F488786

General Info

Members Datasets Scaffolds Average Seq Length
1039 348 2078 148

Family's Representative Sequence

Representative Sequence 3300012500|Ga0157314_1004845|Ga0157314_10048452
Length 172
Sequence MTSSPSSLPPQLAELVDEFAEVGPRDRLQLLLELSQELPELPDRYSDATASMEQVPECQSPLFLAVEVEPAGDRRVHLFFSAPPEAPTTRGFASILRTGLDGEPAAGILAVPDDFYVKLGLGQAVSPLRLRGMAAMLARIKRQVRAGVAGWGISVVEATSKLCEERSPPLPP

Samples

Sample ID Description Type Environment
1 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
104 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
105 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
108 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
245 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
343 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
344 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
345 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
346 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
347 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
348 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.67
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.06
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157314_1004845 3300012500 Bacteria 1003
2 LJQas_1003654 3300000549 Bacteria 2043
3 JGI24735J21928_10088676 3300002067 Bacteria 886
4 JGI25404J52841_10011177 3300003659 Bacteria 1934
5 Ga0070658_10104305 3300005327 Bacteria 2346
6 Ga0070658_11199661 3300005327 Bacteria 660
7 Ga0070676_10061481 3300005328 Bacteria 2233
8 Ga0070683_100010133 3300005329 Bacteria 8089
9 Ga0070683_100164581 3300005329 Bacteria 2104
10 Ga0070683_101075843 3300005329 Bacteria 772
11 Ga0070683_101556590 3300005329 Bacteria 636
12 Ga0070690_101526229 3300005330 Bacteria 540
13 Ga0070670_100214632 3300005331 Bacteria 1673
14 Ga0070670_100385794 3300005331 Bacteria 1235
15 Ga0068869_100048457 3300005334 Bacteria 3072
16 Ga0068869_100080265 3300005334 Bacteria 2433
17 Ga0068869_100194027 3300005334 Bacteria 1598
18 Ga0068869_100959253 3300005334 Bacteria 743
19 Ga0068869_101324989 3300005334 Bacteria 636
20 Ga0070666_10326768 3300005335 Bacteria 1095
21 Ga0070680_100219269 3300005336 Bacteria 1605
22 Ga0070682_100017777 3300005337 Bacteria 4147
23 Ga0070682_100045590 3300005337 Bacteria 2718
24 Ga0070682_100170657 3300005337 Bacteria 1511
25 Ga0070682_100239092 3300005337 Bacteria 1303
26 Ga0070682_100388346 3300005337 Bacteria 1052
27 Ga0070682_100414165 3300005337 Bacteria 1022
28 Ga0068868_100043012 3300005338 Bacteria 3528
29 Ga0068868_100073280 3300005338 Bacteria 2734
30 Ga0068868_100672822 3300005338 Bacteria 923
31 Ga0068868_101312291 3300005338 Bacteria 672
32 Ga0070660_100145004 3300005339 Bacteria 1907
33 Ga0070660_100424222 3300005339 Bacteria 1101
34 Ga0070689_100231932 3300005340 Bacteria 1518
35 Ga0070689_100284504 3300005340 Bacteria 1372
36 Ga0070687_100072860 3300005343 Bacteria 1849
37 Ga0070687_100126729 3300005343 Bacteria 1468
38 Ga0070687_100629113 3300005343 Bacteria 741
39 Ga0070661_100112341 3300005344 Bacteria 2035
40 Ga0070692_10106524 3300005345 Bacteria 1544
41 Ga0070692_11368045 3300005345 Bacteria 510
42 Ga0070668_100115767 3300005347 Bacteria 2137
43 Ga0070668_100139024 3300005347 Bacteria 1956
44 Ga0070668_100959467 3300005347 Bacteria 767
45 Ga0070668_101217430 3300005347 Bacteria 683
46 Ga0070669_100128058 3300005353 Bacteria 1945
47 Ga0070675_100409654 3300005354 Bacteria 1211
48 Ga0070675_100426706 3300005354 Bacteria 1186
49 Ga0070671_100006613 3300005355 Bacteria 9266
50 Ga0070671_100288097 3300005355 Bacteria 1397
51 Ga0070674_100051392 3300005356 Bacteria 2840
52 Ga0070674_100073178 3300005356 Bacteria 2429
53 Ga0070674_100960786 3300005356 Bacteria 748
54 Ga0070674_101383304 3300005356 Bacteria 630
55 Ga0070673_100121492 3300005364 Bacteria 2179
56 Ga0070688_100666547 3300005365 Bacteria 802
57 Ga0070659_100130430 3300005366 Bacteria 2041
58 Ga0070659_100178220 3300005366 Bacteria 1743
59 Ga0070667_100238828 3300005367 Bacteria 1622
60 Ga0070667_100373763 3300005367 Bacteria 1294
61 Ga0070667_100434140 3300005367 Bacteria 1199
62 Ga0070709_10089746 3300005434 Bacteria 2024
63 Ga0070709_10195797 3300005434 Bacteria 1428
64 Ga0070709_10266605 3300005434 Bacteria 1239
65 Ga0070714_100010968 3300005435 Bacteria 7178
66 Ga0070714_100085432 3300005435 Bacteria 2756
67 Ga0070714_100219711 3300005435 Bacteria 1746
68 Ga0070714_100282170 3300005435 Bacteria 1543
69 Ga0070714_100343810 3300005435 Bacteria 1400
70 Ga0070714_100456387 3300005435 Bacteria 1214
71 Ga0070714_100484702 3300005435 Bacteria 1178
72 Ga0070714_100745686 3300005435 Bacteria 946
73 Ga0070714_100897474 3300005435 Bacteria 860
74 Ga0070713_100066279 3300005436 Bacteria 3036
75 Ga0070713_100097647 3300005436 Bacteria 2539
76 Ga0070713_100324547 3300005436 Bacteria 1422
77 Ga0070713_100443980 3300005436 Bacteria 1217
78 Ga0070713_100547427 3300005436 Bacteria 1095
79 Ga0070713_100714225 3300005436 Bacteria 957
80 Ga0070713_100886238 3300005436 Bacteria 858
81 Ga0070710_10010220 3300005437 Bacteria 4606
82 Ga0070710_10025021 3300005437 Bacteria 3156
83 Ga0070710_10038180 3300005437 Bacteria 2636
84 Ga0070710_10123243 3300005437 Bacteria 1571
85 Ga0070710_10224077 3300005437 Bacteria 1197
86 Ga0070710_10250867 3300005437 Bacteria 1137
87 Ga0070710_10259639 3300005437 Bacteria 1120
88 Ga0070710_11085554 3300005437 Bacteria 587
89 Ga0070701_10057036 3300005438 Bacteria 2046
90 Ga0070701_10094393 3300005438 Bacteria 1645
91 Ga0070711_100093981 3300005439 Bacteria 2167
92 Ga0070711_100378670 3300005439 Bacteria 1144
93 Ga0070711_100445242 3300005439 Bacteria 1059
94 Ga0070711_100836482 3300005439 Bacteria 782
95 Ga0070711_100950369 3300005439 Bacteria 735
96 Ga0070705_100756102 3300005440 Bacteria 769
97 Ga0070700_100136296 3300005441 Bacteria 1662
98 Ga0070700_100301955 3300005441 Bacteria 1169
99 Ga0070700_100637938 3300005441 Bacteria 839
100 Ga0070694_100085169 3300005444 Bacteria 2206
101 Ga0070708_100067758 3300005445 Bacteria 3206
102 Ga0070708_100235526 3300005445 Bacteria 1718
103 Ga0070708_100282789 3300005445 Bacteria 1561
104 Ga0070708_100344647 3300005445 Bacteria 1404
105 Ga0070708_100770854 3300005445 Bacteria 904
106 Ga0070708_101327390 3300005445 Bacteria 672
107 Ga0070663_100071242 3300005455 Bacteria 2529
108 Ga0070663_100084123 3300005455 Bacteria 2344
109 Ga0070663_101133845 3300005455 Bacteria 685
110 Ga0070678_100058826 3300005456 Bacteria 2822
111 Ga0070662_101194932 3300005457 Bacteria 654
112 Ga0070685_10081386 3300005466 Bacteria 1942
113 Ga0070685_10125327 3300005466 Bacteria 1599
114 Ga0070685_10293079 3300005466 Bacteria 1094
115 Ga0070685_10359573 3300005466 Bacteria 998
116 Ga0070706_100014528 3300005467 Bacteria 7274
117 Ga0070706_100020291 3300005467 Bacteria 6124
118 Ga0070706_100061918 3300005467 Bacteria 3456
119 Ga0070706_100121825 3300005467 Bacteria 2431
120 Ga0070706_100369843 3300005467 Bacteria 1335
121 Ga0070706_100375891 3300005467 Bacteria 1323
122 Ga0070706_100508414 3300005467 Bacteria 1121
123 Ga0070706_100934721 3300005467 Bacteria 800
124 Ga0070707_100008637 3300005468 Bacteria 9452
125 Ga0070707_100032225 3300005468 Bacteria 4992
126 Ga0070707_100063807 3300005468 Bacteria 3535
127 Ga0070707_100574495 3300005468 Bacteria 1090
128 Ga0070707_100855700 3300005468 Bacteria 873
129 Ga0070707_100868332 3300005468 Bacteria 866
130 Ga0070707_100905693 3300005468 Bacteria 846
131 Ga0070698_100000308 3300005471 Bacteria 49751
132 Ga0070698_100101305 3300005471 Bacteria 2851
133 Ga0070698_100164232 3300005471 Bacteria 2163
134 Ga0070698_100189813 3300005471 Bacteria 1993
135 Ga0070698_100214794 3300005471 Bacteria 1857
136 Ga0070698_100348892 3300005471 Bacteria 1411
137 Ga0070698_100551986 3300005471 Bacteria 1091
138 Ga0070699_100293372 3300005518 Bacteria 1458
139 Ga0070699_100447674 3300005518 Bacteria 1171
140 Ga0070699_100516626 3300005518 Bacteria 1085
141 Ga0070699_100784151 3300005518 Bacteria 872
142 Ga0070699_101124410 3300005518 Bacteria 721
143 Ga0070679_100306096 3300005530 Bacteria 1539
144 Ga0070684_100328046 3300005535 Bacteria 1406
145 Ga0070684_100570997 3300005535 Bacteria 1050
146 Ga0070684_101073271 3300005535 Bacteria 756
147 Ga0070684_101299886 3300005535 Bacteria 684
148 Ga0070684_101410953 3300005535 Bacteria 656
149 Ga0070697_100004980 3300005536 Bacteria 10196
150 Ga0070697_100005122 3300005536 Bacteria 10067
151 Ga0070697_101253910 3300005536 Bacteria 661
152 Ga0068853_100197362 3300005539 Bacteria 1830
153 Ga0068853_100309321 3300005539 Bacteria 1462
154 Ga0068853_101578733 3300005539 Bacteria 636
155 Ga0070672_100585599 3300005543 Bacteria 971
156 Ga0070686_100067208 3300005544 Bacteria 2334
157 Ga0070686_100112399 3300005544 Bacteria 1858
158 Ga0070686_100214821 3300005544 Bacteria 1387
159 Ga0070696_100093758 3300005546 Bacteria 2141
160 Ga0070696_100097333 3300005546 Bacteria 2104
161 Ga0070693_100187885 3300005547 Bacteria 1334
162 Ga0070693_100270120 3300005547 Bacteria 1135
163 Ga0070693_100527194 3300005547 Bacteria 842
164 Ga0070665_100015619 3300005548 Bacteria 7626
165 Ga0070665_100308847 3300005548 Bacteria 1585
166 Ga0070665_100366743 3300005548 Bacteria 1447
167 Ga0070665_100472572 3300005548 Bacteria 1264
168 Ga0070665_100480081 3300005548 Bacteria 1254
169 Ga0070665_100698090 3300005548 Bacteria 1028
170 Ga0070665_100752493 3300005548 Bacteria 987
171 Ga0070665_100903229 3300005548 Bacteria 896
172 Ga0070665_101214992 3300005548 Bacteria 764
173 Ga0070704_100166852 3300005549 Bacteria 1747
174 Ga0068855_100315232 3300005563 Bacteria 1730
175 Ga0068855_102102916 3300005563 Bacteria 568
176 Ga0070664_100058853 3300005564 Bacteria 3268
177 Ga0070664_100393262 3300005564 Bacteria 1267
178 Ga0070664_100498746 3300005564 Bacteria 1122
179 Ga0070664_101563227 3300005564 Bacteria 624
180 Ga0068857_100146134 3300005577 Bacteria 2139
181 Ga0068857_101723658 3300005577 Bacteria 613
182 Ga0068854_100067452 3300005578 Bacteria 2606
183 Ga0068854_100123082 3300005578 Bacteria 1972
184 Ga0068854_100188554 3300005578 Bacteria 1615
185 Ga0068856_100089102 3300005614 Bacteria 3068
186 Ga0068856_100208657 3300005614 Bacteria 1968
187 Ga0068856_100380665 3300005614 Bacteria 1430
188 Ga0068856_100385112 3300005614 Bacteria 1422
189 Ga0068856_100553582 3300005614 Bacteria 1171
190 Ga0068856_101680397 3300005614 Bacteria 647
191 Ga0070702_100098795 3300005615 Bacteria 1786
192 Ga0068852_100023215 3300005616 Bacteria 4989
193 Ga0068852_100727427 3300005616 Bacteria 1004
194 Ga0068859_100090223 3300005617 Bacteria 3116
195 Ga0068864_100259012 3300005618 Bacteria 1617
196 Ga0068864_100338043 3300005618 Bacteria 1418
197 Ga0068864_100426400 3300005618 Bacteria 1264
198 Ga0068864_100849294 3300005618 Bacteria 899
199 Ga0068866_10034753 3300005718 Bacteria 2457
200 Ga0068861_100144239 3300005719 Bacteria 1947
201 Ga0068861_101188824 3300005719 Bacteria 737
202 Ga0068851_10076079 3300005834 Bacteria 1745
203 Ga0068851_10337054 3300005834 Bacteria 875
204 Ga0068870_10064193 3300005840 Bacteria 1983
205 Ga0068870_10088250 3300005840 Bacteria 1728
206 Ga0068870_10290919 3300005840 Bacteria 1028
207 Ga0068870_10395839 3300005840 Bacteria 898
208 Ga0068863_100050833 3300005841 Bacteria 3928
209 Ga0068863_100151463 3300005841 Bacteria 2219
210 Ga0068863_100267518 3300005841 Bacteria 1654
211 Ga0068863_100425178 3300005841 Bacteria 1302
212 Ga0068863_101476785 3300005841 Bacteria 688
213 Ga0068858_100141636 3300005842 Bacteria 2257
214 Ga0068858_100203922 3300005842 Bacteria 1871
215 Ga0068860_100053636 3300005843 Bacteria 3833
216 Ga0068860_100536568 3300005843 Bacteria 1171
217 Ga0068860_102601993 3300005843 Bacteria 525
218 Ga0068862_100198562 3300005844 Bacteria 1808
219 Ga0068862_101111707 3300005844 Bacteria 786
220 Ga0081540_1001418 3300005983 Bacteria 20736
221 Ga0070717_10004588 3300006028 Bacteria 10003
222 Ga0070717_10118622 3300006028 Bacteria 2264
223 Ga0070717_10297442 3300006028 Bacteria 1434
224 Ga0070717_10385994 3300006028 Bacteria 1256
225 Ga0070717_10391053 3300006028 Bacteria 1248
226 Ga0070717_10486228 3300006028 Bacteria 1115
227 Ga0070717_10557928 3300006028 Bacteria 1037
228 Ga0070717_10861681 3300006028 Bacteria 824
229 Ga0070717_11891003 3300006028 Bacteria 539
230 Ga0075432_10143774 3300006058 Bacteria 912
231 Ga0070715_10007549 3300006163 Bacteria 3748
232 Ga0070715_10032347 3300006163 Bacteria 2130
233 Ga0070715_10061303 3300006163 Bacteria 1651
234 Ga0070716_100027939 3300006173 Bacteria 3036
235 Ga0070712_100046024 3300006175 Bacteria 3015
236 Ga0070712_100180523 3300006175 Bacteria 1644
237 Ga0070712_100571476 3300006175 Bacteria 954
238 Ga0070712_101139784 3300006175 Bacteria 677
239 Ga0097621_100084496 3300006237 Bacteria 2646
240 Ga0097621_100313178 3300006237 Bacteria 1389
241 Ga0097621_100360564 3300006237 Bacteria 1295
242 Ga0097621_100533450 3300006237 Bacteria 1067
243 Ga0068871_100099025 3300006358 Bacteria 2440
244 Ga0068871_100223692 3300006358 Bacteria 1631
245 Ga0075433_10035089 3300006852 Bacteria 4311
246 Ga0075433_10584660 3300006852 Bacteria 981
247 Ga0075433_10649805 3300006852 Bacteria 925
248 Ga0075434_100036726 3300006871 Bacteria 4846
249 Ga0075434_100103356 3300006871 Bacteria 2857
250 Ga0075434_101772673 3300006871 Bacteria 624
251 Ga0068865_100143391 3300006881 Bacteria 1803
252 Ga0075436_100019486 3300006914 Bacteria 4649
253 Ga0075436_100849045 3300006914 Bacteria 681
254 Ga0075436_101314648 3300006914 Bacteria 547
255 Ga0097620_100090221 3300006931 Bacteria 3116
256 Ga0075435_100042367 3300007076 Bacteria 3642
257 Ga0075435_100044934 3300007076 Bacteria 3539
258 Ga0075435_101242608 3300007076 Bacteria 652
259 Ga0075435_101343885 3300007076 Bacteria 626
260 Ga0099794_10124513 3300007265 Bacteria 1299
261 Ga0105251_10054880 3300009011 Bacteria 1890
262 Ga0105240_10654932 3300009093 Bacteria 1151
263 Ga0105240_11234018 3300009093 Bacteria 791
264 Ga0111539_10276078 3300009094 Bacteria 1956
265 Ga0111539_10307871 3300009094 Bacteria 1844
266 Ga0111539_11437839 3300009094 Bacteria 800
267 Ga0105245_10084613 3300009098 Bacteria 2906
268 Ga0105245_10327120 3300009098 Bacteria 1512
269 Ga0105245_10939064 3300009098 Bacteria 908
270 Ga0105247_10115558 3300009101 Bacteria 1732
271 Ga0105247_10305072 3300009101 Bacteria 1106
272 Ga0105247_10428711 3300009101 Bacteria 948
273 Ga0105243_10972136 3300009148 Bacteria 850
274 Ga0105241_10145741 3300009174 Bacteria 1932
275 Ga0105241_11388256 3300009174 Bacteria 672
276 Ga0105248_11611908 3300009177 Bacteria 735
277 Ga0105248_12166737 3300009177 Bacteria 632
278 Ga0105237_10213237 3300009545 Bacteria 1930
279 Ga0105237_10822384 3300009545 Bacteria 936
280 Ga0105238_10129854 3300009551 Bacteria 2498
281 Ga0105249_10041106 3300009553 Bacteria 4202
282 Ga0105249_10496493 3300009553 Bacteria 1265
283 Ga0105249_12533046 3300009553 Bacteria 585
284 Ga0099796_10053526 3300010159 Bacteria 1408
285 Ga0105239_10259912 3300010375 Bacteria 1951
286 Ga0105239_10528798 3300010375 Bacteria 1342
287 Ga0105239_10957648 3300010375 Bacteria 983
288 Ga0105246_10077914 3300011119 Bacteria 2353
289 Ga0105246_10728530 3300011119 Bacteria 872
290 Ga0105246_11690965 3300011119 Bacteria 601
291 Ga0105246_11897251 3300011119 Bacteria 572
292 Ga0157343_1005703 3300012488 Bacteria 817
293 Ga0157314_1005099 3300012500 Bacteria 988
294 Ga0157347_1008417 3300012502 Bacteria 1048
295 Ga0157313_1015068 3300012503 Bacteria 722
296 Ga0157342_1004643 3300012507 Bacteria 1229
297 Ga0157316_1021675 3300012510 Bacteria 708
298 Ga0157338_1007878 3300012515 Bacteria 1020
299 Ga0157373_10103326 3300013100 Bacteria 2004
300 Ga0157371_10039209 3300013102 Bacteria 3387
301 Ga0157371_10210603 3300013102 Bacteria 1395
302 Ga0157369_10039494 3300013105 Bacteria 5157
303 Ga0157369_10187760 3300013105 Bacteria 2173
304 Ga0157369_10219124 3300013105 Bacteria 1992
305 Ga0157369_10846810 3300013105 Bacteria 939
306 Ga0157369_10851300 3300013105 Bacteria 936
307 Ga0157369_10869402 3300013105 Bacteria 925
308 Ga0157369_11083434 3300013105 Bacteria 819
309 Ga0157374_11015790 3300013296 Bacteria 849
310 Ga0157378_10965584 3300013297 Bacteria 885
311 Ga0157378_12044892 3300013297 Bacteria 623
312 Ga0163162_10258861 3300013306 Bacteria 1872
313 Ga0163162_11027732 3300013306 Bacteria 932
314 Ga0157372_10075612 3300013307 Bacteria 3800
315 Ga0157372_10311525 3300013307 Bacteria 1832
316 Ga0157372_11945606 3300013307 Bacteria 676
317 Ga0157375_10304650 3300013308 Bacteria 1757
318 Ga0157375_10620938 3300013308 Bacteria 1239
319 Ga0157375_10959864 3300013308 Bacteria 996
320 Ga0157375_11735641 3300013308 Bacteria 739
321 Ga0157375_11754759 3300013308 Bacteria 735
322 Ga0163163_10080889 3300014325 Bacteria 3250
323 Ga0163163_10421235 3300014325 Bacteria 1394
324 Ga0163163_10445921 3300014325 Bacteria 1354
325 Ga0163163_10446241 3300014325 Bacteria 1354
326 Ga0163163_12411555 3300014325 Bacteria 584
327 Ga0163163_12918918 3300014325 Bacteria 533
328 Ga0157380_10019892 3300014326 Bacteria 5009
329 Ga0157380_10918064 3300014326 Bacteria 903
330 Ga0182008_10311211 3300014497 Bacteria 826
331 Ga0157377_10042907 3300014745 Bacteria 2514
332 Ga0157377_10126583 3300014745 Bacteria 1555
333 Ga0157379_10363521 3300014968 Bacteria 1326
334 Ga0157379_10410016 3300014968 Bacteria 1247
335 Ga0157379_10933670 3300014968 Bacteria 824
336 Ga0157379_11161452 3300014968 Bacteria 741
337 Ga0157376_10997969 3300014969 Bacteria 859
338 Ga0157376_11043053 3300014969 Bacteria 842
339 Ga0157376_11453371 3300014969 Bacteria 718
340 Ga0163161_10053874 3300017792 Bacteria 2918
341 Ga0206356_10642078 3300020070 Bacteria 2302
342 Ga0206354_10265570 3300020081 Bacteria 519
343 Ga0206354_10793134 3300020081 Bacteria 2531
344 Ga0206353_11413974 3300020082 Bacteria 1606
345 Ga0213872_10234874 3300021361 Bacteria 777
346 Ga0213874_10045451 3300021377 Bacteria 1329
347 Ga0213874_10211796 3300021377 Bacteria 701
348 Ga0213876_10036362 3300021384 Bacteria 2597
349 Ga0213875_10001142 3300021388 Bacteria 18252
350 Ga0213875_10045334 3300021388 Bacteria 2064
351 Ga0213875_10052591 3300021388 Bacteria 1908
352 Ga0213875_10058196 3300021388 Bacteria 1809
353 Ga0224712_10061690 3300022467 Bacteria 1496
354 Ga0224712_10233497 3300022467 Bacteria 845
355 Ga0228598_1018484 3300024227 Bacteria 1375
356 Ga0228598_1071779 3300024227 Bacteria 692
357 Ga0207653_10010804 3300025885 Bacteria 2848
358 Ga0207692_10004053 3300025898 Bacteria 5774
359 Ga0207692_10040924 3300025898 Bacteria 2290
360 Ga0207692_10071650 3300025898 Bacteria 1828
361 Ga0207642_10073402 3300025899 Bacteria 1636
362 Ga0207642_10303438 3300025899 Bacteria 926
363 Ga0207710_10079641 3300025900 Bacteria 1518
364 Ga0207688_10007772 3300025901 Bacteria 5838
365 Ga0207688_10045836 3300025901 Bacteria 2440
366 Ga0207688_10157397 3300025901 Bacteria 1345
367 Ga0207680_10784292 3300025903 Bacteria 683
368 Ga0207647_10057589 3300025904 Bacteria 2382
369 Ga0207647_10256929 3300025904 Bacteria 1001
370 Ga0207699_10044202 3300025906 Bacteria 2592
371 Ga0207699_10073928 3300025906 Bacteria 2092
372 Ga0207699_10079456 3300025906 Bacteria 2029
373 Ga0207699_10180052 3300025906 Bacteria 1420
374 Ga0207699_10429931 3300025906 Bacteria 944
375 Ga0207699_10845814 3300025906 Bacteria 674
376 Ga0207645_10013813 3300025907 Bacteria 5420
377 Ga0207645_10053173 3300025907 Bacteria 2588
378 Ga0207643_10076171 3300025908 Bacteria 1937
379 Ga0207643_10383788 3300025908 Bacteria 886
380 Ga0207705_10121471 3300025909 Bacteria 1939
381 Ga0207684_10003200 3300025910 Bacteria 16082
382 Ga0207684_10020102 3300025910 Bacteria 5704
383 Ga0207684_10077003 3300025910 Bacteria 2835
384 Ga0207684_10094850 3300025910 Bacteria 2545
385 Ga0207684_10606029 3300025910 Bacteria 935
386 Ga0207684_10885432 3300025910 Bacteria 751
387 Ga0207654_10800665 3300025911 Bacteria 681
388 Ga0207654_10897858 3300025911 Bacteria 642
389 Ga0207654_11189221 3300025911 Bacteria 556
390 Ga0207707_10101703 3300025912 Bacteria 2512
391 Ga0207671_10963621 3300025914 Bacteria 673
392 Ga0207693_10011756 3300025915 Bacteria 7075
393 Ga0207693_10056576 3300025915 Bacteria 3075
394 Ga0207693_10059120 3300025915 Bacteria 3002
395 Ga0207663_10114576 3300025916 Bacteria 1835
396 Ga0207663_10131176 3300025916 Bacteria 1732
397 Ga0207663_10144604 3300025916 Bacteria 1661
398 Ga0207663_10190152 3300025916 Bacteria 1473
399 Ga0207663_10347975 3300025916 Bacteria 1121
400 Ga0207663_10847353 3300025916 Bacteria 729
401 Ga0207660_10192159 3300025917 Bacteria 1590
402 Ga0207662_10002144 3300025918 Bacteria 9824
403 Ga0207662_10045119 3300025918 Bacteria 2605
404 Ga0207657_10015479 3300025919 Bacteria 7389
405 Ga0207657_10023888 3300025919 Bacteria 5678
406 Ga0207649_10406832 3300025920 Bacteria 1019
407 Ga0207646_10005011 3300025922 Bacteria 14111
408 Ga0207646_10112534 3300025922 Bacteria 2443
409 Ga0207646_10271339 3300025922 Bacteria 1533
410 Ga0207646_10396792 3300025922 Bacteria 1246
411 Ga0207646_10400802 3300025922 Bacteria 1239
412 Ga0207646_10481015 3300025922 Bacteria 1119
413 Ga0207646_10545398 3300025922 Bacteria 1043
414 Ga0207681_10132749 3300025923 Bacteria 1843
415 Ga0207659_10333269 3300025926 Bacteria 1255
416 Ga0207659_11039468 3300025926 Bacteria 705
417 Ga0207687_10045231 3300025927 Bacteria 3042
418 Ga0207687_10276077 3300025927 Bacteria 1345
419 Ga0207700_10135686 3300025928 Bacteria 2015
420 Ga0207700_10224393 3300025928 Bacteria 1594
421 Ga0207700_10226535 3300025928 Bacteria 1587
422 Ga0207700_10234458 3300025928 Bacteria 1562
423 Ga0207700_10305846 3300025928 Bacteria 1374
424 Ga0207700_10334989 3300025928 Bacteria 1314
425 Ga0207700_10577756 3300025928 Bacteria 999
426 Ga0207700_10689956 3300025928 Bacteria 911
427 Ga0207700_10854659 3300025928 Bacteria 814
428 Ga0207700_10871614 3300025928 Bacteria 806
429 Ga0207664_10014609 3300025929 Bacteria 5678
430 Ga0207664_10022615 3300025929 Bacteria 4699
431 Ga0207664_10042704 3300025929 Bacteria 3541
432 Ga0207664_10045230 3300025929 Bacteria 3451
433 Ga0207664_10223400 3300025929 Bacteria 1634
434 Ga0207664_10460867 3300025929 Bacteria 1135
435 Ga0207664_10921506 3300025929 Bacteria 784
436 Ga0207664_11824816 3300025929 Bacteria 531
437 Ga0207644_10013700 3300025931 Bacteria 5412
438 Ga0207644_10218922 3300025931 Bacteria 1508
439 Ga0207644_10886441 3300025931 Bacteria 748
440 Ga0207690_11457995 3300025932 Bacteria 572
441 Ga0207706_10014518 3300025933 Bacteria 7139
442 Ga0207706_10020900 3300025933 Bacteria 5878
443 Ga0207706_10749861 3300025933 Bacteria 832
444 Ga0207686_10545499 3300025934 Bacteria 906
445 Ga0207709_10338926 3300025935 Bacteria 1131
446 Ga0207669_10529025 3300025937 Bacteria 948
447 Ga0207669_10822733 3300025937 Bacteria 771
448 Ga0207669_11132866 3300025937 Bacteria 661
449 Ga0207704_11144556 3300025938 Bacteria 662
450 Ga0207665_10017424 3300025939 Bacteria 4720
451 Ga0207665_10023191 3300025939 Bacteria 4088
452 Ga0207691_10063086 3300025940 Bacteria 3361
453 Ga0207691_10144081 3300025940 Bacteria 2098
454 Ga0207711_10648251 3300025941 Bacteria 985
455 Ga0207689_10005167 3300025942 Bacteria 11725
456 Ga0207689_10092506 3300025942 Bacteria 2484
457 Ga0207689_10287121 3300025942 Bacteria 1363
458 Ga0207689_10734424 3300025942 Bacteria 833
459 Ga0207661_10623231 3300025944 Bacteria 991
460 Ga0207661_10876822 3300025944 Bacteria 826
461 Ga0207679_10034943 3300025945 Bacteria 3552
462 Ga0207679_11077229 3300025945 Bacteria 737
463 Ga0207667_10100747 3300025949 Bacteria 2980
464 Ga0207667_11069387 3300025949 Bacteria 791
465 Ga0207651_10334335 3300025960 Bacteria 1271
466 Ga0207651_10607282 3300025960 Bacteria 957
467 Ga0207712_10886559 3300025961 Bacteria 788
468 Ga0207668_10770099 3300025972 Bacteria 850
469 Ga0207668_11511063 3300025972 Bacteria 606
470 Ga0207640_10198576 3300025981 Bacteria 1518
471 Ga0207640_10283131 3300025981 Bacteria 1303
472 Ga0207640_10311143 3300025981 Bacteria 1250
473 Ga0207658_10091859 3300025986 Bacteria 2357
474 Ga0207658_10871532 3300025986 Bacteria 819
475 Ga0207677_10421295 3300026023 Bacteria 1137
476 Ga0207677_10907012 3300026023 Bacteria 795
477 Ga0207703_10885744 3300026035 Bacteria 854
478 Ga0207639_10331386 3300026041 Bacteria 1354
479 Ga0207639_10839814 3300026041 Bacteria 857
480 Ga0207678_10016013 3300026067 Bacteria 6586
481 Ga0207678_10112718 3300026067 Bacteria 2320
482 Ga0207708_10017813 3300026075 Bacteria 5346
483 Ga0207708_10032843 3300026075 Bacteria 3940
484 Ga0207708_11276017 3300026075 Bacteria 643
485 Ga0207702_10132402 3300026078 Bacteria 2245
486 Ga0207702_10228150 3300026078 Bacteria 1739
487 Ga0207702_10426448 3300026078 Bacteria 1283
488 Ga0207641_10027486 3300026088 Bacteria 4699
489 Ga0207641_10640357 3300026088 Bacteria 1043
490 Ga0207641_11298905 3300026088 Bacteria 728
491 Ga0207648_10089701 3300026089 Bacteria 2686
492 Ga0207648_10871823 3300026089 Bacteria 840
493 Ga0207648_11790044 3300026089 Bacteria 576
494 Ga0207676_10418403 3300026095 Bacteria 1256
495 Ga0207676_10650781 3300026095 Bacteria 1017
496 Ga0207676_12175077 3300026095 Bacteria 553
497 Ga0207674_10009354 3300026116 Bacteria 11212
498 Ga0207674_10257954 3300026116 Bacteria 1690
499 Ga0207674_10540600 3300026116 Bacteria 1126
500 Ga0207674_10595912 3300026116 Bacteria 1067
501 Ga0207675_100019761 3300026118 Bacteria 6288
502 Ga0207675_100024633 3300026118 Bacteria 5595
503 Ga0207683_10003875 3300026121 Bacteria 12975
504 Ga0207683_10055388 3300026121 Bacteria 3477
505 Ga0207683_10209191 3300026121 Bacteria 1775
506 Ga0207683_10944602 3300026121 Bacteria 801
507 Ga0207683_11268424 3300026121 Bacteria 682
508 Ga0207698_10252216 3300026142 Bacteria 1615
509 Ga0207428_10088366 3300027907 Bacteria 2410
510 Ga0207428_10732624 3300027907 Bacteria 705
511 Ga0268266_10045907 3300028379 Bacteria 3739
512 Ga0268266_10256942 3300028379 Bacteria 1618
513 Ga0268266_10421736 3300028379 Bacteria 1264
514 Ga0268266_10542530 3300028379 Bacteria 1113
515 Ga0268266_10798690 3300028379 Bacteria 911
516 Ga0268265_11187905 3300028380 Bacteria 760
517 Ga0268265_11413055 3300028380 Bacteria 698
518 Ga0268264_10170508 3300028381 Bacteria 1968
519 Ga0268264_10388922 3300028381 Bacteria 1337
520 Ga0268264_11535869 3300028381 Bacteria 676
521 Ga0268264_11624319 3300028381 Bacteria 657
522 Ga0307513_10159162 3300031456 Bacteria 2153
523 Ga0307408_100230070 3300031548 Bacteria 1518
524 Ga0307410_10294707 3300031852 Bacteria 1278
525 Ga0307410_10368141 3300031852 Bacteria 1153
526 Ga0307410_10624912 3300031852 Bacteria 901
527 Ga0307407_10717815 3300031903 Bacteria 754
528 Ga0307409_100850988 3300031995 Bacteria 923
529 Ga0307414_10157537 3300032004 Bacteria 1800
530 Ga0307411_10195843 3300032005 Bacteria 1547
531 Ga0307411_10368746 3300032005 Bacteria 1177
532 Ga0307411_10439682 3300032005 Bacteria 1088
533 Ga0307415_100041407 3300032126 Bacteria 3059
534 Ga0373948_0003687 3300034817 Bacteria 2375
535 Ga0373948_0053412 3300034817 Bacteria 873
536 Ga0373950_0088072 3300034818 Bacteria 656
537 Ga0373958_0176063 3300034819 Bacteria 549
538 Ga0373938_0039601 3300034957 Bacteria 1043
539 Ga0373926_0002520 3300035083 Bacteria 5818
540 Ga0373926_0004166 3300035083 Bacteria 4716
541 Ga0373928_0022469 3300035084 Bacteria 1338
542 Ga0373929_0140969 3300035085 Bacteria 640
543 Ga0373934_0000065 3300035086 Bacteria 35636
544 Ga0373934_0042856 3300035086 Bacteria 1788
545 Ga0373934_0044329 3300035086 Bacteria 1758
546 Ga0373934_0137968 3300035086 Bacteria 996
547 Ga0373934_0421338 3300035086 Bacteria 559
548 Ga0373940_0001960 3300035088 Bacteria 3886
549 Ga0373940_0059107 3300035088 Bacteria 1093
550 Ga0373944_0000553 3300035089 Bacteria 8845
551 Ga0373944_0001897 3300035089 Bacteria 5285
552 Ga0373944_0024453 3300035089 Bacteria 1771
553 Ga0373944_0093564 3300035089 Bacteria 1007
554 Ga0373944_0153117 3300035089 Bacteria 814
555 Ga0373944_0310731 3300035089 Bacteria 593
556 Ga0373952_0099451 3300035092 Bacteria 766
557 Ga0373923_0025669 3300035111 Bacteria 2338
558 Ga0373923_0058965 3300035111 Bacteria 1626
559 Ga0373923_0082972 3300035111 Bacteria 1392
560 Ga0373923_0112828 3300035111 Bacteria 1208
561 Ga0373923_0217771 3300035111 Bacteria 887
562 Ga0373932_0333493 3300035112 Bacteria 573
563 Ga0373936_0002649 3300035113 Bacteria 6698
564 Ga0373936_0012075 3300035113 Bacteria 3280
565 Ga0373936_0021757 3300035113 Bacteria 2494
566 Ga0373936_0116916 3300035113 Bacteria 1136
567 Ga0373936_0575465 3300035113 Bacteria 528
568 Ga0373945_0000077 3300035116 Bacteria 22256
569 Ga0373953_0000055 3300035117 Bacteria 28969
570 Ga0373953_0004490 3300035117 Bacteria 4453
571 Ga0373953_0065531 3300035117 Bacteria 1491
572 Ga0373953_0088400 3300035117 Bacteria 1294
573 Ga0373954_0017825 3300035118 Bacteria 3193
574 Ga0373954_0022397 3300035118 Bacteria 2865
575 Ga0373956_0000141 3300035119 Bacteria 26025
576 Ga0373956_0009695 3300035119 Bacteria 3921
577 Ga0373956_0080785 3300035119 Bacteria 1491
578 Ga0373956_0281782 3300035119 Bacteria 791
579 Ga0373957_0000093 3300035120 Bacteria 21429
580 Ga0373957_0055231 3300035120 Bacteria 1526
581 Ga0373957_0075711 3300035120 Bacteria 1322
582 Ga0373957_0083588 3300035120 Bacteria 1262
583 Ga0373957_0219676 3300035120 Bacteria 795
584 Ga0373960_0223487 3300035121 Bacteria 674
585 Ga0373960_0432631 3300035121 Bacteria 513
586 Ga0373943_0000164 3300035170 Bacteria 25955
587 Ga0373943_0003174 3300035170 Bacteria 7462
588 Ga0373943_0029808 3300035170 Bacteria 2579
589 Ga0373943_0128150 3300035170 Bacteria 1356
590 Ga0373943_0136585 3300035170 Bacteria 1317
591 Ga0373946_0002495 3300035171 Bacteria 6499
592 Ga0373946_0047922 3300035171 Bacteria 1776
593 Ga0373946_0163571 3300035171 Bacteria 1046
594 Ga0373946_0224305 3300035171 Bacteria 908
595 Ga0373955_0000207 3300035172 Bacteria 24476
596 Ga0373955_0007999 3300035172 Bacteria 4887
597 Ga0373955_0035209 3300035172 Bacteria 2650
598 Ga0373955_0093255 3300035172 Bacteria 1719
599 Ga0373955_0158483 3300035172 Bacteria 1334
600 Ga0373955_0185549 3300035172 Bacteria 1235
601 Ga0373955_0307549 3300035172 Bacteria 956
602 Ga0373955_0369416 3300035172 Bacteria 870
603 Ga0373962_0021488 3300035242 Bacteria 1703
604 Ga0316574_0302297 3300035398 Bacteria 1017
605 Ga0373924_0000073 3300035410 Bacteria 26960
606 Ga0373924_0002275 3300035410 Bacteria 6445
607 Ga0373924_0012047 3300035410 Bacteria 3223
608 Ga0373924_0107036 3300035410 Bacteria 1206
609 Ga0373931_0152396 3300035691 Bacteria 1348
610 Ga0373931_0694686 3300035691 Bacteria 671
611 Ga0373935_0003332 3300035692 Bacteria 9301
612 Ga0373935_0054728 3300035692 Bacteria 2542
613 Ga0373935_0096262 3300035692 Bacteria 1945
614 Ga0373935_0149126 3300035692 Bacteria 1585
615 Ga0373935_0215500 3300035692 Bacteria 1332
616 Ga0373935_0285805 3300035692 Bacteria 1162
617 Ga0373935_0446732 3300035692 Bacteria 933
618 Ga0373935_0532100 3300035692 Bacteria 855
619 Ga0373927_0021656 3300035695 Bacteria 4212
620 Ga0373927_0027321 3300035695 Bacteria 3726
621 Ga0373927_0035125 3300035695 Bacteria 3259
622 Ga0373927_0421948 3300035695 Bacteria 880
623 Ga0373933_0000054 3300035724 Bacteria 69499
624 Ga0373933_0003898 3300035724 Bacteria 8231
625 Ga0373933_0011093 3300035724 Bacteria 4953
626 Ga0373933_0052269 3300035724 Bacteria 2444
627 Ga0373933_0058689 3300035724 Bacteria 2315
628 Ga0373933_0086847 3300035724 Bacteria 1925
629 Ga0373933_0120493 3300035724 Bacteria 1643
630 Ga0373947_0001093 3300035725 Bacteria 16622
631 Ga0373947_0001602 3300035725 Bacteria 13873
632 Ga0373947_0046346 3300035725 Bacteria 2603
633 Ga0373947_0098208 3300035725 Bacteria 1837
634 Ga0373947_0169858 3300035725 Bacteria 1414
635 Ga0373947_0278132 3300035725 Bacteria 1112
636 Ga0373937_0000002 3300036401 Bacteria 304133
637 Ga0373937_0010001 3300036401 Bacteria 8272
638 Ga0373937_0047793 3300036401 Bacteria 3916
639 Ga0373937_0135146 3300036401 Bacteria 2305
640 Ga0373937_0219618 3300036401 Bacteria 1789
641 Ga0373937_0249817 3300036401 Bacteria 1672
642 Ga0373937_0274263 3300036401 Bacteria 1592
643 Ga0373937_0327105 3300036401 Bacteria 1450
644 Ga0373925_0005625 3300037068 Bacteria 9322
645 Ga0373925_0009741 3300037068 Bacteria 6979
646 Ga0373925_0083149 3300037068 Bacteria 2437
647 Ga0373925_0109779 3300037068 Bacteria 2129
648 Ga0373925_0249717 3300037068 Bacteria 1422
649 Ga0373925_0250750 3300037068 Bacteria 1419
650 Ga0373925_0325529 3300037068 Bacteria 1244
651 Ga0373925_0358227 3300037068 Bacteria 1185
652 Ga0373925_0516956 3300037068 Bacteria 981
653 Ga0373925_0866629 3300037068 Bacteria 744
654 Ga0395899_0004263 3300037312 Bacteria 11193
655 Ga0395900_0272449 3300037418 Bacteria 1687
656 Ga0436364_0021886 3300037853 Bacteria 1460
657 Ga0436364_0669885 3300037853 Bacteria 2675
658 Ga0436364_0769079 3300037853 Bacteria 1747
659 Ga0436364_0872343 3300037853 Bacteria 586
660 Ga0436364_1084539 3300037853 Bacteria 1167
661 Ga0436364_1262394 3300037853 Bacteria 14344
662 Ga0436364_1401376 3300037853 Bacteria 69007
663 Ga0436365_0222628 3300039437 Bacteria 6155
664 Ga0436365_0416340 3300039437 Bacteria 991
665 Ga0436365_1293463 3300039437 Bacteria 1618
666 Ga0436361_0158863 3300039447 Bacteria 695
667 Ga0436363_0530596 3300039450 Bacteria 1255
668 Ga0436363_1105940 3300039450 Bacteria 1190
669 Ga0436363_1174765 3300039450 Bacteria 2856
670 Ga0436363_1265393 3300039450 Bacteria 2418
671 Ga0436362_0624818 3300039453 Bacteria 960
672 Ga0436362_0727893 3300039453 Bacteria 1011
673 Ga0451789_0553388 3300041443 Bacteria 732
674 Ga0451791_1593630 3300041451 Bacteria 1354
675 Ga0451804_0297973 3300041463 Bacteria 632
676 Ga0451841_1052420 3300041498 Bacteria 631
677 Ga0466972_0009324 3300044658 Bacteria 4934
678 Ga0466965_0138559 3300044683 Bacteria 1265
679 Ga0466965_0146249 3300044683 Bacteria 1233
680 Ga0466966_0004664 3300044684 Bacteria 9025
681 Ga0466961_0171244 3300044693 Bacteria 1350
682 Ga0466961_0438935 3300044693 Bacteria 790
683 Ga0466961_0439757 3300044693 Bacteria 790
684 Ga0466963_0002427 3300044694 Bacteria 10422
685 Ga0466963_0036568 3300044694 Bacteria 3203
686 Ga0466963_0414536 3300044694 Bacteria 950
687 Ga0466963_0825694 3300044694 Bacteria 654
688 Ga0466964_0732108 3300044706 Bacteria 554
689 Ga0466971_0097029 3300044719 Bacteria 1352
690 Ga0466970_0053321 3300044765 Bacteria 2159
691 Ga0466957_0288507 3300044842 Bacteria 1100
692 Ga0466957_0931384 3300044842 Bacteria 622
693 Ga0466960_0001547 3300044901 Bacteria 8411
694 Ga0466960_0288304 3300044901 Bacteria 922
695 Ga0466959_0127852 3300045049 Bacteria 1802
696 Ga0466959_0833734 3300045049 Bacteria 616
697 Ga0466958_0000849 3300045836 Bacteria 13568
698 Ga0466958_0228027 3300045836 Bacteria 1189
699 Ga0466967_0005545 3300045976 Bacteria 8762
700 Ga0466967_0129109 3300045976 Bacteria 2345
701 Ga0466967_0159286 3300045976 Bacteria 2117
702 Ga0466967_0186235 3300045976 Bacteria 1960
703 Ga0466967_0203012 3300045976 Bacteria 1878
704 Ga0466967_0515435 3300045976 Bacteria 1175
705 Ga0495592_0000003 3300046454 Bacteria 200744
706 Ga0495592_0033887 3300046454 Bacteria 3851
707 Ga0495592_0044826 3300046454 Bacteria 3302
708 Ga0495592_0051815 3300046454 Bacteria 3048
709 Ga0495592_0191623 3300046454 Bacteria 1385
710 Ga0495592_0251608 3300046454 Bacteria 1167
711 Ga0495592_0745992 3300046454 Bacteria 585
712 Ga0495603_0000661 3300046455 Bacteria 19477
713 Ga0495603_0074227 3300046455 Bacteria 1997
714 Ga0495629_0001950 3300046459 Bacteria 16079
715 Ga0495629_0012811 3300046459 Bacteria 6069
716 Ga0495629_0179260 3300046459 Bacteria 1469
717 Ga0495629_0282370 3300046459 Bacteria 1139
718 Ga0495641_0001407 3300046461 Bacteria 20458
719 Ga0495641_0006055 3300046461 Bacteria 7956
720 Ga0495641_0035357 3300046461 Bacteria 2356
721 Ga0495641_0071193 3300046461 Bacteria 1561
722 Ga0495641_0091529 3300046461 Bacteria 1359
723 Ga0495651_0000036 3300046462 Bacteria 97779
724 Ga0495651_0003222 3300046462 Bacteria 12534
725 Ga0495651_0023674 3300046462 Bacteria 4775
726 Ga0495651_0055381 3300046462 Bacteria 3047
727 Ga0495651_0159182 3300046462 Bacteria 1619
728 Ga0495651_0223151 3300046462 Bacteria 1303
729 Ga0495651_0246141 3300046462 Bacteria 1223
730 Ga0495651_0267202 3300046462 Bacteria 1161
731 Ga0495651_0942881 3300046462 Bacteria 526
732 Ga0495653_0000406 3300046463 Bacteria 34551
733 Ga0495653_0002880 3300046463 Bacteria 13761
734 Ga0495653_0007981 3300046463 Bacteria 8668
735 Ga0495653_0038555 3300046463 Bacteria 3750
736 Ga0495653_0038923 3300046463 Bacteria 3729
737 Ga0495653_0093534 3300046463 Bacteria 2192
738 Ga0495653_0112727 3300046463 Bacteria 1951
739 Ga0495653_0443474 3300046463 Bacteria 818
740 Ga0495650_0030915 3300046471 Bacteria 2418
741 Ga0495580_0006551 3300046472 Bacteria 9468
742 Ga0495580_0110900 3300046472 Bacteria 1905
743 Ga0495582_0002623 3300046473 Bacteria 10014
744 Ga0495582_0020254 3300046473 Bacteria 3640
745 Ga0495582_0037471 3300046473 Bacteria 2667
746 Ga0495582_0200431 3300046473 Bacteria 1140
747 Ga0495639_0007269 3300046475 Bacteria 4753
748 Ga0495639_0042136 3300046475 Bacteria 2058
749 Ga0495639_0328258 3300046475 Bacteria 766
750 Ga0495662_0001838 3300046476 Bacteria 10636
751 Ga0495662_0007893 3300046476 Bacteria 5240
752 Ga0495662_0044581 3300046476 Bacteria 2141
753 Ga0495662_0384469 3300046476 Bacteria 689
754 Ga0495664_0000454 3300046477 Bacteria 20119
755 Ga0495664_0101383 3300046477 Bacteria 1734
756 Ga0495664_0121215 3300046477 Bacteria 1582
757 Ga0495664_0229500 3300046477 Bacteria 1123
758 Ga0495664_0264956 3300046477 Bacteria 1038
759 Ga0495594_0031228 3300046499 Bacteria 2887
760 Ga0495608_0000018 3300046511 Bacteria 192512
761 Ga0495608_0026583 3300046511 Bacteria 3943
762 Ga0495608_0027027 3300046511 Bacteria 3907
763 Ga0495608_0034497 3300046511 Bacteria 3415
764 Ga0495608_0040428 3300046511 Bacteria 3124
765 Ga0495608_0041557 3300046511 Bacteria 3076
766 Ga0495618_0007128 3300046514 Bacteria 6762
767 Ga0495618_0015896 3300046514 Bacteria 4594
768 Ga0495618_0017974 3300046514 Bacteria 4338
769 Ga0495618_0028819 3300046514 Bacteria 3461
770 Ga0495618_0066107 3300046514 Bacteria 2298
771 Ga0495618_0078881 3300046514 Bacteria 2099
772 Ga0495618_0204714 3300046514 Bacteria 1248
773 Ga0495628_0000020 3300046516 Bacteria 148606
774 Ga0495628_0110010 3300046516 Bacteria 2120
775 Ga0495628_0240404 3300046516 Bacteria 1354
776 Ga0495628_0253609 3300046516 Bacteria 1313
777 Ga0495630_0036754 3300046517 Bacteria 3660
778 Ga0495630_0052195 3300046517 Bacteria 3061
779 Ga0495630_0075463 3300046517 Bacteria 2540
780 Ga0495630_0096775 3300046517 Bacteria 2231
781 Ga0495630_0449417 3300046517 Bacteria 987
782 Ga0495630_0501692 3300046517 Bacteria 930
783 Ga0495666_0016042 3300046526 Bacteria 3730
784 Ga0495666_0022892 3300046526 Bacteria 3092
785 Ga0495666_0095277 3300046526 Bacteria 1404
786 Ga0495652_0000013 3300046529 Bacteria 238164
787 Ga0495652_0022788 3300046529 Bacteria 5556
788 Ga0495652_0030281 3300046529 Bacteria 4747
789 Ga0495652_0064510 3300046529 Bacteria 3080
790 Ga0495652_0147376 3300046529 Bacteria 1843
791 Ga0495652_0213570 3300046529 Bacteria 1454
792 Ga0495652_0417320 3300046529 Bacteria 946
793 Ga0495665_0001556 3300046531 Bacteria 12246
794 Ga0495665_0019771 3300046531 Bacteria 3622
795 Ga0495665_0050849 3300046531 Bacteria 2196
796 Ga0495665_0086485 3300046531 Bacteria 1647
797 Ga0495640_0016167 3300046533 Bacteria 5586
798 Ga0495640_0023151 3300046533 Bacteria 4533
799 Ga0495640_0031284 3300046533 Bacteria 3799
800 Ga0495640_0031362 3300046533 Bacteria 3793
801 Ga0495640_0034696 3300046533 Bacteria 3574
802 Ga0495640_0161476 3300046533 Bacteria 1435
803 Ga0495640_0842393 3300046533 Bacteria 545
804 Ga0495586_0006621 3300046535 Bacteria 6187
805 Ga0495586_0608161 3300046535 Bacteria 631
806 Ga0495587_0000014 3300046536 Bacteria 192100
807 Ga0495587_0005895 3300046536 Bacteria 7985
808 Ga0495587_0009225 3300046536 Bacteria 6331
809 Ga0495587_0020632 3300046536 Bacteria 4064
810 Ga0495587_0184951 3300046536 Bacteria 1180
811 Ga0495587_0252984 3300046536 Bacteria 990
812 Ga0495645_0030955 3300046543 Bacteria 3897
813 Ga0495645_0060069 3300046543 Bacteria 2755
814 Ga0495645_0072510 3300046543 Bacteria 2481
815 Ga0495645_0121834 3300046543 Bacteria 1835
816 Ga0495645_0138630 3300046543 Bacteria 1699
817 Ga0495645_0168638 3300046543 Bacteria 1508
818 Ga0495645_0200172 3300046543 Bacteria 1355
819 Ga0495622_0121609 3300046557 Bacteria 1192
820 Ga0495667_0000014 3300046559 Bacteria 200767
821 Ga0495667_0000302 3300046559 Bacteria 31369
822 Ga0495667_0016888 3300046559 Bacteria 4928
823 Ga0495667_0037809 3300046559 Bacteria 3215
824 Ga0495667_0097605 3300046559 Bacteria 1902
825 Ga0495667_0180565 3300046559 Bacteria 1354
826 Ga0495668_0699492 3300046616 Bacteria 561
827 Ga0495634_0029290 3300046642 Bacteria 3812
828 Ga0495634_0059420 3300046642 Bacteria 2546
829 Ga0495634_0078856 3300046642 Bacteria 2157
830 Ga0495634_0091725 3300046642 Bacteria 1971
831 Ga0495634_0180104 3300046642 Bacteria 1323
832 Ga0495634_0211029 3300046642 Bacteria 1202
833 Ga0495634_0288652 3300046642 Bacteria 994
834 Ga0495634_0346534 3300046642 Bacteria 890
835 Ga0495635_0000462 3300046663 Bacteria 25695
836 Ga0495635_0002746 3300046663 Bacteria 12067
837 Ga0495635_0004499 3300046663 Bacteria 9661
838 Ga0495635_0014871 3300046663 Bacteria 5445
839 Ga0495635_0033200 3300046663 Bacteria 3579
840 Ga0495635_0247775 3300046663 Bacteria 1201
841 Ga0495635_0443740 3300046663 Bacteria 858
842 Ga0495635_0545769 3300046663 Bacteria 760
843 Ga0495588_0033859 3300046674 Bacteria 2583
844 Ga0495588_0135331 3300046674 Bacteria 1301
845 Ga0495657_0000012 3300046675 Bacteria 197154
846 Ga0495657_0006514 3300046675 Bacteria 9129
847 Ga0495657_0016259 3300046675 Bacteria 5423
848 Ga0495657_0042494 3300046675 Bacteria 3103
849 Ga0495657_0047516 3300046675 Bacteria 2900
850 Ga0495657_0105784 3300046675 Bacteria 1787
851 Ga0495657_0109632 3300046675 Bacteria 1750
852 Ga0495599_0000037 3300046678 Bacteria 101892
853 Ga0495599_0011715 3300046678 Bacteria 5389
854 Ga0495599_0012101 3300046678 Bacteria 5311
855 Ga0495599_0029683 3300046678 Bacteria 3428
856 Ga0495623_0000079 3300046679 Bacteria 57590
857 Ga0495623_0009073 3300046679 Bacteria 6451
858 Ga0495623_0027788 3300046679 Bacteria 3642
859 Ga0495623_0129241 3300046679 Bacteria 1514
860 Ga0495646_0009352 3300046680 Bacteria 6217
861 Ga0495646_0011733 3300046680 Bacteria 5571
862 Ga0495646_0055454 3300046680 Bacteria 2380
863 Ga0495646_0075783 3300046680 Bacteria 1971
864 Ga0495646_0097127 3300046680 Bacteria 1693
865 Ga0495646_0282562 3300046680 Bacteria 881
866 Ga0495647_0001069 3300046681 Bacteria 8346
867 Ga0495647_0120664 3300046681 Bacteria 1102
868 Ga0495658_0002199 3300046683 Bacteria 9868
869 Ga0495613_0006714 3300046689 Bacteria 8590
870 Ga0495613_0220434 3300046689 Bacteria 1332
871 Ga0495613_0689318 3300046689 Bacteria 673
872 Ga0495624_0005490 3300046690 Bacteria 9129
873 Ga0495624_0008133 3300046690 Bacteria 7341
874 Ga0495624_0124468 3300046690 Bacteria 1582
875 Ga0495624_0127217 3300046690 Bacteria 1563
876 Ga0495624_0177773 3300046690 Bacteria 1297
877 Ga0495600_0003734 3300046809 Bacteria 9005
878 Ga0495600_0009438 3300046809 Bacteria 6027
879 Ga0495600_0013917 3300046809 Bacteria 5068
880 Ga0495600_0016008 3300046809 Bacteria 4753
881 Ga0495600_0029865 3300046809 Bacteria 3531
882 Ga0495600_0091649 3300046809 Bacteria 1982
883 Ga0495600_0289005 3300046809 Bacteria 1036
884 Ga0495581_0009902 3300047315 Bacteria 5513
885 Ga0495581_0023893 3300047315 Bacteria 3542
886 Ga0495581_0026782 3300047315 Bacteria 3342
887 Ga0495604_0005054 3300047317 Bacteria 10439
888 Ga0495604_0011248 3300047317 Bacteria 7105
889 Ga0495604_0083032 3300047317 Bacteria 2395
890 Ga0495604_0089914 3300047317 Bacteria 2281
891 Ga0495604_0325045 3300047317 Bacteria 1027
892 Ga0495604_0434846 3300047317 Bacteria 859
893 Ga0495674_0000831 3300047319 Bacteria 29544
894 Ga0495674_0001543 3300047319 Bacteria 22531
895 Ga0495674_0013670 3300047319 Bacteria 7627
896 Ga0495674_0019229 3300047319 Bacteria 6344
897 Ga0495674_0160542 3300047319 Bacteria 1881
898 Ga0495674_0326244 3300047319 Bacteria 1249
899 Ga0495674_1186184 3300047319 Bacteria 578
900 Ga0495676_0020252 3300047321 Bacteria 5841
901 Ga0495676_0064180 3300047321 Bacteria 2858
902 Ga0495676_0081429 3300047321 Bacteria 2454
903 Ga0495676_0124368 3300047321 Bacteria 1871
904 Ga0495676_0216123 3300047321 Bacteria 1323
905 Ga0495680_0000003 3300047322 Bacteria 172246
906 Ga0495680_0001454 3300047322 Bacteria 25547
907 Ga0495680_0002953 3300047322 Bacteria 17014
908 Ga0495680_0010156 3300047322 Bacteria 8415
909 Ga0495680_0029953 3300047322 Bacteria 4449
910 Ga0495680_0040311 3300047322 Bacteria 3721
911 Ga0495680_0055123 3300047322 Bacteria 3084
912 Ga0495680_0226762 3300047322 Bacteria 1331
913 Ga0495680_0270927 3300047322 Bacteria 1199
914 Ga0495680_0343029 3300047322 Bacteria 1041
915 Ga0495675_0000389 3300047444 Bacteria 30325
916 Ga0495675_0020998 3300047444 Bacteria 4157
917 Ga0495675_0033719 3300047444 Bacteria 3267
918 Ga0495675_0200844 3300047444 Bacteria 1213
919 Ga0495675_0236250 3300047444 Bacteria 1101
920 Ga0495684_0003199 3300047471 Bacteria 12839
921 Ga0495684_0005821 3300047471 Bacteria 9583
922 Ga0495684_0007526 3300047471 Bacteria 8429
923 Ga0495684_0011571 3300047471 Bacteria 6812
924 Ga0495684_0023304 3300047471 Bacteria 4760
925 Ga0495684_0070188 3300047471 Bacteria 2663
926 Ga0495684_0148010 3300047471 Bacteria 1757
927 Ga0495684_0612170 3300047471 Bacteria 733
928 Ga0495593_0000847 3300047673 Bacteria 17762
929 Ga0495593_0006911 3300047673 Bacteria 6644
930 Ga0495593_0011275 3300047673 Bacteria 5137
931 Ga0495593_0020492 3300047673 Bacteria 3703
932 Ga0495602_0000014 3300048088 Bacteria 193335
933 Ga0495602_0025497 3300048088 Bacteria 5722
934 Ga0495602_0035056 3300048088 Bacteria 4684
935 Ga0495602_0143675 3300048088 Bacteria 1885
936 Ga0495602_0430876 3300048088 Bacteria 934
937 Ga0495602_0496886 3300048088 Bacteria 853
938 Ga0495602_0843037 3300048088 Bacteria 613
939 Ga0495614_0007195 3300048089 Bacteria 4960
940 Ga0495614_0018832 3300048089 Bacteria 2990
941 Ga0496100_0035899 3300048903 Bacteria 3122
942 Ga0496100_0524411 3300048903 Bacteria 914
943 Ga0496100_1388527 3300048903 Bacteria 554
944 Ga0496101_0131946 3300048904 Bacteria 1897
945 Ga0496101_0183692 3300048904 Bacteria 1611
946 Ga0496101_0527917 3300048904 Bacteria 933
947 Ga0496101_0722039 3300048904 Bacteria 787
948 Ga0496101_1088408 3300048904 Bacteria 628
949 Ga0496102_0099513 3300048905 Bacteria 2699
950 Ga0496102_0630173 3300048905 Bacteria 995
951 Ga0496102_1000742 3300048905 Bacteria 756
952 Ga0496104_0011893 3300048907 Bacteria 7809
953 Ga0496104_0044853 3300048907 Bacteria 4155
954 Ga0496104_0319358 3300048907 Bacteria 1466
955 Ga0496104_0473072 3300048907 Bacteria 1164
956 Ga0496104_0539499 3300048907 Bacteria 1077
957 Ga0496104_0559544 3300048907 Bacteria 1054
958 Ga0496105_0007062 3300048908 Bacteria 8655
959 Ga0496105_0115103 3300048908 Bacteria 2218
960 Ga0496105_0118728 3300048908 Bacteria 2181
961 Ga0496106_0098764 3300048909 Bacteria 2262
962 Ga0496106_0235487 3300048909 Bacteria 1462
963 Ga0496106_0269701 3300048909 Bacteria 1363
964 Ga0496107_0119312 3300048910 Bacteria 1942
965 Ga0496108_0013691 3300048911 Bacteria 6621
966 Ga0496108_0020748 3300048911 Bacteria 5401
967 Ga0496108_0193286 3300048911 Bacteria 1764
968 Ga0496108_0343762 3300048911 Bacteria 1302
969 Ga0496108_0373805 3300048911 Bacteria 1244
970 Ga0496108_0751444 3300048911 Bacteria 843
971 Ga0496108_1134217 3300048911 Bacteria 663
972 Ga0496109_0158665 3300048912 Bacteria 2119
973 Ga0496109_0492128 3300048912 Bacteria 1157
974 Ga0496109_0603886 3300048912 Bacteria 1033
975 Ga0496109_0657349 3300048912 Bacteria 985
976 Ga0496109_0867615 3300048912 Bacteria 840
977 Ga0496109_1257270 3300048912 Bacteria 676
978 Ga0496109_1790130 3300048912 Bacteria 547
979 Ga0496110_0188692 3300048913 Bacteria 1872
980 Ga0496110_0383501 3300048913 Bacteria 1281
981 Ga0496110_1203410 3300048913 Bacteria 666
982 Ga0496111_0030158 3300048914 Bacteria 3856
983 Ga0496111_0063187 3300048914 Bacteria 2685
984 Ga0496111_0202624 3300048914 Bacteria 1475
985 Ga0496111_0659560 3300048914 Bacteria 763
986 Ga0496112_0003525 3300048915 Bacteria 12975
987 Ga0496112_0060274 3300048915 Bacteria 3739
988 Ga0496112_0136605 3300048915 Bacteria 2422
989 Ga0496112_0212460 3300048915 Bacteria 1891
990 Ga0496112_0616351 3300048915 Bacteria 1016
991 Ga0496112_0712307 3300048915 Bacteria 931
992 Ga0496113_0043438 3300048916 Bacteria 3326
993 Ga0496113_0557376 3300048916 Bacteria 919
994 Ga0496113_0761417 3300048916 Bacteria 770
995 Ga0496113_1048068 3300048916 Bacteria 641
996 Ga0496113_1118277 3300048916 Bacteria 617
997 Ga0496114_0154195 3300048917 Bacteria 1994
998 Ga0496114_0458472 3300048917 Bacteria 1128
999 Ga0496115_0010698 3300048918 Bacteria 6862
1000 Ga0496115_0113190 3300048918 Bacteria 2229
1001 Ga0501039_1018652 3300049575 Unclassified 643
1002 Ga0501042_0044911 3300049578 Bacteria 3148
1003 Ga0501043_1056319 3300049579 Bacteria 576
1004 Ga0501072_0380399 3300049588 Bacteria 1120
1005 Ga0501079_0386773 3300049741 Bacteria 1097
1006 Ga0501081_0439842 3300049743 Bacteria 968
1007 nmdc:mga08y16_127207_c1 3300050511 Bacteria 2650
1008 nmdc:mga08y16_859458_c1 3300050511 Bacteria 896
1009 nmdc:mga0n895_5920_c1 3300050512 Bacteria 10282
1010 nmdc:mga0n895_65382_c1 3300050512 Bacteria 3600
1011 nmdc:mga0n895_889796_c1 3300050512 Bacteria 876
1012 nmdc:mga0rr50_1314241_c1 3300050513 Bacteria 613
1013 nmdc:mga0rr50_14871_c1 3300050513 Bacteria 5121
1014 nmdc:mga0rr50_54822_c1 3300050513 Bacteria 2972
1015 nmdc:mga0rr50_826443_c1 3300050513 Bacteria 790
1016 nmdc:mga08x19_16182_c1 3300050514 Bacteria 4545
1017 nmdc:mga08x19_893659_c1 3300050514 Bacteria 631
1018 nmdc:mga0a205_49641_c1 3300050515 Bacteria 4051
1019 nmdc:mga0a205_720479_c1 3300050515 Bacteria 847
1020 Ga0495601_0015583 3300053077 Bacteria 4594
1021 Ga0495601_0023159 3300053077 Bacteria 3815
1022 Ga0495601_0028281 3300053077 Bacteria 3472
1023 Ga0495612_0005770 3300053078 Bacteria 5111
1024 Ga0495595_0001199 3300053084 Bacteria 10074
1025 Ga0495595_0012038 3300053084 Bacteria 3627
1026 Ga0495595_0014508 3300053084 Bacteria 3345
1027 Ga0495619_0019205 3300053085 Bacteria 4343
1028 Ga0495619_0296007 3300053085 Bacteria 1121
1029 Ga0495619_0305932 3300053085 Bacteria 1101
1030 Ga0495619_0673468 3300053085 Bacteria 704
1031 Ga0587062_031234 3300059639 Bacteria 817
1032 Ga0466962_0004801 3300061719 Bacteria 6506
1033 2558912312 2558860112 Bacteria 9931328
1034 2810363650 2808606700 Bacteria 3482157
1035 2816505362 2816332139 Bacteria 9138787
1036 2819668105 2818991458 Bacteria 4794049
1037 2870788794 2870782633 Bacteria 9624083
1038 2915362645 2915358134 Bacteria 6050864
1039 8054475115 8054472261 Bacteria 7464355
1040 Ga0157314_1004845
1041 LJQas_1003654
1042 JGI24735J21928_10088676
1043 JGI25404J52841_10011177
1044 Ga0070658_10104305
1045 Ga0070658_11199661
1046 Ga0070676_10061481
1047 Ga0070683_100010133
1048 Ga0070683_100164581
1049 Ga0070683_101075843
1050 Ga0070683_101556590
1051 Ga0070690_101526229
1052 Ga0070670_100214632
1053 Ga0070670_100385794
1054 Ga0068869_100048457
1055 Ga0068869_100080265
1056 Ga0068869_100194027
1057 Ga0068869_100959253
1058 Ga0068869_101324989
1059 Ga0070666_10326768
1060 Ga0070680_100219269
1061 Ga0070682_100017777
1062 Ga0070682_100045590
1063 Ga0070682_100170657
1064 Ga0070682_100239092
1065 Ga0070682_100388346
1066 Ga0070682_100414165
1067 Ga0068868_100043012
1068 Ga0068868_100073280
1069 Ga0068868_100672822
1070 Ga0068868_101312291
1071 Ga0070660_100145004
1072 Ga0070660_100424222
1073 Ga0070689_100231932
1074 Ga0070689_100284504
1075 Ga0070687_100072860
1076 Ga0070687_100126729
1077 Ga0070687_100629113
1078 Ga0070661_100112341
1079 Ga0070692_10106524
1080 Ga0070692_11368045
1081 Ga0070668_100115767
1082 Ga0070668_100139024
1083 Ga0070668_100959467
1084 Ga0070668_101217430
1085 Ga0070669_100128058
1086 Ga0070675_100409654
1087 Ga0070675_100426706
1088 Ga0070671_100006613
1089 Ga0070671_100288097
1090 Ga0070674_100051392
1091 Ga0070674_100073178
1092 Ga0070674_100960786
1093 Ga0070674_101383304
1094 Ga0070673_100121492
1095 Ga0070688_100666547
1096 Ga0070659_100130430
1097 Ga0070659_100178220
1098 Ga0070667_100238828
1099 Ga0070667_100373763
1100 Ga0070667_100434140
1101 Ga0070709_10089746
1102 Ga0070709_10195797
1103 Ga0070709_10266605
1104 Ga0070714_100010968
1105 Ga0070714_100085432
1106 Ga0070714_100219711
1107 Ga0070714_100282170
1108 Ga0070714_100343810
1109 Ga0070714_100456387
1110 Ga0070714_100484702
1111 Ga0070714_100745686
1112 Ga0070714_100897474
1113 Ga0070713_100066279
1114 Ga0070713_100097647
1115 Ga0070713_100324547
1116 Ga0070713_100443980
1117 Ga0070713_100547427
1118 Ga0070713_100714225
1119 Ga0070713_100886238
1120 Ga0070710_10010220
1121 Ga0070710_10025021
1122 Ga0070710_10038180
1123 Ga0070710_10123243
1124 Ga0070710_10224077
1125 Ga0070710_10250867
1126 Ga0070710_10259639
1127 Ga0070710_11085554
1128 Ga0070701_10057036
1129 Ga0070701_10094393
1130 Ga0070711_100093981
1131 Ga0070711_100378670
1132 Ga0070711_100445242
1133 Ga0070711_100836482
1134 Ga0070711_100950369
1135 Ga0070705_100756102
1136 Ga0070700_100136296
1137 Ga0070700_100301955
1138 Ga0070700_100637938
1139 Ga0070694_100085169
1140 Ga0070708_100067758
1141 Ga0070708_100235526
1142 Ga0070708_100282789
1143 Ga0070708_100344647
1144 Ga0070708_100770854
1145 Ga0070708_101327390
1146 Ga0070663_100071242
1147 Ga0070663_100084123
1148 Ga0070663_101133845
1149 Ga0070678_100058826
1150 Ga0070662_101194932
1151 Ga0070685_10081386
1152 Ga0070685_10125327
1153 Ga0070685_10293079
1154 Ga0070685_10359573
1155 Ga0070706_100014528
1156 Ga0070706_100020291
1157 Ga0070706_100061918
1158 Ga0070706_100121825
1159 Ga0070706_100369843
1160 Ga0070706_100375891
1161 Ga0070706_100508414
1162 Ga0070706_100934721
1163 Ga0070707_100008637
1164 Ga0070707_100032225
1165 Ga0070707_100063807
1166 Ga0070707_100574495
1167 Ga0070707_100855700
1168 Ga0070707_100868332
1169 Ga0070707_100905693
1170 Ga0070698_100000308
1171 Ga0070698_100101305
1172 Ga0070698_100164232
1173 Ga0070698_100189813
1174 Ga0070698_100214794
1175 Ga0070698_100348892
1176 Ga0070698_100551986
1177 Ga0070699_100293372
1178 Ga0070699_100447674
1179 Ga0070699_100516626
1180 Ga0070699_100784151
1181 Ga0070699_101124410
1182 Ga0070679_100306096
1183 Ga0070684_100328046
1184 Ga0070684_100570997
1185 Ga0070684_101073271
1186 Ga0070684_101299886
1187 Ga0070684_101410953
1188 Ga0070697_100004980
1189 Ga0070697_100005122
1190 Ga0070697_101253910
1191 Ga0068853_100197362
1192 Ga0068853_100309321
1193 Ga0068853_101578733
1194 Ga0070672_100585599
1195 Ga0070686_100067208
1196 Ga0070686_100112399
1197 Ga0070686_100214821
1198 Ga0070696_100093758
1199 Ga0070696_100097333
1200 Ga0070693_100187885
1201 Ga0070693_100270120
1202 Ga0070693_100527194
1203 Ga0070665_100015619
1204 Ga0070665_100308847
1205 Ga0070665_100366743
1206 Ga0070665_100472572
1207 Ga0070665_100480081
1208 Ga0070665_100698090
1209 Ga0070665_100752493
1210 Ga0070665_100903229
1211 Ga0070665_101214992
1212 Ga0070704_100166852
1213 Ga0068855_100315232
1214 Ga0068855_102102916
1215 Ga0070664_100058853
1216 Ga0070664_100393262
1217 Ga0070664_100498746
1218 Ga0070664_101563227
1219 Ga0068857_100146134
1220 Ga0068857_101723658
1221 Ga0068854_100067452
1222 Ga0068854_100123082
1223 Ga0068854_100188554
1224 Ga0068856_100089102
1225 Ga0068856_100208657
1226 Ga0068856_100380665
1227 Ga0068856_100385112
1228 Ga0068856_100553582
1229 Ga0068856_101680397
1230 Ga0070702_100098795
1231 Ga0068852_100023215
1232 Ga0068852_100727427
1233 Ga0068859_100090223
1234 Ga0068864_100259012
1235 Ga0068864_100338043
1236 Ga0068864_100426400
1237 Ga0068864_100849294
1238 Ga0068866_10034753
1239 Ga0068861_100144239
1240 Ga0068861_101188824
1241 Ga0068851_10076079
1242 Ga0068851_10337054
1243 Ga0068870_10064193
1244 Ga0068870_10088250
1245 Ga0068870_10290919
1246 Ga0068870_10395839
1247 Ga0068863_100050833
1248 Ga0068863_100151463
1249 Ga0068863_100267518
1250 Ga0068863_100425178
1251 Ga0068863_101476785
1252 Ga0068858_100141636
1253 Ga0068858_100203922
1254 Ga0068860_100053636
1255 Ga0068860_100536568
1256 Ga0068860_102601993
1257 Ga0068862_100198562
1258 Ga0068862_101111707
1259 Ga0081540_1001418
1260 Ga0070717_10004588
1261 Ga0070717_10118622
1262 Ga0070717_10297442
1263 Ga0070717_10385994
1264 Ga0070717_10391053
1265 Ga0070717_10486228
1266 Ga0070717_10557928
1267 Ga0070717_10861681
1268 Ga0070717_11891003
1269 Ga0075432_10143774
1270 Ga0070715_10007549
1271 Ga0070715_10032347
1272 Ga0070715_10061303
1273 Ga0070716_100027939
1274 Ga0070712_100046024
1275 Ga0070712_100180523
1276 Ga0070712_100571476
1277 Ga0070712_101139784
1278 Ga0097621_100084496
1279 Ga0097621_100313178
1280 Ga0097621_100360564
1281 Ga0097621_100533450
1282 Ga0068871_100099025
1283 Ga0068871_100223692
1284 Ga0075433_10035089
1285 Ga0075433_10584660
1286 Ga0075433_10649805
1287 Ga0075434_100036726
1288 Ga0075434_100103356
1289 Ga0075434_101772673
1290 Ga0068865_100143391
1291 Ga0075436_100019486
1292 Ga0075436_100849045
1293 Ga0075436_101314648
1294 Ga0097620_100090221
1295 Ga0075435_100042367
1296 Ga0075435_100044934
1297 Ga0075435_101242608
1298 Ga0075435_101343885
1299 Ga0099794_10124513
1300 Ga0105251_10054880
1301 Ga0105240_10654932
1302 Ga0105240_11234018
1303 Ga0111539_10276078
1304 Ga0111539_10307871
1305 Ga0111539_11437839
1306 Ga0105245_10084613
1307 Ga0105245_10327120
1308 Ga0105245_10939064
1309 Ga0105247_10115558
1310 Ga0105247_10305072
1311 Ga0105247_10428711
1312 Ga0105243_10972136
1313 Ga0105241_10145741
1314 Ga0105241_11388256
1315 Ga0105248_11611908
1316 Ga0105248_12166737
1317 Ga0105237_10213237
1318 Ga0105237_10822384
1319 Ga0105238_10129854
1320 Ga0105249_10041106
1321 Ga0105249_10496493
1322 Ga0105249_12533046
1323 Ga0099796_10053526
1324 Ga0105239_10259912
1325 Ga0105239_10528798
1326 Ga0105239_10957648
1327 Ga0105246_10077914
1328 Ga0105246_10728530
1329 Ga0105246_11690965
1330 Ga0105246_11897251
1331 Ga0157343_1005703
1332 Ga0157314_1005099
1333 Ga0157347_1008417
1334 Ga0157313_1015068
1335 Ga0157342_1004643
1336 Ga0157316_1021675
1337 Ga0157338_1007878
1338 Ga0157373_10103326
1339 Ga0157371_10039209
1340 Ga0157371_10210603
1341 Ga0157369_10039494
1342 Ga0157369_10187760
1343 Ga0157369_10219124
1344 Ga0157369_10846810
1345 Ga0157369_10851300
1346 Ga0157369_10869402
1347 Ga0157369_11083434
1348 Ga0157374_11015790
1349 Ga0157378_10965584
1350 Ga0157378_12044892
1351 Ga0163162_10258861
1352 Ga0163162_11027732
1353 Ga0157372_10075612
1354 Ga0157372_10311525
1355 Ga0157372_11945606
1356 Ga0157375_10304650
1357 Ga0157375_10620938
1358 Ga0157375_10959864
1359 Ga0157375_11735641
1360 Ga0157375_11754759
1361 Ga0163163_10080889
1362 Ga0163163_10421235
1363 Ga0163163_10445921
1364 Ga0163163_10446241
1365 Ga0163163_12411555
1366 Ga0163163_12918918
1367 Ga0157380_10019892
1368 Ga0157380_10918064
1369 Ga0182008_10311211
1370 Ga0157377_10042907
1371 Ga0157377_10126583
1372 Ga0157379_10363521
1373 Ga0157379_10410016
1374 Ga0157379_10933670
1375 Ga0157379_11161452
1376 Ga0157376_10997969
1377 Ga0157376_11043053
1378 Ga0157376_11453371
1379 Ga0163161_10053874
1380 Ga0206356_10642078
1381 Ga0206354_10265570
1382 Ga0206354_10793134
1383 Ga0206353_11413974
1384 Ga0213872_10234874
1385 Ga0213874_10045451
1386 Ga0213874_10211796
1387 Ga0213876_10036362
1388 Ga0213875_10001142
1389 Ga0213875_10045334
1390 Ga0213875_10052591
1391 Ga0213875_10058196
1392 Ga0224712_10061690
1393 Ga0224712_10233497
1394 Ga0228598_1018484
1395 Ga0228598_1071779
1396 Ga0207653_10010804
1397 Ga0207692_10004053
1398 Ga0207692_10040924
1399 Ga0207692_10071650
1400 Ga0207642_10073402
1401 Ga0207642_10303438
1402 Ga0207710_10079641
1403 Ga0207688_10007772
1404 Ga0207688_10045836
1405 Ga0207688_10157397
1406 Ga0207680_10784292
1407 Ga0207647_10057589
1408 Ga0207647_10256929
1409 Ga0207699_10044202
1410 Ga0207699_10073928
1411 Ga0207699_10079456
1412 Ga0207699_10180052
1413 Ga0207699_10429931
1414 Ga0207699_10845814
1415 Ga0207645_10013813
1416 Ga0207645_10053173
1417 Ga0207643_10076171
1418 Ga0207643_10383788
1419 Ga0207705_10121471
1420 Ga0207684_10003200
1421 Ga0207684_10020102
1422 Ga0207684_10077003
1423 Ga0207684_10094850
1424 Ga0207684_10606029
1425 Ga0207684_10885432
1426 Ga0207654_10800665
1427 Ga0207654_10897858
1428 Ga0207654_11189221
1429 Ga0207707_10101703
1430 Ga0207671_10963621
1431 Ga0207693_10011756
1432 Ga0207693_10056576
1433 Ga0207693_10059120
1434 Ga0207663_10114576
1435 Ga0207663_10131176
1436 Ga0207663_10144604
1437 Ga0207663_10190152
1438 Ga0207663_10347975
1439 Ga0207663_10847353
1440 Ga0207660_10192159
1441 Ga0207662_10002144
1442 Ga0207662_10045119
1443 Ga0207657_10015479
1444 Ga0207657_10023888
1445 Ga0207649_10406832
1446 Ga0207646_10005011
1447 Ga0207646_10112534
1448 Ga0207646_10271339
1449 Ga0207646_10396792
1450 Ga0207646_10400802
1451 Ga0207646_10481015
1452 Ga0207646_10545398
1453 Ga0207681_10132749
1454 Ga0207659_10333269
1455 Ga0207659_11039468
1456 Ga0207687_10045231
1457 Ga0207687_10276077
1458 Ga0207700_10135686
1459 Ga0207700_10224393
1460 Ga0207700_10226535
1461 Ga0207700_10234458
1462 Ga0207700_10305846
1463 Ga0207700_10334989
1464 Ga0207700_10577756
1465 Ga0207700_10689956
1466 Ga0207700_10854659
1467 Ga0207700_10871614
1468 Ga0207664_10014609
1469 Ga0207664_10022615
1470 Ga0207664_10042704
1471 Ga0207664_10045230
1472 Ga0207664_10223400
1473 Ga0207664_10460867
1474 Ga0207664_10921506
1475 Ga0207664_11824816
1476 Ga0207644_10013700
1477 Ga0207644_10218922
1478 Ga0207644_10886441
1479 Ga0207690_11457995
1480 Ga0207706_10014518
1481 Ga0207706_10020900
1482 Ga0207706_10749861
1483 Ga0207686_10545499
1484 Ga0207709_10338926
1485 Ga0207669_10529025
1486 Ga0207669_10822733
1487 Ga0207669_11132866
1488 Ga0207704_11144556
1489 Ga0207665_10017424
1490 Ga0207665_10023191
1491 Ga0207691_10063086
1492 Ga0207691_10144081
1493 Ga0207711_10648251
1494 Ga0207689_10005167
1495 Ga0207689_10092506
1496 Ga0207689_10287121
1497 Ga0207689_10734424
1498 Ga0207661_10623231
1499 Ga0207661_10876822
1500 Ga0207679_10034943
1501 Ga0207679_11077229
1502 Ga0207667_10100747
1503 Ga0207667_11069387
1504 Ga0207651_10334335
1505 Ga0207651_10607282
1506 Ga0207712_10886559
1507 Ga0207668_10770099
1508 Ga0207668_11511063
1509 Ga0207640_10198576
1510 Ga0207640_10283131
1511 Ga0207640_10311143
1512 Ga0207658_10091859
1513 Ga0207658_10871532
1514 Ga0207677_10421295
1515 Ga0207677_10907012
1516 Ga0207703_10885744
1517 Ga0207639_10331386
1518 Ga0207639_10839814
1519 Ga0207678_10016013
1520 Ga0207678_10112718
1521 Ga0207708_10017813
1522 Ga0207708_10032843
1523 Ga0207708_11276017
1524 Ga0207702_10132402
1525 Ga0207702_10228150
1526 Ga0207702_10426448
1527 Ga0207641_10027486
1528 Ga0207641_10640357
1529 Ga0207641_11298905
1530 Ga0207648_10089701
1531 Ga0207648_10871823
1532 Ga0207648_11790044
1533 Ga0207676_10418403
1534 Ga0207676_10650781
1535 Ga0207676_12175077
1536 Ga0207674_10009354
1537 Ga0207674_10257954
1538 Ga0207674_10540600
1539 Ga0207674_10595912
1540 Ga0207675_100019761
1541 Ga0207675_100024633
1542 Ga0207683_10003875
1543 Ga0207683_10055388
1544 Ga0207683_10209191
1545 Ga0207683_10944602
1546 Ga0207683_11268424
1547 Ga0207698_10252216
1548 Ga0207428_10088366
1549 Ga0207428_10732624
1550 Ga0268266_10045907
1551 Ga0268266_10256942
1552 Ga0268266_10421736
1553 Ga0268266_10542530
1554 Ga0268266_10798690
1555 Ga0268265_11187905
1556 Ga0268265_11413055
1557 Ga0268264_10170508
1558 Ga0268264_10388922
1559 Ga0268264_11535869
1560 Ga0268264_11624319
1561 Ga0307513_10159162
1562 Ga0307408_100230070
1563 Ga0307410_10294707
1564 Ga0307410_10368141
1565 Ga0307410_10624912
1566 Ga0307407_10717815
1567 Ga0307409_100850988
1568 Ga0307414_10157537
1569 Ga0307411_10195843
1570 Ga0307411_10368746
1571 Ga0307411_10439682
1572 Ga0307415_100041407
1573 Ga0373948_0003687
1574 Ga0373948_0053412
1575 Ga0373950_0088072
1576 Ga0373958_0176063
1577 Ga0373938_0039601
1578 Ga0373926_0002520
1579 Ga0373926_0004166
1580 Ga0373928_0022469
1581 Ga0373929_0140969
1582 Ga0373934_0000065
1583 Ga0373934_0042856
1584 Ga0373934_0044329
1585 Ga0373934_0137968
1586 Ga0373934_0421338
1587 Ga0373940_0001960
1588 Ga0373940_0059107
1589 Ga0373944_0000553
1590 Ga0373944_0001897
1591 Ga0373944_0024453
1592 Ga0373944_0093564
1593 Ga0373944_0153117
1594 Ga0373944_0310731
1595 Ga0373952_0099451
1596 Ga0373923_0025669
1597 Ga0373923_0058965
1598 Ga0373923_0082972
1599 Ga0373923_0112828
1600 Ga0373923_0217771
1601 Ga0373932_0333493
1602 Ga0373936_0002649
1603 Ga0373936_0012075
1604 Ga0373936_0021757
1605 Ga0373936_0116916
1606 Ga0373936_0575465
1607 Ga0373945_0000077
1608 Ga0373953_0000055
1609 Ga0373953_0004490
1610 Ga0373953_0065531
1611 Ga0373953_0088400
1612 Ga0373954_0017825
1613 Ga0373954_0022397
1614 Ga0373956_0000141
1615 Ga0373956_0009695
1616 Ga0373956_0080785
1617 Ga0373956_0281782
1618 Ga0373957_0000093
1619 Ga0373957_0055231
1620 Ga0373957_0075711
1621 Ga0373957_0083588
1622 Ga0373957_0219676
1623 Ga0373960_0223487
1624 Ga0373960_0432631
1625 Ga0373943_0000164
1626 Ga0373943_0003174
1627 Ga0373943_0029808
1628 Ga0373943_0128150
1629 Ga0373943_0136585
1630 Ga0373946_0002495
1631 Ga0373946_0047922
1632 Ga0373946_0163571
1633 Ga0373946_0224305
1634 Ga0373955_0000207
1635 Ga0373955_0007999
1636 Ga0373955_0035209
1637 Ga0373955_0093255
1638 Ga0373955_0158483
1639 Ga0373955_0185549
1640 Ga0373955_0307549
1641 Ga0373955_0369416
1642 Ga0373962_0021488
1643 Ga0316574_0302297
1644 Ga0373924_0000073
1645 Ga0373924_0002275
1646 Ga0373924_0012047
1647 Ga0373924_0107036
1648 Ga0373931_0152396
1649 Ga0373931_0694686
1650 Ga0373935_0003332
1651 Ga0373935_0054728
1652 Ga0373935_0096262
1653 Ga0373935_0149126
1654 Ga0373935_0215500
1655 Ga0373935_0285805
1656 Ga0373935_0446732
1657 Ga0373935_0532100
1658 Ga0373927_0021656
1659 Ga0373927_0027321
1660 Ga0373927_0035125
1661 Ga0373927_0421948
1662 Ga0373933_0000054
1663 Ga0373933_0003898
1664 Ga0373933_0011093
1665 Ga0373933_0052269
1666 Ga0373933_0058689
1667 Ga0373933_0086847
1668 Ga0373933_0120493
1669 Ga0373947_0001093
1670 Ga0373947_0001602
1671 Ga0373947_0046346
1672 Ga0373947_0098208
1673 Ga0373947_0169858
1674 Ga0373947_0278132
1675 Ga0373937_0000002
1676 Ga0373937_0010001
1677 Ga0373937_0047793
1678 Ga0373937_0135146
1679 Ga0373937_0219618
1680 Ga0373937_0249817
1681 Ga0373937_0274263
1682 Ga0373937_0327105
1683 Ga0373925_0005625
1684 Ga0373925_0009741
1685 Ga0373925_0083149
1686 Ga0373925_0109779
1687 Ga0373925_0249717
1688 Ga0373925_0250750
1689 Ga0373925_0325529
1690 Ga0373925_0358227
1691 Ga0373925_0516956
1692 Ga0373925_0866629
1693 Ga0395899_0004263
1694 Ga0395900_0272449
1695 Ga0436364_0021886
1696 Ga0436364_0669885
1697 Ga0436364_0769079
1698 Ga0436364_0872343
1699 Ga0436364_1084539
1700 Ga0436364_1262394
1701 Ga0436364_1401376
1702 Ga0436365_0222628
1703 Ga0436365_0416340
1704 Ga0436365_1293463
1705 Ga0436361_0158863
1706 Ga0436363_0530596
1707 Ga0436363_1105940
1708 Ga0436363_1174765
1709 Ga0436363_1265393
1710 Ga0436362_0624818
1711 Ga0436362_0727893
1712 Ga0451789_0553388
1713 Ga0451791_1593630
1714 Ga0451804_0297973
1715 Ga0451841_1052420
1716 Ga0466972_0009324
1717 Ga0466965_0138559
1718 Ga0466965_0146249
1719 Ga0466966_0004664
1720 Ga0466961_0171244
1721 Ga0466961_0438935
1722 Ga0466961_0439757
1723 Ga0466963_0002427
1724 Ga0466963_0036568
1725 Ga0466963_0414536
1726 Ga0466963_0825694
1727 Ga0466964_0732108
1728 Ga0466971_0097029
1729 Ga0466970_0053321
1730 Ga0466957_0288507
1731 Ga0466957_0931384
1732 Ga0466960_0001547
1733 Ga0466960_0288304
1734 Ga0466959_0127852
1735 Ga0466959_0833734
1736 Ga0466958_0000849
1737 Ga0466958_0228027
1738 Ga0466967_0005545
1739 Ga0466967_0129109
1740 Ga0466967_0159286
1741 Ga0466967_0186235
1742 Ga0466967_0203012
1743 Ga0466967_0515435
1744 Ga0495592_0000003
1745 Ga0495592_0033887
1746 Ga0495592_0044826
1747 Ga0495592_0051815
1748 Ga0495592_0191623
1749 Ga0495592_0251608
1750 Ga0495592_0745992
1751 Ga0495603_0000661
1752 Ga0495603_0074227
1753 Ga0495629_0001950
1754 Ga0495629_0012811
1755 Ga0495629_0179260
1756 Ga0495629_0282370
1757 Ga0495641_0001407
1758 Ga0495641_0006055
1759 Ga0495641_0035357
1760 Ga0495641_0071193
1761 Ga0495641_0091529
1762 Ga0495651_0000036
1763 Ga0495651_0003222
1764 Ga0495651_0023674
1765 Ga0495651_0055381
1766 Ga0495651_0159182
1767 Ga0495651_0223151
1768 Ga0495651_0246141
1769 Ga0495651_0267202
1770 Ga0495651_0942881
1771 Ga0495653_0000406
1772 Ga0495653_0002880
1773 Ga0495653_0007981
1774 Ga0495653_0038555
1775 Ga0495653_0038923
1776 Ga0495653_0093534
1777 Ga0495653_0112727
1778 Ga0495653_0443474
1779 Ga0495650_0030915
1780 Ga0495580_0006551
1781 Ga0495580_0110900
1782 Ga0495582_0002623
1783 Ga0495582_0020254
1784 Ga0495582_0037471
1785 Ga0495582_0200431
1786 Ga0495639_0007269
1787 Ga0495639_0042136
1788 Ga0495639_0328258
1789 Ga0495662_0001838
1790 Ga0495662_0007893
1791 Ga0495662_0044581
1792 Ga0495662_0384469
1793 Ga0495664_0000454
1794 Ga0495664_0101383
1795 Ga0495664_0121215
1796 Ga0495664_0229500
1797 Ga0495664_0264956
1798 Ga0495594_0031228
1799 Ga0495608_0000018
1800 Ga0495608_0026583
1801 Ga0495608_0027027
1802 Ga0495608_0034497
1803 Ga0495608_0040428
1804 Ga0495608_0041557
1805 Ga0495618_0007128
1806 Ga0495618_0015896
1807 Ga0495618_0017974
1808 Ga0495618_0028819
1809 Ga0495618_0066107
1810 Ga0495618_0078881
1811 Ga0495618_0204714
1812 Ga0495628_0000020
1813 Ga0495628_0110010
1814 Ga0495628_0240404
1815 Ga0495628_0253609
1816 Ga0495630_0036754
1817 Ga0495630_0052195
1818 Ga0495630_0075463
1819 Ga0495630_0096775
1820 Ga0495630_0449417
1821 Ga0495630_0501692
1822 Ga0495666_0016042
1823 Ga0495666_0022892
1824 Ga0495666_0095277
1825 Ga0495652_0000013
1826 Ga0495652_0022788
1827 Ga0495652_0030281
1828 Ga0495652_0064510
1829 Ga0495652_0147376
1830 Ga0495652_0213570
1831 Ga0495652_0417320
1832 Ga0495665_0001556
1833 Ga0495665_0019771
1834 Ga0495665_0050849
1835 Ga0495665_0086485
1836 Ga0495640_0016167
1837 Ga0495640_0023151
1838 Ga0495640_0031284
1839 Ga0495640_0031362
1840 Ga0495640_0034696
1841 Ga0495640_0161476
1842 Ga0495640_0842393
1843 Ga0495586_0006621
1844 Ga0495586_0608161
1845 Ga0495587_0000014
1846 Ga0495587_0005895
1847 Ga0495587_0009225
1848 Ga0495587_0020632
1849 Ga0495587_0184951
1850 Ga0495587_0252984
1851 Ga0495645_0030955
1852 Ga0495645_0060069
1853 Ga0495645_0072510
1854 Ga0495645_0121834
1855 Ga0495645_0138630
1856 Ga0495645_0168638
1857 Ga0495645_0200172
1858 Ga0495622_0121609
1859 Ga0495667_0000014
1860 Ga0495667_0000302
1861 Ga0495667_0016888
1862 Ga0495667_0037809
1863 Ga0495667_0097605
1864 Ga0495667_0180565
1865 Ga0495668_0699492
1866 Ga0495634_0029290
1867 Ga0495634_0059420
1868 Ga0495634_0078856
1869 Ga0495634_0091725
1870 Ga0495634_0180104
1871 Ga0495634_0211029
1872 Ga0495634_0288652
1873 Ga0495634_0346534
1874 Ga0495635_0000462
1875 Ga0495635_0002746
1876 Ga0495635_0004499
1877 Ga0495635_0014871
1878 Ga0495635_0033200
1879 Ga0495635_0247775
1880 Ga0495635_0443740
1881 Ga0495635_0545769
1882 Ga0495588_0033859
1883 Ga0495588_0135331
1884 Ga0495657_0000012
1885 Ga0495657_0006514
1886 Ga0495657_0016259
1887 Ga0495657_0042494
1888 Ga0495657_0047516
1889 Ga0495657_0105784
1890 Ga0495657_0109632
1891 Ga0495599_0000037
1892 Ga0495599_0011715
1893 Ga0495599_0012101
1894 Ga0495599_0029683
1895 Ga0495623_0000079
1896 Ga0495623_0009073
1897 Ga0495623_0027788
1898 Ga0495623_0129241
1899 Ga0495646_0009352
1900 Ga0495646_0011733
1901 Ga0495646_0055454
1902 Ga0495646_0075783
1903 Ga0495646_0097127
1904 Ga0495646_0282562
1905 Ga0495647_0001069
1906 Ga0495647_0120664
1907 Ga0495658_0002199
1908 Ga0495613_0006714
1909 Ga0495613_0220434
1910 Ga0495613_0689318
1911 Ga0495624_0005490
1912 Ga0495624_0008133
1913 Ga0495624_0124468
1914 Ga0495624_0127217
1915 Ga0495624_0177773
1916 Ga0495600_0003734
1917 Ga0495600_0009438
1918 Ga0495600_0013917
1919 Ga0495600_0016008
1920 Ga0495600_0029865
1921 Ga0495600_0091649
1922 Ga0495600_0289005
1923 Ga0495581_0009902
1924 Ga0495581_0023893
1925 Ga0495581_0026782
1926 Ga0495604_0005054
1927 Ga0495604_0011248
1928 Ga0495604_0083032
1929 Ga0495604_0089914
1930 Ga0495604_0325045
1931 Ga0495604_0434846
1932 Ga0495674_0000831
1933 Ga0495674_0001543
1934 Ga0495674_0013670
1935 Ga0495674_0019229
1936 Ga0495674_0160542
1937 Ga0495674_0326244
1938 Ga0495674_1186184
1939 Ga0495676_0020252
1940 Ga0495676_0064180
1941 Ga0495676_0081429
1942 Ga0495676_0124368
1943 Ga0495676_0216123
1944 Ga0495680_0000003
1945 Ga0495680_0001454
1946 Ga0495680_0002953
1947 Ga0495680_0010156
1948 Ga0495680_0029953
1949 Ga0495680_0040311
1950 Ga0495680_0055123
1951 Ga0495680_0226762
1952 Ga0495680_0270927
1953 Ga0495680_0343029
1954 Ga0495675_0000389
1955 Ga0495675_0020998
1956 Ga0495675_0033719
1957 Ga0495675_0200844
1958 Ga0495675_0236250
1959 Ga0495684_0003199
1960 Ga0495684_0005821
1961 Ga0495684_0007526
1962 Ga0495684_0011571
1963 Ga0495684_0023304
1964 Ga0495684_0070188
1965 Ga0495684_0148010
1966 Ga0495684_0612170
1967 Ga0495593_0000847
1968 Ga0495593_0006911
1969 Ga0495593_0011275
1970 Ga0495593_0020492
1971 Ga0495602_0000014
1972 Ga0495602_0025497
1973 Ga0495602_0035056
1974 Ga0495602_0143675
1975 Ga0495602_0430876
1976 Ga0495602_0496886
1977 Ga0495602_0843037
1978 Ga0495614_0007195
1979 Ga0495614_0018832
1980 Ga0496100_0035899
1981 Ga0496100_0524411
1982 Ga0496100_1388527
1983 Ga0496101_0131946
1984 Ga0496101_0183692
1985 Ga0496101_0527917
1986 Ga0496101_0722039
1987 Ga0496101_1088408
1988 Ga0496102_0099513
1989 Ga0496102_0630173
1990 Ga0496102_1000742
1991 Ga0496104_0011893
1992 Ga0496104_0044853
1993 Ga0496104_0319358
1994 Ga0496104_0473072
1995 Ga0496104_0539499
1996 Ga0496104_0559544
1997 Ga0496105_0007062
1998 Ga0496105_0115103
1999 Ga0496105_0118728
2000 Ga0496106_0098764
2001 Ga0496106_0235487
2002 Ga0496106_0269701
2003 Ga0496107_0119312
2004 Ga0496108_0013691
2005 Ga0496108_0020748
2006 Ga0496108_0193286
2007 Ga0496108_0343762
2008 Ga0496108_0373805
2009 Ga0496108_0751444
2010 Ga0496108_1134217
2011 Ga0496109_0158665
2012 Ga0496109_0492128
2013 Ga0496109_0603886
2014 Ga0496109_0657349
2015 Ga0496109_0867615
2016 Ga0496109_1257270
2017 Ga0496109_1790130
2018 Ga0496110_0188692
2019 Ga0496110_0383501
2020 Ga0496110_1203410
2021 Ga0496111_0030158
2022 Ga0496111_0063187
2023 Ga0496111_0202624
2024 Ga0496111_0659560
2025 Ga0496112_0003525
2026 Ga0496112_0060274
2027 Ga0496112_0136605
2028 Ga0496112_0212460
2029 Ga0496112_0616351
2030 Ga0496112_0712307
2031 Ga0496113_0043438
2032 Ga0496113_0557376
2033 Ga0496113_0761417
2034 Ga0496113_1048068
2035 Ga0496113_1118277
2036 Ga0496114_0154195
2037 Ga0496114_0458472
2038 Ga0496115_0010698
2039 Ga0496115_0113190
2040 Ga0501039_1018652
2041 Ga0501042_0044911
2042 Ga0501043_1056319
2043 Ga0501072_0380399
2044 Ga0501079_0386773
2045 Ga0501081_0439842
2046 nmdc:mga08y16_127207_c1
2047 nmdc:mga08y16_859458_c1
2048 nmdc:mga0n895_5920_c1
2049 nmdc:mga0n895_65382_c1
2050 nmdc:mga0n895_889796_c1
2051 nmdc:mga0rr50_1314241_c1
2052 nmdc:mga0rr50_14871_c1
2053 nmdc:mga0rr50_54822_c1
2054 nmdc:mga0rr50_826443_c1
2055 nmdc:mga08x19_16182_c1
2056 nmdc:mga08x19_893659_c1
2057 nmdc:mga0a205_49641_c1
2058 nmdc:mga0a205_720479_c1
2059 Ga0495601_0015583
2060 Ga0495601_0023159
2061 Ga0495601_0028281
2062 Ga0495612_0005770
2063 Ga0495595_0001199
2064 Ga0495595_0012038
2065 Ga0495595_0014508
2066 Ga0495619_0019205
2067 Ga0495619_0296007
2068 Ga0495619_0305932
2069 Ga0495619_0673468
2070 Ga0587062_031234
2071 Ga0466962_0004801
2072 2558912312
2073 2810363650
2074 2816505362
2075 2819668105
2076 2870788794
2077 2915362645
2078 8054475115

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

16

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wlo-assembly1.cif.gz_A solution structure of the hypothetical protein from thermus thermophilus hb8 0.8824 9 148
1wlo-assembly1.cif.gz_A solution structure of the hypothetical protein from thermus thermophilus hb8 0.8644 9 148
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.8324 12 146
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.8189 15 146
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.7946 12 146
ID Description Score Start End Superfamily
af_P9WGC3_6_142_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9291 9 147 3.90.1010.10
af_P9WGC3_6_142_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9226 9 147 3.90.1010.10
1wloA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8824 9 148 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8782 25 148 3.90.1010.10
1wloA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8644 9 148 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A399YKW3-F1-model_v4 Cysteine desulfuration protein SufE 0.9836 10 148
AF-A0A292Z179-F1-model_v4 Sulfur acceptor protein SufE 0.9825 7 149
AF-A0A292Z179-F1-model_v4 Sulfur acceptor protein SufE 0.9757 7 149
AF-A0A7X6H7T2-F1-model_v4 deleted 0.973 24 148
AF-A0A7Y4HWS9-F1-model_v4 SufE family protein 0.9725 9 146

Map