F488786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 348 | 2078 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300012500|Ga0157314_1004845|Ga0157314_10048452 |
| Length | 172 |
| Sequence | MTSSPSSLPPQLAELVDEFAEVGPRDRLQLLLELSQELPELPDRYSDATASMEQVPECQSPLFLAVEVEPAGDRRVHLFFSAPPEAPTTRGFASILRTGLDGEPAAGILAVPDDFYVKLGLGQAVSPLRLRGMAAMLARIKRQVRAGVAGWGISVVEATSKLCEERSPPLPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 104 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 106 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 107 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 343 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 344 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 345 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 346 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 347 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 348 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.65 |
| Metatranscriptomes | 0.67 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.06 |
| Rhizosphere | 91.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157314_1004845 | 3300012500 | Bacteria | 1003 |
| 2 | LJQas_1003654 | 3300000549 | Bacteria | 2043 |
| 3 | JGI24735J21928_10088676 | 3300002067 | Bacteria | 886 |
| 4 | JGI25404J52841_10011177 | 3300003659 | Bacteria | 1934 |
| 5 | Ga0070658_10104305 | 3300005327 | Bacteria | 2346 |
| 6 | Ga0070658_11199661 | 3300005327 | Bacteria | 660 |
| 7 | Ga0070676_10061481 | 3300005328 | Bacteria | 2233 |
| 8 | Ga0070683_100010133 | 3300005329 | Bacteria | 8089 |
| 9 | Ga0070683_100164581 | 3300005329 | Bacteria | 2104 |
| 10 | Ga0070683_101075843 | 3300005329 | Bacteria | 772 |
| 11 | Ga0070683_101556590 | 3300005329 | Bacteria | 636 |
| 12 | Ga0070690_101526229 | 3300005330 | Bacteria | 540 |
| 13 | Ga0070670_100214632 | 3300005331 | Bacteria | 1673 |
| 14 | Ga0070670_100385794 | 3300005331 | Bacteria | 1235 |
| 15 | Ga0068869_100048457 | 3300005334 | Bacteria | 3072 |
| 16 | Ga0068869_100080265 | 3300005334 | Bacteria | 2433 |
| 17 | Ga0068869_100194027 | 3300005334 | Bacteria | 1598 |
| 18 | Ga0068869_100959253 | 3300005334 | Bacteria | 743 |
| 19 | Ga0068869_101324989 | 3300005334 | Bacteria | 636 |
| 20 | Ga0070666_10326768 | 3300005335 | Bacteria | 1095 |
| 21 | Ga0070680_100219269 | 3300005336 | Bacteria | 1605 |
| 22 | Ga0070682_100017777 | 3300005337 | Bacteria | 4147 |
| 23 | Ga0070682_100045590 | 3300005337 | Bacteria | 2718 |
| 24 | Ga0070682_100170657 | 3300005337 | Bacteria | 1511 |
| 25 | Ga0070682_100239092 | 3300005337 | Bacteria | 1303 |
| 26 | Ga0070682_100388346 | 3300005337 | Bacteria | 1052 |
| 27 | Ga0070682_100414165 | 3300005337 | Bacteria | 1022 |
| 28 | Ga0068868_100043012 | 3300005338 | Bacteria | 3528 |
| 29 | Ga0068868_100073280 | 3300005338 | Bacteria | 2734 |
| 30 | Ga0068868_100672822 | 3300005338 | Bacteria | 923 |
| 31 | Ga0068868_101312291 | 3300005338 | Bacteria | 672 |
| 32 | Ga0070660_100145004 | 3300005339 | Bacteria | 1907 |
| 33 | Ga0070660_100424222 | 3300005339 | Bacteria | 1101 |
| 34 | Ga0070689_100231932 | 3300005340 | Bacteria | 1518 |
| 35 | Ga0070689_100284504 | 3300005340 | Bacteria | 1372 |
| 36 | Ga0070687_100072860 | 3300005343 | Bacteria | 1849 |
| 37 | Ga0070687_100126729 | 3300005343 | Bacteria | 1468 |
| 38 | Ga0070687_100629113 | 3300005343 | Bacteria | 741 |
| 39 | Ga0070661_100112341 | 3300005344 | Bacteria | 2035 |
| 40 | Ga0070692_10106524 | 3300005345 | Bacteria | 1544 |
| 41 | Ga0070692_11368045 | 3300005345 | Bacteria | 510 |
| 42 | Ga0070668_100115767 | 3300005347 | Bacteria | 2137 |
| 43 | Ga0070668_100139024 | 3300005347 | Bacteria | 1956 |
| 44 | Ga0070668_100959467 | 3300005347 | Bacteria | 767 |
| 45 | Ga0070668_101217430 | 3300005347 | Bacteria | 683 |
| 46 | Ga0070669_100128058 | 3300005353 | Bacteria | 1945 |
| 47 | Ga0070675_100409654 | 3300005354 | Bacteria | 1211 |
| 48 | Ga0070675_100426706 | 3300005354 | Bacteria | 1186 |
| 49 | Ga0070671_100006613 | 3300005355 | Bacteria | 9266 |
| 50 | Ga0070671_100288097 | 3300005355 | Bacteria | 1397 |
| 51 | Ga0070674_100051392 | 3300005356 | Bacteria | 2840 |
| 52 | Ga0070674_100073178 | 3300005356 | Bacteria | 2429 |
| 53 | Ga0070674_100960786 | 3300005356 | Bacteria | 748 |
| 54 | Ga0070674_101383304 | 3300005356 | Bacteria | 630 |
| 55 | Ga0070673_100121492 | 3300005364 | Bacteria | 2179 |
| 56 | Ga0070688_100666547 | 3300005365 | Bacteria | 802 |
| 57 | Ga0070659_100130430 | 3300005366 | Bacteria | 2041 |
| 58 | Ga0070659_100178220 | 3300005366 | Bacteria | 1743 |
| 59 | Ga0070667_100238828 | 3300005367 | Bacteria | 1622 |
| 60 | Ga0070667_100373763 | 3300005367 | Bacteria | 1294 |
| 61 | Ga0070667_100434140 | 3300005367 | Bacteria | 1199 |
| 62 | Ga0070709_10089746 | 3300005434 | Bacteria | 2024 |
| 63 | Ga0070709_10195797 | 3300005434 | Bacteria | 1428 |
| 64 | Ga0070709_10266605 | 3300005434 | Bacteria | 1239 |
| 65 | Ga0070714_100010968 | 3300005435 | Bacteria | 7178 |
| 66 | Ga0070714_100085432 | 3300005435 | Bacteria | 2756 |
| 67 | Ga0070714_100219711 | 3300005435 | Bacteria | 1746 |
| 68 | Ga0070714_100282170 | 3300005435 | Bacteria | 1543 |
| 69 | Ga0070714_100343810 | 3300005435 | Bacteria | 1400 |
| 70 | Ga0070714_100456387 | 3300005435 | Bacteria | 1214 |
| 71 | Ga0070714_100484702 | 3300005435 | Bacteria | 1178 |
| 72 | Ga0070714_100745686 | 3300005435 | Bacteria | 946 |
| 73 | Ga0070714_100897474 | 3300005435 | Bacteria | 860 |
| 74 | Ga0070713_100066279 | 3300005436 | Bacteria | 3036 |
| 75 | Ga0070713_100097647 | 3300005436 | Bacteria | 2539 |
| 76 | Ga0070713_100324547 | 3300005436 | Bacteria | 1422 |
| 77 | Ga0070713_100443980 | 3300005436 | Bacteria | 1217 |
| 78 | Ga0070713_100547427 | 3300005436 | Bacteria | 1095 |
| 79 | Ga0070713_100714225 | 3300005436 | Bacteria | 957 |
| 80 | Ga0070713_100886238 | 3300005436 | Bacteria | 858 |
| 81 | Ga0070710_10010220 | 3300005437 | Bacteria | 4606 |
| 82 | Ga0070710_10025021 | 3300005437 | Bacteria | 3156 |
| 83 | Ga0070710_10038180 | 3300005437 | Bacteria | 2636 |
| 84 | Ga0070710_10123243 | 3300005437 | Bacteria | 1571 |
| 85 | Ga0070710_10224077 | 3300005437 | Bacteria | 1197 |
| 86 | Ga0070710_10250867 | 3300005437 | Bacteria | 1137 |
| 87 | Ga0070710_10259639 | 3300005437 | Bacteria | 1120 |
| 88 | Ga0070710_11085554 | 3300005437 | Bacteria | 587 |
| 89 | Ga0070701_10057036 | 3300005438 | Bacteria | 2046 |
| 90 | Ga0070701_10094393 | 3300005438 | Bacteria | 1645 |
| 91 | Ga0070711_100093981 | 3300005439 | Bacteria | 2167 |
| 92 | Ga0070711_100378670 | 3300005439 | Bacteria | 1144 |
| 93 | Ga0070711_100445242 | 3300005439 | Bacteria | 1059 |
| 94 | Ga0070711_100836482 | 3300005439 | Bacteria | 782 |
| 95 | Ga0070711_100950369 | 3300005439 | Bacteria | 735 |
| 96 | Ga0070705_100756102 | 3300005440 | Bacteria | 769 |
| 97 | Ga0070700_100136296 | 3300005441 | Bacteria | 1662 |
| 98 | Ga0070700_100301955 | 3300005441 | Bacteria | 1169 |
| 99 | Ga0070700_100637938 | 3300005441 | Bacteria | 839 |
| 100 | Ga0070694_100085169 | 3300005444 | Bacteria | 2206 |
| 101 | Ga0070708_100067758 | 3300005445 | Bacteria | 3206 |
| 102 | Ga0070708_100235526 | 3300005445 | Bacteria | 1718 |
| 103 | Ga0070708_100282789 | 3300005445 | Bacteria | 1561 |
| 104 | Ga0070708_100344647 | 3300005445 | Bacteria | 1404 |
| 105 | Ga0070708_100770854 | 3300005445 | Bacteria | 904 |
| 106 | Ga0070708_101327390 | 3300005445 | Bacteria | 672 |
| 107 | Ga0070663_100071242 | 3300005455 | Bacteria | 2529 |
| 108 | Ga0070663_100084123 | 3300005455 | Bacteria | 2344 |
| 109 | Ga0070663_101133845 | 3300005455 | Bacteria | 685 |
| 110 | Ga0070678_100058826 | 3300005456 | Bacteria | 2822 |
| 111 | Ga0070662_101194932 | 3300005457 | Bacteria | 654 |
| 112 | Ga0070685_10081386 | 3300005466 | Bacteria | 1942 |
| 113 | Ga0070685_10125327 | 3300005466 | Bacteria | 1599 |
| 114 | Ga0070685_10293079 | 3300005466 | Bacteria | 1094 |
| 115 | Ga0070685_10359573 | 3300005466 | Bacteria | 998 |
| 116 | Ga0070706_100014528 | 3300005467 | Bacteria | 7274 |
| 117 | Ga0070706_100020291 | 3300005467 | Bacteria | 6124 |
| 118 | Ga0070706_100061918 | 3300005467 | Bacteria | 3456 |
| 119 | Ga0070706_100121825 | 3300005467 | Bacteria | 2431 |
| 120 | Ga0070706_100369843 | 3300005467 | Bacteria | 1335 |
| 121 | Ga0070706_100375891 | 3300005467 | Bacteria | 1323 |
| 122 | Ga0070706_100508414 | 3300005467 | Bacteria | 1121 |
| 123 | Ga0070706_100934721 | 3300005467 | Bacteria | 800 |
| 124 | Ga0070707_100008637 | 3300005468 | Bacteria | 9452 |
| 125 | Ga0070707_100032225 | 3300005468 | Bacteria | 4992 |
| 126 | Ga0070707_100063807 | 3300005468 | Bacteria | 3535 |
| 127 | Ga0070707_100574495 | 3300005468 | Bacteria | 1090 |
| 128 | Ga0070707_100855700 | 3300005468 | Bacteria | 873 |
| 129 | Ga0070707_100868332 | 3300005468 | Bacteria | 866 |
| 130 | Ga0070707_100905693 | 3300005468 | Bacteria | 846 |
| 131 | Ga0070698_100000308 | 3300005471 | Bacteria | 49751 |
| 132 | Ga0070698_100101305 | 3300005471 | Bacteria | 2851 |
| 133 | Ga0070698_100164232 | 3300005471 | Bacteria | 2163 |
| 134 | Ga0070698_100189813 | 3300005471 | Bacteria | 1993 |
| 135 | Ga0070698_100214794 | 3300005471 | Bacteria | 1857 |
| 136 | Ga0070698_100348892 | 3300005471 | Bacteria | 1411 |
| 137 | Ga0070698_100551986 | 3300005471 | Bacteria | 1091 |
| 138 | Ga0070699_100293372 | 3300005518 | Bacteria | 1458 |
| 139 | Ga0070699_100447674 | 3300005518 | Bacteria | 1171 |
| 140 | Ga0070699_100516626 | 3300005518 | Bacteria | 1085 |
| 141 | Ga0070699_100784151 | 3300005518 | Bacteria | 872 |
| 142 | Ga0070699_101124410 | 3300005518 | Bacteria | 721 |
| 143 | Ga0070679_100306096 | 3300005530 | Bacteria | 1539 |
| 144 | Ga0070684_100328046 | 3300005535 | Bacteria | 1406 |
| 145 | Ga0070684_100570997 | 3300005535 | Bacteria | 1050 |
| 146 | Ga0070684_101073271 | 3300005535 | Bacteria | 756 |
| 147 | Ga0070684_101299886 | 3300005535 | Bacteria | 684 |
| 148 | Ga0070684_101410953 | 3300005535 | Bacteria | 656 |
| 149 | Ga0070697_100004980 | 3300005536 | Bacteria | 10196 |
| 150 | Ga0070697_100005122 | 3300005536 | Bacteria | 10067 |
| 151 | Ga0070697_101253910 | 3300005536 | Bacteria | 661 |
| 152 | Ga0068853_100197362 | 3300005539 | Bacteria | 1830 |
| 153 | Ga0068853_100309321 | 3300005539 | Bacteria | 1462 |
| 154 | Ga0068853_101578733 | 3300005539 | Bacteria | 636 |
| 155 | Ga0070672_100585599 | 3300005543 | Bacteria | 971 |
| 156 | Ga0070686_100067208 | 3300005544 | Bacteria | 2334 |
| 157 | Ga0070686_100112399 | 3300005544 | Bacteria | 1858 |
| 158 | Ga0070686_100214821 | 3300005544 | Bacteria | 1387 |
| 159 | Ga0070696_100093758 | 3300005546 | Bacteria | 2141 |
| 160 | Ga0070696_100097333 | 3300005546 | Bacteria | 2104 |
| 161 | Ga0070693_100187885 | 3300005547 | Bacteria | 1334 |
| 162 | Ga0070693_100270120 | 3300005547 | Bacteria | 1135 |
| 163 | Ga0070693_100527194 | 3300005547 | Bacteria | 842 |
| 164 | Ga0070665_100015619 | 3300005548 | Bacteria | 7626 |
| 165 | Ga0070665_100308847 | 3300005548 | Bacteria | 1585 |
| 166 | Ga0070665_100366743 | 3300005548 | Bacteria | 1447 |
| 167 | Ga0070665_100472572 | 3300005548 | Bacteria | 1264 |
| 168 | Ga0070665_100480081 | 3300005548 | Bacteria | 1254 |
| 169 | Ga0070665_100698090 | 3300005548 | Bacteria | 1028 |
| 170 | Ga0070665_100752493 | 3300005548 | Bacteria | 987 |
| 171 | Ga0070665_100903229 | 3300005548 | Bacteria | 896 |
| 172 | Ga0070665_101214992 | 3300005548 | Bacteria | 764 |
| 173 | Ga0070704_100166852 | 3300005549 | Bacteria | 1747 |
| 174 | Ga0068855_100315232 | 3300005563 | Bacteria | 1730 |
| 175 | Ga0068855_102102916 | 3300005563 | Bacteria | 568 |
| 176 | Ga0070664_100058853 | 3300005564 | Bacteria | 3268 |
| 177 | Ga0070664_100393262 | 3300005564 | Bacteria | 1267 |
| 178 | Ga0070664_100498746 | 3300005564 | Bacteria | 1122 |
| 179 | Ga0070664_101563227 | 3300005564 | Bacteria | 624 |
| 180 | Ga0068857_100146134 | 3300005577 | Bacteria | 2139 |
| 181 | Ga0068857_101723658 | 3300005577 | Bacteria | 613 |
| 182 | Ga0068854_100067452 | 3300005578 | Bacteria | 2606 |
| 183 | Ga0068854_100123082 | 3300005578 | Bacteria | 1972 |
| 184 | Ga0068854_100188554 | 3300005578 | Bacteria | 1615 |
| 185 | Ga0068856_100089102 | 3300005614 | Bacteria | 3068 |
| 186 | Ga0068856_100208657 | 3300005614 | Bacteria | 1968 |
| 187 | Ga0068856_100380665 | 3300005614 | Bacteria | 1430 |
| 188 | Ga0068856_100385112 | 3300005614 | Bacteria | 1422 |
| 189 | Ga0068856_100553582 | 3300005614 | Bacteria | 1171 |
| 190 | Ga0068856_101680397 | 3300005614 | Bacteria | 647 |
| 191 | Ga0070702_100098795 | 3300005615 | Bacteria | 1786 |
| 192 | Ga0068852_100023215 | 3300005616 | Bacteria | 4989 |
| 193 | Ga0068852_100727427 | 3300005616 | Bacteria | 1004 |
| 194 | Ga0068859_100090223 | 3300005617 | Bacteria | 3116 |
| 195 | Ga0068864_100259012 | 3300005618 | Bacteria | 1617 |
| 196 | Ga0068864_100338043 | 3300005618 | Bacteria | 1418 |
| 197 | Ga0068864_100426400 | 3300005618 | Bacteria | 1264 |
| 198 | Ga0068864_100849294 | 3300005618 | Bacteria | 899 |
| 199 | Ga0068866_10034753 | 3300005718 | Bacteria | 2457 |
| 200 | Ga0068861_100144239 | 3300005719 | Bacteria | 1947 |
| 201 | Ga0068861_101188824 | 3300005719 | Bacteria | 737 |
| 202 | Ga0068851_10076079 | 3300005834 | Bacteria | 1745 |
| 203 | Ga0068851_10337054 | 3300005834 | Bacteria | 875 |
| 204 | Ga0068870_10064193 | 3300005840 | Bacteria | 1983 |
| 205 | Ga0068870_10088250 | 3300005840 | Bacteria | 1728 |
| 206 | Ga0068870_10290919 | 3300005840 | Bacteria | 1028 |
| 207 | Ga0068870_10395839 | 3300005840 | Bacteria | 898 |
| 208 | Ga0068863_100050833 | 3300005841 | Bacteria | 3928 |
| 209 | Ga0068863_100151463 | 3300005841 | Bacteria | 2219 |
| 210 | Ga0068863_100267518 | 3300005841 | Bacteria | 1654 |
| 211 | Ga0068863_100425178 | 3300005841 | Bacteria | 1302 |
| 212 | Ga0068863_101476785 | 3300005841 | Bacteria | 688 |
| 213 | Ga0068858_100141636 | 3300005842 | Bacteria | 2257 |
| 214 | Ga0068858_100203922 | 3300005842 | Bacteria | 1871 |
| 215 | Ga0068860_100053636 | 3300005843 | Bacteria | 3833 |
| 216 | Ga0068860_100536568 | 3300005843 | Bacteria | 1171 |
| 217 | Ga0068860_102601993 | 3300005843 | Bacteria | 525 |
| 218 | Ga0068862_100198562 | 3300005844 | Bacteria | 1808 |
| 219 | Ga0068862_101111707 | 3300005844 | Bacteria | 786 |
| 220 | Ga0081540_1001418 | 3300005983 | Bacteria | 20736 |
| 221 | Ga0070717_10004588 | 3300006028 | Bacteria | 10003 |
| 222 | Ga0070717_10118622 | 3300006028 | Bacteria | 2264 |
| 223 | Ga0070717_10297442 | 3300006028 | Bacteria | 1434 |
| 224 | Ga0070717_10385994 | 3300006028 | Bacteria | 1256 |
| 225 | Ga0070717_10391053 | 3300006028 | Bacteria | 1248 |
| 226 | Ga0070717_10486228 | 3300006028 | Bacteria | 1115 |
| 227 | Ga0070717_10557928 | 3300006028 | Bacteria | 1037 |
| 228 | Ga0070717_10861681 | 3300006028 | Bacteria | 824 |
| 229 | Ga0070717_11891003 | 3300006028 | Bacteria | 539 |
| 230 | Ga0075432_10143774 | 3300006058 | Bacteria | 912 |
| 231 | Ga0070715_10007549 | 3300006163 | Bacteria | 3748 |
| 232 | Ga0070715_10032347 | 3300006163 | Bacteria | 2130 |
| 233 | Ga0070715_10061303 | 3300006163 | Bacteria | 1651 |
| 234 | Ga0070716_100027939 | 3300006173 | Bacteria | 3036 |
| 235 | Ga0070712_100046024 | 3300006175 | Bacteria | 3015 |
| 236 | Ga0070712_100180523 | 3300006175 | Bacteria | 1644 |
| 237 | Ga0070712_100571476 | 3300006175 | Bacteria | 954 |
| 238 | Ga0070712_101139784 | 3300006175 | Bacteria | 677 |
| 239 | Ga0097621_100084496 | 3300006237 | Bacteria | 2646 |
| 240 | Ga0097621_100313178 | 3300006237 | Bacteria | 1389 |
| 241 | Ga0097621_100360564 | 3300006237 | Bacteria | 1295 |
| 242 | Ga0097621_100533450 | 3300006237 | Bacteria | 1067 |
| 243 | Ga0068871_100099025 | 3300006358 | Bacteria | 2440 |
| 244 | Ga0068871_100223692 | 3300006358 | Bacteria | 1631 |
| 245 | Ga0075433_10035089 | 3300006852 | Bacteria | 4311 |
| 246 | Ga0075433_10584660 | 3300006852 | Bacteria | 981 |
| 247 | Ga0075433_10649805 | 3300006852 | Bacteria | 925 |
| 248 | Ga0075434_100036726 | 3300006871 | Bacteria | 4846 |
| 249 | Ga0075434_100103356 | 3300006871 | Bacteria | 2857 |
| 250 | Ga0075434_101772673 | 3300006871 | Bacteria | 624 |
| 251 | Ga0068865_100143391 | 3300006881 | Bacteria | 1803 |
| 252 | Ga0075436_100019486 | 3300006914 | Bacteria | 4649 |
| 253 | Ga0075436_100849045 | 3300006914 | Bacteria | 681 |
| 254 | Ga0075436_101314648 | 3300006914 | Bacteria | 547 |
| 255 | Ga0097620_100090221 | 3300006931 | Bacteria | 3116 |
| 256 | Ga0075435_100042367 | 3300007076 | Bacteria | 3642 |
| 257 | Ga0075435_100044934 | 3300007076 | Bacteria | 3539 |
| 258 | Ga0075435_101242608 | 3300007076 | Bacteria | 652 |
| 259 | Ga0075435_101343885 | 3300007076 | Bacteria | 626 |
| 260 | Ga0099794_10124513 | 3300007265 | Bacteria | 1299 |
| 261 | Ga0105251_10054880 | 3300009011 | Bacteria | 1890 |
| 262 | Ga0105240_10654932 | 3300009093 | Bacteria | 1151 |
| 263 | Ga0105240_11234018 | 3300009093 | Bacteria | 791 |
| 264 | Ga0111539_10276078 | 3300009094 | Bacteria | 1956 |
| 265 | Ga0111539_10307871 | 3300009094 | Bacteria | 1844 |
| 266 | Ga0111539_11437839 | 3300009094 | Bacteria | 800 |
| 267 | Ga0105245_10084613 | 3300009098 | Bacteria | 2906 |
| 268 | Ga0105245_10327120 | 3300009098 | Bacteria | 1512 |
| 269 | Ga0105245_10939064 | 3300009098 | Bacteria | 908 |
| 270 | Ga0105247_10115558 | 3300009101 | Bacteria | 1732 |
| 271 | Ga0105247_10305072 | 3300009101 | Bacteria | 1106 |
| 272 | Ga0105247_10428711 | 3300009101 | Bacteria | 948 |
| 273 | Ga0105243_10972136 | 3300009148 | Bacteria | 850 |
| 274 | Ga0105241_10145741 | 3300009174 | Bacteria | 1932 |
| 275 | Ga0105241_11388256 | 3300009174 | Bacteria | 672 |
| 276 | Ga0105248_11611908 | 3300009177 | Bacteria | 735 |
| 277 | Ga0105248_12166737 | 3300009177 | Bacteria | 632 |
| 278 | Ga0105237_10213237 | 3300009545 | Bacteria | 1930 |
| 279 | Ga0105237_10822384 | 3300009545 | Bacteria | 936 |
| 280 | Ga0105238_10129854 | 3300009551 | Bacteria | 2498 |
| 281 | Ga0105249_10041106 | 3300009553 | Bacteria | 4202 |
| 282 | Ga0105249_10496493 | 3300009553 | Bacteria | 1265 |
| 283 | Ga0105249_12533046 | 3300009553 | Bacteria | 585 |
| 284 | Ga0099796_10053526 | 3300010159 | Bacteria | 1408 |
| 285 | Ga0105239_10259912 | 3300010375 | Bacteria | 1951 |
| 286 | Ga0105239_10528798 | 3300010375 | Bacteria | 1342 |
| 287 | Ga0105239_10957648 | 3300010375 | Bacteria | 983 |
| 288 | Ga0105246_10077914 | 3300011119 | Bacteria | 2353 |
| 289 | Ga0105246_10728530 | 3300011119 | Bacteria | 872 |
| 290 | Ga0105246_11690965 | 3300011119 | Bacteria | 601 |
| 291 | Ga0105246_11897251 | 3300011119 | Bacteria | 572 |
| 292 | Ga0157343_1005703 | 3300012488 | Bacteria | 817 |
| 293 | Ga0157314_1005099 | 3300012500 | Bacteria | 988 |
| 294 | Ga0157347_1008417 | 3300012502 | Bacteria | 1048 |
| 295 | Ga0157313_1015068 | 3300012503 | Bacteria | 722 |
| 296 | Ga0157342_1004643 | 3300012507 | Bacteria | 1229 |
| 297 | Ga0157316_1021675 | 3300012510 | Bacteria | 708 |
| 298 | Ga0157338_1007878 | 3300012515 | Bacteria | 1020 |
| 299 | Ga0157373_10103326 | 3300013100 | Bacteria | 2004 |
| 300 | Ga0157371_10039209 | 3300013102 | Bacteria | 3387 |
| 301 | Ga0157371_10210603 | 3300013102 | Bacteria | 1395 |
| 302 | Ga0157369_10039494 | 3300013105 | Bacteria | 5157 |
| 303 | Ga0157369_10187760 | 3300013105 | Bacteria | 2173 |
| 304 | Ga0157369_10219124 | 3300013105 | Bacteria | 1992 |
| 305 | Ga0157369_10846810 | 3300013105 | Bacteria | 939 |
| 306 | Ga0157369_10851300 | 3300013105 | Bacteria | 936 |
| 307 | Ga0157369_10869402 | 3300013105 | Bacteria | 925 |
| 308 | Ga0157369_11083434 | 3300013105 | Bacteria | 819 |
| 309 | Ga0157374_11015790 | 3300013296 | Bacteria | 849 |
| 310 | Ga0157378_10965584 | 3300013297 | Bacteria | 885 |
| 311 | Ga0157378_12044892 | 3300013297 | Bacteria | 623 |
| 312 | Ga0163162_10258861 | 3300013306 | Bacteria | 1872 |
| 313 | Ga0163162_11027732 | 3300013306 | Bacteria | 932 |
| 314 | Ga0157372_10075612 | 3300013307 | Bacteria | 3800 |
| 315 | Ga0157372_10311525 | 3300013307 | Bacteria | 1832 |
| 316 | Ga0157372_11945606 | 3300013307 | Bacteria | 676 |
| 317 | Ga0157375_10304650 | 3300013308 | Bacteria | 1757 |
| 318 | Ga0157375_10620938 | 3300013308 | Bacteria | 1239 |
| 319 | Ga0157375_10959864 | 3300013308 | Bacteria | 996 |
| 320 | Ga0157375_11735641 | 3300013308 | Bacteria | 739 |
| 321 | Ga0157375_11754759 | 3300013308 | Bacteria | 735 |
| 322 | Ga0163163_10080889 | 3300014325 | Bacteria | 3250 |
| 323 | Ga0163163_10421235 | 3300014325 | Bacteria | 1394 |
| 324 | Ga0163163_10445921 | 3300014325 | Bacteria | 1354 |
| 325 | Ga0163163_10446241 | 3300014325 | Bacteria | 1354 |
| 326 | Ga0163163_12411555 | 3300014325 | Bacteria | 584 |
| 327 | Ga0163163_12918918 | 3300014325 | Bacteria | 533 |
| 328 | Ga0157380_10019892 | 3300014326 | Bacteria | 5009 |
| 329 | Ga0157380_10918064 | 3300014326 | Bacteria | 903 |
| 330 | Ga0182008_10311211 | 3300014497 | Bacteria | 826 |
| 331 | Ga0157377_10042907 | 3300014745 | Bacteria | 2514 |
| 332 | Ga0157377_10126583 | 3300014745 | Bacteria | 1555 |
| 333 | Ga0157379_10363521 | 3300014968 | Bacteria | 1326 |
| 334 | Ga0157379_10410016 | 3300014968 | Bacteria | 1247 |
| 335 | Ga0157379_10933670 | 3300014968 | Bacteria | 824 |
| 336 | Ga0157379_11161452 | 3300014968 | Bacteria | 741 |
| 337 | Ga0157376_10997969 | 3300014969 | Bacteria | 859 |
| 338 | Ga0157376_11043053 | 3300014969 | Bacteria | 842 |
| 339 | Ga0157376_11453371 | 3300014969 | Bacteria | 718 |
| 340 | Ga0163161_10053874 | 3300017792 | Bacteria | 2918 |
| 341 | Ga0206356_10642078 | 3300020070 | Bacteria | 2302 |
| 342 | Ga0206354_10265570 | 3300020081 | Bacteria | 519 |
| 343 | Ga0206354_10793134 | 3300020081 | Bacteria | 2531 |
| 344 | Ga0206353_11413974 | 3300020082 | Bacteria | 1606 |
| 345 | Ga0213872_10234874 | 3300021361 | Bacteria | 777 |
| 346 | Ga0213874_10045451 | 3300021377 | Bacteria | 1329 |
| 347 | Ga0213874_10211796 | 3300021377 | Bacteria | 701 |
| 348 | Ga0213876_10036362 | 3300021384 | Bacteria | 2597 |
| 349 | Ga0213875_10001142 | 3300021388 | Bacteria | 18252 |
| 350 | Ga0213875_10045334 | 3300021388 | Bacteria | 2064 |
| 351 | Ga0213875_10052591 | 3300021388 | Bacteria | 1908 |
| 352 | Ga0213875_10058196 | 3300021388 | Bacteria | 1809 |
| 353 | Ga0224712_10061690 | 3300022467 | Bacteria | 1496 |
| 354 | Ga0224712_10233497 | 3300022467 | Bacteria | 845 |
| 355 | Ga0228598_1018484 | 3300024227 | Bacteria | 1375 |
| 356 | Ga0228598_1071779 | 3300024227 | Bacteria | 692 |
| 357 | Ga0207653_10010804 | 3300025885 | Bacteria | 2848 |
| 358 | Ga0207692_10004053 | 3300025898 | Bacteria | 5774 |
| 359 | Ga0207692_10040924 | 3300025898 | Bacteria | 2290 |
| 360 | Ga0207692_10071650 | 3300025898 | Bacteria | 1828 |
| 361 | Ga0207642_10073402 | 3300025899 | Bacteria | 1636 |
| 362 | Ga0207642_10303438 | 3300025899 | Bacteria | 926 |
| 363 | Ga0207710_10079641 | 3300025900 | Bacteria | 1518 |
| 364 | Ga0207688_10007772 | 3300025901 | Bacteria | 5838 |
| 365 | Ga0207688_10045836 | 3300025901 | Bacteria | 2440 |
| 366 | Ga0207688_10157397 | 3300025901 | Bacteria | 1345 |
| 367 | Ga0207680_10784292 | 3300025903 | Bacteria | 683 |
| 368 | Ga0207647_10057589 | 3300025904 | Bacteria | 2382 |
| 369 | Ga0207647_10256929 | 3300025904 | Bacteria | 1001 |
| 370 | Ga0207699_10044202 | 3300025906 | Bacteria | 2592 |
| 371 | Ga0207699_10073928 | 3300025906 | Bacteria | 2092 |
| 372 | Ga0207699_10079456 | 3300025906 | Bacteria | 2029 |
| 373 | Ga0207699_10180052 | 3300025906 | Bacteria | 1420 |
| 374 | Ga0207699_10429931 | 3300025906 | Bacteria | 944 |
| 375 | Ga0207699_10845814 | 3300025906 | Bacteria | 674 |
| 376 | Ga0207645_10013813 | 3300025907 | Bacteria | 5420 |
| 377 | Ga0207645_10053173 | 3300025907 | Bacteria | 2588 |
| 378 | Ga0207643_10076171 | 3300025908 | Bacteria | 1937 |
| 379 | Ga0207643_10383788 | 3300025908 | Bacteria | 886 |
| 380 | Ga0207705_10121471 | 3300025909 | Bacteria | 1939 |
| 381 | Ga0207684_10003200 | 3300025910 | Bacteria | 16082 |
| 382 | Ga0207684_10020102 | 3300025910 | Bacteria | 5704 |
| 383 | Ga0207684_10077003 | 3300025910 | Bacteria | 2835 |
| 384 | Ga0207684_10094850 | 3300025910 | Bacteria | 2545 |
| 385 | Ga0207684_10606029 | 3300025910 | Bacteria | 935 |
| 386 | Ga0207684_10885432 | 3300025910 | Bacteria | 751 |
| 387 | Ga0207654_10800665 | 3300025911 | Bacteria | 681 |
| 388 | Ga0207654_10897858 | 3300025911 | Bacteria | 642 |
| 389 | Ga0207654_11189221 | 3300025911 | Bacteria | 556 |
| 390 | Ga0207707_10101703 | 3300025912 | Bacteria | 2512 |
| 391 | Ga0207671_10963621 | 3300025914 | Bacteria | 673 |
| 392 | Ga0207693_10011756 | 3300025915 | Bacteria | 7075 |
| 393 | Ga0207693_10056576 | 3300025915 | Bacteria | 3075 |
| 394 | Ga0207693_10059120 | 3300025915 | Bacteria | 3002 |
| 395 | Ga0207663_10114576 | 3300025916 | Bacteria | 1835 |
| 396 | Ga0207663_10131176 | 3300025916 | Bacteria | 1732 |
| 397 | Ga0207663_10144604 | 3300025916 | Bacteria | 1661 |
| 398 | Ga0207663_10190152 | 3300025916 | Bacteria | 1473 |
| 399 | Ga0207663_10347975 | 3300025916 | Bacteria | 1121 |
| 400 | Ga0207663_10847353 | 3300025916 | Bacteria | 729 |
| 401 | Ga0207660_10192159 | 3300025917 | Bacteria | 1590 |
| 402 | Ga0207662_10002144 | 3300025918 | Bacteria | 9824 |
| 403 | Ga0207662_10045119 | 3300025918 | Bacteria | 2605 |
| 404 | Ga0207657_10015479 | 3300025919 | Bacteria | 7389 |
| 405 | Ga0207657_10023888 | 3300025919 | Bacteria | 5678 |
| 406 | Ga0207649_10406832 | 3300025920 | Bacteria | 1019 |
| 407 | Ga0207646_10005011 | 3300025922 | Bacteria | 14111 |
| 408 | Ga0207646_10112534 | 3300025922 | Bacteria | 2443 |
| 409 | Ga0207646_10271339 | 3300025922 | Bacteria | 1533 |
| 410 | Ga0207646_10396792 | 3300025922 | Bacteria | 1246 |
| 411 | Ga0207646_10400802 | 3300025922 | Bacteria | 1239 |
| 412 | Ga0207646_10481015 | 3300025922 | Bacteria | 1119 |
| 413 | Ga0207646_10545398 | 3300025922 | Bacteria | 1043 |
| 414 | Ga0207681_10132749 | 3300025923 | Bacteria | 1843 |
| 415 | Ga0207659_10333269 | 3300025926 | Bacteria | 1255 |
| 416 | Ga0207659_11039468 | 3300025926 | Bacteria | 705 |
| 417 | Ga0207687_10045231 | 3300025927 | Bacteria | 3042 |
| 418 | Ga0207687_10276077 | 3300025927 | Bacteria | 1345 |
| 419 | Ga0207700_10135686 | 3300025928 | Bacteria | 2015 |
| 420 | Ga0207700_10224393 | 3300025928 | Bacteria | 1594 |
| 421 | Ga0207700_10226535 | 3300025928 | Bacteria | 1587 |
| 422 | Ga0207700_10234458 | 3300025928 | Bacteria | 1562 |
| 423 | Ga0207700_10305846 | 3300025928 | Bacteria | 1374 |
| 424 | Ga0207700_10334989 | 3300025928 | Bacteria | 1314 |
| 425 | Ga0207700_10577756 | 3300025928 | Bacteria | 999 |
| 426 | Ga0207700_10689956 | 3300025928 | Bacteria | 911 |
| 427 | Ga0207700_10854659 | 3300025928 | Bacteria | 814 |
| 428 | Ga0207700_10871614 | 3300025928 | Bacteria | 806 |
| 429 | Ga0207664_10014609 | 3300025929 | Bacteria | 5678 |
| 430 | Ga0207664_10022615 | 3300025929 | Bacteria | 4699 |
| 431 | Ga0207664_10042704 | 3300025929 | Bacteria | 3541 |
| 432 | Ga0207664_10045230 | 3300025929 | Bacteria | 3451 |
| 433 | Ga0207664_10223400 | 3300025929 | Bacteria | 1634 |
| 434 | Ga0207664_10460867 | 3300025929 | Bacteria | 1135 |
| 435 | Ga0207664_10921506 | 3300025929 | Bacteria | 784 |
| 436 | Ga0207664_11824816 | 3300025929 | Bacteria | 531 |
| 437 | Ga0207644_10013700 | 3300025931 | Bacteria | 5412 |
| 438 | Ga0207644_10218922 | 3300025931 | Bacteria | 1508 |
| 439 | Ga0207644_10886441 | 3300025931 | Bacteria | 748 |
| 440 | Ga0207690_11457995 | 3300025932 | Bacteria | 572 |
| 441 | Ga0207706_10014518 | 3300025933 | Bacteria | 7139 |
| 442 | Ga0207706_10020900 | 3300025933 | Bacteria | 5878 |
| 443 | Ga0207706_10749861 | 3300025933 | Bacteria | 832 |
| 444 | Ga0207686_10545499 | 3300025934 | Bacteria | 906 |
| 445 | Ga0207709_10338926 | 3300025935 | Bacteria | 1131 |
| 446 | Ga0207669_10529025 | 3300025937 | Bacteria | 948 |
| 447 | Ga0207669_10822733 | 3300025937 | Bacteria | 771 |
| 448 | Ga0207669_11132866 | 3300025937 | Bacteria | 661 |
| 449 | Ga0207704_11144556 | 3300025938 | Bacteria | 662 |
| 450 | Ga0207665_10017424 | 3300025939 | Bacteria | 4720 |
| 451 | Ga0207665_10023191 | 3300025939 | Bacteria | 4088 |
| 452 | Ga0207691_10063086 | 3300025940 | Bacteria | 3361 |
| 453 | Ga0207691_10144081 | 3300025940 | Bacteria | 2098 |
| 454 | Ga0207711_10648251 | 3300025941 | Bacteria | 985 |
| 455 | Ga0207689_10005167 | 3300025942 | Bacteria | 11725 |
| 456 | Ga0207689_10092506 | 3300025942 | Bacteria | 2484 |
| 457 | Ga0207689_10287121 | 3300025942 | Bacteria | 1363 |
| 458 | Ga0207689_10734424 | 3300025942 | Bacteria | 833 |
| 459 | Ga0207661_10623231 | 3300025944 | Bacteria | 991 |
| 460 | Ga0207661_10876822 | 3300025944 | Bacteria | 826 |
| 461 | Ga0207679_10034943 | 3300025945 | Bacteria | 3552 |
| 462 | Ga0207679_11077229 | 3300025945 | Bacteria | 737 |
| 463 | Ga0207667_10100747 | 3300025949 | Bacteria | 2980 |
| 464 | Ga0207667_11069387 | 3300025949 | Bacteria | 791 |
| 465 | Ga0207651_10334335 | 3300025960 | Bacteria | 1271 |
| 466 | Ga0207651_10607282 | 3300025960 | Bacteria | 957 |
| 467 | Ga0207712_10886559 | 3300025961 | Bacteria | 788 |
| 468 | Ga0207668_10770099 | 3300025972 | Bacteria | 850 |
| 469 | Ga0207668_11511063 | 3300025972 | Bacteria | 606 |
| 470 | Ga0207640_10198576 | 3300025981 | Bacteria | 1518 |
| 471 | Ga0207640_10283131 | 3300025981 | Bacteria | 1303 |
| 472 | Ga0207640_10311143 | 3300025981 | Bacteria | 1250 |
| 473 | Ga0207658_10091859 | 3300025986 | Bacteria | 2357 |
| 474 | Ga0207658_10871532 | 3300025986 | Bacteria | 819 |
| 475 | Ga0207677_10421295 | 3300026023 | Bacteria | 1137 |
| 476 | Ga0207677_10907012 | 3300026023 | Bacteria | 795 |
| 477 | Ga0207703_10885744 | 3300026035 | Bacteria | 854 |
| 478 | Ga0207639_10331386 | 3300026041 | Bacteria | 1354 |
| 479 | Ga0207639_10839814 | 3300026041 | Bacteria | 857 |
| 480 | Ga0207678_10016013 | 3300026067 | Bacteria | 6586 |
| 481 | Ga0207678_10112718 | 3300026067 | Bacteria | 2320 |
| 482 | Ga0207708_10017813 | 3300026075 | Bacteria | 5346 |
| 483 | Ga0207708_10032843 | 3300026075 | Bacteria | 3940 |
| 484 | Ga0207708_11276017 | 3300026075 | Bacteria | 643 |
| 485 | Ga0207702_10132402 | 3300026078 | Bacteria | 2245 |
| 486 | Ga0207702_10228150 | 3300026078 | Bacteria | 1739 |
| 487 | Ga0207702_10426448 | 3300026078 | Bacteria | 1283 |
| 488 | Ga0207641_10027486 | 3300026088 | Bacteria | 4699 |
| 489 | Ga0207641_10640357 | 3300026088 | Bacteria | 1043 |
| 490 | Ga0207641_11298905 | 3300026088 | Bacteria | 728 |
| 491 | Ga0207648_10089701 | 3300026089 | Bacteria | 2686 |
| 492 | Ga0207648_10871823 | 3300026089 | Bacteria | 840 |
| 493 | Ga0207648_11790044 | 3300026089 | Bacteria | 576 |
| 494 | Ga0207676_10418403 | 3300026095 | Bacteria | 1256 |
| 495 | Ga0207676_10650781 | 3300026095 | Bacteria | 1017 |
| 496 | Ga0207676_12175077 | 3300026095 | Bacteria | 553 |
| 497 | Ga0207674_10009354 | 3300026116 | Bacteria | 11212 |
| 498 | Ga0207674_10257954 | 3300026116 | Bacteria | 1690 |
| 499 | Ga0207674_10540600 | 3300026116 | Bacteria | 1126 |
| 500 | Ga0207674_10595912 | 3300026116 | Bacteria | 1067 |
| 501 | Ga0207675_100019761 | 3300026118 | Bacteria | 6288 |
| 502 | Ga0207675_100024633 | 3300026118 | Bacteria | 5595 |
| 503 | Ga0207683_10003875 | 3300026121 | Bacteria | 12975 |
| 504 | Ga0207683_10055388 | 3300026121 | Bacteria | 3477 |
| 505 | Ga0207683_10209191 | 3300026121 | Bacteria | 1775 |
| 506 | Ga0207683_10944602 | 3300026121 | Bacteria | 801 |
| 507 | Ga0207683_11268424 | 3300026121 | Bacteria | 682 |
| 508 | Ga0207698_10252216 | 3300026142 | Bacteria | 1615 |
| 509 | Ga0207428_10088366 | 3300027907 | Bacteria | 2410 |
| 510 | Ga0207428_10732624 | 3300027907 | Bacteria | 705 |
| 511 | Ga0268266_10045907 | 3300028379 | Bacteria | 3739 |
| 512 | Ga0268266_10256942 | 3300028379 | Bacteria | 1618 |
| 513 | Ga0268266_10421736 | 3300028379 | Bacteria | 1264 |
| 514 | Ga0268266_10542530 | 3300028379 | Bacteria | 1113 |
| 515 | Ga0268266_10798690 | 3300028379 | Bacteria | 911 |
| 516 | Ga0268265_11187905 | 3300028380 | Bacteria | 760 |
| 517 | Ga0268265_11413055 | 3300028380 | Bacteria | 698 |
| 518 | Ga0268264_10170508 | 3300028381 | Bacteria | 1968 |
| 519 | Ga0268264_10388922 | 3300028381 | Bacteria | 1337 |
| 520 | Ga0268264_11535869 | 3300028381 | Bacteria | 676 |
| 521 | Ga0268264_11624319 | 3300028381 | Bacteria | 657 |
| 522 | Ga0307513_10159162 | 3300031456 | Bacteria | 2153 |
| 523 | Ga0307408_100230070 | 3300031548 | Bacteria | 1518 |
| 524 | Ga0307410_10294707 | 3300031852 | Bacteria | 1278 |
| 525 | Ga0307410_10368141 | 3300031852 | Bacteria | 1153 |
| 526 | Ga0307410_10624912 | 3300031852 | Bacteria | 901 |
| 527 | Ga0307407_10717815 | 3300031903 | Bacteria | 754 |
| 528 | Ga0307409_100850988 | 3300031995 | Bacteria | 923 |
| 529 | Ga0307414_10157537 | 3300032004 | Bacteria | 1800 |
| 530 | Ga0307411_10195843 | 3300032005 | Bacteria | 1547 |
| 531 | Ga0307411_10368746 | 3300032005 | Bacteria | 1177 |
| 532 | Ga0307411_10439682 | 3300032005 | Bacteria | 1088 |
| 533 | Ga0307415_100041407 | 3300032126 | Bacteria | 3059 |
| 534 | Ga0373948_0003687 | 3300034817 | Bacteria | 2375 |
| 535 | Ga0373948_0053412 | 3300034817 | Bacteria | 873 |
| 536 | Ga0373950_0088072 | 3300034818 | Bacteria | 656 |
| 537 | Ga0373958_0176063 | 3300034819 | Bacteria | 549 |
| 538 | Ga0373938_0039601 | 3300034957 | Bacteria | 1043 |
| 539 | Ga0373926_0002520 | 3300035083 | Bacteria | 5818 |
| 540 | Ga0373926_0004166 | 3300035083 | Bacteria | 4716 |
| 541 | Ga0373928_0022469 | 3300035084 | Bacteria | 1338 |
| 542 | Ga0373929_0140969 | 3300035085 | Bacteria | 640 |
| 543 | Ga0373934_0000065 | 3300035086 | Bacteria | 35636 |
| 544 | Ga0373934_0042856 | 3300035086 | Bacteria | 1788 |
| 545 | Ga0373934_0044329 | 3300035086 | Bacteria | 1758 |
| 546 | Ga0373934_0137968 | 3300035086 | Bacteria | 996 |
| 547 | Ga0373934_0421338 | 3300035086 | Bacteria | 559 |
| 548 | Ga0373940_0001960 | 3300035088 | Bacteria | 3886 |
| 549 | Ga0373940_0059107 | 3300035088 | Bacteria | 1093 |
| 550 | Ga0373944_0000553 | 3300035089 | Bacteria | 8845 |
| 551 | Ga0373944_0001897 | 3300035089 | Bacteria | 5285 |
| 552 | Ga0373944_0024453 | 3300035089 | Bacteria | 1771 |
| 553 | Ga0373944_0093564 | 3300035089 | Bacteria | 1007 |
| 554 | Ga0373944_0153117 | 3300035089 | Bacteria | 814 |
| 555 | Ga0373944_0310731 | 3300035089 | Bacteria | 593 |
| 556 | Ga0373952_0099451 | 3300035092 | Bacteria | 766 |
| 557 | Ga0373923_0025669 | 3300035111 | Bacteria | 2338 |
| 558 | Ga0373923_0058965 | 3300035111 | Bacteria | 1626 |
| 559 | Ga0373923_0082972 | 3300035111 | Bacteria | 1392 |
| 560 | Ga0373923_0112828 | 3300035111 | Bacteria | 1208 |
| 561 | Ga0373923_0217771 | 3300035111 | Bacteria | 887 |
| 562 | Ga0373932_0333493 | 3300035112 | Bacteria | 573 |
| 563 | Ga0373936_0002649 | 3300035113 | Bacteria | 6698 |
| 564 | Ga0373936_0012075 | 3300035113 | Bacteria | 3280 |
| 565 | Ga0373936_0021757 | 3300035113 | Bacteria | 2494 |
| 566 | Ga0373936_0116916 | 3300035113 | Bacteria | 1136 |
| 567 | Ga0373936_0575465 | 3300035113 | Bacteria | 528 |
| 568 | Ga0373945_0000077 | 3300035116 | Bacteria | 22256 |
| 569 | Ga0373953_0000055 | 3300035117 | Bacteria | 28969 |
| 570 | Ga0373953_0004490 | 3300035117 | Bacteria | 4453 |
| 571 | Ga0373953_0065531 | 3300035117 | Bacteria | 1491 |
| 572 | Ga0373953_0088400 | 3300035117 | Bacteria | 1294 |
| 573 | Ga0373954_0017825 | 3300035118 | Bacteria | 3193 |
| 574 | Ga0373954_0022397 | 3300035118 | Bacteria | 2865 |
| 575 | Ga0373956_0000141 | 3300035119 | Bacteria | 26025 |
| 576 | Ga0373956_0009695 | 3300035119 | Bacteria | 3921 |
| 577 | Ga0373956_0080785 | 3300035119 | Bacteria | 1491 |
| 578 | Ga0373956_0281782 | 3300035119 | Bacteria | 791 |
| 579 | Ga0373957_0000093 | 3300035120 | Bacteria | 21429 |
| 580 | Ga0373957_0055231 | 3300035120 | Bacteria | 1526 |
| 581 | Ga0373957_0075711 | 3300035120 | Bacteria | 1322 |
| 582 | Ga0373957_0083588 | 3300035120 | Bacteria | 1262 |
| 583 | Ga0373957_0219676 | 3300035120 | Bacteria | 795 |
| 584 | Ga0373960_0223487 | 3300035121 | Bacteria | 674 |
| 585 | Ga0373960_0432631 | 3300035121 | Bacteria | 513 |
| 586 | Ga0373943_0000164 | 3300035170 | Bacteria | 25955 |
| 587 | Ga0373943_0003174 | 3300035170 | Bacteria | 7462 |
| 588 | Ga0373943_0029808 | 3300035170 | Bacteria | 2579 |
| 589 | Ga0373943_0128150 | 3300035170 | Bacteria | 1356 |
| 590 | Ga0373943_0136585 | 3300035170 | Bacteria | 1317 |
| 591 | Ga0373946_0002495 | 3300035171 | Bacteria | 6499 |
| 592 | Ga0373946_0047922 | 3300035171 | Bacteria | 1776 |
| 593 | Ga0373946_0163571 | 3300035171 | Bacteria | 1046 |
| 594 | Ga0373946_0224305 | 3300035171 | Bacteria | 908 |
| 595 | Ga0373955_0000207 | 3300035172 | Bacteria | 24476 |
| 596 | Ga0373955_0007999 | 3300035172 | Bacteria | 4887 |
| 597 | Ga0373955_0035209 | 3300035172 | Bacteria | 2650 |
| 598 | Ga0373955_0093255 | 3300035172 | Bacteria | 1719 |
| 599 | Ga0373955_0158483 | 3300035172 | Bacteria | 1334 |
| 600 | Ga0373955_0185549 | 3300035172 | Bacteria | 1235 |
| 601 | Ga0373955_0307549 | 3300035172 | Bacteria | 956 |
| 602 | Ga0373955_0369416 | 3300035172 | Bacteria | 870 |
| 603 | Ga0373962_0021488 | 3300035242 | Bacteria | 1703 |
| 604 | Ga0316574_0302297 | 3300035398 | Bacteria | 1017 |
| 605 | Ga0373924_0000073 | 3300035410 | Bacteria | 26960 |
| 606 | Ga0373924_0002275 | 3300035410 | Bacteria | 6445 |
| 607 | Ga0373924_0012047 | 3300035410 | Bacteria | 3223 |
| 608 | Ga0373924_0107036 | 3300035410 | Bacteria | 1206 |
| 609 | Ga0373931_0152396 | 3300035691 | Bacteria | 1348 |
| 610 | Ga0373931_0694686 | 3300035691 | Bacteria | 671 |
| 611 | Ga0373935_0003332 | 3300035692 | Bacteria | 9301 |
| 612 | Ga0373935_0054728 | 3300035692 | Bacteria | 2542 |
| 613 | Ga0373935_0096262 | 3300035692 | Bacteria | 1945 |
| 614 | Ga0373935_0149126 | 3300035692 | Bacteria | 1585 |
| 615 | Ga0373935_0215500 | 3300035692 | Bacteria | 1332 |
| 616 | Ga0373935_0285805 | 3300035692 | Bacteria | 1162 |
| 617 | Ga0373935_0446732 | 3300035692 | Bacteria | 933 |
| 618 | Ga0373935_0532100 | 3300035692 | Bacteria | 855 |
| 619 | Ga0373927_0021656 | 3300035695 | Bacteria | 4212 |
| 620 | Ga0373927_0027321 | 3300035695 | Bacteria | 3726 |
| 621 | Ga0373927_0035125 | 3300035695 | Bacteria | 3259 |
| 622 | Ga0373927_0421948 | 3300035695 | Bacteria | 880 |
| 623 | Ga0373933_0000054 | 3300035724 | Bacteria | 69499 |
| 624 | Ga0373933_0003898 | 3300035724 | Bacteria | 8231 |
| 625 | Ga0373933_0011093 | 3300035724 | Bacteria | 4953 |
| 626 | Ga0373933_0052269 | 3300035724 | Bacteria | 2444 |
| 627 | Ga0373933_0058689 | 3300035724 | Bacteria | 2315 |
| 628 | Ga0373933_0086847 | 3300035724 | Bacteria | 1925 |
| 629 | Ga0373933_0120493 | 3300035724 | Bacteria | 1643 |
| 630 | Ga0373947_0001093 | 3300035725 | Bacteria | 16622 |
| 631 | Ga0373947_0001602 | 3300035725 | Bacteria | 13873 |
| 632 | Ga0373947_0046346 | 3300035725 | Bacteria | 2603 |
| 633 | Ga0373947_0098208 | 3300035725 | Bacteria | 1837 |
| 634 | Ga0373947_0169858 | 3300035725 | Bacteria | 1414 |
| 635 | Ga0373947_0278132 | 3300035725 | Bacteria | 1112 |
| 636 | Ga0373937_0000002 | 3300036401 | Bacteria | 304133 |
| 637 | Ga0373937_0010001 | 3300036401 | Bacteria | 8272 |
| 638 | Ga0373937_0047793 | 3300036401 | Bacteria | 3916 |
| 639 | Ga0373937_0135146 | 3300036401 | Bacteria | 2305 |
| 640 | Ga0373937_0219618 | 3300036401 | Bacteria | 1789 |
| 641 | Ga0373937_0249817 | 3300036401 | Bacteria | 1672 |
| 642 | Ga0373937_0274263 | 3300036401 | Bacteria | 1592 |
| 643 | Ga0373937_0327105 | 3300036401 | Bacteria | 1450 |
| 644 | Ga0373925_0005625 | 3300037068 | Bacteria | 9322 |
| 645 | Ga0373925_0009741 | 3300037068 | Bacteria | 6979 |
| 646 | Ga0373925_0083149 | 3300037068 | Bacteria | 2437 |
| 647 | Ga0373925_0109779 | 3300037068 | Bacteria | 2129 |
| 648 | Ga0373925_0249717 | 3300037068 | Bacteria | 1422 |
| 649 | Ga0373925_0250750 | 3300037068 | Bacteria | 1419 |
| 650 | Ga0373925_0325529 | 3300037068 | Bacteria | 1244 |
| 651 | Ga0373925_0358227 | 3300037068 | Bacteria | 1185 |
| 652 | Ga0373925_0516956 | 3300037068 | Bacteria | 981 |
| 653 | Ga0373925_0866629 | 3300037068 | Bacteria | 744 |
| 654 | Ga0395899_0004263 | 3300037312 | Bacteria | 11193 |
| 655 | Ga0395900_0272449 | 3300037418 | Bacteria | 1687 |
| 656 | Ga0436364_0021886 | 3300037853 | Bacteria | 1460 |
| 657 | Ga0436364_0669885 | 3300037853 | Bacteria | 2675 |
| 658 | Ga0436364_0769079 | 3300037853 | Bacteria | 1747 |
| 659 | Ga0436364_0872343 | 3300037853 | Bacteria | 586 |
| 660 | Ga0436364_1084539 | 3300037853 | Bacteria | 1167 |
| 661 | Ga0436364_1262394 | 3300037853 | Bacteria | 14344 |
| 662 | Ga0436364_1401376 | 3300037853 | Bacteria | 69007 |
| 663 | Ga0436365_0222628 | 3300039437 | Bacteria | 6155 |
| 664 | Ga0436365_0416340 | 3300039437 | Bacteria | 991 |
| 665 | Ga0436365_1293463 | 3300039437 | Bacteria | 1618 |
| 666 | Ga0436361_0158863 | 3300039447 | Bacteria | 695 |
| 667 | Ga0436363_0530596 | 3300039450 | Bacteria | 1255 |
| 668 | Ga0436363_1105940 | 3300039450 | Bacteria | 1190 |
| 669 | Ga0436363_1174765 | 3300039450 | Bacteria | 2856 |
| 670 | Ga0436363_1265393 | 3300039450 | Bacteria | 2418 |
| 671 | Ga0436362_0624818 | 3300039453 | Bacteria | 960 |
| 672 | Ga0436362_0727893 | 3300039453 | Bacteria | 1011 |
| 673 | Ga0451789_0553388 | 3300041443 | Bacteria | 732 |
| 674 | Ga0451791_1593630 | 3300041451 | Bacteria | 1354 |
| 675 | Ga0451804_0297973 | 3300041463 | Bacteria | 632 |
| 676 | Ga0451841_1052420 | 3300041498 | Bacteria | 631 |
| 677 | Ga0466972_0009324 | 3300044658 | Bacteria | 4934 |
| 678 | Ga0466965_0138559 | 3300044683 | Bacteria | 1265 |
| 679 | Ga0466965_0146249 | 3300044683 | Bacteria | 1233 |
| 680 | Ga0466966_0004664 | 3300044684 | Bacteria | 9025 |
| 681 | Ga0466961_0171244 | 3300044693 | Bacteria | 1350 |
| 682 | Ga0466961_0438935 | 3300044693 | Bacteria | 790 |
| 683 | Ga0466961_0439757 | 3300044693 | Bacteria | 790 |
| 684 | Ga0466963_0002427 | 3300044694 | Bacteria | 10422 |
| 685 | Ga0466963_0036568 | 3300044694 | Bacteria | 3203 |
| 686 | Ga0466963_0414536 | 3300044694 | Bacteria | 950 |
| 687 | Ga0466963_0825694 | 3300044694 | Bacteria | 654 |
| 688 | Ga0466964_0732108 | 3300044706 | Bacteria | 554 |
| 689 | Ga0466971_0097029 | 3300044719 | Bacteria | 1352 |
| 690 | Ga0466970_0053321 | 3300044765 | Bacteria | 2159 |
| 691 | Ga0466957_0288507 | 3300044842 | Bacteria | 1100 |
| 692 | Ga0466957_0931384 | 3300044842 | Bacteria | 622 |
| 693 | Ga0466960_0001547 | 3300044901 | Bacteria | 8411 |
| 694 | Ga0466960_0288304 | 3300044901 | Bacteria | 922 |
| 695 | Ga0466959_0127852 | 3300045049 | Bacteria | 1802 |
| 696 | Ga0466959_0833734 | 3300045049 | Bacteria | 616 |
| 697 | Ga0466958_0000849 | 3300045836 | Bacteria | 13568 |
| 698 | Ga0466958_0228027 | 3300045836 | Bacteria | 1189 |
| 699 | Ga0466967_0005545 | 3300045976 | Bacteria | 8762 |
| 700 | Ga0466967_0129109 | 3300045976 | Bacteria | 2345 |
| 701 | Ga0466967_0159286 | 3300045976 | Bacteria | 2117 |
| 702 | Ga0466967_0186235 | 3300045976 | Bacteria | 1960 |
| 703 | Ga0466967_0203012 | 3300045976 | Bacteria | 1878 |
| 704 | Ga0466967_0515435 | 3300045976 | Bacteria | 1175 |
| 705 | Ga0495592_0000003 | 3300046454 | Bacteria | 200744 |
| 706 | Ga0495592_0033887 | 3300046454 | Bacteria | 3851 |
| 707 | Ga0495592_0044826 | 3300046454 | Bacteria | 3302 |
| 708 | Ga0495592_0051815 | 3300046454 | Bacteria | 3048 |
| 709 | Ga0495592_0191623 | 3300046454 | Bacteria | 1385 |
| 710 | Ga0495592_0251608 | 3300046454 | Bacteria | 1167 |
| 711 | Ga0495592_0745992 | 3300046454 | Bacteria | 585 |
| 712 | Ga0495603_0000661 | 3300046455 | Bacteria | 19477 |
| 713 | Ga0495603_0074227 | 3300046455 | Bacteria | 1997 |
| 714 | Ga0495629_0001950 | 3300046459 | Bacteria | 16079 |
| 715 | Ga0495629_0012811 | 3300046459 | Bacteria | 6069 |
| 716 | Ga0495629_0179260 | 3300046459 | Bacteria | 1469 |
| 717 | Ga0495629_0282370 | 3300046459 | Bacteria | 1139 |
| 718 | Ga0495641_0001407 | 3300046461 | Bacteria | 20458 |
| 719 | Ga0495641_0006055 | 3300046461 | Bacteria | 7956 |
| 720 | Ga0495641_0035357 | 3300046461 | Bacteria | 2356 |
| 721 | Ga0495641_0071193 | 3300046461 | Bacteria | 1561 |
| 722 | Ga0495641_0091529 | 3300046461 | Bacteria | 1359 |
| 723 | Ga0495651_0000036 | 3300046462 | Bacteria | 97779 |
| 724 | Ga0495651_0003222 | 3300046462 | Bacteria | 12534 |
| 725 | Ga0495651_0023674 | 3300046462 | Bacteria | 4775 |
| 726 | Ga0495651_0055381 | 3300046462 | Bacteria | 3047 |
| 727 | Ga0495651_0159182 | 3300046462 | Bacteria | 1619 |
| 728 | Ga0495651_0223151 | 3300046462 | Bacteria | 1303 |
| 729 | Ga0495651_0246141 | 3300046462 | Bacteria | 1223 |
| 730 | Ga0495651_0267202 | 3300046462 | Bacteria | 1161 |
| 731 | Ga0495651_0942881 | 3300046462 | Bacteria | 526 |
| 732 | Ga0495653_0000406 | 3300046463 | Bacteria | 34551 |
| 733 | Ga0495653_0002880 | 3300046463 | Bacteria | 13761 |
| 734 | Ga0495653_0007981 | 3300046463 | Bacteria | 8668 |
| 735 | Ga0495653_0038555 | 3300046463 | Bacteria | 3750 |
| 736 | Ga0495653_0038923 | 3300046463 | Bacteria | 3729 |
| 737 | Ga0495653_0093534 | 3300046463 | Bacteria | 2192 |
| 738 | Ga0495653_0112727 | 3300046463 | Bacteria | 1951 |
| 739 | Ga0495653_0443474 | 3300046463 | Bacteria | 818 |
| 740 | Ga0495650_0030915 | 3300046471 | Bacteria | 2418 |
| 741 | Ga0495580_0006551 | 3300046472 | Bacteria | 9468 |
| 742 | Ga0495580_0110900 | 3300046472 | Bacteria | 1905 |
| 743 | Ga0495582_0002623 | 3300046473 | Bacteria | 10014 |
| 744 | Ga0495582_0020254 | 3300046473 | Bacteria | 3640 |
| 745 | Ga0495582_0037471 | 3300046473 | Bacteria | 2667 |
| 746 | Ga0495582_0200431 | 3300046473 | Bacteria | 1140 |
| 747 | Ga0495639_0007269 | 3300046475 | Bacteria | 4753 |
| 748 | Ga0495639_0042136 | 3300046475 | Bacteria | 2058 |
| 749 | Ga0495639_0328258 | 3300046475 | Bacteria | 766 |
| 750 | Ga0495662_0001838 | 3300046476 | Bacteria | 10636 |
| 751 | Ga0495662_0007893 | 3300046476 | Bacteria | 5240 |
| 752 | Ga0495662_0044581 | 3300046476 | Bacteria | 2141 |
| 753 | Ga0495662_0384469 | 3300046476 | Bacteria | 689 |
| 754 | Ga0495664_0000454 | 3300046477 | Bacteria | 20119 |
| 755 | Ga0495664_0101383 | 3300046477 | Bacteria | 1734 |
| 756 | Ga0495664_0121215 | 3300046477 | Bacteria | 1582 |
| 757 | Ga0495664_0229500 | 3300046477 | Bacteria | 1123 |
| 758 | Ga0495664_0264956 | 3300046477 | Bacteria | 1038 |
| 759 | Ga0495594_0031228 | 3300046499 | Bacteria | 2887 |
| 760 | Ga0495608_0000018 | 3300046511 | Bacteria | 192512 |
| 761 | Ga0495608_0026583 | 3300046511 | Bacteria | 3943 |
| 762 | Ga0495608_0027027 | 3300046511 | Bacteria | 3907 |
| 763 | Ga0495608_0034497 | 3300046511 | Bacteria | 3415 |
| 764 | Ga0495608_0040428 | 3300046511 | Bacteria | 3124 |
| 765 | Ga0495608_0041557 | 3300046511 | Bacteria | 3076 |
| 766 | Ga0495618_0007128 | 3300046514 | Bacteria | 6762 |
| 767 | Ga0495618_0015896 | 3300046514 | Bacteria | 4594 |
| 768 | Ga0495618_0017974 | 3300046514 | Bacteria | 4338 |
| 769 | Ga0495618_0028819 | 3300046514 | Bacteria | 3461 |
| 770 | Ga0495618_0066107 | 3300046514 | Bacteria | 2298 |
| 771 | Ga0495618_0078881 | 3300046514 | Bacteria | 2099 |
| 772 | Ga0495618_0204714 | 3300046514 | Bacteria | 1248 |
| 773 | Ga0495628_0000020 | 3300046516 | Bacteria | 148606 |
| 774 | Ga0495628_0110010 | 3300046516 | Bacteria | 2120 |
| 775 | Ga0495628_0240404 | 3300046516 | Bacteria | 1354 |
| 776 | Ga0495628_0253609 | 3300046516 | Bacteria | 1313 |
| 777 | Ga0495630_0036754 | 3300046517 | Bacteria | 3660 |
| 778 | Ga0495630_0052195 | 3300046517 | Bacteria | 3061 |
| 779 | Ga0495630_0075463 | 3300046517 | Bacteria | 2540 |
| 780 | Ga0495630_0096775 | 3300046517 | Bacteria | 2231 |
| 781 | Ga0495630_0449417 | 3300046517 | Bacteria | 987 |
| 782 | Ga0495630_0501692 | 3300046517 | Bacteria | 930 |
| 783 | Ga0495666_0016042 | 3300046526 | Bacteria | 3730 |
| 784 | Ga0495666_0022892 | 3300046526 | Bacteria | 3092 |
| 785 | Ga0495666_0095277 | 3300046526 | Bacteria | 1404 |
| 786 | Ga0495652_0000013 | 3300046529 | Bacteria | 238164 |
| 787 | Ga0495652_0022788 | 3300046529 | Bacteria | 5556 |
| 788 | Ga0495652_0030281 | 3300046529 | Bacteria | 4747 |
| 789 | Ga0495652_0064510 | 3300046529 | Bacteria | 3080 |
| 790 | Ga0495652_0147376 | 3300046529 | Bacteria | 1843 |
| 791 | Ga0495652_0213570 | 3300046529 | Bacteria | 1454 |
| 792 | Ga0495652_0417320 | 3300046529 | Bacteria | 946 |
| 793 | Ga0495665_0001556 | 3300046531 | Bacteria | 12246 |
| 794 | Ga0495665_0019771 | 3300046531 | Bacteria | 3622 |
| 795 | Ga0495665_0050849 | 3300046531 | Bacteria | 2196 |
| 796 | Ga0495665_0086485 | 3300046531 | Bacteria | 1647 |
| 797 | Ga0495640_0016167 | 3300046533 | Bacteria | 5586 |
| 798 | Ga0495640_0023151 | 3300046533 | Bacteria | 4533 |
| 799 | Ga0495640_0031284 | 3300046533 | Bacteria | 3799 |
| 800 | Ga0495640_0031362 | 3300046533 | Bacteria | 3793 |
| 801 | Ga0495640_0034696 | 3300046533 | Bacteria | 3574 |
| 802 | Ga0495640_0161476 | 3300046533 | Bacteria | 1435 |
| 803 | Ga0495640_0842393 | 3300046533 | Bacteria | 545 |
| 804 | Ga0495586_0006621 | 3300046535 | Bacteria | 6187 |
| 805 | Ga0495586_0608161 | 3300046535 | Bacteria | 631 |
| 806 | Ga0495587_0000014 | 3300046536 | Bacteria | 192100 |
| 807 | Ga0495587_0005895 | 3300046536 | Bacteria | 7985 |
| 808 | Ga0495587_0009225 | 3300046536 | Bacteria | 6331 |
| 809 | Ga0495587_0020632 | 3300046536 | Bacteria | 4064 |
| 810 | Ga0495587_0184951 | 3300046536 | Bacteria | 1180 |
| 811 | Ga0495587_0252984 | 3300046536 | Bacteria | 990 |
| 812 | Ga0495645_0030955 | 3300046543 | Bacteria | 3897 |
| 813 | Ga0495645_0060069 | 3300046543 | Bacteria | 2755 |
| 814 | Ga0495645_0072510 | 3300046543 | Bacteria | 2481 |
| 815 | Ga0495645_0121834 | 3300046543 | Bacteria | 1835 |
| 816 | Ga0495645_0138630 | 3300046543 | Bacteria | 1699 |
| 817 | Ga0495645_0168638 | 3300046543 | Bacteria | 1508 |
| 818 | Ga0495645_0200172 | 3300046543 | Bacteria | 1355 |
| 819 | Ga0495622_0121609 | 3300046557 | Bacteria | 1192 |
| 820 | Ga0495667_0000014 | 3300046559 | Bacteria | 200767 |
| 821 | Ga0495667_0000302 | 3300046559 | Bacteria | 31369 |
| 822 | Ga0495667_0016888 | 3300046559 | Bacteria | 4928 |
| 823 | Ga0495667_0037809 | 3300046559 | Bacteria | 3215 |
| 824 | Ga0495667_0097605 | 3300046559 | Bacteria | 1902 |
| 825 | Ga0495667_0180565 | 3300046559 | Bacteria | 1354 |
| 826 | Ga0495668_0699492 | 3300046616 | Bacteria | 561 |
| 827 | Ga0495634_0029290 | 3300046642 | Bacteria | 3812 |
| 828 | Ga0495634_0059420 | 3300046642 | Bacteria | 2546 |
| 829 | Ga0495634_0078856 | 3300046642 | Bacteria | 2157 |
| 830 | Ga0495634_0091725 | 3300046642 | Bacteria | 1971 |
| 831 | Ga0495634_0180104 | 3300046642 | Bacteria | 1323 |
| 832 | Ga0495634_0211029 | 3300046642 | Bacteria | 1202 |
| 833 | Ga0495634_0288652 | 3300046642 | Bacteria | 994 |
| 834 | Ga0495634_0346534 | 3300046642 | Bacteria | 890 |
| 835 | Ga0495635_0000462 | 3300046663 | Bacteria | 25695 |
| 836 | Ga0495635_0002746 | 3300046663 | Bacteria | 12067 |
| 837 | Ga0495635_0004499 | 3300046663 | Bacteria | 9661 |
| 838 | Ga0495635_0014871 | 3300046663 | Bacteria | 5445 |
| 839 | Ga0495635_0033200 | 3300046663 | Bacteria | 3579 |
| 840 | Ga0495635_0247775 | 3300046663 | Bacteria | 1201 |
| 841 | Ga0495635_0443740 | 3300046663 | Bacteria | 858 |
| 842 | Ga0495635_0545769 | 3300046663 | Bacteria | 760 |
| 843 | Ga0495588_0033859 | 3300046674 | Bacteria | 2583 |
| 844 | Ga0495588_0135331 | 3300046674 | Bacteria | 1301 |
| 845 | Ga0495657_0000012 | 3300046675 | Bacteria | 197154 |
| 846 | Ga0495657_0006514 | 3300046675 | Bacteria | 9129 |
| 847 | Ga0495657_0016259 | 3300046675 | Bacteria | 5423 |
| 848 | Ga0495657_0042494 | 3300046675 | Bacteria | 3103 |
| 849 | Ga0495657_0047516 | 3300046675 | Bacteria | 2900 |
| 850 | Ga0495657_0105784 | 3300046675 | Bacteria | 1787 |
| 851 | Ga0495657_0109632 | 3300046675 | Bacteria | 1750 |
| 852 | Ga0495599_0000037 | 3300046678 | Bacteria | 101892 |
| 853 | Ga0495599_0011715 | 3300046678 | Bacteria | 5389 |
| 854 | Ga0495599_0012101 | 3300046678 | Bacteria | 5311 |
| 855 | Ga0495599_0029683 | 3300046678 | Bacteria | 3428 |
| 856 | Ga0495623_0000079 | 3300046679 | Bacteria | 57590 |
| 857 | Ga0495623_0009073 | 3300046679 | Bacteria | 6451 |
| 858 | Ga0495623_0027788 | 3300046679 | Bacteria | 3642 |
| 859 | Ga0495623_0129241 | 3300046679 | Bacteria | 1514 |
| 860 | Ga0495646_0009352 | 3300046680 | Bacteria | 6217 |
| 861 | Ga0495646_0011733 | 3300046680 | Bacteria | 5571 |
| 862 | Ga0495646_0055454 | 3300046680 | Bacteria | 2380 |
| 863 | Ga0495646_0075783 | 3300046680 | Bacteria | 1971 |
| 864 | Ga0495646_0097127 | 3300046680 | Bacteria | 1693 |
| 865 | Ga0495646_0282562 | 3300046680 | Bacteria | 881 |
| 866 | Ga0495647_0001069 | 3300046681 | Bacteria | 8346 |
| 867 | Ga0495647_0120664 | 3300046681 | Bacteria | 1102 |
| 868 | Ga0495658_0002199 | 3300046683 | Bacteria | 9868 |
| 869 | Ga0495613_0006714 | 3300046689 | Bacteria | 8590 |
| 870 | Ga0495613_0220434 | 3300046689 | Bacteria | 1332 |
| 871 | Ga0495613_0689318 | 3300046689 | Bacteria | 673 |
| 872 | Ga0495624_0005490 | 3300046690 | Bacteria | 9129 |
| 873 | Ga0495624_0008133 | 3300046690 | Bacteria | 7341 |
| 874 | Ga0495624_0124468 | 3300046690 | Bacteria | 1582 |
| 875 | Ga0495624_0127217 | 3300046690 | Bacteria | 1563 |
| 876 | Ga0495624_0177773 | 3300046690 | Bacteria | 1297 |
| 877 | Ga0495600_0003734 | 3300046809 | Bacteria | 9005 |
| 878 | Ga0495600_0009438 | 3300046809 | Bacteria | 6027 |
| 879 | Ga0495600_0013917 | 3300046809 | Bacteria | 5068 |
| 880 | Ga0495600_0016008 | 3300046809 | Bacteria | 4753 |
| 881 | Ga0495600_0029865 | 3300046809 | Bacteria | 3531 |
| 882 | Ga0495600_0091649 | 3300046809 | Bacteria | 1982 |
| 883 | Ga0495600_0289005 | 3300046809 | Bacteria | 1036 |
| 884 | Ga0495581_0009902 | 3300047315 | Bacteria | 5513 |
| 885 | Ga0495581_0023893 | 3300047315 | Bacteria | 3542 |
| 886 | Ga0495581_0026782 | 3300047315 | Bacteria | 3342 |
| 887 | Ga0495604_0005054 | 3300047317 | Bacteria | 10439 |
| 888 | Ga0495604_0011248 | 3300047317 | Bacteria | 7105 |
| 889 | Ga0495604_0083032 | 3300047317 | Bacteria | 2395 |
| 890 | Ga0495604_0089914 | 3300047317 | Bacteria | 2281 |
| 891 | Ga0495604_0325045 | 3300047317 | Bacteria | 1027 |
| 892 | Ga0495604_0434846 | 3300047317 | Bacteria | 859 |
| 893 | Ga0495674_0000831 | 3300047319 | Bacteria | 29544 |
| 894 | Ga0495674_0001543 | 3300047319 | Bacteria | 22531 |
| 895 | Ga0495674_0013670 | 3300047319 | Bacteria | 7627 |
| 896 | Ga0495674_0019229 | 3300047319 | Bacteria | 6344 |
| 897 | Ga0495674_0160542 | 3300047319 | Bacteria | 1881 |
| 898 | Ga0495674_0326244 | 3300047319 | Bacteria | 1249 |
| 899 | Ga0495674_1186184 | 3300047319 | Bacteria | 578 |
| 900 | Ga0495676_0020252 | 3300047321 | Bacteria | 5841 |
| 901 | Ga0495676_0064180 | 3300047321 | Bacteria | 2858 |
| 902 | Ga0495676_0081429 | 3300047321 | Bacteria | 2454 |
| 903 | Ga0495676_0124368 | 3300047321 | Bacteria | 1871 |
| 904 | Ga0495676_0216123 | 3300047321 | Bacteria | 1323 |
| 905 | Ga0495680_0000003 | 3300047322 | Bacteria | 172246 |
| 906 | Ga0495680_0001454 | 3300047322 | Bacteria | 25547 |
| 907 | Ga0495680_0002953 | 3300047322 | Bacteria | 17014 |
| 908 | Ga0495680_0010156 | 3300047322 | Bacteria | 8415 |
| 909 | Ga0495680_0029953 | 3300047322 | Bacteria | 4449 |
| 910 | Ga0495680_0040311 | 3300047322 | Bacteria | 3721 |
| 911 | Ga0495680_0055123 | 3300047322 | Bacteria | 3084 |
| 912 | Ga0495680_0226762 | 3300047322 | Bacteria | 1331 |
| 913 | Ga0495680_0270927 | 3300047322 | Bacteria | 1199 |
| 914 | Ga0495680_0343029 | 3300047322 | Bacteria | 1041 |
| 915 | Ga0495675_0000389 | 3300047444 | Bacteria | 30325 |
| 916 | Ga0495675_0020998 | 3300047444 | Bacteria | 4157 |
| 917 | Ga0495675_0033719 | 3300047444 | Bacteria | 3267 |
| 918 | Ga0495675_0200844 | 3300047444 | Bacteria | 1213 |
| 919 | Ga0495675_0236250 | 3300047444 | Bacteria | 1101 |
| 920 | Ga0495684_0003199 | 3300047471 | Bacteria | 12839 |
| 921 | Ga0495684_0005821 | 3300047471 | Bacteria | 9583 |
| 922 | Ga0495684_0007526 | 3300047471 | Bacteria | 8429 |
| 923 | Ga0495684_0011571 | 3300047471 | Bacteria | 6812 |
| 924 | Ga0495684_0023304 | 3300047471 | Bacteria | 4760 |
| 925 | Ga0495684_0070188 | 3300047471 | Bacteria | 2663 |
| 926 | Ga0495684_0148010 | 3300047471 | Bacteria | 1757 |
| 927 | Ga0495684_0612170 | 3300047471 | Bacteria | 733 |
| 928 | Ga0495593_0000847 | 3300047673 | Bacteria | 17762 |
| 929 | Ga0495593_0006911 | 3300047673 | Bacteria | 6644 |
| 930 | Ga0495593_0011275 | 3300047673 | Bacteria | 5137 |
| 931 | Ga0495593_0020492 | 3300047673 | Bacteria | 3703 |
| 932 | Ga0495602_0000014 | 3300048088 | Bacteria | 193335 |
| 933 | Ga0495602_0025497 | 3300048088 | Bacteria | 5722 |
| 934 | Ga0495602_0035056 | 3300048088 | Bacteria | 4684 |
| 935 | Ga0495602_0143675 | 3300048088 | Bacteria | 1885 |
| 936 | Ga0495602_0430876 | 3300048088 | Bacteria | 934 |
| 937 | Ga0495602_0496886 | 3300048088 | Bacteria | 853 |
| 938 | Ga0495602_0843037 | 3300048088 | Bacteria | 613 |
| 939 | Ga0495614_0007195 | 3300048089 | Bacteria | 4960 |
| 940 | Ga0495614_0018832 | 3300048089 | Bacteria | 2990 |
| 941 | Ga0496100_0035899 | 3300048903 | Bacteria | 3122 |
| 942 | Ga0496100_0524411 | 3300048903 | Bacteria | 914 |
| 943 | Ga0496100_1388527 | 3300048903 | Bacteria | 554 |
| 944 | Ga0496101_0131946 | 3300048904 | Bacteria | 1897 |
| 945 | Ga0496101_0183692 | 3300048904 | Bacteria | 1611 |
| 946 | Ga0496101_0527917 | 3300048904 | Bacteria | 933 |
| 947 | Ga0496101_0722039 | 3300048904 | Bacteria | 787 |
| 948 | Ga0496101_1088408 | 3300048904 | Bacteria | 628 |
| 949 | Ga0496102_0099513 | 3300048905 | Bacteria | 2699 |
| 950 | Ga0496102_0630173 | 3300048905 | Bacteria | 995 |
| 951 | Ga0496102_1000742 | 3300048905 | Bacteria | 756 |
| 952 | Ga0496104_0011893 | 3300048907 | Bacteria | 7809 |
| 953 | Ga0496104_0044853 | 3300048907 | Bacteria | 4155 |
| 954 | Ga0496104_0319358 | 3300048907 | Bacteria | 1466 |
| 955 | Ga0496104_0473072 | 3300048907 | Bacteria | 1164 |
| 956 | Ga0496104_0539499 | 3300048907 | Bacteria | 1077 |
| 957 | Ga0496104_0559544 | 3300048907 | Bacteria | 1054 |
| 958 | Ga0496105_0007062 | 3300048908 | Bacteria | 8655 |
| 959 | Ga0496105_0115103 | 3300048908 | Bacteria | 2218 |
| 960 | Ga0496105_0118728 | 3300048908 | Bacteria | 2181 |
| 961 | Ga0496106_0098764 | 3300048909 | Bacteria | 2262 |
| 962 | Ga0496106_0235487 | 3300048909 | Bacteria | 1462 |
| 963 | Ga0496106_0269701 | 3300048909 | Bacteria | 1363 |
| 964 | Ga0496107_0119312 | 3300048910 | Bacteria | 1942 |
| 965 | Ga0496108_0013691 | 3300048911 | Bacteria | 6621 |
| 966 | Ga0496108_0020748 | 3300048911 | Bacteria | 5401 |
| 967 | Ga0496108_0193286 | 3300048911 | Bacteria | 1764 |
| 968 | Ga0496108_0343762 | 3300048911 | Bacteria | 1302 |
| 969 | Ga0496108_0373805 | 3300048911 | Bacteria | 1244 |
| 970 | Ga0496108_0751444 | 3300048911 | Bacteria | 843 |
| 971 | Ga0496108_1134217 | 3300048911 | Bacteria | 663 |
| 972 | Ga0496109_0158665 | 3300048912 | Bacteria | 2119 |
| 973 | Ga0496109_0492128 | 3300048912 | Bacteria | 1157 |
| 974 | Ga0496109_0603886 | 3300048912 | Bacteria | 1033 |
| 975 | Ga0496109_0657349 | 3300048912 | Bacteria | 985 |
| 976 | Ga0496109_0867615 | 3300048912 | Bacteria | 840 |
| 977 | Ga0496109_1257270 | 3300048912 | Bacteria | 676 |
| 978 | Ga0496109_1790130 | 3300048912 | Bacteria | 547 |
| 979 | Ga0496110_0188692 | 3300048913 | Bacteria | 1872 |
| 980 | Ga0496110_0383501 | 3300048913 | Bacteria | 1281 |
| 981 | Ga0496110_1203410 | 3300048913 | Bacteria | 666 |
| 982 | Ga0496111_0030158 | 3300048914 | Bacteria | 3856 |
| 983 | Ga0496111_0063187 | 3300048914 | Bacteria | 2685 |
| 984 | Ga0496111_0202624 | 3300048914 | Bacteria | 1475 |
| 985 | Ga0496111_0659560 | 3300048914 | Bacteria | 763 |
| 986 | Ga0496112_0003525 | 3300048915 | Bacteria | 12975 |
| 987 | Ga0496112_0060274 | 3300048915 | Bacteria | 3739 |
| 988 | Ga0496112_0136605 | 3300048915 | Bacteria | 2422 |
| 989 | Ga0496112_0212460 | 3300048915 | Bacteria | 1891 |
| 990 | Ga0496112_0616351 | 3300048915 | Bacteria | 1016 |
| 991 | Ga0496112_0712307 | 3300048915 | Bacteria | 931 |
| 992 | Ga0496113_0043438 | 3300048916 | Bacteria | 3326 |
| 993 | Ga0496113_0557376 | 3300048916 | Bacteria | 919 |
| 994 | Ga0496113_0761417 | 3300048916 | Bacteria | 770 |
| 995 | Ga0496113_1048068 | 3300048916 | Bacteria | 641 |
| 996 | Ga0496113_1118277 | 3300048916 | Bacteria | 617 |
| 997 | Ga0496114_0154195 | 3300048917 | Bacteria | 1994 |
| 998 | Ga0496114_0458472 | 3300048917 | Bacteria | 1128 |
| 999 | Ga0496115_0010698 | 3300048918 | Bacteria | 6862 |
| 1000 | Ga0496115_0113190 | 3300048918 | Bacteria | 2229 |
| 1001 | Ga0501039_1018652 | 3300049575 | Unclassified | 643 |
| 1002 | Ga0501042_0044911 | 3300049578 | Bacteria | 3148 |
| 1003 | Ga0501043_1056319 | 3300049579 | Bacteria | 576 |
| 1004 | Ga0501072_0380399 | 3300049588 | Bacteria | 1120 |
| 1005 | Ga0501079_0386773 | 3300049741 | Bacteria | 1097 |
| 1006 | Ga0501081_0439842 | 3300049743 | Bacteria | 968 |
| 1007 | nmdc:mga08y16_127207_c1 | 3300050511 | Bacteria | 2650 |
| 1008 | nmdc:mga08y16_859458_c1 | 3300050511 | Bacteria | 896 |
| 1009 | nmdc:mga0n895_5920_c1 | 3300050512 | Bacteria | 10282 |
| 1010 | nmdc:mga0n895_65382_c1 | 3300050512 | Bacteria | 3600 |
| 1011 | nmdc:mga0n895_889796_c1 | 3300050512 | Bacteria | 876 |
| 1012 | nmdc:mga0rr50_1314241_c1 | 3300050513 | Bacteria | 613 |
| 1013 | nmdc:mga0rr50_14871_c1 | 3300050513 | Bacteria | 5121 |
| 1014 | nmdc:mga0rr50_54822_c1 | 3300050513 | Bacteria | 2972 |
| 1015 | nmdc:mga0rr50_826443_c1 | 3300050513 | Bacteria | 790 |
| 1016 | nmdc:mga08x19_16182_c1 | 3300050514 | Bacteria | 4545 |
| 1017 | nmdc:mga08x19_893659_c1 | 3300050514 | Bacteria | 631 |
| 1018 | nmdc:mga0a205_49641_c1 | 3300050515 | Bacteria | 4051 |
| 1019 | nmdc:mga0a205_720479_c1 | 3300050515 | Bacteria | 847 |
| 1020 | Ga0495601_0015583 | 3300053077 | Bacteria | 4594 |
| 1021 | Ga0495601_0023159 | 3300053077 | Bacteria | 3815 |
| 1022 | Ga0495601_0028281 | 3300053077 | Bacteria | 3472 |
| 1023 | Ga0495612_0005770 | 3300053078 | Bacteria | 5111 |
| 1024 | Ga0495595_0001199 | 3300053084 | Bacteria | 10074 |
| 1025 | Ga0495595_0012038 | 3300053084 | Bacteria | 3627 |
| 1026 | Ga0495595_0014508 | 3300053084 | Bacteria | 3345 |
| 1027 | Ga0495619_0019205 | 3300053085 | Bacteria | 4343 |
| 1028 | Ga0495619_0296007 | 3300053085 | Bacteria | 1121 |
| 1029 | Ga0495619_0305932 | 3300053085 | Bacteria | 1101 |
| 1030 | Ga0495619_0673468 | 3300053085 | Bacteria | 704 |
| 1031 | Ga0587062_031234 | 3300059639 | Bacteria | 817 |
| 1032 | Ga0466962_0004801 | 3300061719 | Bacteria | 6506 |
| 1033 | 2558912312 | 2558860112 | Bacteria | 9931328 |
| 1034 | 2810363650 | 2808606700 | Bacteria | 3482157 |
| 1035 | 2816505362 | 2816332139 | Bacteria | 9138787 |
| 1036 | 2819668105 | 2818991458 | Bacteria | 4794049 |
| 1037 | 2870788794 | 2870782633 | Bacteria | 9624083 |
| 1038 | 2915362645 | 2915358134 | Bacteria | 6050864 |
| 1039 | 8054475115 | 8054472261 | Bacteria | 7464355 |
| 1040 | Ga0157314_1004845 | |||
| 1041 | LJQas_1003654 | |||
| 1042 | JGI24735J21928_10088676 | |||
| 1043 | JGI25404J52841_10011177 | |||
| 1044 | Ga0070658_10104305 | |||
| 1045 | Ga0070658_11199661 | |||
| 1046 | Ga0070676_10061481 | |||
| 1047 | Ga0070683_100010133 | |||
| 1048 | Ga0070683_100164581 | |||
| 1049 | Ga0070683_101075843 | |||
| 1050 | Ga0070683_101556590 | |||
| 1051 | Ga0070690_101526229 | |||
| 1052 | Ga0070670_100214632 | |||
| 1053 | Ga0070670_100385794 | |||
| 1054 | Ga0068869_100048457 | |||
| 1055 | Ga0068869_100080265 | |||
| 1056 | Ga0068869_100194027 | |||
| 1057 | Ga0068869_100959253 | |||
| 1058 | Ga0068869_101324989 | |||
| 1059 | Ga0070666_10326768 | |||
| 1060 | Ga0070680_100219269 | |||
| 1061 | Ga0070682_100017777 | |||
| 1062 | Ga0070682_100045590 | |||
| 1063 | Ga0070682_100170657 | |||
| 1064 | Ga0070682_100239092 | |||
| 1065 | Ga0070682_100388346 | |||
| 1066 | Ga0070682_100414165 | |||
| 1067 | Ga0068868_100043012 | |||
| 1068 | Ga0068868_100073280 | |||
| 1069 | Ga0068868_100672822 | |||
| 1070 | Ga0068868_101312291 | |||
| 1071 | Ga0070660_100145004 | |||
| 1072 | Ga0070660_100424222 | |||
| 1073 | Ga0070689_100231932 | |||
| 1074 | Ga0070689_100284504 | |||
| 1075 | Ga0070687_100072860 | |||
| 1076 | Ga0070687_100126729 | |||
| 1077 | Ga0070687_100629113 | |||
| 1078 | Ga0070661_100112341 | |||
| 1079 | Ga0070692_10106524 | |||
| 1080 | Ga0070692_11368045 | |||
| 1081 | Ga0070668_100115767 | |||
| 1082 | Ga0070668_100139024 | |||
| 1083 | Ga0070668_100959467 | |||
| 1084 | Ga0070668_101217430 | |||
| 1085 | Ga0070669_100128058 | |||
| 1086 | Ga0070675_100409654 | |||
| 1087 | Ga0070675_100426706 | |||
| 1088 | Ga0070671_100006613 | |||
| 1089 | Ga0070671_100288097 | |||
| 1090 | Ga0070674_100051392 | |||
| 1091 | Ga0070674_100073178 | |||
| 1092 | Ga0070674_100960786 | |||
| 1093 | Ga0070674_101383304 | |||
| 1094 | Ga0070673_100121492 | |||
| 1095 | Ga0070688_100666547 | |||
| 1096 | Ga0070659_100130430 | |||
| 1097 | Ga0070659_100178220 | |||
| 1098 | Ga0070667_100238828 | |||
| 1099 | Ga0070667_100373763 | |||
| 1100 | Ga0070667_100434140 | |||
| 1101 | Ga0070709_10089746 | |||
| 1102 | Ga0070709_10195797 | |||
| 1103 | Ga0070709_10266605 | |||
| 1104 | Ga0070714_100010968 | |||
| 1105 | Ga0070714_100085432 | |||
| 1106 | Ga0070714_100219711 | |||
| 1107 | Ga0070714_100282170 | |||
| 1108 | Ga0070714_100343810 | |||
| 1109 | Ga0070714_100456387 | |||
| 1110 | Ga0070714_100484702 | |||
| 1111 | Ga0070714_100745686 | |||
| 1112 | Ga0070714_100897474 | |||
| 1113 | Ga0070713_100066279 | |||
| 1114 | Ga0070713_100097647 | |||
| 1115 | Ga0070713_100324547 | |||
| 1116 | Ga0070713_100443980 | |||
| 1117 | Ga0070713_100547427 | |||
| 1118 | Ga0070713_100714225 | |||
| 1119 | Ga0070713_100886238 | |||
| 1120 | Ga0070710_10010220 | |||
| 1121 | Ga0070710_10025021 | |||
| 1122 | Ga0070710_10038180 | |||
| 1123 | Ga0070710_10123243 | |||
| 1124 | Ga0070710_10224077 | |||
| 1125 | Ga0070710_10250867 | |||
| 1126 | Ga0070710_10259639 | |||
| 1127 | Ga0070710_11085554 | |||
| 1128 | Ga0070701_10057036 | |||
| 1129 | Ga0070701_10094393 | |||
| 1130 | Ga0070711_100093981 | |||
| 1131 | Ga0070711_100378670 | |||
| 1132 | Ga0070711_100445242 | |||
| 1133 | Ga0070711_100836482 | |||
| 1134 | Ga0070711_100950369 | |||
| 1135 | Ga0070705_100756102 | |||
| 1136 | Ga0070700_100136296 | |||
| 1137 | Ga0070700_100301955 | |||
| 1138 | Ga0070700_100637938 | |||
| 1139 | Ga0070694_100085169 | |||
| 1140 | Ga0070708_100067758 | |||
| 1141 | Ga0070708_100235526 | |||
| 1142 | Ga0070708_100282789 | |||
| 1143 | Ga0070708_100344647 | |||
| 1144 | Ga0070708_100770854 | |||
| 1145 | Ga0070708_101327390 | |||
| 1146 | Ga0070663_100071242 | |||
| 1147 | Ga0070663_100084123 | |||
| 1148 | Ga0070663_101133845 | |||
| 1149 | Ga0070678_100058826 | |||
| 1150 | Ga0070662_101194932 | |||
| 1151 | Ga0070685_10081386 | |||
| 1152 | Ga0070685_10125327 | |||
| 1153 | Ga0070685_10293079 | |||
| 1154 | Ga0070685_10359573 | |||
| 1155 | Ga0070706_100014528 | |||
| 1156 | Ga0070706_100020291 | |||
| 1157 | Ga0070706_100061918 | |||
| 1158 | Ga0070706_100121825 | |||
| 1159 | Ga0070706_100369843 | |||
| 1160 | Ga0070706_100375891 | |||
| 1161 | Ga0070706_100508414 | |||
| 1162 | Ga0070706_100934721 | |||
| 1163 | Ga0070707_100008637 | |||
| 1164 | Ga0070707_100032225 | |||
| 1165 | Ga0070707_100063807 | |||
| 1166 | Ga0070707_100574495 | |||
| 1167 | Ga0070707_100855700 | |||
| 1168 | Ga0070707_100868332 | |||
| 1169 | Ga0070707_100905693 | |||
| 1170 | Ga0070698_100000308 | |||
| 1171 | Ga0070698_100101305 | |||
| 1172 | Ga0070698_100164232 | |||
| 1173 | Ga0070698_100189813 | |||
| 1174 | Ga0070698_100214794 | |||
| 1175 | Ga0070698_100348892 | |||
| 1176 | Ga0070698_100551986 | |||
| 1177 | Ga0070699_100293372 | |||
| 1178 | Ga0070699_100447674 | |||
| 1179 | Ga0070699_100516626 | |||
| 1180 | Ga0070699_100784151 | |||
| 1181 | Ga0070699_101124410 | |||
| 1182 | Ga0070679_100306096 | |||
| 1183 | Ga0070684_100328046 | |||
| 1184 | Ga0070684_100570997 | |||
| 1185 | Ga0070684_101073271 | |||
| 1186 | Ga0070684_101299886 | |||
| 1187 | Ga0070684_101410953 | |||
| 1188 | Ga0070697_100004980 | |||
| 1189 | Ga0070697_100005122 | |||
| 1190 | Ga0070697_101253910 | |||
| 1191 | Ga0068853_100197362 | |||
| 1192 | Ga0068853_100309321 | |||
| 1193 | Ga0068853_101578733 | |||
| 1194 | Ga0070672_100585599 | |||
| 1195 | Ga0070686_100067208 | |||
| 1196 | Ga0070686_100112399 | |||
| 1197 | Ga0070686_100214821 | |||
| 1198 | Ga0070696_100093758 | |||
| 1199 | Ga0070696_100097333 | |||
| 1200 | Ga0070693_100187885 | |||
| 1201 | Ga0070693_100270120 | |||
| 1202 | Ga0070693_100527194 | |||
| 1203 | Ga0070665_100015619 | |||
| 1204 | Ga0070665_100308847 | |||
| 1205 | Ga0070665_100366743 | |||
| 1206 | Ga0070665_100472572 | |||
| 1207 | Ga0070665_100480081 | |||
| 1208 | Ga0070665_100698090 | |||
| 1209 | Ga0070665_100752493 | |||
| 1210 | Ga0070665_100903229 | |||
| 1211 | Ga0070665_101214992 | |||
| 1212 | Ga0070704_100166852 | |||
| 1213 | Ga0068855_100315232 | |||
| 1214 | Ga0068855_102102916 | |||
| 1215 | Ga0070664_100058853 | |||
| 1216 | Ga0070664_100393262 | |||
| 1217 | Ga0070664_100498746 | |||
| 1218 | Ga0070664_101563227 | |||
| 1219 | Ga0068857_100146134 | |||
| 1220 | Ga0068857_101723658 | |||
| 1221 | Ga0068854_100067452 | |||
| 1222 | Ga0068854_100123082 | |||
| 1223 | Ga0068854_100188554 | |||
| 1224 | Ga0068856_100089102 | |||
| 1225 | Ga0068856_100208657 | |||
| 1226 | Ga0068856_100380665 | |||
| 1227 | Ga0068856_100385112 | |||
| 1228 | Ga0068856_100553582 | |||
| 1229 | Ga0068856_101680397 | |||
| 1230 | Ga0070702_100098795 | |||
| 1231 | Ga0068852_100023215 | |||
| 1232 | Ga0068852_100727427 | |||
| 1233 | Ga0068859_100090223 | |||
| 1234 | Ga0068864_100259012 | |||
| 1235 | Ga0068864_100338043 | |||
| 1236 | Ga0068864_100426400 | |||
| 1237 | Ga0068864_100849294 | |||
| 1238 | Ga0068866_10034753 | |||
| 1239 | Ga0068861_100144239 | |||
| 1240 | Ga0068861_101188824 | |||
| 1241 | Ga0068851_10076079 | |||
| 1242 | Ga0068851_10337054 | |||
| 1243 | Ga0068870_10064193 | |||
| 1244 | Ga0068870_10088250 | |||
| 1245 | Ga0068870_10290919 | |||
| 1246 | Ga0068870_10395839 | |||
| 1247 | Ga0068863_100050833 | |||
| 1248 | Ga0068863_100151463 | |||
| 1249 | Ga0068863_100267518 | |||
| 1250 | Ga0068863_100425178 | |||
| 1251 | Ga0068863_101476785 | |||
| 1252 | Ga0068858_100141636 | |||
| 1253 | Ga0068858_100203922 | |||
| 1254 | Ga0068860_100053636 | |||
| 1255 | Ga0068860_100536568 | |||
| 1256 | Ga0068860_102601993 | |||
| 1257 | Ga0068862_100198562 | |||
| 1258 | Ga0068862_101111707 | |||
| 1259 | Ga0081540_1001418 | |||
| 1260 | Ga0070717_10004588 | |||
| 1261 | Ga0070717_10118622 | |||
| 1262 | Ga0070717_10297442 | |||
| 1263 | Ga0070717_10385994 | |||
| 1264 | Ga0070717_10391053 | |||
| 1265 | Ga0070717_10486228 | |||
| 1266 | Ga0070717_10557928 | |||
| 1267 | Ga0070717_10861681 | |||
| 1268 | Ga0070717_11891003 | |||
| 1269 | Ga0075432_10143774 | |||
| 1270 | Ga0070715_10007549 | |||
| 1271 | Ga0070715_10032347 | |||
| 1272 | Ga0070715_10061303 | |||
| 1273 | Ga0070716_100027939 | |||
| 1274 | Ga0070712_100046024 | |||
| 1275 | Ga0070712_100180523 | |||
| 1276 | Ga0070712_100571476 | |||
| 1277 | Ga0070712_101139784 | |||
| 1278 | Ga0097621_100084496 | |||
| 1279 | Ga0097621_100313178 | |||
| 1280 | Ga0097621_100360564 | |||
| 1281 | Ga0097621_100533450 | |||
| 1282 | Ga0068871_100099025 | |||
| 1283 | Ga0068871_100223692 | |||
| 1284 | Ga0075433_10035089 | |||
| 1285 | Ga0075433_10584660 | |||
| 1286 | Ga0075433_10649805 | |||
| 1287 | Ga0075434_100036726 | |||
| 1288 | Ga0075434_100103356 | |||
| 1289 | Ga0075434_101772673 | |||
| 1290 | Ga0068865_100143391 | |||
| 1291 | Ga0075436_100019486 | |||
| 1292 | Ga0075436_100849045 | |||
| 1293 | Ga0075436_101314648 | |||
| 1294 | Ga0097620_100090221 | |||
| 1295 | Ga0075435_100042367 | |||
| 1296 | Ga0075435_100044934 | |||
| 1297 | Ga0075435_101242608 | |||
| 1298 | Ga0075435_101343885 | |||
| 1299 | Ga0099794_10124513 | |||
| 1300 | Ga0105251_10054880 | |||
| 1301 | Ga0105240_10654932 | |||
| 1302 | Ga0105240_11234018 | |||
| 1303 | Ga0111539_10276078 | |||
| 1304 | Ga0111539_10307871 | |||
| 1305 | Ga0111539_11437839 | |||
| 1306 | Ga0105245_10084613 | |||
| 1307 | Ga0105245_10327120 | |||
| 1308 | Ga0105245_10939064 | |||
| 1309 | Ga0105247_10115558 | |||
| 1310 | Ga0105247_10305072 | |||
| 1311 | Ga0105247_10428711 | |||
| 1312 | Ga0105243_10972136 | |||
| 1313 | Ga0105241_10145741 | |||
| 1314 | Ga0105241_11388256 | |||
| 1315 | Ga0105248_11611908 | |||
| 1316 | Ga0105248_12166737 | |||
| 1317 | Ga0105237_10213237 | |||
| 1318 | Ga0105237_10822384 | |||
| 1319 | Ga0105238_10129854 | |||
| 1320 | Ga0105249_10041106 | |||
| 1321 | Ga0105249_10496493 | |||
| 1322 | Ga0105249_12533046 | |||
| 1323 | Ga0099796_10053526 | |||
| 1324 | Ga0105239_10259912 | |||
| 1325 | Ga0105239_10528798 | |||
| 1326 | Ga0105239_10957648 | |||
| 1327 | Ga0105246_10077914 | |||
| 1328 | Ga0105246_10728530 | |||
| 1329 | Ga0105246_11690965 | |||
| 1330 | Ga0105246_11897251 | |||
| 1331 | Ga0157343_1005703 | |||
| 1332 | Ga0157314_1005099 | |||
| 1333 | Ga0157347_1008417 | |||
| 1334 | Ga0157313_1015068 | |||
| 1335 | Ga0157342_1004643 | |||
| 1336 | Ga0157316_1021675 | |||
| 1337 | Ga0157338_1007878 | |||
| 1338 | Ga0157373_10103326 | |||
| 1339 | Ga0157371_10039209 | |||
| 1340 | Ga0157371_10210603 | |||
| 1341 | Ga0157369_10039494 | |||
| 1342 | Ga0157369_10187760 | |||
| 1343 | Ga0157369_10219124 | |||
| 1344 | Ga0157369_10846810 | |||
| 1345 | Ga0157369_10851300 | |||
| 1346 | Ga0157369_10869402 | |||
| 1347 | Ga0157369_11083434 | |||
| 1348 | Ga0157374_11015790 | |||
| 1349 | Ga0157378_10965584 | |||
| 1350 | Ga0157378_12044892 | |||
| 1351 | Ga0163162_10258861 | |||
| 1352 | Ga0163162_11027732 | |||
| 1353 | Ga0157372_10075612 | |||
| 1354 | Ga0157372_10311525 | |||
| 1355 | Ga0157372_11945606 | |||
| 1356 | Ga0157375_10304650 | |||
| 1357 | Ga0157375_10620938 | |||
| 1358 | Ga0157375_10959864 | |||
| 1359 | Ga0157375_11735641 | |||
| 1360 | Ga0157375_11754759 | |||
| 1361 | Ga0163163_10080889 | |||
| 1362 | Ga0163163_10421235 | |||
| 1363 | Ga0163163_10445921 | |||
| 1364 | Ga0163163_10446241 | |||
| 1365 | Ga0163163_12411555 | |||
| 1366 | Ga0163163_12918918 | |||
| 1367 | Ga0157380_10019892 | |||
| 1368 | Ga0157380_10918064 | |||
| 1369 | Ga0182008_10311211 | |||
| 1370 | Ga0157377_10042907 | |||
| 1371 | Ga0157377_10126583 | |||
| 1372 | Ga0157379_10363521 | |||
| 1373 | Ga0157379_10410016 | |||
| 1374 | Ga0157379_10933670 | |||
| 1375 | Ga0157379_11161452 | |||
| 1376 | Ga0157376_10997969 | |||
| 1377 | Ga0157376_11043053 | |||
| 1378 | Ga0157376_11453371 | |||
| 1379 | Ga0163161_10053874 | |||
| 1380 | Ga0206356_10642078 | |||
| 1381 | Ga0206354_10265570 | |||
| 1382 | Ga0206354_10793134 | |||
| 1383 | Ga0206353_11413974 | |||
| 1384 | Ga0213872_10234874 | |||
| 1385 | Ga0213874_10045451 | |||
| 1386 | Ga0213874_10211796 | |||
| 1387 | Ga0213876_10036362 | |||
| 1388 | Ga0213875_10001142 | |||
| 1389 | Ga0213875_10045334 | |||
| 1390 | Ga0213875_10052591 | |||
| 1391 | Ga0213875_10058196 | |||
| 1392 | Ga0224712_10061690 | |||
| 1393 | Ga0224712_10233497 | |||
| 1394 | Ga0228598_1018484 | |||
| 1395 | Ga0228598_1071779 | |||
| 1396 | Ga0207653_10010804 | |||
| 1397 | Ga0207692_10004053 | |||
| 1398 | Ga0207692_10040924 | |||
| 1399 | Ga0207692_10071650 | |||
| 1400 | Ga0207642_10073402 | |||
| 1401 | Ga0207642_10303438 | |||
| 1402 | Ga0207710_10079641 | |||
| 1403 | Ga0207688_10007772 | |||
| 1404 | Ga0207688_10045836 | |||
| 1405 | Ga0207688_10157397 | |||
| 1406 | Ga0207680_10784292 | |||
| 1407 | Ga0207647_10057589 | |||
| 1408 | Ga0207647_10256929 | |||
| 1409 | Ga0207699_10044202 | |||
| 1410 | Ga0207699_10073928 | |||
| 1411 | Ga0207699_10079456 | |||
| 1412 | Ga0207699_10180052 | |||
| 1413 | Ga0207699_10429931 | |||
| 1414 | Ga0207699_10845814 | |||
| 1415 | Ga0207645_10013813 | |||
| 1416 | Ga0207645_10053173 | |||
| 1417 | Ga0207643_10076171 | |||
| 1418 | Ga0207643_10383788 | |||
| 1419 | Ga0207705_10121471 | |||
| 1420 | Ga0207684_10003200 | |||
| 1421 | Ga0207684_10020102 | |||
| 1422 | Ga0207684_10077003 | |||
| 1423 | Ga0207684_10094850 | |||
| 1424 | Ga0207684_10606029 | |||
| 1425 | Ga0207684_10885432 | |||
| 1426 | Ga0207654_10800665 | |||
| 1427 | Ga0207654_10897858 | |||
| 1428 | Ga0207654_11189221 | |||
| 1429 | Ga0207707_10101703 | |||
| 1430 | Ga0207671_10963621 | |||
| 1431 | Ga0207693_10011756 | |||
| 1432 | Ga0207693_10056576 | |||
| 1433 | Ga0207693_10059120 | |||
| 1434 | Ga0207663_10114576 | |||
| 1435 | Ga0207663_10131176 | |||
| 1436 | Ga0207663_10144604 | |||
| 1437 | Ga0207663_10190152 | |||
| 1438 | Ga0207663_10347975 | |||
| 1439 | Ga0207663_10847353 | |||
| 1440 | Ga0207660_10192159 | |||
| 1441 | Ga0207662_10002144 | |||
| 1442 | Ga0207662_10045119 | |||
| 1443 | Ga0207657_10015479 | |||
| 1444 | Ga0207657_10023888 | |||
| 1445 | Ga0207649_10406832 | |||
| 1446 | Ga0207646_10005011 | |||
| 1447 | Ga0207646_10112534 | |||
| 1448 | Ga0207646_10271339 | |||
| 1449 | Ga0207646_10396792 | |||
| 1450 | Ga0207646_10400802 | |||
| 1451 | Ga0207646_10481015 | |||
| 1452 | Ga0207646_10545398 | |||
| 1453 | Ga0207681_10132749 | |||
| 1454 | Ga0207659_10333269 | |||
| 1455 | Ga0207659_11039468 | |||
| 1456 | Ga0207687_10045231 | |||
| 1457 | Ga0207687_10276077 | |||
| 1458 | Ga0207700_10135686 | |||
| 1459 | Ga0207700_10224393 | |||
| 1460 | Ga0207700_10226535 | |||
| 1461 | Ga0207700_10234458 | |||
| 1462 | Ga0207700_10305846 | |||
| 1463 | Ga0207700_10334989 | |||
| 1464 | Ga0207700_10577756 | |||
| 1465 | Ga0207700_10689956 | |||
| 1466 | Ga0207700_10854659 | |||
| 1467 | Ga0207700_10871614 | |||
| 1468 | Ga0207664_10014609 | |||
| 1469 | Ga0207664_10022615 | |||
| 1470 | Ga0207664_10042704 | |||
| 1471 | Ga0207664_10045230 | |||
| 1472 | Ga0207664_10223400 | |||
| 1473 | Ga0207664_10460867 | |||
| 1474 | Ga0207664_10921506 | |||
| 1475 | Ga0207664_11824816 | |||
| 1476 | Ga0207644_10013700 | |||
| 1477 | Ga0207644_10218922 | |||
| 1478 | Ga0207644_10886441 | |||
| 1479 | Ga0207690_11457995 | |||
| 1480 | Ga0207706_10014518 | |||
| 1481 | Ga0207706_10020900 | |||
| 1482 | Ga0207706_10749861 | |||
| 1483 | Ga0207686_10545499 | |||
| 1484 | Ga0207709_10338926 | |||
| 1485 | Ga0207669_10529025 | |||
| 1486 | Ga0207669_10822733 | |||
| 1487 | Ga0207669_11132866 | |||
| 1488 | Ga0207704_11144556 | |||
| 1489 | Ga0207665_10017424 | |||
| 1490 | Ga0207665_10023191 | |||
| 1491 | Ga0207691_10063086 | |||
| 1492 | Ga0207691_10144081 | |||
| 1493 | Ga0207711_10648251 | |||
| 1494 | Ga0207689_10005167 | |||
| 1495 | Ga0207689_10092506 | |||
| 1496 | Ga0207689_10287121 | |||
| 1497 | Ga0207689_10734424 | |||
| 1498 | Ga0207661_10623231 | |||
| 1499 | Ga0207661_10876822 | |||
| 1500 | Ga0207679_10034943 | |||
| 1501 | Ga0207679_11077229 | |||
| 1502 | Ga0207667_10100747 | |||
| 1503 | Ga0207667_11069387 | |||
| 1504 | Ga0207651_10334335 | |||
| 1505 | Ga0207651_10607282 | |||
| 1506 | Ga0207712_10886559 | |||
| 1507 | Ga0207668_10770099 | |||
| 1508 | Ga0207668_11511063 | |||
| 1509 | Ga0207640_10198576 | |||
| 1510 | Ga0207640_10283131 | |||
| 1511 | Ga0207640_10311143 | |||
| 1512 | Ga0207658_10091859 | |||
| 1513 | Ga0207658_10871532 | |||
| 1514 | Ga0207677_10421295 | |||
| 1515 | Ga0207677_10907012 | |||
| 1516 | Ga0207703_10885744 | |||
| 1517 | Ga0207639_10331386 | |||
| 1518 | Ga0207639_10839814 | |||
| 1519 | Ga0207678_10016013 | |||
| 1520 | Ga0207678_10112718 | |||
| 1521 | Ga0207708_10017813 | |||
| 1522 | Ga0207708_10032843 | |||
| 1523 | Ga0207708_11276017 | |||
| 1524 | Ga0207702_10132402 | |||
| 1525 | Ga0207702_10228150 | |||
| 1526 | Ga0207702_10426448 | |||
| 1527 | Ga0207641_10027486 | |||
| 1528 | Ga0207641_10640357 | |||
| 1529 | Ga0207641_11298905 | |||
| 1530 | Ga0207648_10089701 | |||
| 1531 | Ga0207648_10871823 | |||
| 1532 | Ga0207648_11790044 | |||
| 1533 | Ga0207676_10418403 | |||
| 1534 | Ga0207676_10650781 | |||
| 1535 | Ga0207676_12175077 | |||
| 1536 | Ga0207674_10009354 | |||
| 1537 | Ga0207674_10257954 | |||
| 1538 | Ga0207674_10540600 | |||
| 1539 | Ga0207674_10595912 | |||
| 1540 | Ga0207675_100019761 | |||
| 1541 | Ga0207675_100024633 | |||
| 1542 | Ga0207683_10003875 | |||
| 1543 | Ga0207683_10055388 | |||
| 1544 | Ga0207683_10209191 | |||
| 1545 | Ga0207683_10944602 | |||
| 1546 | Ga0207683_11268424 | |||
| 1547 | Ga0207698_10252216 | |||
| 1548 | Ga0207428_10088366 | |||
| 1549 | Ga0207428_10732624 | |||
| 1550 | Ga0268266_10045907 | |||
| 1551 | Ga0268266_10256942 | |||
| 1552 | Ga0268266_10421736 | |||
| 1553 | Ga0268266_10542530 | |||
| 1554 | Ga0268266_10798690 | |||
| 1555 | Ga0268265_11187905 | |||
| 1556 | Ga0268265_11413055 | |||
| 1557 | Ga0268264_10170508 | |||
| 1558 | Ga0268264_10388922 | |||
| 1559 | Ga0268264_11535869 | |||
| 1560 | Ga0268264_11624319 | |||
| 1561 | Ga0307513_10159162 | |||
| 1562 | Ga0307408_100230070 | |||
| 1563 | Ga0307410_10294707 | |||
| 1564 | Ga0307410_10368141 | |||
| 1565 | Ga0307410_10624912 | |||
| 1566 | Ga0307407_10717815 | |||
| 1567 | Ga0307409_100850988 | |||
| 1568 | Ga0307414_10157537 | |||
| 1569 | Ga0307411_10195843 | |||
| 1570 | Ga0307411_10368746 | |||
| 1571 | Ga0307411_10439682 | |||
| 1572 | Ga0307415_100041407 | |||
| 1573 | Ga0373948_0003687 | |||
| 1574 | Ga0373948_0053412 | |||
| 1575 | Ga0373950_0088072 | |||
| 1576 | Ga0373958_0176063 | |||
| 1577 | Ga0373938_0039601 | |||
| 1578 | Ga0373926_0002520 | |||
| 1579 | Ga0373926_0004166 | |||
| 1580 | Ga0373928_0022469 | |||
| 1581 | Ga0373929_0140969 | |||
| 1582 | Ga0373934_0000065 | |||
| 1583 | Ga0373934_0042856 | |||
| 1584 | Ga0373934_0044329 | |||
| 1585 | Ga0373934_0137968 | |||
| 1586 | Ga0373934_0421338 | |||
| 1587 | Ga0373940_0001960 | |||
| 1588 | Ga0373940_0059107 | |||
| 1589 | Ga0373944_0000553 | |||
| 1590 | Ga0373944_0001897 | |||
| 1591 | Ga0373944_0024453 | |||
| 1592 | Ga0373944_0093564 | |||
| 1593 | Ga0373944_0153117 | |||
| 1594 | Ga0373944_0310731 | |||
| 1595 | Ga0373952_0099451 | |||
| 1596 | Ga0373923_0025669 | |||
| 1597 | Ga0373923_0058965 | |||
| 1598 | Ga0373923_0082972 | |||
| 1599 | Ga0373923_0112828 | |||
| 1600 | Ga0373923_0217771 | |||
| 1601 | Ga0373932_0333493 | |||
| 1602 | Ga0373936_0002649 | |||
| 1603 | Ga0373936_0012075 | |||
| 1604 | Ga0373936_0021757 | |||
| 1605 | Ga0373936_0116916 | |||
| 1606 | Ga0373936_0575465 | |||
| 1607 | Ga0373945_0000077 | |||
| 1608 | Ga0373953_0000055 | |||
| 1609 | Ga0373953_0004490 | |||
| 1610 | Ga0373953_0065531 | |||
| 1611 | Ga0373953_0088400 | |||
| 1612 | Ga0373954_0017825 | |||
| 1613 | Ga0373954_0022397 | |||
| 1614 | Ga0373956_0000141 | |||
| 1615 | Ga0373956_0009695 | |||
| 1616 | Ga0373956_0080785 | |||
| 1617 | Ga0373956_0281782 | |||
| 1618 | Ga0373957_0000093 | |||
| 1619 | Ga0373957_0055231 | |||
| 1620 | Ga0373957_0075711 | |||
| 1621 | Ga0373957_0083588 | |||
| 1622 | Ga0373957_0219676 | |||
| 1623 | Ga0373960_0223487 | |||
| 1624 | Ga0373960_0432631 | |||
| 1625 | Ga0373943_0000164 | |||
| 1626 | Ga0373943_0003174 | |||
| 1627 | Ga0373943_0029808 | |||
| 1628 | Ga0373943_0128150 | |||
| 1629 | Ga0373943_0136585 | |||
| 1630 | Ga0373946_0002495 | |||
| 1631 | Ga0373946_0047922 | |||
| 1632 | Ga0373946_0163571 | |||
| 1633 | Ga0373946_0224305 | |||
| 1634 | Ga0373955_0000207 | |||
| 1635 | Ga0373955_0007999 | |||
| 1636 | Ga0373955_0035209 | |||
| 1637 | Ga0373955_0093255 | |||
| 1638 | Ga0373955_0158483 | |||
| 1639 | Ga0373955_0185549 | |||
| 1640 | Ga0373955_0307549 | |||
| 1641 | Ga0373955_0369416 | |||
| 1642 | Ga0373962_0021488 | |||
| 1643 | Ga0316574_0302297 | |||
| 1644 | Ga0373924_0000073 | |||
| 1645 | Ga0373924_0002275 | |||
| 1646 | Ga0373924_0012047 | |||
| 1647 | Ga0373924_0107036 | |||
| 1648 | Ga0373931_0152396 | |||
| 1649 | Ga0373931_0694686 | |||
| 1650 | Ga0373935_0003332 | |||
| 1651 | Ga0373935_0054728 | |||
| 1652 | Ga0373935_0096262 | |||
| 1653 | Ga0373935_0149126 | |||
| 1654 | Ga0373935_0215500 | |||
| 1655 | Ga0373935_0285805 | |||
| 1656 | Ga0373935_0446732 | |||
| 1657 | Ga0373935_0532100 | |||
| 1658 | Ga0373927_0021656 | |||
| 1659 | Ga0373927_0027321 | |||
| 1660 | Ga0373927_0035125 | |||
| 1661 | Ga0373927_0421948 | |||
| 1662 | Ga0373933_0000054 | |||
| 1663 | Ga0373933_0003898 | |||
| 1664 | Ga0373933_0011093 | |||
| 1665 | Ga0373933_0052269 | |||
| 1666 | Ga0373933_0058689 | |||
| 1667 | Ga0373933_0086847 | |||
| 1668 | Ga0373933_0120493 | |||
| 1669 | Ga0373947_0001093 | |||
| 1670 | Ga0373947_0001602 | |||
| 1671 | Ga0373947_0046346 | |||
| 1672 | Ga0373947_0098208 | |||
| 1673 | Ga0373947_0169858 | |||
| 1674 | Ga0373947_0278132 | |||
| 1675 | Ga0373937_0000002 | |||
| 1676 | Ga0373937_0010001 | |||
| 1677 | Ga0373937_0047793 | |||
| 1678 | Ga0373937_0135146 | |||
| 1679 | Ga0373937_0219618 | |||
| 1680 | Ga0373937_0249817 | |||
| 1681 | Ga0373937_0274263 | |||
| 1682 | Ga0373937_0327105 | |||
| 1683 | Ga0373925_0005625 | |||
| 1684 | Ga0373925_0009741 | |||
| 1685 | Ga0373925_0083149 | |||
| 1686 | Ga0373925_0109779 | |||
| 1687 | Ga0373925_0249717 | |||
| 1688 | Ga0373925_0250750 | |||
| 1689 | Ga0373925_0325529 | |||
| 1690 | Ga0373925_0358227 | |||
| 1691 | Ga0373925_0516956 | |||
| 1692 | Ga0373925_0866629 | |||
| 1693 | Ga0395899_0004263 | |||
| 1694 | Ga0395900_0272449 | |||
| 1695 | Ga0436364_0021886 | |||
| 1696 | Ga0436364_0669885 | |||
| 1697 | Ga0436364_0769079 | |||
| 1698 | Ga0436364_0872343 | |||
| 1699 | Ga0436364_1084539 | |||
| 1700 | Ga0436364_1262394 | |||
| 1701 | Ga0436364_1401376 | |||
| 1702 | Ga0436365_0222628 | |||
| 1703 | Ga0436365_0416340 | |||
| 1704 | Ga0436365_1293463 | |||
| 1705 | Ga0436361_0158863 | |||
| 1706 | Ga0436363_0530596 | |||
| 1707 | Ga0436363_1105940 | |||
| 1708 | Ga0436363_1174765 | |||
| 1709 | Ga0436363_1265393 | |||
| 1710 | Ga0436362_0624818 | |||
| 1711 | Ga0436362_0727893 | |||
| 1712 | Ga0451789_0553388 | |||
| 1713 | Ga0451791_1593630 | |||
| 1714 | Ga0451804_0297973 | |||
| 1715 | Ga0451841_1052420 | |||
| 1716 | Ga0466972_0009324 | |||
| 1717 | Ga0466965_0138559 | |||
| 1718 | Ga0466965_0146249 | |||
| 1719 | Ga0466966_0004664 | |||
| 1720 | Ga0466961_0171244 | |||
| 1721 | Ga0466961_0438935 | |||
| 1722 | Ga0466961_0439757 | |||
| 1723 | Ga0466963_0002427 | |||
| 1724 | Ga0466963_0036568 | |||
| 1725 | Ga0466963_0414536 | |||
| 1726 | Ga0466963_0825694 | |||
| 1727 | Ga0466964_0732108 | |||
| 1728 | Ga0466971_0097029 | |||
| 1729 | Ga0466970_0053321 | |||
| 1730 | Ga0466957_0288507 | |||
| 1731 | Ga0466957_0931384 | |||
| 1732 | Ga0466960_0001547 | |||
| 1733 | Ga0466960_0288304 | |||
| 1734 | Ga0466959_0127852 | |||
| 1735 | Ga0466959_0833734 | |||
| 1736 | Ga0466958_0000849 | |||
| 1737 | Ga0466958_0228027 | |||
| 1738 | Ga0466967_0005545 | |||
| 1739 | Ga0466967_0129109 | |||
| 1740 | Ga0466967_0159286 | |||
| 1741 | Ga0466967_0186235 | |||
| 1742 | Ga0466967_0203012 | |||
| 1743 | Ga0466967_0515435 | |||
| 1744 | Ga0495592_0000003 | |||
| 1745 | Ga0495592_0033887 | |||
| 1746 | Ga0495592_0044826 | |||
| 1747 | Ga0495592_0051815 | |||
| 1748 | Ga0495592_0191623 | |||
| 1749 | Ga0495592_0251608 | |||
| 1750 | Ga0495592_0745992 | |||
| 1751 | Ga0495603_0000661 | |||
| 1752 | Ga0495603_0074227 | |||
| 1753 | Ga0495629_0001950 | |||
| 1754 | Ga0495629_0012811 | |||
| 1755 | Ga0495629_0179260 | |||
| 1756 | Ga0495629_0282370 | |||
| 1757 | Ga0495641_0001407 | |||
| 1758 | Ga0495641_0006055 | |||
| 1759 | Ga0495641_0035357 | |||
| 1760 | Ga0495641_0071193 | |||
| 1761 | Ga0495641_0091529 | |||
| 1762 | Ga0495651_0000036 | |||
| 1763 | Ga0495651_0003222 | |||
| 1764 | Ga0495651_0023674 | |||
| 1765 | Ga0495651_0055381 | |||
| 1766 | Ga0495651_0159182 | |||
| 1767 | Ga0495651_0223151 | |||
| 1768 | Ga0495651_0246141 | |||
| 1769 | Ga0495651_0267202 | |||
| 1770 | Ga0495651_0942881 | |||
| 1771 | Ga0495653_0000406 | |||
| 1772 | Ga0495653_0002880 | |||
| 1773 | Ga0495653_0007981 | |||
| 1774 | Ga0495653_0038555 | |||
| 1775 | Ga0495653_0038923 | |||
| 1776 | Ga0495653_0093534 | |||
| 1777 | Ga0495653_0112727 | |||
| 1778 | Ga0495653_0443474 | |||
| 1779 | Ga0495650_0030915 | |||
| 1780 | Ga0495580_0006551 | |||
| 1781 | Ga0495580_0110900 | |||
| 1782 | Ga0495582_0002623 | |||
| 1783 | Ga0495582_0020254 | |||
| 1784 | Ga0495582_0037471 | |||
| 1785 | Ga0495582_0200431 | |||
| 1786 | Ga0495639_0007269 | |||
| 1787 | Ga0495639_0042136 | |||
| 1788 | Ga0495639_0328258 | |||
| 1789 | Ga0495662_0001838 | |||
| 1790 | Ga0495662_0007893 | |||
| 1791 | Ga0495662_0044581 | |||
| 1792 | Ga0495662_0384469 | |||
| 1793 | Ga0495664_0000454 | |||
| 1794 | Ga0495664_0101383 | |||
| 1795 | Ga0495664_0121215 | |||
| 1796 | Ga0495664_0229500 | |||
| 1797 | Ga0495664_0264956 | |||
| 1798 | Ga0495594_0031228 | |||
| 1799 | Ga0495608_0000018 | |||
| 1800 | Ga0495608_0026583 | |||
| 1801 | Ga0495608_0027027 | |||
| 1802 | Ga0495608_0034497 | |||
| 1803 | Ga0495608_0040428 | |||
| 1804 | Ga0495608_0041557 | |||
| 1805 | Ga0495618_0007128 | |||
| 1806 | Ga0495618_0015896 | |||
| 1807 | Ga0495618_0017974 | |||
| 1808 | Ga0495618_0028819 | |||
| 1809 | Ga0495618_0066107 | |||
| 1810 | Ga0495618_0078881 | |||
| 1811 | Ga0495618_0204714 | |||
| 1812 | Ga0495628_0000020 | |||
| 1813 | Ga0495628_0110010 | |||
| 1814 | Ga0495628_0240404 | |||
| 1815 | Ga0495628_0253609 | |||
| 1816 | Ga0495630_0036754 | |||
| 1817 | Ga0495630_0052195 | |||
| 1818 | Ga0495630_0075463 | |||
| 1819 | Ga0495630_0096775 | |||
| 1820 | Ga0495630_0449417 | |||
| 1821 | Ga0495630_0501692 | |||
| 1822 | Ga0495666_0016042 | |||
| 1823 | Ga0495666_0022892 | |||
| 1824 | Ga0495666_0095277 | |||
| 1825 | Ga0495652_0000013 | |||
| 1826 | Ga0495652_0022788 | |||
| 1827 | Ga0495652_0030281 | |||
| 1828 | Ga0495652_0064510 | |||
| 1829 | Ga0495652_0147376 | |||
| 1830 | Ga0495652_0213570 | |||
| 1831 | Ga0495652_0417320 | |||
| 1832 | Ga0495665_0001556 | |||
| 1833 | Ga0495665_0019771 | |||
| 1834 | Ga0495665_0050849 | |||
| 1835 | Ga0495665_0086485 | |||
| 1836 | Ga0495640_0016167 | |||
| 1837 | Ga0495640_0023151 | |||
| 1838 | Ga0495640_0031284 | |||
| 1839 | Ga0495640_0031362 | |||
| 1840 | Ga0495640_0034696 | |||
| 1841 | Ga0495640_0161476 | |||
| 1842 | Ga0495640_0842393 | |||
| 1843 | Ga0495586_0006621 | |||
| 1844 | Ga0495586_0608161 | |||
| 1845 | Ga0495587_0000014 | |||
| 1846 | Ga0495587_0005895 | |||
| 1847 | Ga0495587_0009225 | |||
| 1848 | Ga0495587_0020632 | |||
| 1849 | Ga0495587_0184951 | |||
| 1850 | Ga0495587_0252984 | |||
| 1851 | Ga0495645_0030955 | |||
| 1852 | Ga0495645_0060069 | |||
| 1853 | Ga0495645_0072510 | |||
| 1854 | Ga0495645_0121834 | |||
| 1855 | Ga0495645_0138630 | |||
| 1856 | Ga0495645_0168638 | |||
| 1857 | Ga0495645_0200172 | |||
| 1858 | Ga0495622_0121609 | |||
| 1859 | Ga0495667_0000014 | |||
| 1860 | Ga0495667_0000302 | |||
| 1861 | Ga0495667_0016888 | |||
| 1862 | Ga0495667_0037809 | |||
| 1863 | Ga0495667_0097605 | |||
| 1864 | Ga0495667_0180565 | |||
| 1865 | Ga0495668_0699492 | |||
| 1866 | Ga0495634_0029290 | |||
| 1867 | Ga0495634_0059420 | |||
| 1868 | Ga0495634_0078856 | |||
| 1869 | Ga0495634_0091725 | |||
| 1870 | Ga0495634_0180104 | |||
| 1871 | Ga0495634_0211029 | |||
| 1872 | Ga0495634_0288652 | |||
| 1873 | Ga0495634_0346534 | |||
| 1874 | Ga0495635_0000462 | |||
| 1875 | Ga0495635_0002746 | |||
| 1876 | Ga0495635_0004499 | |||
| 1877 | Ga0495635_0014871 | |||
| 1878 | Ga0495635_0033200 | |||
| 1879 | Ga0495635_0247775 | |||
| 1880 | Ga0495635_0443740 | |||
| 1881 | Ga0495635_0545769 | |||
| 1882 | Ga0495588_0033859 | |||
| 1883 | Ga0495588_0135331 | |||
| 1884 | Ga0495657_0000012 | |||
| 1885 | Ga0495657_0006514 | |||
| 1886 | Ga0495657_0016259 | |||
| 1887 | Ga0495657_0042494 | |||
| 1888 | Ga0495657_0047516 | |||
| 1889 | Ga0495657_0105784 | |||
| 1890 | Ga0495657_0109632 | |||
| 1891 | Ga0495599_0000037 | |||
| 1892 | Ga0495599_0011715 | |||
| 1893 | Ga0495599_0012101 | |||
| 1894 | Ga0495599_0029683 | |||
| 1895 | Ga0495623_0000079 | |||
| 1896 | Ga0495623_0009073 | |||
| 1897 | Ga0495623_0027788 | |||
| 1898 | Ga0495623_0129241 | |||
| 1899 | Ga0495646_0009352 | |||
| 1900 | Ga0495646_0011733 | |||
| 1901 | Ga0495646_0055454 | |||
| 1902 | Ga0495646_0075783 | |||
| 1903 | Ga0495646_0097127 | |||
| 1904 | Ga0495646_0282562 | |||
| 1905 | Ga0495647_0001069 | |||
| 1906 | Ga0495647_0120664 | |||
| 1907 | Ga0495658_0002199 | |||
| 1908 | Ga0495613_0006714 | |||
| 1909 | Ga0495613_0220434 | |||
| 1910 | Ga0495613_0689318 | |||
| 1911 | Ga0495624_0005490 | |||
| 1912 | Ga0495624_0008133 | |||
| 1913 | Ga0495624_0124468 | |||
| 1914 | Ga0495624_0127217 | |||
| 1915 | Ga0495624_0177773 | |||
| 1916 | Ga0495600_0003734 | |||
| 1917 | Ga0495600_0009438 | |||
| 1918 | Ga0495600_0013917 | |||
| 1919 | Ga0495600_0016008 | |||
| 1920 | Ga0495600_0029865 | |||
| 1921 | Ga0495600_0091649 | |||
| 1922 | Ga0495600_0289005 | |||
| 1923 | Ga0495581_0009902 | |||
| 1924 | Ga0495581_0023893 | |||
| 1925 | Ga0495581_0026782 | |||
| 1926 | Ga0495604_0005054 | |||
| 1927 | Ga0495604_0011248 | |||
| 1928 | Ga0495604_0083032 | |||
| 1929 | Ga0495604_0089914 | |||
| 1930 | Ga0495604_0325045 | |||
| 1931 | Ga0495604_0434846 | |||
| 1932 | Ga0495674_0000831 | |||
| 1933 | Ga0495674_0001543 | |||
| 1934 | Ga0495674_0013670 | |||
| 1935 | Ga0495674_0019229 | |||
| 1936 | Ga0495674_0160542 | |||
| 1937 | Ga0495674_0326244 | |||
| 1938 | Ga0495674_1186184 | |||
| 1939 | Ga0495676_0020252 | |||
| 1940 | Ga0495676_0064180 | |||
| 1941 | Ga0495676_0081429 | |||
| 1942 | Ga0495676_0124368 | |||
| 1943 | Ga0495676_0216123 | |||
| 1944 | Ga0495680_0000003 | |||
| 1945 | Ga0495680_0001454 | |||
| 1946 | Ga0495680_0002953 | |||
| 1947 | Ga0495680_0010156 | |||
| 1948 | Ga0495680_0029953 | |||
| 1949 | Ga0495680_0040311 | |||
| 1950 | Ga0495680_0055123 | |||
| 1951 | Ga0495680_0226762 | |||
| 1952 | Ga0495680_0270927 | |||
| 1953 | Ga0495680_0343029 | |||
| 1954 | Ga0495675_0000389 | |||
| 1955 | Ga0495675_0020998 | |||
| 1956 | Ga0495675_0033719 | |||
| 1957 | Ga0495675_0200844 | |||
| 1958 | Ga0495675_0236250 | |||
| 1959 | Ga0495684_0003199 | |||
| 1960 | Ga0495684_0005821 | |||
| 1961 | Ga0495684_0007526 | |||
| 1962 | Ga0495684_0011571 | |||
| 1963 | Ga0495684_0023304 | |||
| 1964 | Ga0495684_0070188 | |||
| 1965 | Ga0495684_0148010 | |||
| 1966 | Ga0495684_0612170 | |||
| 1967 | Ga0495593_0000847 | |||
| 1968 | Ga0495593_0006911 | |||
| 1969 | Ga0495593_0011275 | |||
| 1970 | Ga0495593_0020492 | |||
| 1971 | Ga0495602_0000014 | |||
| 1972 | Ga0495602_0025497 | |||
| 1973 | Ga0495602_0035056 | |||
| 1974 | Ga0495602_0143675 | |||
| 1975 | Ga0495602_0430876 | |||
| 1976 | Ga0495602_0496886 | |||
| 1977 | Ga0495602_0843037 | |||
| 1978 | Ga0495614_0007195 | |||
| 1979 | Ga0495614_0018832 | |||
| 1980 | Ga0496100_0035899 | |||
| 1981 | Ga0496100_0524411 | |||
| 1982 | Ga0496100_1388527 | |||
| 1983 | Ga0496101_0131946 | |||
| 1984 | Ga0496101_0183692 | |||
| 1985 | Ga0496101_0527917 | |||
| 1986 | Ga0496101_0722039 | |||
| 1987 | Ga0496101_1088408 | |||
| 1988 | Ga0496102_0099513 | |||
| 1989 | Ga0496102_0630173 | |||
| 1990 | Ga0496102_1000742 | |||
| 1991 | Ga0496104_0011893 | |||
| 1992 | Ga0496104_0044853 | |||
| 1993 | Ga0496104_0319358 | |||
| 1994 | Ga0496104_0473072 | |||
| 1995 | Ga0496104_0539499 | |||
| 1996 | Ga0496104_0559544 | |||
| 1997 | Ga0496105_0007062 | |||
| 1998 | Ga0496105_0115103 | |||
| 1999 | Ga0496105_0118728 | |||
| 2000 | Ga0496106_0098764 | |||
| 2001 | Ga0496106_0235487 | |||
| 2002 | Ga0496106_0269701 | |||
| 2003 | Ga0496107_0119312 | |||
| 2004 | Ga0496108_0013691 | |||
| 2005 | Ga0496108_0020748 | |||
| 2006 | Ga0496108_0193286 | |||
| 2007 | Ga0496108_0343762 | |||
| 2008 | Ga0496108_0373805 | |||
| 2009 | Ga0496108_0751444 | |||
| 2010 | Ga0496108_1134217 | |||
| 2011 | Ga0496109_0158665 | |||
| 2012 | Ga0496109_0492128 | |||
| 2013 | Ga0496109_0603886 | |||
| 2014 | Ga0496109_0657349 | |||
| 2015 | Ga0496109_0867615 | |||
| 2016 | Ga0496109_1257270 | |||
| 2017 | Ga0496109_1790130 | |||
| 2018 | Ga0496110_0188692 | |||
| 2019 | Ga0496110_0383501 | |||
| 2020 | Ga0496110_1203410 | |||
| 2021 | Ga0496111_0030158 | |||
| 2022 | Ga0496111_0063187 | |||
| 2023 | Ga0496111_0202624 | |||
| 2024 | Ga0496111_0659560 | |||
| 2025 | Ga0496112_0003525 | |||
| 2026 | Ga0496112_0060274 | |||
| 2027 | Ga0496112_0136605 | |||
| 2028 | Ga0496112_0212460 | |||
| 2029 | Ga0496112_0616351 | |||
| 2030 | Ga0496112_0712307 | |||
| 2031 | Ga0496113_0043438 | |||
| 2032 | Ga0496113_0557376 | |||
| 2033 | Ga0496113_0761417 | |||
| 2034 | Ga0496113_1048068 | |||
| 2035 | Ga0496113_1118277 | |||
| 2036 | Ga0496114_0154195 | |||
| 2037 | Ga0496114_0458472 | |||
| 2038 | Ga0496115_0010698 | |||
| 2039 | Ga0496115_0113190 | |||
| 2040 | Ga0501039_1018652 | |||
| 2041 | Ga0501042_0044911 | |||
| 2042 | Ga0501043_1056319 | |||
| 2043 | Ga0501072_0380399 | |||
| 2044 | Ga0501079_0386773 | |||
| 2045 | Ga0501081_0439842 | |||
| 2046 | nmdc:mga08y16_127207_c1 | |||
| 2047 | nmdc:mga08y16_859458_c1 | |||
| 2048 | nmdc:mga0n895_5920_c1 | |||
| 2049 | nmdc:mga0n895_65382_c1 | |||
| 2050 | nmdc:mga0n895_889796_c1 | |||
| 2051 | nmdc:mga0rr50_1314241_c1 | |||
| 2052 | nmdc:mga0rr50_14871_c1 | |||
| 2053 | nmdc:mga0rr50_54822_c1 | |||
| 2054 | nmdc:mga0rr50_826443_c1 | |||
| 2055 | nmdc:mga08x19_16182_c1 | |||
| 2056 | nmdc:mga08x19_893659_c1 | |||
| 2057 | nmdc:mga0a205_49641_c1 | |||
| 2058 | nmdc:mga0a205_720479_c1 | |||
| 2059 | Ga0495601_0015583 | |||
| 2060 | Ga0495601_0023159 | |||
| 2061 | Ga0495601_0028281 | |||
| 2062 | Ga0495612_0005770 | |||
| 2063 | Ga0495595_0001199 | |||
| 2064 | Ga0495595_0012038 | |||
| 2065 | Ga0495595_0014508 | |||
| 2066 | Ga0495619_0019205 | |||
| 2067 | Ga0495619_0296007 | |||
| 2068 | Ga0495619_0305932 | |||
| 2069 | Ga0495619_0673468 | |||
| 2070 | Ga0587062_031234 | |||
| 2071 | Ga0466962_0004801 | |||
| 2072 | 2558912312 | |||
| 2073 | 2810363650 | |||
| 2074 | 2816505362 | |||
| 2075 | 2819668105 | |||
| 2076 | 2870788794 | |||
| 2077 | 2915362645 | |||
| 2078 | 8054475115 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wlo-assembly1.cif.gz_A | solution structure of the hypothetical protein from thermus thermophilus hb8 | 0.8824 | 9 | 148 |
| 1wlo-assembly1.cif.gz_A | solution structure of the hypothetical protein from thermus thermophilus hb8 | 0.8644 | 9 | 148 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.8324 | 12 | 146 |
| 5eep-assembly1.cif.gz_A | crystal structure of e. coli csde | 0.8189 | 15 | 146 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.7946 | 12 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGC3_6_142_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9291 | 9 | 147 | 3.90.1010.10 |
| af_P9WGC3_6_142_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9226 | 9 | 147 | 3.90.1010.10 |
| 1wloA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8824 | 9 | 148 | 3.90.1010.10 |
| af_A0A0R0FV61_26_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8782 | 25 | 148 | 3.90.1010.10 |
| 1wloA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8644 | 9 | 148 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399YKW3-F1-model_v4 | Cysteine desulfuration protein SufE | 0.9836 | 10 | 148 |
|
| AF-A0A292Z179-F1-model_v4 | Sulfur acceptor protein SufE | 0.9825 | 7 | 149 |
|
| AF-A0A292Z179-F1-model_v4 | Sulfur acceptor protein SufE | 0.9757 | 7 | 149 |
|
| AF-A0A7X6H7T2-F1-model_v4 | deleted | 0.973 | 24 | 148 |
|
| AF-A0A7Y4HWS9-F1-model_v4 | SufE family protein | 0.9725 | 9 | 146 |
|