065165_10100153 293
604 3300005355 Ga0070671_100066028 Ga0070671_1000660283 293
605 3300005367 Ga0070667_100073952 Ga0070667_1000739523 293
606 3300005455 Ga0070663_100078389 Ga0070663_1000783892 293
607 3300005457 Ga0070662_100408109 Ga0070662_1004081091 293
608 3300006042 Ga0075368_10018029 Ga0075368_100180292 293
609 3300006048 Ga0075363_100071258 Ga0075363_1000712582 293
610 3300006177 Ga0075362_10009877 Ga0075362_100098773 293
611 3300006178 Ga0075367_10020813 Ga0075367_100208136 293
612 3300006178 Ga0075367_10081074 Ga0075367_100810742 293
613 3300006178 Ga0075367_10096813 Ga0075367_100968132 293
614 3300006186 Ga0075369_10001520 Ga0075369_100015202 293
615 3300006195 Ga0075366_10162942 Ga0075366_101629421 293
616 3300006353 Ga0075370_10000872 Ga0075370_100008721 293
617 3300006353 Ga0075370_10115253 Ga0075370_101152533 293
618 3300009765 Ga0123341_1000016 Ga0123341_100001622 293
619 3300009766 Ga0123342_1044877 Ga0123342_10448771 293
620 3300012490 Ga0157322_1002157 Ga0157322_10021571 293
621 3300025208 Ga0209436_100072 Ga0209436_10007239 293
622 3300025245 Ga0207425_1000070 Ga0207425_100007065 293
623 3300025245 Ga0207425_1003108 Ga0207425_10031083 293
624 3300025245 Ga0207425_1004995 Ga0207425_10049954 293
625 3300025258 Ga0209129_1000080 Ga0209129_1000080127 293
626 3300025258 Ga0209129_1000172 Ga0209129_100017265 293
627 3300025258 Ga0209129_1000232 Ga0209129_100023224 293
628 3300025258 Ga0209129_1000681 Ga0209129_10006819 293
629 3300025258 Ga0209129_1000773 Ga0209129_10007733 293
630 3300025258 Ga0209129_1001915 Ga0209129_10019156 293
631 3300025258 Ga0209129_1002970 Ga0209129_10029709 293
632 3300025258 Ga0209129_1007179 Ga0209129_10071793 293
633 3300025273 Ga0209673_1000037 Ga0209673_1000037180 293
634 3300025273 Ga0209673_1000060 Ga0209673_1000060182 293
635 3300025273 Ga0209673_1000312 Ga0209673_100031265 293
636 3300025273 Ga0209673_1000439 Ga0209673_100043951 293
637 3300025273 Ga0209673_1000649 Ga0209673_100064914 293
638 3300025273 Ga0209673_1001880 Ga0209673_100188023 293
639 3300025273 Ga0209673_1004749 Ga0209673_10047493 293
640 3300025273 Ga0209673_1006702 Ga0209673_10067026 293
641 3300025284 Ga0209130_1000030 Ga0209130_1000030196 293
642 3300025284 Ga0209130_1029986 Ga0209130_10299861 293
643 3300025292 Ga0209676_1036147 Ga0209676_10361472 293
644 3300025294 Ga0209025_1000083 Ga0209025_1000083198 293
645 3300025294 Ga0209025_1000389 Ga0209025_100038936 293
646 3300025294 Ga0209025_1000607 Ga0209025_100060750 293
647 3300025294 Ga0209025_1004571 Ga0209025_10045713 293
648 3300025294 Ga0209025_1015269 Ga0209025_10152692 293
649 3300025295 Ga0209564_1000116 Ga0209564_1000116182 293
650 3300025295 Ga0209564_1000125 Ga0209564_100012521 293
651 3300025295 Ga0209564_1000281 Ga0209564_100028127 293
652 3300025295 Ga0209564_1003058 Ga0209564_100305811 293
653 3300025295 Ga0209564_1014851 Ga0209564_10148511 293
654 3300025295 Ga0209564_1019396 Ga0209564_10193961 293
655 3300025297 Ga0209758_1000090 Ga0209758_100009065 293
656 3300025297 Ga0209758_1000357 Ga0209758_100035739 293
657 3300025297 Ga0209758_1000892 Ga0209758_100089230 293
658 3300025297 Ga0209758_1001670 Ga0209758_100167010 293
659 3300025297 Ga0209758_1002964 Ga0209758_100296410 293
660 3300025297 Ga0209758_1004285 Ga0209758_10042856 293
661 3300025297 Ga0209758_1055329 Ga0209758_10553291 293
662 3300025298 Ga0209050_1048529 Ga0209050_10485291 293
663 3300025299 Ga0209256_1000854 Ga0209256_100085417 293
664 3300025299 Ga0209256_1001567 Ga0209256_10015675 293
665 3300025299 Ga0209256_1001901 Ga0209256_100190113 293
666 3300025299 Ga0209256_1004259 Ga0209256_10042599 293
667 3300025299 Ga0209256_1023559 Ga0209256_10235591 293
668 3300025302 Ga0207426_1000047 Ga0207426_1000047205 293
669 3300025302 Ga0207426_1000268 Ga0207426_100026866 293
670 3300025302 Ga0207426_1001666 Ga0207426_10016667 293
671 3300025303 Ga0209051_1000371 Ga0209051_100037115 293
672 3300025303 Ga0209051_1002253 Ga0209051_100225319 293
673 3300025303 Ga0209051_1008182 Ga0209051_10081824 293
674 3300025304 Ga0209257_1005871 Ga0209257_10058712 293
675 3300025304 Ga0209257_1040705 Ga0209257_10407051 293
676 3300025931 Ga0207644_10019252 Ga0207644_100192521 293
677 3300028379 Ga0268266_10145867 Ga0268266_101458672 293
678 3300028794 Ga0307515_10004358 Ga0307515_100043586 293
679 3300028794 Ga0307515_10040917 Ga0307515_100409177 293
680 3300028794 Ga0307515_10295593 Ga0307515_102955931 293
681 3300031456 Ga0307513_10056159 Ga0307513_100561591 293
682 3300031456 Ga0307513_10060399 Ga0307513_100603993 293
683 3300031731 Ga0307405_10000994 Ga0307405_100009947 293
684 3300031911 Ga0307412_10003267 Ga0307412_1000326710 293
685 3300031911 Ga0307412_10158243 Ga0307412_101582432 293
686 3300035695 Ga0373927_0001739 Ga0373927_0001739_7393_8277 293
687 3300037068 Ga0373925_0012096 Ga0373925_0012096_4374_5258 293
688 3300037471 Ga0395905_0004700 Ga0395905_0004700_6670_7554 293
689 3300037471 Ga0395905_0005359 Ga0395905_0005359_7433_8317 293
690 3300041404 Ga0439436_0058730 Ga0439436_0058730_35_916 293
691 3300041413 Ga0439465_0007359 Ga0439465_0007359_511_1392 293
692 3300041413 Ga0439465_0028355 Ga0439465_0028355_512_1393 293
693 3300041491 Ga0451833_0051479 Ga0451833_0051479_649_1530 293
694 3300041492 Ga0451835_0302626 Ga0451835_0302626_2706_3587 293
695 3300041494 Ga0451837_0060979 Ga0451837_0060979_173_1054 293
696 3300041496 Ga0451839_0718998 Ga0451839_0718998_272_1153 293
697 3300041496 Ga0451839_0917332 Ga0451839_0917332_457_1338 293
698 3300041501 Ga0451845_0681531 Ga0451845_0681531_998_1879 293
699 3300041503 Ga0451847_0508924 Ga0451847_0508924_61_942 293
700 3300041506 Ga0451850_50252 Ga0451850_50252_53_934 293
701 3300041507 Ga0451851_1216410 Ga0451851_1216410_502_1383 293
702 3300041509 Ga0451843_0986684 Ga0451843_0986684_191_1072 293
703 3300041511 Ga0451855_1356713 Ga0451855_1356713_266_1147 293
704 3300041512 Ga0451853_0980795 Ga0451853_0980795_458_1339 293
705 3300046460 Ga0495638_0002245 Ga0495638_0002245_4982_5863 293
706 3300046460 Ga0495638_0032082 Ga0495638_0032082_101_1039 293
707 3300046460 Ga0495638_0081074 Ga0495638_0081074_352_1236 293
708 3300046471 Ga0495650_0098029 Ga0495650_0098029_20_901 293
709 3300046492 Ga0495585_0062116 Ga0495585_0062116_1044_1925 293
710 3300046492 Ga0495585_0089691 Ga0495585_0089691_735_1616 293
711 3300046501 Ga0495607_0079425 Ga0495607_0079425_468_1349 293
712 3300046507 Ga0495606_0027058 Ga0495606_0027058_2306_3187 293
713 3300046512 Ga0495610_0124406 Ga0495610_0124406_34_915 293
714 3300046513 Ga0495616_0014904 Ga0495616_0014904_2704_3585 293
715 3300046513 Ga0495616_0099911 Ga0495616_0099911_39_920 293
716 3300046515 Ga0495620_0035007 Ga0495620_0035007_380_1261 293
717 3300046518 Ga0495631_0001536 Ga0495631_0001536_7540_8421 293
718 3300046519 Ga0495632_0011408 Ga0495632_0011408_3393_4274 293
719 3300046522 Ga0495643_0028426 Ga0495643_0028426_313_1194 293
720 3300046522 Ga0495643_0049203 Ga0495643_0049203_580_1461 293
721 3300046522 Ga0495643_0124401 Ga0495643_0124401_143_1024 293
722 3300046524 Ga0495648_0076026 Ga0495648_0076026_355_1236 293
723 3300046530 Ga0495654_0021069 Ga0495654_0021069_799_1680 293
724 3300046538 Ga0495609_0016177 Ga0495609_0016177_693_1574 293
725 3300046542 Ga0495597_0023913 Ga0495597_0023913_1478_2359 293
726 3300046648 Ga0495611_0005032 Ga0495611_0005032_2174_3055 293
727 3300046660 Ga0495625_0003752 Ga0495625_0003752_9363_10244 293
728 3300046665 Ga0495661_0075275 Ga0495661_0075275_365_1246 293
729 3300046691 Ga0495670_0017514 Ga0495670_0017514_132_1013 293
730 3300046692 Ga0495671_0061466 Ga0495671_0061466_350_1231 293
731 3300046694 Ga0495649_0034661 Ga0495649_0034661_1454_2335 293
732 3300046810 Ga0495660_0088553 Ga0495660_0088553_447_1328 293
733 3300047318 Ga0495636_0058652 Ga0495636_0058652_223_1104 293
734 3300047443 Ga0495687_034233 Ga0495687_034233_341_1222 293
735 3300047469 Ga0495673_0125702 Ga0495673_0125702_93_974 293
736 3300047472 Ga0495686_0025145 Ga0495686_0025145_2502_3383 293
737 3300048091 Ga0495626_0041805 Ga0495626_0041805_785_1666 293
738 3300048091 Ga0495626_0085445 Ga0495626_0085445_386_1267 293
739 3300048909 Ga0496106_0000326 Ga0496106_0000326_8671_9555 293
740 3300048909 Ga0496106_0153230 Ga0496106_0153230_202_1086 293
741 3300048919 Ga0496116_0013575 Ga0496116_0013575_5161_6042 293
742 3300048919 Ga0496116_0132087 Ga0496116_0132087_177_1058 293
743 3300048920 Ga0496117_0174737 Ga0496117_0174737_135_1016 293
744 3300048920 Ga0496117_0208383 Ga0496117_0208383_48_929 293
745 3300048921 Ga0496118_0044052 Ga0496118_0044052_2196_3077 293
746 3300048924 Ga0496121_0048898 Ga0496121_0048898_327_1211 293
747 3300048924 Ga0496121_0111031 Ga0496121_0111031_69_950 293
748 3300048924 Ga0496121_0115924 Ga0496121_0115924_667_1548 293
749 3300048924 Ga0496121_0201253 Ga0496121_0201253_347_1228 293
750 3300048925 Ga0496122_0067215 Ga0496122_0067215_971_1852 293
751 3300048925 Ga0496122_0135156 Ga0496122_0135156_335_1216 293
752 3300048926 Ga0496123_0032582 Ga0496123_0032582_2242_3123 293
753 3300048926 Ga0496123_0063904 Ga0496123_0063904_1343_2224 293
754 3300048927 Ga0496124_0002161 Ga0496124_0002161_20579_21460 293
755 3300048927 Ga0496124_0139774 Ga0496124_0139774_954_1835 293
756 3300048928 Ga0496125_0033327 Ga0496125_0033327_1266_2147 293
757 3300048929 Ga0496126_0138432 Ga0496126_0138432_702_1583 293
758 3300049459 Ga0495678_041453 Ga0495678_041453_785_1666 293
759 3300049570 Ga0501033_0004143 Ga0501033_0004143_1007_1894 293
760 3300049571 Ga0501034_0224955 Ga0501034_0224955_615_1499 293
761 3300049573 Ga0501037_0076208 Ga0501037_0076208_1069_1953 293
762 3300049574 Ga0501038_0025453 Ga0501038_0025453_3016_3900 293
763 3300049575 Ga0501039_0115254 Ga0501039_0115254_167_1051 293
764 3300049742 Ga0501080_0513309 Ga0501080_0513309_123_1007 293
765 3300049744 Ga0501083_0190490 Ga0501083_0190490_354_1235 293
766 3300049822 Ga0501035_0000707 Ga0501035_0000707_384_1271 293
767 3300049823 Ga0501044_0034844 Ga0501044_0034844_3256_4140 293
768 3300050489 nmdc:mga03683_11702_c1 nmdc:mga03683_11702_c1_2193_3074 293
769 3300050492 nmdc:mga0yw44_41859_c1 nmdc:mga0yw44_41859_c1_860_1741 293
770 3300050493 nmdc:mga0k408_7034_c1 nmdc:mga0k408_7034_c1_3662_4543 293
771 3300050494 nmdc:mga06z11_7904_c2 nmdc:mga06z11_7904_c2_525_1406 293
772 3300050496 nmdc:mga07m45_14585_c1 nmdc:mga07m45_14585_c1_1944_2825 293
773 3300050496 nmdc:mga07m45_80704_c1 nmdc:mga07m45_80704_c1_147_1028 293
774 3300050516 nmdc:mga0sz30_1144_c1 nmdc:mga0sz30_1144_c1_5387_6268 293
775 3300053088 Ga0500644_0003536 Ga0500644_0003536_398_1336 293
776 3300053134 Ga0500658_0000868 Ga0500658_0000868_7324_8205 293
777 3300053136 Ga0500559_0015626 Ga0500559_0015626_2156_3040 293
778 3300053139 Ga0500568_0003075 Ga0500568_0003075_697_1581 293
779 3300053140 Ga0500573_0002542 Ga0500573_0002542_7068_7952 293
780 3300053140 Ga0500573_0072051 Ga0500573_0072051_94_978 293
781 3300053151 Ga0500604_0051822 Ga0500604_0051822_284_1168 293
782 3300053153 Ga0500616_0006118 Ga0500616_0006118_2103_2984 293
783 3300053153 Ga0500616_0039225 Ga0500616_0039225_507_1388 293
784 3300053156 Ga0500622_0000918 Ga0500622_0000918_16517_17398 293
785 3300053156 Ga0500622_0001540 Ga0500622_0001540_6720_7658 293
786 3300053156 Ga0500622_0152819 Ga0500622_0152819_136_1017 293
787 3300053158 Ga0500627_0097611 Ga0500627_0097611_309_1190 293
788 3300059492 Ga0587073_0036208 Ga0587073_0036208_114_995 293
789 3300060353 Ga0501082_0029595 Ga0501082_0029595_2593_3474 293
790 3300002704 JGI25155J39150_1000007 JGI25155J39150_100000727 294
791 3300002704 JGI25155J39150_1000012 JGI25155J39150_1000012180 294
792 3300002705 JGI25156J39149_1001609 JGI25156J39149_100160911 294
793 3300002737 JGI25162J39368_1000449 JGI25162J39368_10004493 294
794 3300002737 JGI25162J39368_1000471 JGI25162J39368_100047125 294
795 3300002738 JGI25154J39366_1001077 JGI25154J39366_100107711 294
796 3300002738 JGI25154J39366_1001309 JGI25154J39366_10013091 294
797 3300002741 JGI25157J39369_1000124 JGI25157J39369_100012449 294
798 3300002987 JGI25159J45721_1002318 JGI25159J45721_100231813 294
799 3300003187 JGI25151J46595_10000031 JGI25151J46595_10000031154 294
800 3300003187 JGI25151J46595_10017466 JGI25151J46595_100174661 294
801 3300003214 JGI25165J46597_1000443 JGI25165J46597_10004433 294
802 3300003214 JGI25165J46597_1000845 JGI25165J46597_100084517 294
803 3300003215 JGI25153J46596_10000937 JGI25153J46596_1000093726 294
804 3300003354 JGI25160J50197_1000114 JGI25160J50197_100011469 294
805 3300003374 JGI25161J50226_1000089 JGI25161J50226_100008914 294
806 3300003791 Ga0055530_10011799 Ga0055530_100117995 294
807 3300003792 Ga0055540_1004346 Ga0055540_10043464 294
808 3300003794 Ga0055531_10002239 Ga0055531_100022398 294
809 3300003856 Ga0058692_1016793 Ga0058692_10167931 294
810 3300004625 Ga0055543_1000002 Ga0055543_1000002344 294
811 3300005262 Ga0065165_1000537 Ga0065165_100053731 294
812 3300005262 Ga0065165_1004459 Ga0065165_10044596 294
813 3300005331 Ga0070670_100000577 Ga0070670_10000057725 294
814 3300005548 Ga0070665_100003560 Ga0070665_1000035604 294
815 3300005548 Ga0070665_100130182 Ga0070665_1001301822 294
816 3300005614 Ga0068856_100351846 Ga0068856_1003518461 294
817 3300005616 Ga0068852_100115404 Ga0068852_1001154044 294
818 3300006038 Ga0075365_10004800 Ga0075365_100048007 294
819 3300006038 Ga0075365_10031222 Ga0075365_100312224 294
820 3300006042 Ga0075368_10001630 Ga0075368_100016303 294
821 3300006051 Ga0075364_10162552 Ga0075364_101625522 294
822 3300006177 Ga0075362_10014139 Ga0075362_100141394 294
823 3300006178 Ga0075367_10007124 Ga0075367_100071241 294
824 3300006186 Ga0075369_10006231 Ga0075369_100062314 294
825 3300006946 Ga0079104_1000042 Ga0079104_1000042137 294
826 3300006948 Ga0099826_10000270 Ga0099826_1000027017 294
827 3300009011 Ga0105251_10006217 Ga0105251_1000621710 294
828 3300009092 Ga0105250_10028882 Ga0105250_100288822 294
829 3300009093 Ga0105240_10000019 Ga0105240_10000019182 294
830 3300009148 Ga0105243_10247981 Ga0105243_102479811 294
831 3300009545 Ga0105237_10001085 Ga0105237_1000108525 294
832 3300009551 Ga0105238_10256518 Ga0105238_102565182 294
833 3300009766 Ga0123342_1011116 Ga0123342_101111610 294
834 3300010375 Ga0105239_10030478 Ga0105239_100304783 294
835 3300011119 Ga0105246_10035508 Ga0105246_100355083 294
836 3300013100 Ga0157373_10006893 Ga0157373_100068937 294
837 3300013100 Ga0157373_10108052 Ga0157373_101080522 294
838 3300013102 Ga0157371_10000304 Ga0157371_100003044 294
839 3300013104 Ga0157370_10000824 Ga0157370_1000082427 294
840 3300013104 Ga0157370_10010711 Ga0157370_100107112 294
841 3300013104 Ga0157370_10029226 Ga0157370_100292262 294
842 3300015262 Ga0182007_10004588 Ga0182007_100045884 294
843 3300015265 Ga0182005_1007509 Ga0182005_10075093 294
844 3300025206 Ga0209435_100005 Ga0209435_100005180 294
845 3300025208 Ga0209436_105953 Ga0209436_1059531 294
846 3300025228 Ga0209672_109696 Ga0209672_1096961 294
847 3300025233 Ga0209437_100078 Ga0209437_100078203 294
848 3300025233 Ga0209437_100291 Ga0209437_10029132 294
849 3300025246 Ga0209646_1000011 Ga0209646_1000011180 294
850 3300025246 Ga0209646_1007664 Ga0209646_10076642 294
851 3300025250 Ga0209026_1000008 Ga0209026_1000008180 294
852 3300025253 Ga0209677_100640 Ga0209677_1006407 294
853 3300025256 Ga0209759_1000004 Ga0209759_1000004180 294
854 3300025261 Ga0209233_1000157 Ga0209233_100015727 294
855 3300025261 Ga0209233_1000192 Ga0209233_100019246 294
856 3300025261 Ga0209233_1000194 Ga0209233_100019442 294
857 3300025272 Ga0209455_1015810 Ga0209455_10158102 294
858 3300025284 Ga0209130_1000083 Ga0209130_1000083154 294
859 3300025292 Ga0209676_1009885 Ga0209676_10098852 294
860 3300025294 Ga0209025_1000052 Ga0209025_1000052140 294
861 3300025294 Ga0209025_1011198 Ga0209025_10111982 294
862 3300025297 Ga0209758_1000657 Ga0209758_100065744 294
863 3300025297 Ga0209758_1013680 Ga0209758_10136805 294
864 3300025297 Ga0209758_1015070 Ga0209758_10150703 294
865 3300025298 Ga0209050_1014318 Ga0209050_10143186 294
866 3300025302 Ga0207426_1000173 Ga0207426_1000173154 294
867 3300025303 Ga0209051_1004310 Ga0209051_10043104 294
868 3300025304 Ga0209257_1005862 Ga0209257_10058626 294
869 3300025913 Ga0207695_10000049 Ga0207695_10000049184 294
870 3300025914 Ga0207671_10001282 Ga0207671_1000128217 294
871 3300025925 Ga0207650_10004194 Ga0207650_100041944 294
872 3300025935 Ga0207709_10087673 Ga0207709_100876732 294
873 3300026078 Ga0207702_10387045 Ga0207702_103870451 294
874 3300027111 Ga0209281_1000068 Ga0209281_10000686 294
875 3300027312 Ga0209371_1002415 Ga0209371_10024152 294
876 3300028379 Ga0268266_10003136 Ga0268266_100031364 294
877 3300028379 Ga0268266_10101428 Ga0268266_101014283 294
878 3300028794 Ga0307515_10000263 Ga0307515_1000026354 294
879 3300028794 Ga0307515_10011563 Ga0307515_100115638 294
880 3300030500 Ga0268256_1002345 Ga0268256_10023459 294
881 3300030500 Ga0268256_1005024 Ga0268256_10050245 294
882 3300030744 Ga0316181_1213661 Ga0316181_12136614 294
883 3300031456 Ga0307513_10002589 Ga0307513_1000258915 294
884 3300031824 Ga0307413_10181017 Ga0307413_101810171 294
885 3300031911 Ga0307412_10135531 Ga0307412_101355313 294
886 3300031911 Ga0307412_10441012 Ga0307412_104410121 294
887 3300032004 Ga0307414_10087343 Ga0307414_100873432 294
888 3300041413 Ga0439465_0003521 Ga0439465_0003521_2573_3457 294
889 3300042146 Ga0450907_007846 Ga0450907_007846_826_1710 294
890 3300042185 Ga0450909_016653 Ga0450909_016653_35_919 294
891 3300042435 Ga0439434_0009734 Ga0439434_0009734_1057_1941 294
892 3300042531 Ga0450918_012085 Ga0450918_012085_280_1164 294
893 3300044765 Ga0466970_0005750 Ga0466970_0005750_3764_4663 294
894 3300046459 Ga0495629_0039434 Ga0495629_0039434_1757_2656 294
895 3300046462 Ga0495651_0056767 Ga0495651_0056767_164_1063 294
896 3300046476 Ga0495662_0008770 Ga0495662_0008770_2519_3418 294
897 3300046501 Ga0495607_0051193 Ga0495607_0051193_256_1143 294
898 3300046501 Ga0495607_0097619 Ga0495607_0097619_288_1172 294
899 3300046506 Ga0495583_0006132 Ga0495583_0006132_6272_7225 294
900 3300046507 Ga0495606_0005438 Ga0495606_0005438_7671_8555 294
901 3300046512 Ga0495610_0003921 Ga0495610_0003921_9751_10704 294
902 3300046515 Ga0495620_0064260 Ga0495620_0064260_53_1006 294
903 3300046519 Ga0495632_0002903 Ga0495632_0002903_6451_7404 294
904 3300046519 Ga0495632_0094918 Ga0495632_0094918_317_1270 294
905 3300046522 Ga0495643_0015771 Ga0495643_0015771_3464_4417 294
906 3300046530 Ga0495654_0000401 Ga0495654_0000401_8660_9547 294
907 3300046533 Ga0495640_0042763 Ga0495640_0042763_175_1074 294
908 3300046557 Ga0495622_0015658 Ga0495622_0015658_1576_2475 294
909 3300046660 Ga0495625_0060586 Ga0495625_0060586_155_1039 294
910 3300046674 Ga0495588_0004270 Ga0495588_0004270_2907_3791 294
911 3300046675 Ga0495657_0031373 Ga0495657_0031373_1623_2522 294
912 3300046683 Ga0495658_0035776 Ga0495658_0035776_1697_2596 294
913 3300046809 Ga0495600_0053585 Ga0495600_0053585_753_1652 294
914 3300047321 Ga0495676_0202724 Ga0495676_0202724_185_1084 294
915 3300047443 Ga0495687_031132 Ga0495687_031132_63_947 294
916 3300047470 Ga0495681_0011425 Ga0495681_0011425_640_1524 294
917 3300047470 Ga0495681_0054588 Ga0495681_0054588_593_1483 294
918 3300047472 Ga0495686_0006222 Ga0495686_0006222_7572_8525 294
919 3300047472 Ga0495686_0019963 Ga0495686_0019963_1232_2116 294
920 3300047472 Ga0495686_0259158 Ga0495686_0259158_61_948 294
921 3300048905 Ga0496102_0021717 Ga0496102_0021717_814_1713 294
922 3300048907 Ga0496104_0040272 Ga0496104_0040272_3381_4265 294
923 3300048914 Ga0496111_0001131 Ga0496111_0001131_11017_11922 294
924 3300048917 Ga0496114_0088108 Ga0496114_0088108_997_1896 294
925 3300048919 Ga0496116_0025407 Ga0496116_0025407_1039_1923 294
926 3300048919 Ga0496116_0053121 Ga0496116_0053121_1590_2489 294
927 3300048919 Ga0496116_0100069 Ga0496116_0100069_726_1610 294
928 3300048919 Ga0496116_0161513 Ga0496116_0161513_300_1184 294
929 3300048920 Ga0496117_0000052 Ga0496117_0000052_217730_218614 294
930 3300048920 Ga0496117_0000814 Ga0496117_0000814_22868_23752 294
931 3300048920 Ga0496117_0005480 Ga0496117_0005480_5105_5989 294
932 3300048920 Ga0496117_0017733 Ga0496117_0017733_4703_5656 294
933 3300048920 Ga0496117_0139948 Ga0496117_0139948_206_1090 294
934 3300048921 Ga0496118_0001701 Ga0496118_0001701_782_1666 294
935 3300048921 Ga0496118_0002033 Ga0496118_0002033_4192_5076 294
936 3300048922 Ga0496119_0007227 Ga0496119_0007227_6996_7880 294
937 3300048922 Ga0496119_0008625 Ga0496119_0008625_7946_8845 294
938 3300048922 Ga0496119_0026534 Ga0496119_0026534_807_1691 294
939 3300048922 Ga0496119_0074156 Ga0496119_0074156_463_1347 294
940 3300048923 Ga0496120_0000019 Ga0496120_0000019_197465_198349 294
941 3300048923 Ga0496120_0043823 Ga0496120_0043823_510_1394 294
942 3300048924 Ga0496121_0000003 Ga0496121_0000003_976212_977096 294
943 3300048924 Ga0496121_0001407 Ga0496121_0001407_7014_7898 294
944 3300048924 Ga0496121_0001871 Ga0496121_0001871_13318_14202 294
945 3300048924 Ga0496121_0009541 Ga0496121_0009541_4709_5662 294
946 3300048924 Ga0496121_0017896 Ga0496121_0017896_836_1723 294
947 3300048924 Ga0496121_0018198 Ga0496121_0018198_711_1631 294
948 3300048924 Ga0496121_0037911 Ga0496121_0037911_249_1133 294
949 3300048925 Ga0496122_0000024 Ga0496122_0000024_230491_231375 294
950 3300048925 Ga0496122_0000053 Ga0496122_0000053_197465_198349 294
951 3300048925 Ga0496122_0000107 Ga0496122_0000107_9571_10461 294
952 3300048925 Ga0496122_0008439 Ga0496122_0008439_3305_4258 294
953 3300048925 Ga0496122_0008929 Ga0496122_0008929_6890_7774 294
954 3300048925 Ga0496122_0015748 Ga0496122_0015748_485_1384 294
955 3300048925 Ga0496122_0089305 Ga0496122_0089305_45_929 294
956 3300048925 Ga0496122_0093950 Ga0496122_0093950_1056_2009 294
957 3300048926 Ga0496123_0000038 Ga0496123_0000038_197465_198349 294
958 3300048926 Ga0496123_0000063 Ga0496123_0000063_182648_183538 294
959 3300048926 Ga0496123_0000086 Ga0496123_0000086_154090_154974 294
960 3300048926 Ga0496123_0009011 Ga0496123_0009011_7011_7895 294
961 3300048926 Ga0496123_0011406 Ga0496123_0011406_5671_6624 294
962 3300048926 Ga0496123_0065804 Ga0496123_0065804_68_973 294
963 3300048926 Ga0496123_0074475 Ga0496123_0074475_65_1018 294
964 3300048927 Ga0496124_0000413 Ga0496124_0000413_53786_54670 294
965 3300048927 Ga0496124_0002342 Ga0496124_0002342_18816_19700 294
966 3300048927 Ga0496124_0102667 Ga0496124_0102667_1385_2269 294
967 3300048927 Ga0496124_0107757 Ga0496124_0107757_1201_2154 294
968 3300048927 Ga0496124_0121992 Ga0496124_0121992_1035_1988 294
969 3300048927 Ga0496124_0262981 Ga0496124_0262981_87_1040 294
970 3300048927 Ga0496124_0263578 Ga0496124_0263578_77_961 294
971 3300048927 Ga0496124_0280210 Ga0496124_0280210_41_925 294
972 3300048927 Ga0496124_0360467 Ga0496124_0360467_45_929 294
973 3300048928 Ga0496125_0000345 Ga0496125_0000345_45707_46591 294
974 3300048928 Ga0496125_0000651 Ga0496125_0000651_23122_24006 294
975 3300048928 Ga0496125_0006752 Ga0496125_0006752_9664_10617 294
976 3300048928 Ga0496125_0013018 Ga0496125_0013018_6680_7564 294
977 3300048929 Ga0496126_0002468 Ga0496126_0002468_5027_5911 294
978 3300048929 Ga0496126_0021729 Ga0496126_0021729_2974_3858 294
979 3300048929 Ga0496126_0082360 Ga0496126_0082360_1729_2616 294
980 3300048929 Ga0496126_0128089 Ga0496126_0128089_882_1766 294
981 3300048929 Ga0496126_0131579 Ga0496126_0131579_1233_2117 294
982 3300048929 Ga0496126_0194513 Ga0496126_0194513_663_1607 294
983 3300049459 Ga0495678_021016 Ga0495678_021016_356_1309 294
984 3300049568 Ga0501031_0019801 Ga0501031_0019801_604_1488 294
985 3300049569 Ga0501032_0126854 Ga0501032_0126854_54_938 294
986 3300049571 Ga0501034_0052265 Ga0501034_0052265_133_1017 294
987 3300049571 Ga0501034_0242704 Ga0501034_0242704_125_1009 294
988 3300049574 Ga0501038_0170638 Ga0501038_0170638_99_983 294
989 3300049575 Ga0501039_0059846 Ga0501039_0059846_342_1226 294
990 3300050489 nmdc:mga03683_54147_c1 nmdc:mga03683_54147_c1_27_911 294
991 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_83394_84278 294
992 3300050491 nmdc:mga00v17_130168_c1 nmdc:mga00v17_130168_c1_583_1467 294
993 3300050491 nmdc:mga00v17_244730_c1 nmdc:mga00v17_244730_c1_233_1117 294
994 3300050492 nmdc:mga0yw44_1642_c1 nmdc:mga0yw44_1642_c1_6132_7019 294
995 3300050492 nmdc:mga0yw44_65_c1 nmdc:mga0yw44_65_c1_18087_18971 294
996 3300050493 nmdc:mga0k408_126577_c1 nmdc:mga0k408_126577_c1_220_1104 294
997 3300050494 nmdc:mga06z11_17309_c1 nmdc:mga06z11_17309_c1_434_1318 294
998 3300050495 nmdc:mga04h51_1588_c1 nmdc:mga04h51_1588_c1_4249_5133 294
999 3300050516 nmdc:mga0sz30_13690_c1 nmdc:mga0sz30_13690_c1_1059_1943 294
1000 3300050516 nmdc:mga0sz30_6648_c1 nmdc:mga0sz30_6648_c1_782_1666 294
1001 3300053107 Ga0500560_097676 Ga0500560_097676_82_966 294
1002 3300053125 Ga0500618_001118 Ga0500618_001118_828_1715 294
1003 3300053133 Ga0500655_002005 Ga0500655_002005_1299_2186 294
1004 3300053137 Ga0500561_0000931 Ga0500561_0000931_2825_3709 294
1005 3300053139 Ga0500568_0079018 Ga0500568_0079018_175_1062 294
1006 3300053148 Ga0500590_000352 Ga0500590_000352_5905_6804 294
1007 3300053153 Ga0500616_0002052 Ga0500616_0002052_7785_8672 294
1008 3300053157 Ga0500624_000692 Ga0500624_000692_3181_4065 294
1009 3300053157 Ga0500624_004903 Ga0500624_004903_364_1248 294
1010 iso_pu_bacteria 2510917022 2511136581 294
1011 iso_pu_bacteria 2510917028 2511185116 294
1012 iso_pu_bacteria 2524023209 2524460089 294
1013 iso_pu_bacteria 2582581307 2585274263 294
1014 iso_pu_bacteria 2582581308 2585280323 294
1015 iso_pu_bacteria 2582581315 2585322601 294
1016 iso_pu_bacteria 2582581316 2585330714 294
1017 iso_pu_bacteria 2585427527 2585532553 294
1018 iso_pu_bacteria 2585427530 2585554431 294
1019 iso_pu_bacteria 2585427531 2585560712 294
1020 iso_pu_bacteria 2585427609 2585903490 294
1021 iso_pu_bacteria 2585428125 2587981391 294
1022 iso_pu_bacteria 2615840626 2616307376 294
1023 iso_pu_bacteria 2615840698 2616554919 294
1024 iso_pu_bacteria 2617270742 2617383368 294
1025 iso_pu_bacteria 2643221634 2644195857 294
1026 iso_pu_bacteria 2667528174 2671112169 294
1027 iso_pu_bacteria 2775507266 2778175984 294
1028 iso_pu_bacteria 2818991448 2819609624 294
1029 iso_pu_bacteria 2818991453 2819639722 294
1030 iso_pu_bacteria 2838029111 2838033107 294
1031 iso_pu_bacteria 2842475841 2842479840 294
1032 iso_pu_bacteria 2842482326 2842483414 294
1033 iso_pu_bacteria 2842502639 2842507016 294
1034 iso_pu_bacteria 2919408235 2919410655 294
1035 iso_pu_bacteria 2996887358 2996889173 294
1036 iso_pu_bacteria 3005416602 3005418510 294
1037 iso_pu_bacteria 8005258706 8005264249 294
1038 iso_pu_bacteria 8005314921 8005318598 294
1039 iso_pu_bacteria 8005321885 8005323700 294
1040 iso_pu_bacteria 8005484373 8005488517 294
1041 iso_pu_bacteria 8005645114 8005648984 294
1042 iso_pu_bacteria 8005682033 8005682224 294
1043 iso_pu_bacteria 8024486573 8024489327 294
1044 iso_pu_bacteria 8046767195 8046773246 294
1045 iso_pu_bacteria 8057575449 8057581019 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

141

241

0.97

PF05013

FGase

N-formylglutamate amidohydrolase

26

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8929 11 284
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8927 11 284
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8739 11 284
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8718 11 284
3a9l-assembly1.cif.gz_B structure of bacteriophage poly-gamma-glutamate hydrolase 0.6009 10 277
ID Description Score Start End Superfamily
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.881 11 284 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8622 11 284 3.40.630.40
4hz2B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7662 189 221 3.40.30.10
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6172 182 221 3.40.30.10
3a9lB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Poly-gamma-glutamate hydrolase, zinc-binding motif 0.6009 10 277 3.40.630.100
ID Description Score Start End GO Terms
AF-A0A2M9P8M4-F1-model_v4 N-formylglutamate amidohydrolase 0.9753 10 72 GO:0016787
AF-A0A2G1ZS25-F1-model_v4 N-formylglutamate amidohydrolase 0.9622 10 74 GO:0016787
AF-A0A530MR67-F1-model_v4 deleted 0.9525 123 278
AF-A0A4P1JT73-F1-model_v4 N-formylglutamate deformylase 0.9515 187 280
AF-A0A526PZ33-F1-model_v4 N-formylglutamate amidohydrolase 0.9512 124 255 GO:0016787

Feature Viewer

pLDDT pTM Quality
81.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map