F488743

General Info

Members Datasets Scaffolds Average Seq Length
1037 288 2074 98

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0007278|Ga0395899_0007278_6637_6969
Length 110
Sequence LRRNDRAAKPAIMLIALVDIANLLLSVVTWIIIIQVILSWLFAFNVLNTSSQGVRTVAVAIDRITAPLYRPVRRILPDFGGIDFSPLVILILIQVIKKLLAGVVMQYYGI

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
268 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
269 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
270 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
273 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
274 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
277 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
278 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
281 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
282 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
283 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
284 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
285 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 3.66
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0007278 3300037312 Bacteria 8561
2 JGI24736J21556_1020912 3300001904 Bacteria 1027
3 JGI24741J21665_1008557 3300001915 Bacteria 1924
4 JGI24741J21665_1008594 3300001915 Bacteria 1919
5 JGI24747J21853_1002402 3300001978 Bacteria 1525
6 JGI24747J21853_1011601 3300001978 Bacteria 893
7 JGI24740J21852_10009374 3300001979 Bacteria 3836
8 JGI24740J21852_10047433 3300001979 Bacteria 1254
9 JGI24740J21852_10149131 3300001979 Unclassified 581
10 JGI24739J22299_10077383 3300001989 Bacteria 1026
11 JGI24739J22299_10084372 3300001989 Bacteria 972
12 JGI24737J22298_10007721 3300001990 Bacteria 3625
13 JGI24737J22298_10019478 3300001990 Bacteria 2170
14 JGI24737J22298_10151273 3300001990 Bacteria 685
15 JGI24737J22298_10207947 3300001990 Bacteria 577
16 JGI24743J22301_10002872 3300001991 Bacteria 2655
17 JGI24743J22301_10017326 3300001991 Bacteria 1351
18 JGI24735J21928_10006140 3300002067 Bacteria 3966
19 JGI24735J21928_10101212 3300002067 Bacteria 827
20 JGI24735J21928_10214129 3300002067 Bacteria 559
21 JGI24745J21846_1040230 3300002073 Bacteria 578
22 JGI24738J21930_10046291 3300002075 Bacteria 885
23 JGI24744J21845_10001585 3300002077 Bacteria 4537
24 JGI24744J21845_10077148 3300002077 Bacteria 609
25 JGI24034J26672_10032452 3300002239 Bacteria 855
26 JGI24742J22300_10021446 3300002244 Bacteria 1103
27 JGI24751J29686_10025650 3300002459 Bacteria 1223
28 JGI24751J29686_10083501 3300002459 Bacteria 662
29 JGI25406J46586_10057619 3300003203 Bacteria 1270
30 rootL2_10140508 3300003322 Bacteria 1453
31 Ga0065715_10432613 3300005293 Bacteria 828
32 Ga0065715_11117021 3300005293 Bacteria 516
33 Ga0070658_10066207 3300005327 Bacteria 2951
34 Ga0070658_10075391 3300005327 Bacteria 2766
35 Ga0070658_10085273 3300005327 Bacteria 2597
36 Ga0070658_10163452 3300005327 Bacteria 1868
37 Ga0070658_10165847 3300005327 Bacteria 1854
38 Ga0070658_10272833 3300005327 Bacteria 1439
39 Ga0070658_10426509 3300005327 Bacteria 1141
40 Ga0070658_10592463 3300005327 Bacteria 961
41 Ga0070658_11177287 3300005327 Bacteria 666
42 Ga0070658_11330146 3300005327 Bacteria 624
43 Ga0070676_10015404 3300005328 Bacteria 4218
44 Ga0070676_10016027 3300005328 Bacteria 4139
45 Ga0070676_10110959 3300005328 Bacteria 1708
46 Ga0070676_10461999 3300005328 Bacteria 895
47 Ga0070683_100038899 3300005329 Bacteria 4363
48 Ga0070683_100211431 3300005329 Bacteria 1843
49 Ga0070683_100428494 3300005329 Bacteria 1262
50 Ga0070683_101088629 3300005329 Bacteria 768
51 Ga0070690_100006336 3300005330 Bacteria 6709
52 Ga0070690_100173019 3300005330 Bacteria 1487
53 Ga0070690_100531153 3300005330 Bacteria 884
54 Ga0070690_100536979 3300005330 Bacteria 880
55 Ga0070670_100013225 3300005331 Bacteria 7070
56 Ga0070670_100014982 3300005331 Bacteria 6654
57 Ga0070670_100076532 3300005331 Bacteria 2875
58 Ga0070670_100080502 3300005331 Bacteria 2799
59 Ga0070670_100142924 3300005331 Bacteria 2069
60 Ga0070670_100519148 3300005331 Bacteria 1060
61 Ga0070670_101740013 3300005331 Bacteria 574
62 Ga0070670_101937482 3300005331 Bacteria 543
63 Ga0070677_10011735 3300005333 Bacteria 3028
64 Ga0070677_10017057 3300005333 Bacteria 2594
65 Ga0068869_100086966 3300005334 Bacteria 2344
66 Ga0068869_101720882 3300005334 Bacteria 560
67 Ga0070666_10005953 3300005335 Bacteria 7486
68 Ga0070666_10048049 3300005335 Bacteria 2866
69 Ga0070666_10065966 3300005335 Bacteria 2456
70 Ga0070666_10166582 3300005335 Bacteria 1542
71 Ga0070666_10261028 3300005335 Bacteria 1228
72 Ga0070666_10397347 3300005335 Bacteria 991
73 Ga0070666_10437209 3300005335 Bacteria 944
74 Ga0070666_10949706 3300005335 Bacteria 637
75 Ga0070666_11010986 3300005335 Bacteria 617
76 Ga0070680_100024380 3300005336 Bacteria 4832
77 Ga0070680_101948317 3300005336 Bacteria 509
78 Ga0070680_101964372 3300005336 Bacteria 507
79 Ga0070682_100074295 3300005337 Bacteria 2183
80 Ga0070682_100471395 3300005337 Bacteria 966
81 Ga0068868_100015245 3300005338 Bacteria 5681
82 Ga0068868_100048166 3300005338 Bacteria 3343
83 Ga0068868_100061889 3300005338 Bacteria 2966
84 Ga0068868_100064262 3300005338 Bacteria 2913
85 Ga0068868_100490199 3300005338 Bacteria 1075
86 Ga0068868_100499257 3300005338 Bacteria 1065
87 Ga0068868_101153908 3300005338 Bacteria 715
88 Ga0068868_101436788 3300005338 Bacteria 644
89 Ga0070660_100000156 3300005339 Bacteria 44192
90 Ga0070660_100002966 3300005339 Bacteria 11674
91 Ga0070660_100016614 3300005339 Bacteria 5346
92 Ga0070660_100028293 3300005339 Bacteria 4192
93 Ga0070660_100064071 3300005339 Bacteria 2859
94 Ga0070660_100072385 3300005339 Bacteria 2693
95 Ga0070660_100144401 3300005339 Bacteria 1911
96 Ga0070660_100277699 3300005339 Bacteria 1370
97 Ga0070660_100341182 3300005339 Bacteria 1233
98 Ga0070660_100651836 3300005339 Bacteria 882
99 Ga0070660_101339846 3300005339 Unclassified 608
100 Ga0070660_101795208 3300005339 Bacteria 522
101 Ga0070689_100158173 3300005340 Bacteria 1830
102 Ga0070691_10658536 3300005341 Bacteria 624
103 Ga0070661_100034708 3300005344 Bacteria 3659
104 Ga0070661_100036795 3300005344 Bacteria 3557
105 Ga0070661_100069996 3300005344 Bacteria 2580
106 Ga0070661_100081244 3300005344 Bacteria 2393
107 Ga0070661_100087732 3300005344 Bacteria 2302
108 Ga0070661_100128134 3300005344 Bacteria 1905
109 Ga0070661_100129254 3300005344 Bacteria 1896
110 Ga0070661_100303823 3300005344 Bacteria 1243
111 Ga0070661_100374693 3300005344 Bacteria 1121
112 Ga0070661_100504222 3300005344 Bacteria 969
113 Ga0070692_10278260 3300005345 Bacteria 1013
114 Ga0070692_10411460 3300005345 Bacteria 856
115 Ga0070692_10514304 3300005345 Bacteria 778
116 Ga0070668_100379161 3300005347 Bacteria 1203
117 Ga0070668_100840641 3300005347 Unclassified 818
118 Ga0070668_102037572 3300005347 Bacteria 529
119 Ga0070669_100033518 3300005353 Bacteria 3715
120 Ga0070669_100164872 3300005353 Bacteria 1724
121 Ga0070669_100452609 3300005353 Bacteria 1058
122 Ga0070669_100454631 3300005353 Bacteria 1056
123 Ga0070669_100966435 3300005353 Bacteria 730
124 Ga0070675_100023558 3300005354 Bacteria 4925
125 Ga0070675_100180001 3300005354 Bacteria 1827
126 Ga0070675_100210201 3300005354 Bacteria 1691
127 Ga0070675_100257207 3300005354 Bacteria 1529
128 Ga0070675_100924480 3300005354 Bacteria 800
129 Ga0070671_100000051 3300005355 Bacteria 79207
130 Ga0070671_100006975 3300005355 Bacteria 9048
131 Ga0070671_100033206 3300005355 Bacteria 4267
132 Ga0070671_100059930 3300005355 Bacteria 3168
133 Ga0070671_100143990 3300005355 Bacteria 2012
134 Ga0070671_100235834 3300005355 Bacteria 1553
135 Ga0070671_100259607 3300005355 Bacteria 1476
136 Ga0070671_100306390 3300005355 Bacteria 1352
137 Ga0070671_100420832 3300005355 Bacteria 1144
138 Ga0070671_101540279 3300005355 Bacteria 589
139 Ga0070674_100011997 3300005356 Bacteria 5306
140 Ga0070674_100014729 3300005356 Bacteria 4866
141 Ga0070674_100026956 3300005356 Bacteria 3760
142 Ga0070674_100051171 3300005356 Bacteria 2846
143 Ga0070674_100175509 3300005356 Bacteria 1637
144 Ga0070674_100389875 3300005356 Unclassified 1135
145 Ga0070674_101351730 3300005356 Bacteria 637
146 Ga0070673_100011602 3300005364 Bacteria 6020
147 Ga0070673_100011732 3300005364 Bacteria 5992
148 Ga0070673_100114366 3300005364 Bacteria 2242
149 Ga0070673_100155841 3300005364 Bacteria 1938
150 Ga0070673_100302014 3300005364 Bacteria 1409
151 Ga0070673_100376767 3300005364 Bacteria 1264
152 Ga0070673_100413693 3300005364 Bacteria 1208
153 Ga0070673_100677424 3300005364 Bacteria 946
154 Ga0070673_101754116 3300005364 Bacteria 588
155 Ga0070688_100554371 3300005365 Bacteria 874
156 Ga0070688_101610996 3300005365 Bacteria 530
157 Ga0070659_100003926 3300005366 Bacteria 10583
158 Ga0070659_100061929 3300005366 Bacteria 2957
159 Ga0070659_100066651 3300005366 Bacteria 2853
160 Ga0070659_100083062 3300005366 Bacteria 2560
161 Ga0070659_100083740 3300005366 Bacteria 2549
162 Ga0070659_100098258 3300005366 Bacteria 2354
163 Ga0070659_100199196 3300005366 Bacteria 1648
164 Ga0070659_100482086 3300005366 Bacteria 1055
165 Ga0070659_101002831 3300005366 Bacteria 733
166 Ga0070659_101047034 3300005366 Bacteria 718
167 Ga0070659_101341076 3300005366 Bacteria 635
168 Ga0070659_101394140 3300005366 Bacteria 623
169 Ga0070659_101427693 3300005366 Bacteria 616
170 Ga0070659_101650748 3300005366 Bacteria 573
171 Ga0070667_100001311 3300005367 Bacteria 22374
172 Ga0070667_100025802 3300005367 Bacteria 4887
173 Ga0070667_100065494 3300005367 Bacteria 3085
174 Ga0070667_100104177 3300005367 Bacteria 2454
175 Ga0070667_100569914 3300005367 Bacteria 1042
176 Ga0070667_101376340 3300005367 Bacteria 662
177 Ga0070667_101669081 3300005367 Bacteria 599
178 Ga0070667_101798653 3300005367 Bacteria 577
179 Ga0070709_10081361 3300005434 Bacteria 2114
180 Ga0070709_11415187 3300005434 Unclassified 563
181 Ga0070714_100055739 3300005435 Bacteria 3379
182 Ga0070714_100063691 3300005435 Bacteria 3171
183 Ga0070714_100252100 3300005435 Bacteria 1632
184 Ga0070714_101824868 3300005435 Bacteria 594
185 Ga0070713_100032969 3300005436 Bacteria 4144
186 Ga0070713_100202477 3300005436 Bacteria 1793
187 Ga0070713_100449365 3300005436 Bacteria 1210
188 Ga0070701_10395867 3300005438 Bacteria 874
189 Ga0070711_101876006 3300005439 Bacteria 526
190 Ga0070663_100010764 3300005455 Bacteria 5711
191 Ga0070663_100020658 3300005455 Bacteria 4363
192 Ga0070663_100026400 3300005455 Bacteria 3934
193 Ga0070663_100093271 3300005455 Bacteria 2234
194 Ga0070663_100271906 3300005455 Bacteria 1347
195 Ga0070663_100387113 3300005455 Bacteria 1140
196 Ga0070663_100391081 3300005455 Bacteria 1134
197 Ga0070663_100561215 3300005455 Bacteria 955
198 Ga0070663_101370547 3300005455 Bacteria 626
199 Ga0070663_101402024 3300005455 Bacteria 619
200 Ga0070678_100001121 3300005456 Bacteria 14070
201 Ga0070678_100002490 3300005456 Bacteria 10099
202 Ga0070678_100034382 3300005456 Bacteria 3529
203 Ga0070678_100137937 3300005456 Bacteria 1948
204 Ga0070678_100206575 3300005456 Bacteria 1624
205 Ga0070678_100344490 3300005456 Bacteria 1279
206 Ga0070662_100001195 3300005457 Bacteria 15948
207 Ga0070662_100004959 3300005457 Bacteria 8456
208 Ga0070662_100014122 3300005457 Bacteria 5327
209 Ga0070662_100017911 3300005457 Bacteria 4782
210 Ga0070662_100039331 3300005457 Bacteria 3363
211 Ga0070662_100039339 3300005457 Bacteria 3363
212 Ga0070662_100045906 3300005457 Bacteria 3137
213 Ga0070662_100058911 3300005457 Bacteria 2796
214 Ga0070662_100078053 3300005457 Bacteria 2459
215 Ga0070662_100189587 3300005457 Bacteria 1625
216 Ga0070662_100198471 3300005457 Bacteria 1591
217 Ga0070662_100294846 3300005457 Bacteria 1316
218 Ga0070662_100653742 3300005457 Unclassified 887
219 Ga0070662_101502363 3300005457 Bacteria 581
220 Ga0070681_10058866 3300005458 Bacteria 3822
221 Ga0070681_10288180 3300005458 Bacteria 1552
222 Ga0070681_11016448 3300005458 Bacteria 749
223 Ga0068867_100022766 3300005459 Bacteria 4482
224 Ga0068867_100368578 3300005459 Bacteria 1203
225 Ga0068867_100493649 3300005459 Bacteria 1051
226 Ga0068867_101153741 3300005459 Bacteria 710
227 Ga0068867_101331753 3300005459 Unclassified 664
228 Ga0070685_10129542 3300005466 Bacteria 1576
229 Ga0070679_100009722 3300005530 Bacteria 9098
230 Ga0070679_100019156 3300005530 Bacteria 6649
231 Ga0070679_100174555 3300005530 Bacteria 2121
232 Ga0070679_100372922 3300005530 Unclassified 1374
233 Ga0070679_100754260 3300005530 Bacteria 916
234 Ga0070679_101353121 3300005530 Unclassified 658
235 Ga0070679_101421165 3300005530 Bacteria 640
236 Ga0070684_100068081 3300005535 Bacteria 3129
237 Ga0070684_102115280 3300005535 Bacteria 531
238 Ga0068853_100025405 3300005539 Bacteria 4969
239 Ga0068853_100387060 3300005539 Bacteria 1307
240 Ga0068853_100469235 3300005539 Bacteria 1185
241 Ga0068853_100522702 3300005539 Bacteria 1122
242 Ga0068853_100640747 3300005539 Bacteria 1011
243 Ga0068853_101155853 3300005539 Unclassified 747
244 Ga0068853_101276403 3300005539 Bacteria 710
245 Ga0068853_101483083 3300005539 Bacteria 657
246 Ga0068853_101643763 3300005539 Bacteria 622
247 Ga0070672_100003335 3300005543 Bacteria 10402
248 Ga0070672_100015335 3300005543 Bacteria 5454
249 Ga0070672_100128397 3300005543 Bacteria 2081
250 Ga0070672_100278366 3300005543 Bacteria 1414
251 Ga0070672_100300936 3300005543 Bacteria 1359
252 Ga0070672_100642030 3300005543 Bacteria 927
253 Ga0070672_101265171 3300005543 Bacteria 658
254 Ga0070672_101549882 3300005543 Bacteria 594
255 Ga0070686_100032521 3300005544 Bacteria 3199
256 Ga0070695_100335500 3300005545 Bacteria 1128
257 Ga0070696_100585448 3300005546 Bacteria 898
258 Ga0070693_100425669 3300005547 Bacteria 926
259 Ga0070665_100013547 3300005548 Bacteria 8203
260 Ga0070665_100019750 3300005548 Bacteria 6763
261 Ga0070665_100021059 3300005548 Bacteria 6556
262 Ga0070665_100566968 3300005548 Bacteria 1148
263 Ga0068855_100042906 3300005563 Bacteria 5359
264 Ga0068855_100377383 3300005563 Bacteria 1557
265 Ga0068855_100553106 3300005563 Bacteria 1245
266 Ga0068855_100994134 3300005563 Bacteria 882
267 Ga0070664_100005488 3300005564 Bacteria 10184
268 Ga0070664_100010804 3300005564 Bacteria 7403
269 Ga0070664_100073402 3300005564 Bacteria 2935
270 Ga0070664_100088706 3300005564 Bacteria 2674
271 Ga0070664_100229423 3300005564 Bacteria 1664
272 Ga0070664_100286767 3300005564 Bacteria 1486
273 Ga0070664_100563832 3300005564 Bacteria 1054
274 Ga0070664_100714899 3300005564 Bacteria 934
275 Ga0070664_100734566 3300005564 Unclassified 921
276 Ga0070664_102197857 3300005564 Unclassified 524
277 Ga0068857_100008116 3300005577 Bacteria 9064
278 Ga0068857_100126060 3300005577 Bacteria 2307
279 Ga0068857_100151220 3300005577 Bacteria 2103
280 Ga0068857_100315172 3300005577 Bacteria 1444
281 Ga0068857_100434983 3300005577 Bacteria 1225
282 Ga0068857_102278722 3300005577 Bacteria 532
283 Ga0068854_100020300 3300005578 Bacteria 4493
284 Ga0068854_100047329 3300005578 Bacteria 3065
285 Ga0068854_100074929 3300005578 Bacteria 2484
286 Ga0068854_100111507 3300005578 Bacteria 2064
287 Ga0068854_100165138 3300005578 Bacteria 1718
288 Ga0068854_100271063 3300005578 Bacteria 1363
289 Ga0068854_100275076 3300005578 Bacteria 1353
290 Ga0068854_100566578 3300005578 Bacteria 965
291 Ga0068854_100638705 3300005578 Bacteria 913
292 Ga0068854_100884689 3300005578 Bacteria 784
293 Ga0068854_102151494 3300005578 Bacteria 516
294 Ga0068856_100023762 3300005614 Bacteria 5961
295 Ga0068856_100027363 3300005614 Bacteria 5563
296 Ga0068856_100185923 3300005614 Bacteria 2091
297 Ga0068856_100323893 3300005614 Bacteria 1558
298 Ga0068856_100333314 3300005614 Bacteria 1535
299 Ga0068856_101618028 3300005614 Bacteria 661
300 Ga0068856_102449087 3300005614 Bacteria 529
301 Ga0070702_101482694 3300005615 Bacteria 557
302 Ga0068852_100035258 3300005616 Bacteria 4171
303 Ga0068852_100038835 3300005616 Bacteria 4004
304 Ga0068852_100045745 3300005616 Bacteria 3725
305 Ga0068852_100122683 3300005616 Bacteria 2382
306 Ga0068852_100182868 3300005616 Bacteria 1972
307 Ga0068852_100310680 3300005616 Bacteria 1528
308 Ga0068852_100333219 3300005616 Bacteria 1477
309 Ga0068852_100456244 3300005616 Bacteria 1266
310 Ga0068852_100471672 3300005616 Bacteria 1246
311 Ga0068852_100566468 3300005616 Bacteria 1138
312 Ga0068852_100869340 3300005616 Bacteria 918
313 Ga0068852_101273366 3300005616 Bacteria 757
314 Ga0068859_100067219 3300005617 Bacteria 3619
315 Ga0068859_100186379 3300005617 Bacteria 2159
316 Ga0068859_100279375 3300005617 Bacteria 1762
317 Ga0068859_101433960 3300005617 Bacteria 762
318 Ga0068864_100003198 3300005618 Bacteria 13529
319 Ga0068864_100023399 3300005618 Bacteria 5187
320 Ga0068864_100473741 3300005618 Bacteria 1201
321 Ga0068866_10023764 3300005718 Bacteria 2855
322 Ga0068866_10026409 3300005718 Bacteria 2742
323 Ga0068866_10204017 3300005718 Bacteria 1183
324 Ga0068866_10339675 3300005718 Bacteria 951
325 Ga0068861_100027898 3300005719 Bacteria 4117
326 Ga0068861_100531459 3300005719 Bacteria 1068
327 Ga0068861_100754928 3300005719 Unclassified 909
328 Ga0068861_101503858 3300005719 Unclassified 661
329 Ga0068861_101728555 3300005719 Bacteria 619
330 Ga0068851_10052156 3300005834 Bacteria 2080
331 Ga0068851_10068571 3300005834 Bacteria 1831
332 Ga0068851_10091247 3300005834 Bacteria 1604
333 Ga0068851_10268414 3300005834 Bacteria 972
334 Ga0068870_11141887 3300005840 Bacteria 562
335 Ga0068863_100003336 3300005841 Bacteria 15863
336 Ga0068863_100004174 3300005841 Bacteria 14263
337 Ga0068863_100503547 3300005841 Bacteria 1193
338 Ga0068863_100720481 3300005841 Bacteria 992
339 Ga0068858_100009881 3300005842 Bacteria 9065
340 Ga0068858_100024491 3300005842 Bacteria 5622
341 Ga0068858_100551693 3300005842 Bacteria 1116
342 Ga0068860_100264921 3300005843 Bacteria 1676
343 Ga0068862_100345812 3300005844 Bacteria 1378
344 Ga0068862_100889838 3300005844 Bacteria 875
345 Ga0081455_10112174 3300005937 Bacteria 2165
346 Ga0081539_10021962 3300005985 Bacteria 4240
347 Ga0070717_11321974 3300006028 Bacteria 655
348 Ga0070716_100017029 3300006173 Bacteria 3761
349 Ga0070716_100237612 3300006173 Bacteria 1234
350 Ga0070712_100043513 3300006175 Bacteria 3091
351 Ga0070712_100199713 3300006175 Bacteria 1570
352 Ga0070712_100409844 3300006175 Unclassified 1121
353 Ga0075369_10224746 3300006186 Bacteria 869
354 Ga0075366_10634674 3300006195 Bacteria 662
355 Ga0097621_100036057 3300006237 Bacteria 3954
356 Ga0097621_100200994 3300006237 Bacteria 1730
357 Ga0097621_100874416 3300006237 Bacteria 836
358 Ga0097621_101060345 3300006237 Bacteria 760
359 Ga0075370_10373493 3300006353 Bacteria 854
360 Ga0068871_100200469 3300006358 Bacteria 1723
361 Ga0068871_100460286 3300006358 Bacteria 1141
362 Ga0075434_100306851 3300006871 Bacteria 1607
363 Ga0068865_100072973 3300006881 Bacteria 2439
364 Ga0068865_100615315 3300006881 Bacteria 920
365 Ga0068865_100978046 3300006881 Bacteria 740
366 Ga0068865_101045802 3300006881 Bacteria 717
367 Ga0097620_100067222 3300006931 Bacteria 3619
368 Ga0097620_100186370 3300006931 Bacteria 2159
369 Ga0097620_100279373 3300006931 Bacteria 1762
370 Ga0097620_101433801 3300006931 Bacteria 762
371 Ga0105244_10507981 3300009036 Bacteria 555
372 Ga0105240_11027586 3300009093 Unclassified 880
373 Ga0105240_11248634 3300009093 Unclassified 785
374 Ga0105245_10019606 3300009098 Bacteria 5925
375 Ga0105245_10023282 3300009098 Bacteria 5437
376 Ga0105245_10198795 3300009098 Bacteria 1924
377 Ga0105245_11304672 3300009098 Bacteria 775
378 Ga0105245_11610038 3300009098 Bacteria 701
379 Ga0105245_12384180 3300009098 Bacteria 583
380 Ga0105243_10017247 3300009148 Bacteria 5460
381 Ga0105243_10592442 3300009148 Bacteria 1066
382 Ga0105243_11201855 3300009148 Bacteria 771
383 Ga0105241_10685630 3300009174 Bacteria 934
384 Ga0105241_11342443 3300009174 Unclassified 682
385 Ga0105242_10155550 3300009176 Bacteria 1997
386 Ga0105242_11181354 3300009176 Bacteria 783
387 Ga0105248_10001634 3300009177 Bacteria 24926
388 Ga0105248_10001894 3300009177 Bacteria 23189
389 Ga0105248_10002448 3300009177 Bacteria 20617
390 Ga0105248_10026794 3300009177 Bacteria 6411
391 Ga0105248_10052041 3300009177 Bacteria 4595
392 Ga0105248_10055565 3300009177 Bacteria 4441
393 Ga0105248_10219657 3300009177 Bacteria 2140
394 Ga0105248_10254978 3300009177 Bacteria 1975
395 Ga0105248_10688259 3300009177 Bacteria 1153
396 Ga0105237_10449078 3300009545 Bacteria 1295
397 Ga0105238_10324553 3300009551 Bacteria 1526
398 Ga0105249_10261845 3300009553 Bacteria 1719
399 Ga0105249_11854036 3300009553 Bacteria 676
400 Ga0105239_10544206 3300010375 Bacteria 1322
401 Ga0105239_11448792 3300010375 Unclassified 793
402 Ga0105239_11720435 3300010375 Bacteria 726
403 Ga0105239_13271721 3300010375 Bacteria 527
404 Ga0105246_10064694 3300011119 Bacteria 2556
405 Ga0105246_10641954 3300011119 Bacteria 923
406 Ga0157327_1014092 3300012512 Bacteria 812
407 Ga0157373_10021660 3300013100 Bacteria 4664
408 Ga0157373_10072363 3300013100 Bacteria 2433
409 Ga0157373_10173185 3300013100 Bacteria 1519
410 Ga0157373_10368773 3300013100 Bacteria 1026
411 Ga0157373_10524357 3300013100 Bacteria 857
412 Ga0157373_10805553 3300013100 Bacteria 693
413 Ga0157371_10051761 3300013102 Bacteria 2918
414 Ga0157371_10053945 3300013102 Bacteria 2855
415 Ga0157371_10225171 3300013102 Bacteria 1347
416 Ga0157371_10257009 3300013102 Bacteria 1259
417 Ga0157371_10312879 3300013102 Bacteria 1138
418 Ga0157371_10357931 3300013102 Bacteria 1063
419 Ga0157371_10472897 3300013102 Bacteria 923
420 Ga0157370_10041941 3300013104 Bacteria 4411
421 Ga0157370_10133136 3300013104 Bacteria 2318
422 Ga0157370_10167170 3300013104 Bacteria 2045
423 Ga0157370_10957146 3300013104 Bacteria 776
424 Ga0157369_10140020 3300013105 Bacteria 2561
425 Ga0157369_10153643 3300013105 Bacteria 2432
426 Ga0157369_10462082 3300013105 Bacteria 1314
427 Ga0157369_10862726 3300013105 Bacteria 929
428 Ga0157374_10019076 3300013296 Bacteria 6068
429 Ga0157374_10159797 3300013296 Bacteria 2195
430 Ga0157374_10197873 3300013296 Bacteria 1967
431 Ga0157374_11582747 3300013296 Unclassified 679
432 Ga0157374_11988145 3300013296 Archaea 608
433 Ga0157378_10191875 3300013297 Bacteria 1927
434 Ga0157378_10268195 3300013297 Bacteria 1641
435 Ga0157378_10534681 3300013297 Bacteria 1175
436 Ga0157378_10535647 3300013297 Bacteria 1174
437 Ga0157378_10589800 3300013297 Bacteria 1121
438 Ga0157378_10959130 3300013297 Bacteria 888
439 Ga0163162_10000768 3300013306 Bacteria 29827
440 Ga0163162_10023881 3300013306 Bacteria 6034
441 Ga0163162_10104995 3300013306 Bacteria 2920
442 Ga0163162_10128812 3300013306 Bacteria 2639
443 Ga0163162_12230085 3300013306 Unclassified 629
444 Ga0157372_10118491 3300013307 Bacteria 3038
445 Ga0157372_10409795 3300013307 Bacteria 1580
446 Ga0157372_10591808 3300013307 Bacteria 1293
447 Ga0157372_10890480 3300013307 Bacteria 1033
448 Ga0157372_10917523 3300013307 Bacteria 1016
449 Ga0157372_11572598 3300013307 Bacteria 757
450 Ga0157372_11613633 3300013307 Bacteria 747
451 Ga0157375_10005630 3300013308 Bacteria 10907
452 Ga0157375_10020583 3300013308 Bacteria 6030
453 Ga0157375_10213250 3300013308 Bacteria 2089
454 Ga0157375_10403985 3300013308 Bacteria 1533
455 Ga0157375_11826491 3300013308 Bacteria 721
456 Ga0163163_10073297 3300014325 Bacteria 3415
457 Ga0163163_10206336 3300014325 Bacteria 2013
458 Ga0157380_10835979 3300014326 Bacteria 941
459 Ga0157380_12285446 3300014326 Bacteria 605
460 Ga0182008_10056733 3300014497 Bacteria 1934
461 Ga0157377_10148714 3300014745 Bacteria 1446
462 Ga0157379_12409262 3300014968 Bacteria 525
463 Ga0157376_10090404 3300014969 Bacteria 2649
464 Ga0163161_10328102 3300017792 Bacteria 1211
465 Ga0163161_10368541 3300017792 Bacteria 1145
466 Ga0206354_11545716 3300020081 Bacteria 1047
467 Ga0213876_10023631 3300021384 Bacteria 3246
468 Ga0213876_10077576 3300021384 Bacteria 1755
469 Ga0207673_1022881 3300025290 Bacteria 849
470 Ga0207697_10011452 3300025315 Bacteria 3751
471 Ga0207697_10140730 3300025315 Bacteria 1046
472 Ga0207656_10130030 3300025321 Bacteria 1179
473 Ga0207656_10173642 3300025321 Bacteria 1031
474 Ga0207656_10194328 3300025321 Bacteria 978
475 Ga0207656_10321154 3300025321 Bacteria 769
476 Ga0207682_10004204 3300025893 Bacteria 6081
477 Ga0207682_10077134 3300025893 Bacteria 1421
478 Ga0207642_10007391 3300025899 Bacteria 3709
479 Ga0207642_10042153 3300025899 Bacteria 2004
480 Ga0207642_10164071 3300025899 Bacteria 1196
481 Ga0207642_10270163 3300025899 Bacteria 973
482 Ga0207642_10610956 3300025899 Bacteria 680
483 Ga0207688_10009345 3300025901 Bacteria 5344
484 Ga0207688_10022437 3300025901 Bacteria 3454
485 Ga0207688_10027272 3300025901 Bacteria 3142
486 Ga0207688_10029570 3300025901 Bacteria 3017
487 Ga0207688_10126250 3300025901 Bacteria 1496
488 Ga0207688_10129436 3300025901 Bacteria 1479
489 Ga0207680_10002585 3300025903 Bacteria 8443
490 Ga0207680_10101277 3300025903 Bacteria 1851
491 Ga0207680_10310385 3300025903 Bacteria 1101
492 Ga0207680_10505087 3300025903 Bacteria 861
493 Ga0207680_11234789 3300025903 Bacteria 532
494 Ga0207680_11242879 3300025903 Archaea 531
495 Ga0207647_10009676 3300025904 Bacteria 6843
496 Ga0207647_10012986 3300025904 Bacteria 5785
497 Ga0207647_10027273 3300025904 Bacteria 3724
498 Ga0207647_10050442 3300025904 Bacteria 2576
499 Ga0207647_10065670 3300025904 Bacteria 2202
500 Ga0207647_10082023 3300025904 Bacteria 1932
501 Ga0207647_10302630 3300025904 Bacteria 910
502 Ga0207699_10146761 3300025906 Bacteria 1556
503 Ga0207645_10020823 3300025907 Bacteria 4285
504 Ga0207645_10031056 3300025907 Bacteria 3439
505 Ga0207645_10046178 3300025907 Bacteria 2783
506 Ga0207645_10762584 3300025907 Bacteria 658
507 Ga0207645_11026039 3300025907 Bacteria 558
508 Ga0207645_11191719 3300025907 Unclassified 511
509 Ga0207705_10003597 3300025909 Bacteria 11806
510 Ga0207705_10004771 3300025909 Bacteria 10210
511 Ga0207705_10009807 3300025909 Bacteria 6970
512 Ga0207705_10046912 3300025909 Bacteria 3106
513 Ga0207705_10131333 3300025909 Bacteria 1864
514 Ga0207705_10180650 3300025909 Bacteria 1592
515 Ga0207705_10578866 3300025909 Bacteria 873
516 Ga0207705_10799219 3300025909 Bacteria 732
517 Ga0207705_11140637 3300025909 Unclassified 599
518 Ga0207654_11216505 3300025911 Bacteria 549
519 Ga0207707_10124551 3300025912 Bacteria 2254
520 Ga0207707_10150276 3300025912 Bacteria 2036
521 Ga0207707_10341825 3300025912 Bacteria 1290
522 Ga0207707_10476500 3300025912 Bacteria 1066
523 Ga0207695_10210052 3300025913 Bacteria 1858
524 Ga0207693_10014544 3300025915 Bacteria 6324
525 Ga0207660_10002662 3300025917 Bacteria 11716
526 Ga0207662_10207392 3300025918 Bacteria 1271
527 Ga0207662_10974084 3300025918 Bacteria 602
528 Ga0207657_10000434 3300025919 Bacteria 44542
529 Ga0207657_10001170 3300025919 Bacteria 27822
530 Ga0207657_10002813 3300025919 Bacteria 18715
531 Ga0207657_10024081 3300025919 Bacteria 5651
532 Ga0207657_10040928 3300025919 Bacteria 4102
533 Ga0207657_10042145 3300025919 Bacteria 4030
534 Ga0207657_10098472 3300025919 Bacteria 2430
535 Ga0207657_10102994 3300025919 Bacteria 2367
536 Ga0207657_10124050 3300025919 Bacteria 2122
537 Ga0207657_10167306 3300025919 Bacteria 1783
538 Ga0207657_10268630 3300025919 Bacteria 1356
539 Ga0207657_10356827 3300025919 Bacteria 1153
540 Ga0207657_10510349 3300025919 Bacteria 941
541 Ga0207657_10958389 3300025919 Unclassified 657
542 Ga0207649_10011041 3300025920 Bacteria 4970
543 Ga0207649_10027276 3300025920 Bacteria 3350
544 Ga0207649_10034090 3300025920 Bacteria 3047
545 Ga0207649_10060338 3300025920 Bacteria 2383
546 Ga0207649_10112156 3300025920 Bacteria 1824
547 Ga0207649_10129581 3300025920 Bacteria 1711
548 Ga0207649_10287679 3300025920 Bacteria 1197
549 Ga0207649_10307304 3300025920 Bacteria 1161
550 Ga0207649_10434297 3300025920 Bacteria 988
551 Ga0207649_10494474 3300025920 Bacteria 929
552 Ga0207649_11694553 3300025920 Bacteria 500
553 Ga0207652_10000034 3300025921 Bacteria 138571
554 Ga0207652_10058852 3300025921 Bacteria 3311
555 Ga0207652_10122947 3300025921 Bacteria 2310
556 Ga0207652_10143490 3300025921 Bacteria 2136
557 Ga0207652_10454642 3300025921 Bacteria 1154
558 Ga0207681_10004355 3300025923 Bacteria 8731
559 Ga0207681_10050998 3300025923 Bacteria 2802
560 Ga0207681_10167103 3300025923 Bacteria 1664
561 Ga0207681_10264112 3300025923 Bacteria 1349
562 Ga0207681_10336792 3300025923 Bacteria 1204
563 Ga0207681_10418805 3300025923 Bacteria 1085
564 Ga0207694_10538823 3300025924 Bacteria 979
565 Ga0207650_10002948 3300025925 Bacteria 11736
566 Ga0207650_10040539 3300025925 Bacteria 3408
567 Ga0207650_10043580 3300025925 Bacteria 3294
568 Ga0207650_10052391 3300025925 Bacteria 3023
569 Ga0207650_10059964 3300025925 Bacteria 2838
570 Ga0207650_10107594 3300025925 Bacteria 2154
571 Ga0207650_10227661 3300025925 Bacteria 1503
572 Ga0207650_11345655 3300025925 Bacteria 608
573 Ga0207650_11421791 3300025925 Bacteria 590
574 Ga0207659_10076781 3300025926 Bacteria 2457
575 Ga0207659_10085108 3300025926 Bacteria 2348
576 Ga0207659_10829266 3300025926 Bacteria 795
577 Ga0207659_11153323 3300025926 Bacteria 666
578 Ga0207687_10012657 3300025927 Bacteria 5512
579 Ga0207687_10035715 3300025927 Bacteria 3382
580 Ga0207687_10893712 3300025927 Bacteria 760
581 Ga0207687_11508204 3300025927 Unclassified 577
582 Ga0207700_10388919 3300025928 Bacteria 1221
583 Ga0207664_10018146 3300025929 Bacteria 5171
584 Ga0207664_10079535 3300025929 Bacteria 2662
585 Ga0207664_11394232 3300025929 Unclassified 621
586 Ga0207644_10000052 3300025931 Bacteria 91473
587 Ga0207644_10000943 3300025931 Bacteria 18532
588 Ga0207644_10000996 3300025931 Bacteria 18076
589 Ga0207644_10017678 3300025931 Bacteria 4821
590 Ga0207644_10032654 3300025931 Bacteria 3633
591 Ga0207644_10105072 3300025931 Bacteria 2127
592 Ga0207644_10209244 3300025931 Bacteria 1541
593 Ga0207644_10250949 3300025931 Bacteria 1412
594 Ga0207644_10259752 3300025931 Bacteria 1388
595 Ga0207644_10761302 3300025931 Bacteria 809
596 Ga0207644_11284946 3300025931 Bacteria 615
597 Ga0207644_11564618 3300025931 Bacteria 553
598 Ga0207690_10002842 3300025932 Bacteria 10446
599 Ga0207690_10013275 3300025932 Bacteria 4946
600 Ga0207690_10034676 3300025932 Bacteria 3253
601 Ga0207690_10049022 3300025932 Bacteria 2813
602 Ga0207690_10109546 3300025932 Bacteria 1987
603 Ga0207690_10149234 3300025932 Bacteria 1732
604 Ga0207690_10199876 3300025932 Bacteria 1517
605 Ga0207690_10260883 3300025932 Bacteria 1342
606 Ga0207690_10427935 3300025932 Bacteria 1060
607 Ga0207690_10691141 3300025932 Bacteria 838
608 Ga0207690_10892420 3300025932 Bacteria 737
609 Ga0207690_11199707 3300025932 Bacteria 634
610 Ga0207690_11496497 3300025932 Bacteria 564
611 Ga0207706_10000299 3300025933 Bacteria 53751
612 Ga0207706_10000614 3300025933 Bacteria 37833
613 Ga0207706_10007215 3300025933 Bacteria 10277
614 Ga0207706_10020875 3300025933 Bacteria 5881
615 Ga0207706_10040584 3300025933 Bacteria 4125
616 Ga0207706_10048431 3300025933 Bacteria 3758
617 Ga0207706_10124972 3300025933 Bacteria 2263
618 Ga0207706_10155926 3300025933 Bacteria 2008
619 Ga0207706_10180054 3300025933 Bacteria 1856
620 Ga0207706_10528423 3300025933 Bacteria 1017
621 Ga0207706_10601912 3300025933 Bacteria 944
622 Ga0207706_10680466 3300025933 Bacteria 880
623 Ga0207706_11571005 3300025933 Bacteria 534
624 Ga0207686_10269296 3300025934 Bacteria 1252
625 Ga0207686_10342765 3300025934 Bacteria 1123
626 Ga0207670_10203249 3300025936 Bacteria 1506
627 Ga0207670_10501107 3300025936 Bacteria 986
628 Ga0207669_10153294 3300025937 Bacteria 1617
629 Ga0207669_10168664 3300025937 Bacteria 1555
630 Ga0207669_10186735 3300025937 Bacteria 1491
631 Ga0207669_10410156 3300025937 Bacteria 1063
632 Ga0207669_10556401 3300025937 Bacteria 926
633 Ga0207669_10985967 3300025937 Bacteria 707
634 Ga0207704_10138617 3300025938 Bacteria 1698
635 Ga0207704_10292820 3300025938 Bacteria 1243
636 Ga0207704_11156174 3300025938 Bacteria 659
637 Ga0207665_10565645 3300025939 Bacteria 885
638 Ga0207691_10000998 3300025940 Bacteria 28103
639 Ga0207691_10013011 3300025940 Bacteria 7967
640 Ga0207691_10016113 3300025940 Bacteria 7100
641 Ga0207691_10071125 3300025940 Bacteria 3140
642 Ga0207691_10108220 3300025940 Bacteria 2474
643 Ga0207691_10128425 3300025940 Bacteria 2241
644 Ga0207691_10339902 3300025940 Bacteria 1285
645 Ga0207691_10471177 3300025940 Bacteria 1068
646 Ga0207691_11150273 3300025940 Bacteria 644
647 Ga0207711_10000420 3300025941 Bacteria 44798
648 Ga0207711_10001311 3300025941 Bacteria 23539
649 Ga0207711_10003129 3300025941 Bacteria 14421
650 Ga0207711_10011832 3300025941 Bacteria 7250
651 Ga0207711_10189622 3300025941 Bacteria 1873
652 Ga0207711_10192745 3300025941 Bacteria 1858
653 Ga0207711_10294821 3300025941 Bacteria 1495
654 Ga0207689_10033251 3300025942 Bacteria 4285
655 Ga0207661_10032385 3300025944 Bacteria 4049
656 Ga0207661_10224509 3300025944 Bacteria 1661
657 Ga0207661_10415947 3300025944 Bacteria 1221
658 Ga0207661_11391683 3300025944 Bacteria 644
659 Ga0207679_10023965 3300025945 Bacteria 4180
660 Ga0207679_10025671 3300025945 Bacteria 4055
661 Ga0207679_10034407 3300025945 Bacteria 3574
662 Ga0207679_10092592 3300025945 Bacteria 2342
663 Ga0207679_10183638 3300025945 Bacteria 1732
664 Ga0207679_10295415 3300025945 Bacteria 1394
665 Ga0207679_10523871 3300025945 Bacteria 1060
666 Ga0207679_10739393 3300025945 Bacteria 894
667 Ga0207679_10904130 3300025945 Bacteria 807
668 Ga0207679_10961685 3300025945 Bacteria 782
669 Ga0207667_10012261 3300025949 Bacteria 9895
670 Ga0207667_10049447 3300025949 Bacteria 4440
671 Ga0207667_10366878 3300025949 Bacteria 1468
672 Ga0207667_10500052 3300025949 Bacteria 1233
673 Ga0207651_10000652 3300025960 Bacteria 14745
674 Ga0207651_10012001 3300025960 Bacteria 4878
675 Ga0207651_10013969 3300025960 Bacteria 4619
676 Ga0207651_10140058 3300025960 Bacteria 1867
677 Ga0207651_10201589 3300025960 Bacteria 1595
678 Ga0207651_10430531 3300025960 Bacteria 1128
679 Ga0207651_10441912 3300025960 Bacteria 1114
680 Ga0207651_10480599 3300025960 Bacteria 1071
681 Ga0207651_10654794 3300025960 Bacteria 922
682 Ga0207651_11182526 3300025960 Bacteria 686
683 Ga0207651_11281837 3300025960 Bacteria 658
684 Ga0207712_11482182 3300025961 Bacteria 608
685 Ga0207668_10198870 3300025972 Bacteria 1594
686 Ga0207668_10219539 3300025972 Bacteria 1526
687 Ga0207668_11125351 3300025972 Bacteria 704
688 Ga0207640_10057391 3300025981 Bacteria 2560
689 Ga0207640_10175109 3300025981 Bacteria 1603
690 Ga0207640_10207631 3300025981 Bacteria 1489
691 Ga0207640_10209652 3300025981 Bacteria 1483
692 Ga0207640_10425775 3300025981 Bacteria 1087
693 Ga0207640_10610929 3300025981 Bacteria 924
694 Ga0207640_10832447 3300025981 Bacteria 802
695 Ga0207640_11160446 3300025981 Bacteria 685
696 Ga0207640_11370765 3300025981 Bacteria 633
697 Ga0207640_11607904 3300025981 Bacteria 585
698 Ga0207658_10004807 3300025986 Bacteria 9347
699 Ga0207658_10038494 3300025986 Bacteria 3445
700 Ga0207658_10066062 3300025986 Bacteria 2719
701 Ga0207658_10123783 3300025986 Bacteria 2066
702 Ga0207658_10165199 3300025986 Bacteria 1818
703 Ga0207658_10312073 3300025986 Bacteria 1359
704 Ga0207658_10654966 3300025986 Bacteria 947
705 Ga0207658_11098034 3300025986 Bacteria 727
706 Ga0207677_10003117 3300026023 Bacteria 8747
707 Ga0207677_10018354 3300026023 Bacteria 4196
708 Ga0207677_10030638 3300026023 Bacteria 3437
709 Ga0207677_10072056 3300026023 Bacteria 2441
710 Ga0207677_10679258 3300026023 Bacteria 912
711 Ga0207703_10002663 3300026035 Bacteria 15352
712 Ga0207703_10031952 3300026035 Bacteria 4164
713 Ga0207703_10079372 3300026035 Bacteria 2730
714 Ga0207639_10117021 3300026041 Bacteria 2183
715 Ga0207639_10230713 3300026041 Bacteria 1604
716 Ga0207639_10555240 3300026041 Bacteria 1055
717 Ga0207639_10622591 3300026041 Bacteria 997
718 Ga0207639_10654861 3300026041 Bacteria 972
719 Ga0207639_10679122 3300026041 Bacteria 954
720 Ga0207639_10716064 3300026041 Bacteria 929
721 Ga0207639_11194175 3300026041 Bacteria 714
722 Ga0207678_10000117 3300026067 Bacteria 65678
723 Ga0207678_10006831 3300026067 Bacteria 10119
724 Ga0207678_10020241 3300026067 Bacteria 5841
725 Ga0207678_10040138 3300026067 Bacteria 4060
726 Ga0207678_10129505 3300026067 Bacteria 2152
727 Ga0207678_10143668 3300026067 Bacteria 2037
728 Ga0207678_10170926 3300026067 Bacteria 1856
729 Ga0207678_10216460 3300026067 Bacteria 1639
730 Ga0207678_10265351 3300026067 Bacteria 1472
731 Ga0207678_11064414 3300026067 Bacteria 716
732 Ga0207702_10079971 3300026078 Bacteria 2835
733 Ga0207702_10408586 3300026078 Bacteria 1310
734 Ga0207702_10993495 3300026078 Unclassified 832
735 Ga0207702_11535377 3300026078 Bacteria 659
736 Ga0207702_11818892 3300026078 Bacteria 601
737 Ga0207702_12287974 3300026078 Bacteria 528
738 Ga0207641_10006363 3300026088 Bacteria 9971
739 Ga0207641_10092172 3300026088 Bacteria 2653
740 Ga0207641_10810568 3300026088 Bacteria 926
741 Ga0207641_11232560 3300026088 Bacteria 748
742 Ga0207648_10016503 3300026089 Bacteria 6744
743 Ga0207648_10057138 3300026089 Bacteria 3404
744 Ga0207648_10142850 3300026089 Bacteria 2110
745 Ga0207648_10309763 3300026089 Bacteria 1417
746 Ga0207648_10358818 3300026089 Bacteria 1315
747 Ga0207676_10005353 3300026095 Bacteria 9088
748 Ga0207676_10045938 3300026095 Bacteria 3376
749 Ga0207676_10228584 3300026095 Bacteria 1661
750 Ga0207676_10310404 3300026095 Bacteria 1444
751 Ga0207674_10000086 3300026116 Bacteria 100722
752 Ga0207674_10006741 3300026116 Bacteria 13483
753 Ga0207674_10154256 3300026116 Bacteria 2252
754 Ga0207674_10173540 3300026116 Bacteria 2109
755 Ga0207674_11045692 3300026116 Bacteria 786
756 Ga0207675_100044742 3300026118 Bacteria 4137
757 Ga0207675_100147851 3300026118 Bacteria 2235
758 Ga0207675_101529073 3300026118 Unclassified 688
759 Ga0207683_10000846 3300026121 Bacteria 28093
760 Ga0207683_10003887 3300026121 Bacteria 12956
761 Ga0207683_10067903 3300026121 Bacteria 3146
762 Ga0207683_10100386 3300026121 Bacteria 2584
763 Ga0207683_10106035 3300026121 Bacteria 2513
764 Ga0207683_10177759 3300026121 Bacteria 1929
765 Ga0207698_10078193 3300026142 Bacteria 2655
766 Ga0207698_10089400 3300026142 Bacteria 2515
767 Ga0207698_10147231 3300026142 Bacteria 2038
768 Ga0207698_10149172 3300026142 Bacteria 2027
769 Ga0207698_10232933 3300026142 Bacteria 1673
770 Ga0207698_10245977 3300026142 Bacteria 1633
771 Ga0207698_10277882 3300026142 Bacteria 1547
772 Ga0207698_10293572 3300026142 Bacteria 1510
773 Ga0207698_10355606 3300026142 Bacteria 1385
774 Ga0207698_10508813 3300026142 Bacteria 1173
775 Ga0207698_10782532 3300026142 Bacteria 955
776 Ga0207698_11361809 3300026142 Bacteria 724
777 Ga0209974_10053592 3300027876 Bacteria 1358
778 Ga0209974_10319248 3300027876 Bacteria 598
779 Ga0268266_10055274 3300028379 Bacteria 3412
780 Ga0268266_10083549 3300028379 Bacteria 2787
781 Ga0268266_10506053 3300028379 Bacteria 1154
782 Ga0268265_10475786 3300028380 Bacteria 1172
783 Ga0268265_11085440 3300028380 Bacteria 794
784 Ga0268264_10503308 3300028381 Bacteria 1182
785 Ga0268264_10641038 3300028381 Bacteria 1051
786 Ga0307408_100336708 3300031548 Bacteria 1276
787 Ga0307405_10004019 3300031731 Bacteria 6900
788 Ga0307405_10025754 3300031731 Bacteria 3382
789 Ga0307405_10414443 3300031731 Bacteria 1058
790 Ga0307405_10591326 3300031731 Bacteria 904
791 Ga0307413_10140181 3300031824 Bacteria 1669
792 Ga0307413_11407450 3300031824 Bacteria 613
793 Ga0307410_10047487 3300031852 Bacteria 2869
794 Ga0307410_10112970 3300031852 Bacteria 1968
795 Ga0307410_10215246 3300031852 Bacteria 1474
796 Ga0307406_10103064 3300031901 Bacteria 1948
797 Ga0307406_10176990 3300031901 Bacteria 1549
798 Ga0307407_10082056 3300031903 Bacteria 1953
799 Ga0307407_10473151 3300031903 Bacteria 913
800 Ga0307412_10062941 3300031911 Bacteria 2501
801 Ga0307412_10669854 3300031911 Bacteria 887
802 Ga0307412_10778493 3300031911 Bacteria 828
803 Ga0307412_10873923 3300031911 Bacteria 786
804 Ga0307409_100025333 3300031995 Bacteria 4158
805 Ga0307409_100186308 3300031995 Bacteria 1842
806 Ga0307409_100217944 3300031995 Bacteria 1721
807 Ga0307409_100343324 3300031995 Bacteria 1406
808 Ga0307409_100637213 3300031995 Bacteria 1058
809 Ga0307409_101102104 3300031995 Bacteria 815
810 Ga0307416_100018217 3300032002 Bacteria 4942
811 Ga0307416_100144033 3300032002 Bacteria 2172
812 Ga0307416_100530778 3300032002 Bacteria 1247
813 Ga0307416_102023742 3300032002 Bacteria 678
814 Ga0307414_10102821 3300032004 Bacteria 2154
815 Ga0307414_10600876 3300032004 Bacteria 986
816 Ga0307414_11451945 3300032004 Bacteria 638
817 Ga0307411_10032660 3300032005 Bacteria 3218
818 Ga0307411_10434736 3300032005 Bacteria 1093
819 Ga0307415_100035303 3300032126 Bacteria 3265
820 Ga0307415_100065523 3300032126 Bacteria 2531
821 Ga0307415_100172906 3300032126 Bacteria 1686
822 Ga0307415_101124989 3300032126 Bacteria 736
823 Ga0373950_0075644 3300034818 Unclassified 696
824 Ga0373959_0177768 3300034820 Bacteria 552
825 Ga0373938_0154874 3300034957 Bacteria 612
826 Ga0373929_0018067 3300035085 Bacteria 1398
827 Ga0373939_0095605 3300035114 Bacteria 1011
828 Ga0373939_0375018 3300035114 Bacteria 584
829 Ga0373960_0157523 3300035121 Bacteria 780
830 Ga0373960_0338373 3300035121 Bacteria 568
831 Ga0373943_0029916 3300035170 Bacteria 2575
832 Ga0373961_0081310 3300035241 Bacteria 1020
833 Ga0373931_1213654 3300035691 Bacteria 517
834 Ga0373935_0002322 3300035692 Bacteria 10863
835 Ga0373927_0155573 3300035695 Bacteria 1497
836 Ga0373947_0250366 3300035725 Bacteria 1171
837 Ga0373947_0722365 3300035725 Bacteria 680
838 Ga0373937_0546426 3300036401 Bacteria 1100
839 Ga0373937_0976411 3300036401 Bacteria 796
840 Ga0373925_0044348 3300037068 Bacteria 3302
841 Ga0395899_0002062 3300037312 Bacteria 16534
842 Ga0395899_0017806 3300037312 Bacteria 5409
843 Ga0395899_0044714 3300037312 Bacteria 3299
844 Ga0395899_0108787 3300037312 Bacteria 1995
845 Ga0395899_0127594 3300037312 Bacteria 1818
846 Ga0395899_0176318 3300037312 Bacteria 1503
847 Ga0395899_0177552 3300037312 Bacteria 1497
848 Ga0395899_0198152 3300037312 Bacteria 1402
849 Ga0395899_0239494 3300037312 Bacteria 1249
850 Ga0395899_0263495 3300037312 Bacteria 1178
851 Ga0395899_0479984 3300037312 Bacteria 809
852 Ga0395899_0506867 3300037312 Unclassified 782
853 Ga0395900_0000997 3300037418 Bacteria 36770
854 Ga0395900_0003165 3300037418 Bacteria 17843
855 Ga0395900_0005624 3300037418 Bacteria 13109
856 Ga0395900_0011036 3300037418 Bacteria 9232
857 Ga0395900_0027388 3300037418 Bacteria 5837
858 Ga0395900_0062013 3300037418 Bacteria 3844
859 Ga0395900_0089574 3300037418 Bacteria 3162
860 Ga0395900_0090128 3300037418 Bacteria 3152
861 Ga0395900_0121970 3300037418 Bacteria 2674
862 Ga0395900_0151212 3300037418 Bacteria 2371
863 Ga0395900_0204665 3300037418 Bacteria 1995
864 Ga0395900_0205499 3300037418 Bacteria 1990
865 Ga0395900_0244780 3300037418 Bacteria 1797
866 Ga0395900_0275184 3300037418 Bacteria 1677
867 Ga0395900_0351368 3300037418 Bacteria 1448
868 Ga0395900_0448047 3300037418 Bacteria 1247
869 Ga0395900_0457515 3300037418 Bacteria 1231
870 Ga0395900_0744561 3300037418 Bacteria 911
871 Ga0395900_0971092 3300037418 Bacteria 770
872 Ga0395900_1070448 3300037418 Bacteria 724
873 Ga0395900_1085104 3300037418 Bacteria 718
874 Ga0395900_1292094 3300037418 Unclassified 644
875 Ga0395900_1692724 3300037418 Bacteria 543
876 Ga0395898_0003637 3300037466 Bacteria 17137
877 Ga0395898_0006632 3300037466 Bacteria 12342
878 Ga0395898_0116024 3300037466 Bacteria 2565
879 Ga0395898_0157508 3300037466 Bacteria 2172
880 Ga0395898_0212865 3300037466 Bacteria 1843
881 Ga0395898_0668955 3300037466 Bacteria 980
882 Ga0395898_0991061 3300037466 Unclassified 776
883 Ga0395898_1093030 3300037466 Bacteria 731
884 Ga0395898_1176341 3300037466 Bacteria 698
885 Ga0395898_1605356 3300037466 Bacteria 575
886 Ga0395905_0000226 3300037471 Bacteria 85938
887 Ga0395905_0001164 3300037471 Bacteria 32823
888 Ga0395905_0009116 3300037471 Bacteria 9720
889 Ga0395905_0010087 3300037471 Bacteria 9207
890 Ga0395905_0013695 3300037471 Bacteria 7767
891 Ga0395905_0019939 3300037471 Bacteria 6354
892 Ga0395905_0035158 3300037471 Bacteria 4704
893 Ga0395905_0047368 3300037471 Bacteria 4029
894 Ga0395905_0055100 3300037471 Bacteria 3722
895 Ga0395905_0055679 3300037471 Bacteria 3701
896 Ga0395905_0057172 3300037471 Bacteria 3649
897 Ga0395905_0060505 3300037471 Bacteria 3541
898 Ga0395905_0073743 3300037471 Bacteria 3199
899 Ga0395905_0088555 3300037471 Bacteria 2901
900 Ga0395905_0089238 3300037471 Bacteria 2889
901 Ga0395905_0135203 3300037471 Bacteria 2319
902 Ga0395905_0138969 3300037471 Bacteria 2285
903 Ga0395905_0213181 3300037471 Bacteria 1809
904 Ga0395905_0248596 3300037471 Bacteria 1661
905 Ga0395905_0280336 3300037471 Bacteria 1553
906 Ga0395905_0349456 3300037471 Bacteria 1370
907 Ga0395905_0361712 3300037471 Bacteria 1344
908 Ga0395905_0777761 3300037471 Bacteria 860
909 Ga0395905_0784082 3300037471 Bacteria 856
910 Ga0395905_0827445 3300037471 Bacteria 829
911 Ga0395905_1451105 3300037471 Unclassified 590
912 Ga0395905_1543824 3300037471 Unclassified 568
913 Ga0395901_0002401 3300038443 Bacteria 19031
914 Ga0395901_0003908 3300038443 Bacteria 14995
915 Ga0395901_0012496 3300038443 Bacteria 8617
916 Ga0395901_0016592 3300038443 Bacteria 7505
917 Ga0395901_0048282 3300038443 Bacteria 4420
918 Ga0395901_0062494 3300038443 Bacteria 3875
919 Ga0395901_0141581 3300038443 Bacteria 2528
920 Ga0395901_0195423 3300038443 Bacteria 2121
921 Ga0395901_0205990 3300038443 Bacteria 2060
922 Ga0395901_0218283 3300038443 Bacteria 1994
923 Ga0395901_0219925 3300038443 Bacteria 1985
924 Ga0395901_0291865 3300038443 Bacteria 1692
925 Ga0395901_0349022 3300038443 Bacteria 1527
926 Ga0395901_0438272 3300038443 Bacteria 1338
927 Ga0395901_0475511 3300038443 Bacteria 1275
928 Ga0395901_0479076 3300038443 Bacteria 1269
929 Ga0395901_0568390 3300038443 Bacteria 1147
930 Ga0395901_1911557 3300038443 Bacteria 541
931 Ga0436365_0428348 3300039437 Bacteria 1267
932 Ga0436365_1575011 3300039437 Bacteria 17698
933 Ga0436365_1884350 3300039437 Bacteria 751
934 Ga0439465_0034100 3300041413 Bacteria 1629
935 Ga0451845_0414206 3300041501 Bacteria 775
936 Ga0439445_0079259 3300042004 Bacteria 916
937 Ga0439448_0091094 3300042005 Bacteria 1030
938 Ga0439432_010963 3300042006 Bacteria 3127
939 Ga0439432_022427 3300042006 Bacteria 2085
940 Ga0439449_0027822 3300042007 Bacteria 2109
941 Ga0439449_0278171 3300042007 Bacteria 631
942 Ga0439455_0199918 3300042012 Bacteria 578
943 Ga0439458_0042423 3300042157 Bacteria 1107
944 Ga0466969_0212953 3300044656 Bacteria 880
945 Ga0466966_0130198 3300044684 Bacteria 1541
946 Ga0466964_0666721 3300044706 Unclassified 577
947 Ga0466970_0579892 3300044765 Bacteria 650
948 Ga0466957_0748177 3300044842 Unclassified 692
949 Ga0466960_0028051 3300044901 Bacteria 2574
950 Ga0466959_0132459 3300045049 Bacteria 1766
951 Ga0495580_0453022 3300046472 Bacteria 861
952 Ga0495582_0355114 3300046473 Bacteria 844
953 Ga0495643_0223268 3300046522 Unclassified 892
954 Ga0495663_0066801 3300046525 Bacteria 1139
955 Ga0495663_0082632 3300046525 Bacteria 1037
956 Ga0495642_0074659 3300046528 Bacteria 1422
957 Ga0495598_0002306 3300046537 Bacteria 3924
958 Ga0495621_0011102 3300046539 Bacteria 2777
959 Ga0495633_0094425 3300046558 Bacteria 1390
960 Ga0495659_0112117 3300046664 Bacteria 1066
961 Ga0495669_0002275 3300046684 Bacteria 7881
962 Ga0495669_0006331 3300046684 Bacteria 4945
963 Ga0495669_0256576 3300046684 Bacteria 840
964 Ga0495670_0011308 3300046691 Bacteria 4388
965 Ga0495670_0618703 3300046691 Bacteria 590
966 Ga0495671_0439482 3300046692 Bacteria 624
967 Ga0495677_0020443 3300047445 Bacteria 2400
968 Ga0495677_0196492 3300047445 Bacteria 784
969 Ga0496100_0022281 3300048903 Bacteria 3832
970 Ga0496100_0266676 3300048903 Bacteria 1272
971 Ga0496100_0318986 3300048903 Bacteria 1167
972 Ga0496100_0556035 3300048903 Bacteria 888
973 Ga0496101_0049682 3300048904 Bacteria 3018
974 Ga0496101_0294292 3300048904 Bacteria 1271
975 Ga0496102_0161723 3300048905 Bacteria 2106
976 Ga0496102_0208593 3300048905 Bacteria 1842
977 Ga0496102_0302707 3300048905 Bacteria 1507
978 Ga0496102_1113417 3300048905 Bacteria 709
979 Ga0496103_0379844 3300048906 Bacteria 908
980 Ga0496103_0799264 3300048906 Bacteria 595
981 Ga0496103_0816550 3300048906 Bacteria 587
982 Ga0496105_0099105 3300048908 Bacteria 2406
983 Ga0496106_0446978 3300048909 Bacteria 1038
984 Ga0496106_0740003 3300048909 Bacteria 782
985 Ga0496107_0041965 3300048910 Bacteria 3286
986 Ga0496107_0046226 3300048910 Bacteria 3133
987 Ga0496107_0285552 3300048910 Bacteria 1228
988 Ga0496108_0027555 3300048911 Bacteria 4693
989 Ga0496108_0057480 3300048911 Bacteria 3268
990 Ga0496109_0000610 3300048912 Bacteria 29899
991 Ga0496109_0080365 3300048912 Bacteria 3003
992 Ga0496109_1954386 3300048912 Bacteria 519
993 Ga0496110_0042470 3300048913 Bacteria 3968
994 Ga0496110_0209938 3300048913 Bacteria 1770
995 Ga0496111_0122553 3300048914 Bacteria 1920
996 Ga0496111_0547946 3300048914 Bacteria 849
997 Ga0496112_0004014 3300048915 Bacteria 12339
998 Ga0496112_0055685 3300048915 Bacteria 3890
999 Ga0496112_0092290 3300048915 Bacteria 2997
1000 Ga0496112_0216286 3300048915 Bacteria 1873
1001 Ga0496112_0355303 3300048915 Bacteria 1407
1002 Ga0496112_0516506 3300048915 Bacteria 1129
1003 Ga0496113_0000952 3300048916 Bacteria 15412
1004 Ga0496113_0158155 3300048916 Bacteria 1790
1005 Ga0496114_0000016 3300048917 Bacteria 274656
1006 Ga0496114_0045920 3300048917 Bacteria 3629
1007 Ga0501292_112198 3300049515 Bacteria 550
1008 Ga0501298_042688 3300049521 Bacteria 923
1009 Ga0501067_0295719 3300049583 Bacteria 901
1010 Ga0501067_0707877 3300049583 Bacteria 566
1011 Ga0501068_0295564 3300049584 Bacteria 1036
1012 Ga0501069_0203005 3300049585 Bacteria 1149
1013 Ga0501069_1042432 3300049585 Bacteria 500
1014 Ga0501071_0280020 3300049587 Bacteria 1262
1015 Ga0501074_0708082 3300049590 Bacteria 711
1016 Ga0501198_055091 3300049649 Bacteria 717
1017 Ga0501202_008297 3300049652 Bacteria 1892
1018 Ga0501217_166429 3300049661 Bacteria 668
1019 Ga0501227_118849 3300049665 Bacteria 713
1020 Ga0501233_030637 3300049668 Bacteria 1214
1021 Ga0501238_027609 3300049671 Bacteria 816
1022 Ga0501243_075528 3300049675 Bacteria 647
1023 Ga0501247_018851 3300049677 Bacteria 884
1024 Ga0501257_052611 3300049686 Bacteria 1018
1025 Ga0501221_028044 3300049704 Bacteria 1156
1026 Ga0501225_0209700 3300049705 Bacteria 622
1027 Ga0501234_018058 3300049707 Bacteria 1116
1028 Ga0501080_0397204 3300049742 Bacteria 1241
1029 Ga0501262_005846 3300049759 Bacteria 1460
1030 Ga0501268_044183 3300049765 Bacteria 847
1031 Ga0501270_044020 3300049767 Bacteria 787
1032 Ga0501279_058969 3300049775 Bacteria 625
1033 Ga0501283_067293 3300049779 Bacteria 655
1034 Ga0501212_029334 3300049851 Bacteria 882
1035 nmdc:mga07m45_550703_c1 3300050496 Bacteria 667
1036 nmdc:mga0n895_681245_c1 3300050512 Bacteria 1025
1037 Ga0495655_0270679 3300053083 Bacteria 576
1038 Ga0395899_0007278
1039 JGI24736J21556_1020912
1040 JGI24741J21665_1008557
1041 JGI24741J21665_1008594
1042 JGI24747J21853_1002402
1043 JGI24747J21853_1011601
1044 JGI24740J21852_10009374
1045 JGI24740J21852_10047433
1046 JGI24740J21852_10149131
1047 JGI24739J22299_10077383
1048 JGI24739J22299_10084372
1049 JGI24737J22298_10007721
1050 JGI24737J22298_10019478
1051 JGI24737J22298_10151273
1052 JGI24737J22298_10207947
1053 JGI24743J22301_10002872
1054 JGI24743J22301_10017326
1055 JGI24735J21928_10006140
1056 JGI24735J21928_10101212
1057 JGI24735J21928_10214129
1058 JGI24745J21846_1040230
1059 JGI24738J21930_10046291
1060 JGI24744J21845_10001585
1061 JGI24744J21845_10077148
1062 JGI24034J26672_10032452
1063 JGI24742J22300_10021446
1064 JGI24751J29686_10025650
1065 JGI24751J29686_10083501
1066 JGI25406J46586_10057619
1067 rootL2_10140508
1068 Ga0065715_10432613
1069 Ga0065715_11117021
1070 Ga0070658_10066207
1071 Ga0070658_10075391
1072 Ga0070658_10085273
1073 Ga0070658_10163452
1074 Ga0070658_10165847
1075 Ga0070658_10272833
1076 Ga0070658_10426509
1077 Ga0070658_10592463
1078 Ga0070658_11177287
1079 Ga0070658_11330146
1080 Ga0070676_10015404
1081 Ga0070676_10016027
1082 Ga0070676_10110959
1083 Ga0070676_10461999
1084 Ga0070683_100038899
1085 Ga0070683_100211431
1086 Ga0070683_100428494
1087 Ga0070683_101088629
1088 Ga0070690_100006336
1089 Ga0070690_100173019
1090 Ga0070690_100531153
1091 Ga0070690_100536979
1092 Ga0070670_100013225
1093 Ga0070670_100014982
1094 Ga0070670_100076532
1095 Ga0070670_100080502
1096 Ga0070670_100142924
1097 Ga0070670_100519148
1098 Ga0070670_101740013
1099 Ga0070670_101937482
1100 Ga0070677_10011735
1101 Ga0070677_10017057
1102 Ga0068869_100086966
1103 Ga0068869_101720882
1104 Ga0070666_10005953
1105 Ga0070666_10048049
1106 Ga0070666_10065966
1107 Ga0070666_10166582
1108 Ga0070666_10261028
1109 Ga0070666_10397347
1110 Ga0070666_10437209
1111 Ga0070666_10949706
1112 Ga0070666_11010986
1113 Ga0070680_100024380
1114 Ga0070680_101948317
1115 Ga0070680_101964372
1116 Ga0070682_100074295
1117 Ga0070682_100471395
1118 Ga0068868_100015245
1119 Ga0068868_100048166
1120 Ga0068868_100061889
1121 Ga0068868_100064262
1122 Ga0068868_100490199
1123 Ga0068868_100499257
1124 Ga0068868_101153908
1125 Ga0068868_101436788
1126 Ga0070660_100000156
1127 Ga0070660_100002966
1128 Ga0070660_100016614
1129 Ga0070660_100028293
1130 Ga0070660_100064071
1131 Ga0070660_100072385
1132 Ga0070660_100144401
1133 Ga0070660_100277699
1134 Ga0070660_100341182
1135 Ga0070660_100651836
1136 Ga0070660_101339846
1137 Ga0070660_101795208
1138 Ga0070689_100158173
1139 Ga0070691_10658536
1140 Ga0070661_100034708
1141 Ga0070661_100036795
1142 Ga0070661_100069996
1143 Ga0070661_100081244
1144 Ga0070661_100087732
1145 Ga0070661_100128134
1146 Ga0070661_100129254
1147 Ga0070661_100303823
1148 Ga0070661_100374693
1149 Ga0070661_100504222
1150 Ga0070692_10278260
1151 Ga0070692_10411460
1152 Ga0070692_10514304
1153 Ga0070668_100379161
1154 Ga0070668_100840641
1155 Ga0070668_102037572
1156 Ga0070669_100033518
1157 Ga0070669_100164872
1158 Ga0070669_100452609
1159 Ga0070669_100454631
1160 Ga0070669_100966435
1161 Ga0070675_100023558
1162 Ga0070675_100180001
1163 Ga0070675_100210201
1164 Ga0070675_100257207
1165 Ga0070675_100924480
1166 Ga0070671_100000051
1167 Ga0070671_100006975
1168 Ga0070671_100033206
1169 Ga0070671_100059930
1170 Ga0070671_100143990
1171 Ga0070671_100235834
1172 Ga0070671_100259607
1173 Ga0070671_100306390
1174 Ga0070671_100420832
1175 Ga0070671_101540279
1176 Ga0070674_100011997
1177 Ga0070674_100014729
1178 Ga0070674_100026956
1179 Ga0070674_100051171
1180 Ga0070674_100175509
1181 Ga0070674_100389875
1182 Ga0070674_101351730
1183 Ga0070673_100011602
1184 Ga0070673_100011732
1185 Ga0070673_100114366
1186 Ga0070673_100155841
1187 Ga0070673_100302014
1188 Ga0070673_100376767
1189 Ga0070673_100413693
1190 Ga0070673_100677424
1191 Ga0070673_101754116
1192 Ga0070688_100554371
1193 Ga0070688_101610996
1194 Ga0070659_100003926
1195 Ga0070659_100061929
1196 Ga0070659_100066651
1197 Ga0070659_100083062
1198 Ga0070659_100083740
1199 Ga0070659_100098258
1200 Ga0070659_100199196
1201 Ga0070659_100482086
1202 Ga0070659_101002831
1203 Ga0070659_101047034
1204 Ga0070659_101341076
1205 Ga0070659_101394140
1206 Ga0070659_101427693
1207 Ga0070659_101650748
1208 Ga0070667_100001311
1209 Ga0070667_100025802
1210 Ga0070667_100065494
1211 Ga0070667_100104177
1212 Ga0070667_100569914
1213 Ga0070667_101376340
1214 Ga0070667_101669081
1215 Ga0070667_101798653
1216 Ga0070709_10081361
1217 Ga0070709_11415187
1218 Ga0070714_100055739
1219 Ga0070714_100063691
1220 Ga0070714_100252100
1221 Ga0070714_101824868
1222 Ga0070713_100032969
1223 Ga0070713_100202477
1224 Ga0070713_100449365
1225 Ga0070701_10395867
1226 Ga0070711_101876006
1227 Ga0070663_100010764
1228 Ga0070663_100020658
1229 Ga0070663_100026400
1230 Ga0070663_100093271
1231 Ga0070663_100271906
1232 Ga0070663_100387113
1233 Ga0070663_100391081
1234 Ga0070663_100561215
1235 Ga0070663_101370547
1236 Ga0070663_101402024
1237 Ga0070678_100001121
1238 Ga0070678_100002490
1239 Ga0070678_100034382
1240 Ga0070678_100137937
1241 Ga0070678_100206575
1242 Ga0070678_100344490
1243 Ga0070662_100001195
1244 Ga0070662_100004959
1245 Ga0070662_100014122
1246 Ga0070662_100017911
1247 Ga0070662_100039331
1248 Ga0070662_100039339
1249 Ga0070662_100045906
1250 Ga0070662_100058911
1251 Ga0070662_100078053
1252 Ga0070662_100189587
1253 Ga0070662_100198471
1254 Ga0070662_100294846
1255 Ga0070662_100653742
1256 Ga0070662_101502363
1257 Ga0070681_10058866
1258 Ga0070681_10288180
1259 Ga0070681_11016448
1260 Ga0068867_100022766
1261 Ga0068867_100368578
1262 Ga0068867_100493649
1263 Ga0068867_101153741
1264 Ga0068867_101331753
1265 Ga0070685_10129542
1266 Ga0070679_100009722
1267 Ga0070679_100019156
1268 Ga0070679_100174555
1269 Ga0070679_100372922
1270 Ga0070679_100754260
1271 Ga0070679_101353121
1272 Ga0070679_101421165
1273 Ga0070684_100068081
1274 Ga0070684_102115280
1275 Ga0068853_100025405
1276 Ga0068853_100387060
1277 Ga0068853_100469235
1278 Ga0068853_100522702
1279 Ga0068853_100640747
1280 Ga0068853_101155853
1281 Ga0068853_101276403
1282 Ga0068853_101483083
1283 Ga0068853_101643763
1284 Ga0070672_100003335
1285 Ga0070672_100015335
1286 Ga0070672_100128397
1287 Ga0070672_100278366
1288 Ga0070672_100300936
1289 Ga0070672_100642030
1290 Ga0070672_101265171
1291 Ga0070672_101549882
1292 Ga0070686_100032521
1293 Ga0070695_100335500
1294 Ga0070696_100585448
1295 Ga0070693_100425669
1296 Ga0070665_100013547
1297 Ga0070665_100019750
1298 Ga0070665_100021059
1299 Ga0070665_100566968
1300 Ga0068855_100042906
1301 Ga0068855_100377383
1302 Ga0068855_100553106
1303 Ga0068855_100994134
1304 Ga0070664_100005488
1305 Ga0070664_100010804
1306 Ga0070664_100073402
1307 Ga0070664_100088706
1308 Ga0070664_100229423
1309 Ga0070664_100286767
1310 Ga0070664_100563832
1311 Ga0070664_100714899
1312 Ga0070664_100734566
1313 Ga0070664_102197857
1314 Ga0068857_100008116
1315 Ga0068857_100126060
1316 Ga0068857_100151220
1317 Ga0068857_100315172
1318 Ga0068857_100434983
1319 Ga0068857_102278722
1320 Ga0068854_100020300
1321 Ga0068854_100047329
1322 Ga0068854_100074929
1323 Ga0068854_100111507
1324 Ga0068854_100165138
1325 Ga0068854_100271063
1326 Ga0068854_100275076
1327 Ga0068854_100566578
1328 Ga0068854_100638705
1329 Ga0068854_100884689
1330 Ga0068854_102151494
1331 Ga0068856_100023762
1332 Ga0068856_100027363
1333 Ga0068856_100185923
1334 Ga0068856_100323893
1335 Ga0068856_100333314
1336 Ga0068856_101618028
1337 Ga0068856_102449087
1338 Ga0070702_101482694
1339 Ga0068852_100035258
1340 Ga0068852_100038835
1341 Ga0068852_100045745
1342 Ga0068852_100122683
1343 Ga0068852_100182868
1344 Ga0068852_100310680
1345 Ga0068852_100333219
1346 Ga0068852_100456244
1347 Ga0068852_100471672
1348 Ga0068852_100566468
1349 Ga0068852_100869340
1350 Ga0068852_101273366
1351 Ga0068859_100067219
1352 Ga0068859_100186379
1353 Ga0068859_100279375
1354 Ga0068859_101433960
1355 Ga0068864_100003198
1356 Ga0068864_100023399
1357 Ga0068864_100473741
1358 Ga0068866_10023764
1359 Ga0068866_10026409
1360 Ga0068866_10204017
1361 Ga0068866_10339675
1362 Ga0068861_100027898
1363 Ga0068861_100531459
1364 Ga0068861_100754928
1365 Ga0068861_101503858
1366 Ga0068861_101728555
1367 Ga0068851_10052156
1368 Ga0068851_10068571
1369 Ga0068851_10091247
1370 Ga0068851_10268414
1371 Ga0068870_11141887
1372 Ga0068863_100003336
1373 Ga0068863_100004174
1374 Ga0068863_100503547
1375 Ga0068863_100720481
1376 Ga0068858_100009881
1377 Ga0068858_100024491
1378 Ga0068858_100551693
1379 Ga0068860_100264921
1380 Ga0068862_100345812
1381 Ga0068862_100889838
1382 Ga0081455_10112174
1383 Ga0081539_10021962
1384 Ga0070717_11321974
1385 Ga0070716_100017029
1386 Ga0070716_100237612
1387 Ga0070712_100043513
1388 Ga0070712_100199713
1389 Ga0070712_100409844
1390 Ga0075369_10224746
1391 Ga0075366_10634674
1392 Ga0097621_100036057
1393 Ga0097621_100200994
1394 Ga0097621_100874416
1395 Ga0097621_101060345
1396 Ga0075370_10373493
1397 Ga0068871_100200469
1398 Ga0068871_100460286
1399 Ga0075434_100306851
1400 Ga0068865_100072973
1401 Ga0068865_100615315
1402 Ga0068865_100978046
1403 Ga0068865_101045802
1404 Ga0097620_100067222
1405 Ga0097620_100186370
1406 Ga0097620_100279373
1407 Ga0097620_101433801
1408 Ga0105244_10507981
1409 Ga0105240_11027586
1410 Ga0105240_11248634
1411 Ga0105245_10019606
1412 Ga0105245_10023282
1413 Ga0105245_10198795
1414 Ga0105245_11304672
1415 Ga0105245_11610038
1416 Ga0105245_12384180
1417 Ga0105243_10017247
1418 Ga0105243_10592442
1419 Ga0105243_11201855
1420 Ga0105241_10685630
1421 Ga0105241_11342443
1422 Ga0105242_10155550
1423 Ga0105242_11181354
1424 Ga0105248_10001634
1425 Ga0105248_10001894
1426 Ga0105248_10002448
1427 Ga0105248_10026794
1428 Ga0105248_10052041
1429 Ga0105248_10055565
1430 Ga0105248_10219657
1431 Ga0105248_10254978
1432 Ga0105248_10688259
1433 Ga0105237_10449078
1434 Ga0105238_10324553
1435 Ga0105249_10261845
1436 Ga0105249_11854036
1437 Ga0105239_10544206
1438 Ga0105239_11448792
1439 Ga0105239_11720435
1440 Ga0105239_13271721
1441 Ga0105246_10064694
1442 Ga0105246_10641954
1443 Ga0157327_1014092
1444 Ga0157373_10021660
1445 Ga0157373_10072363
1446 Ga0157373_10173185
1447 Ga0157373_10368773
1448 Ga0157373_10524357
1449 Ga0157373_10805553
1450 Ga0157371_10051761
1451 Ga0157371_10053945
1452 Ga0157371_10225171
1453 Ga0157371_10257009
1454 Ga0157371_10312879
1455 Ga0157371_10357931
1456 Ga0157371_10472897
1457 Ga0157370_10041941
1458 Ga0157370_10133136
1459 Ga0157370_10167170
1460 Ga0157370_10957146
1461 Ga0157369_10140020
1462 Ga0157369_10153643
1463 Ga0157369_10462082
1464 Ga0157369_10862726
1465 Ga0157374_10019076
1466 Ga0157374_10159797
1467 Ga0157374_10197873
1468 Ga0157374_11582747
1469 Ga0157374_11988145
1470 Ga0157378_10191875
1471 Ga0157378_10268195
1472 Ga0157378_10534681
1473 Ga0157378_10535647
1474 Ga0157378_10589800
1475 Ga0157378_10959130
1476 Ga0163162_10000768
1477 Ga0163162_10023881
1478 Ga0163162_10104995
1479 Ga0163162_10128812
1480 Ga0163162_12230085
1481 Ga0157372_10118491
1482 Ga0157372_10409795
1483 Ga0157372_10591808
1484 Ga0157372_10890480
1485 Ga0157372_10917523
1486 Ga0157372_11572598
1487 Ga0157372_11613633
1488 Ga0157375_10005630
1489 Ga0157375_10020583
1490 Ga0157375_10213250
1491 Ga0157375_10403985
1492 Ga0157375_11826491
1493 Ga0163163_10073297
1494 Ga0163163_10206336
1495 Ga0157380_10835979
1496 Ga0157380_12285446
1497 Ga0182008_10056733
1498 Ga0157377_10148714
1499 Ga0157379_12409262
1500 Ga0157376_10090404
1501 Ga0163161_10328102
1502 Ga0163161_10368541
1503 Ga0206354_11545716
1504 Ga0213876_10023631
1505 Ga0213876_10077576
1506 Ga0207673_1022881
1507 Ga0207697_10011452
1508 Ga0207697_10140730
1509 Ga0207656_10130030
1510 Ga0207656_10173642
1511 Ga0207656_10194328
1512 Ga0207656_10321154
1513 Ga0207682_10004204
1514 Ga0207682_10077134
1515 Ga0207642_10007391
1516 Ga0207642_10042153
1517 Ga0207642_10164071
1518 Ga0207642_10270163
1519 Ga0207642_10610956
1520 Ga0207688_10009345
1521 Ga0207688_10022437
1522 Ga0207688_10027272
1523 Ga0207688_10029570
1524 Ga0207688_10126250
1525 Ga0207688_10129436
1526 Ga0207680_10002585
1527 Ga0207680_10101277
1528 Ga0207680_10310385
1529 Ga0207680_10505087
1530 Ga0207680_11234789
1531 Ga0207680_11242879
1532 Ga0207647_10009676
1533 Ga0207647_10012986
1534 Ga0207647_10027273
1535 Ga0207647_10050442
1536 Ga0207647_10065670
1537 Ga0207647_10082023
1538 Ga0207647_10302630
1539 Ga0207699_10146761
1540 Ga0207645_10020823
1541 Ga0207645_10031056
1542 Ga0207645_10046178
1543 Ga0207645_10762584
1544 Ga0207645_11026039
1545 Ga0207645_11191719
1546 Ga0207705_10003597
1547 Ga0207705_10004771
1548 Ga0207705_10009807
1549 Ga0207705_10046912
1550 Ga0207705_10131333
1551 Ga0207705_10180650
1552 Ga0207705_10578866
1553 Ga0207705_10799219
1554 Ga0207705_11140637
1555 Ga0207654_11216505
1556 Ga0207707_10124551
1557 Ga0207707_10150276
1558 Ga0207707_10341825
1559 Ga0207707_10476500
1560 Ga0207695_10210052
1561 Ga0207693_10014544
1562 Ga0207660_10002662
1563 Ga0207662_10207392
1564 Ga0207662_10974084
1565 Ga0207657_10000434
1566 Ga0207657_10001170
1567 Ga0207657_10002813
1568 Ga0207657_10024081
1569 Ga0207657_10040928
1570 Ga0207657_10042145
1571 Ga0207657_10098472
1572 Ga0207657_10102994
1573 Ga0207657_10124050
1574 Ga0207657_10167306
1575 Ga0207657_10268630
1576 Ga0207657_10356827
1577 Ga0207657_10510349
1578 Ga0207657_10958389
1579 Ga0207649_10011041
1580 Ga0207649_10027276
1581 Ga0207649_10034090
1582 Ga0207649_10060338
1583 Ga0207649_10112156
1584 Ga0207649_10129581
1585 Ga0207649_10287679
1586 Ga0207649_10307304
1587 Ga0207649_10434297
1588 Ga0207649_10494474
1589 Ga0207649_11694553
1590 Ga0207652_10000034
1591 Ga0207652_10058852
1592 Ga0207652_10122947
1593 Ga0207652_10143490
1594 Ga0207652_10454642
1595 Ga0207681_10004355
1596 Ga0207681_10050998
1597 Ga0207681_10167103
1598 Ga0207681_10264112
1599 Ga0207681_10336792
1600 Ga0207681_10418805
1601 Ga0207694_10538823
1602 Ga0207650_10002948
1603 Ga0207650_10040539
1604 Ga0207650_10043580
1605 Ga0207650_10052391
1606 Ga0207650_10059964
1607 Ga0207650_10107594
1608 Ga0207650_10227661
1609 Ga0207650_11345655
1610 Ga0207650_11421791
1611 Ga0207659_10076781
1612 Ga0207659_10085108
1613 Ga0207659_10829266
1614 Ga0207659_11153323
1615 Ga0207687_10012657
1616 Ga0207687_10035715
1617 Ga0207687_10893712
1618 Ga0207687_11508204
1619 Ga0207700_10388919
1620 Ga0207664_10018146
1621 Ga0207664_10079535
1622 Ga0207664_11394232
1623 Ga0207644_10000052
1624 Ga0207644_10000943
1625 Ga0207644_10000996
1626 Ga0207644_10017678
1627 Ga0207644_10032654
1628 Ga0207644_10105072
1629 Ga0207644_10209244
1630 Ga0207644_10250949
1631 Ga0207644_10259752
1632 Ga0207644_10761302
1633 Ga0207644_11284946
1634 Ga0207644_11564618
1635 Ga0207690_10002842
1636 Ga0207690_10013275
1637 Ga0207690_10034676
1638 Ga0207690_10049022
1639 Ga0207690_10109546
1640 Ga0207690_10149234
1641 Ga0207690_10199876
1642 Ga0207690_10260883
1643 Ga0207690_10427935
1644 Ga0207690_10691141
1645 Ga0207690_10892420
1646 Ga0207690_11199707
1647 Ga0207690_11496497
1648 Ga0207706_10000299
1649 Ga0207706_10000614
1650 Ga0207706_10007215
1651 Ga0207706_10020875
1652 Ga0207706_10040584
1653 Ga0207706_10048431
1654 Ga0207706_10124972
1655 Ga0207706_10155926
1656 Ga0207706_10180054
1657 Ga0207706_10528423
1658 Ga0207706_10601912
1659 Ga0207706_10680466
1660 Ga0207706_11571005
1661 Ga0207686_10269296
1662 Ga0207686_10342765
1663 Ga0207670_10203249
1664 Ga0207670_10501107
1665 Ga0207669_10153294
1666 Ga0207669_10168664
1667 Ga0207669_10186735
1668 Ga0207669_10410156
1669 Ga0207669_10556401
1670 Ga0207669_10985967
1671 Ga0207704_10138617
1672 Ga0207704_10292820
1673 Ga0207704_11156174
1674 Ga0207665_10565645
1675 Ga0207691_10000998
1676 Ga0207691_10013011
1677 Ga0207691_10016113
1678 Ga0207691_10071125
1679 Ga0207691_10108220
1680 Ga0207691_10128425
1681 Ga0207691_10339902
1682 Ga0207691_10471177
1683 Ga0207691_11150273
1684 Ga0207711_10000420
1685 Ga0207711_10001311
1686 Ga0207711_10003129
1687 Ga0207711_10011832
1688 Ga0207711_10189622
1689 Ga0207711_10192745
1690 Ga0207711_10294821
1691 Ga0207689_10033251
1692 Ga0207661_10032385
1693 Ga0207661_10224509
1694 Ga0207661_10415947
1695 Ga0207661_11391683
1696 Ga0207679_10023965
1697 Ga0207679_10025671
1698 Ga0207679_10034407
1699 Ga0207679_10092592
1700 Ga0207679_10183638
1701 Ga0207679_10295415
1702 Ga0207679_10523871
1703 Ga0207679_10739393
1704 Ga0207679_10904130
1705 Ga0207679_10961685
1706 Ga0207667_10012261
1707 Ga0207667_10049447
1708 Ga0207667_10366878
1709 Ga0207667_10500052
1710 Ga0207651_10000652
1711 Ga0207651_10012001
1712 Ga0207651_10013969
1713 Ga0207651_10140058
1714 Ga0207651_10201589
1715 Ga0207651_10430531
1716 Ga0207651_10441912
1717 Ga0207651_10480599
1718 Ga0207651_10654794
1719 Ga0207651_11182526
1720 Ga0207651_11281837
1721 Ga0207712_11482182
1722 Ga0207668_10198870
1723 Ga0207668_10219539
1724 Ga0207668_11125351
1725 Ga0207640_10057391
1726 Ga0207640_10175109
1727 Ga0207640_10207631
1728 Ga0207640_10209652
1729 Ga0207640_10425775
1730 Ga0207640_10610929
1731 Ga0207640_10832447
1732 Ga0207640_11160446
1733 Ga0207640_11370765
1734 Ga0207640_11607904
1735 Ga0207658_10004807
1736 Ga0207658_10038494
1737 Ga0207658_10066062
1738 Ga0207658_10123783
1739 Ga0207658_10165199
1740 Ga0207658_10312073
1741 Ga0207658_10654966
1742 Ga0207658_11098034
1743 Ga0207677_10003117
1744 Ga0207677_10018354
1745 Ga0207677_10030638
1746 Ga0207677_10072056
1747 Ga0207677_10679258
1748 Ga0207703_10002663
1749 Ga0207703_10031952
1750 Ga0207703_10079372
1751 Ga0207639_10117021
1752 Ga0207639_10230713
1753 Ga0207639_10555240
1754 Ga0207639_10622591
1755 Ga0207639_10654861
1756 Ga0207639_10679122
1757 Ga0207639_10716064
1758 Ga0207639_11194175
1759 Ga0207678_10000117
1760 Ga0207678_10006831
1761 Ga0207678_10020241
1762 Ga0207678_10040138
1763 Ga0207678_10129505
1764 Ga0207678_10143668
1765 Ga0207678_10170926
1766 Ga0207678_10216460
1767 Ga0207678_10265351
1768 Ga0207678_11064414
1769 Ga0207702_10079971
1770 Ga0207702_10408586
1771 Ga0207702_10993495
1772 Ga0207702_11535377
1773 Ga0207702_11818892
1774 Ga0207702_12287974
1775 Ga0207641_10006363
1776 Ga0207641_10092172
1777 Ga0207641_10810568
1778 Ga0207641_11232560
1779 Ga0207648_10016503
1780 Ga0207648_10057138
1781 Ga0207648_10142850
1782 Ga0207648_10309763
1783 Ga0207648_10358818
1784 Ga0207676_10005353
1785 Ga0207676_10045938
1786 Ga0207676_10228584
1787 Ga0207676_10310404
1788 Ga0207674_10000086
1789 Ga0207674_10006741
1790 Ga0207674_10154256
1791 Ga0207674_10173540
1792 Ga0207674_11045692
1793 Ga0207675_100044742
1794 Ga0207675_100147851
1795 Ga0207675_101529073
1796 Ga0207683_10000846
1797 Ga0207683_10003887
1798 Ga0207683_10067903
1799 Ga0207683_10100386
1800 Ga0207683_10106035
1801 Ga0207683_10177759
1802 Ga0207698_10078193
1803 Ga0207698_10089400
1804 Ga0207698_10147231
1805 Ga0207698_10149172
1806 Ga0207698_10232933
1807 Ga0207698_10245977
1808 Ga0207698_10277882
1809 Ga0207698_10293572
1810 Ga0207698_10355606
1811 Ga0207698_10508813
1812 Ga0207698_10782532
1813 Ga0207698_11361809
1814 Ga0209974_10053592
1815 Ga0209974_10319248
1816 Ga0268266_10055274
1817 Ga0268266_10083549
1818 Ga0268266_10506053
1819 Ga0268265_10475786
1820 Ga0268265_11085440
1821 Ga0268264_10503308
1822 Ga0268264_10641038
1823 Ga0307408_100336708
1824 Ga0307405_10004019
1825 Ga0307405_10025754
1826 Ga0307405_10414443
1827 Ga0307405_10591326
1828 Ga0307413_10140181
1829 Ga0307413_11407450
1830 Ga0307410_10047487
1831 Ga0307410_10112970
1832 Ga0307410_10215246
1833 Ga0307406_10103064
1834 Ga0307406_10176990
1835 Ga0307407_10082056
1836 Ga0307407_10473151
1837 Ga0307412_10062941
1838 Ga0307412_10669854
1839 Ga0307412_10778493
1840 Ga0307412_10873923
1841 Ga0307409_100025333
1842 Ga0307409_100186308
1843 Ga0307409_100217944
1844 Ga0307409_100343324
1845 Ga0307409_100637213
1846 Ga0307409_101102104
1847 Ga0307416_100018217
1848 Ga0307416_100144033
1849 Ga0307416_100530778
1850 Ga0307416_102023742
1851 Ga0307414_10102821
1852 Ga0307414_10600876
1853 Ga0307414_11451945
1854 Ga0307411_10032660
1855 Ga0307411_10434736
1856 Ga0307415_100035303
1857 Ga0307415_100065523
1858 Ga0307415_100172906
1859 Ga0307415_101124989
1860 Ga0373950_0075644
1861 Ga0373959_0177768
1862 Ga0373938_0154874
1863 Ga0373929_0018067
1864 Ga0373939_0095605
1865 Ga0373939_0375018
1866 Ga0373960_0157523
1867 Ga0373960_0338373
1868 Ga0373943_0029916
1869 Ga0373961_0081310
1870 Ga0373931_1213654
1871 Ga0373935_0002322
1872 Ga0373927_0155573
1873 Ga0373947_0250366
1874 Ga0373947_0722365
1875 Ga0373937_0546426
1876 Ga0373937_0976411
1877 Ga0373925_0044348
1878 Ga0395899_0002062
1879 Ga0395899_0017806
1880 Ga0395899_0044714
1881 Ga0395899_0108787
1882 Ga0395899_0127594
1883 Ga0395899_0176318
1884 Ga0395899_0177552
1885 Ga0395899_0198152
1886 Ga0395899_0239494
1887 Ga0395899_0263495
1888 Ga0395899_0479984
1889 Ga0395899_0506867
1890 Ga0395900_0000997
1891 Ga0395900_0003165
1892 Ga0395900_0005624
1893 Ga0395900_0011036
1894 Ga0395900_0027388
1895 Ga0395900_0062013
1896 Ga0395900_0089574
1897 Ga0395900_0090128
1898 Ga0395900_0121970
1899 Ga0395900_0151212
1900 Ga0395900_0204665
1901 Ga0395900_0205499
1902 Ga0395900_0244780
1903 Ga0395900_0275184
1904 Ga0395900_0351368
1905 Ga0395900_0448047
1906 Ga0395900_0457515
1907 Ga0395900_0744561
1908 Ga0395900_0971092
1909 Ga0395900_1070448
1910 Ga0395900_1085104
1911 Ga0395900_1292094
1912 Ga0395900_1692724
1913 Ga0395898_0003637
1914 Ga0395898_0006632
1915 Ga0395898_0116024
1916 Ga0395898_0157508
1917 Ga0395898_0212865
1918 Ga0395898_0668955
1919 Ga0395898_0991061
1920 Ga0395898_1093030
1921 Ga0395898_1176341
1922 Ga0395898_1605356
1923 Ga0395905_0000226
1924 Ga0395905_0001164
1925 Ga0395905_0009116
1926 Ga0395905_0010087
1927 Ga0395905_0013695
1928 Ga0395905_0019939
1929 Ga0395905_0035158
1930 Ga0395905_0047368
1931 Ga0395905_0055100
1932 Ga0395905_0055679
1933 Ga0395905_0057172
1934 Ga0395905_0060505
1935 Ga0395905_0073743
1936 Ga0395905_0088555
1937 Ga0395905_0089238
1938 Ga0395905_0135203
1939 Ga0395905_0138969
1940 Ga0395905_0213181
1941 Ga0395905_0248596
1942 Ga0395905_0280336
1943 Ga0395905_0349456
1944 Ga0395905_0361712
1945 Ga0395905_0777761
1946 Ga0395905_0784082
1947 Ga0395905_0827445
1948 Ga0395905_1451105
1949 Ga0395905_1543824
1950 Ga0395901_0002401
1951 Ga0395901_0003908
1952 Ga0395901_0012496
1953 Ga0395901_0016592
1954 Ga0395901_0048282
1955 Ga0395901_0062494
1956 Ga0395901_0141581
1957 Ga0395901_0195423
1958 Ga0395901_0205990
1959 Ga0395901_0218283
1960 Ga0395901_0219925
1961 Ga0395901_0291865
1962 Ga0395901_0349022
1963 Ga0395901_0438272
1964 Ga0395901_0475511
1965 Ga0395901_0479076
1966 Ga0395901_0568390
1967 Ga0395901_1911557
1968 Ga0436365_0428348
1969 Ga0436365_1575011
1970 Ga0436365_1884350
1971 Ga0439465_0034100
1972 Ga0451845_0414206
1973 Ga0439445_0079259
1974 Ga0439448_0091094
1975 Ga0439432_010963
1976 Ga0439432_022427
1977 Ga0439449_0027822
1978 Ga0439449_0278171
1979 Ga0439455_0199918
1980 Ga0439458_0042423
1981 Ga0466969_0212953
1982 Ga0466966_0130198
1983 Ga0466964_0666721
1984 Ga0466970_0579892
1985 Ga0466957_0748177
1986 Ga0466960_0028051
1987 Ga0466959_0132459
1988 Ga0495580_0453022
1989 Ga0495582_0355114
1990 Ga0495643_0223268
1991 Ga0495663_0066801
1992 Ga0495663_0082632
1993 Ga0495642_0074659
1994 Ga0495598_0002306
1995 Ga0495621_0011102
1996 Ga0495633_0094425
1997 Ga0495659_0112117
1998 Ga0495669_0002275
1999 Ga0495669_0006331
2000 Ga0495669_0256576
2001 Ga0495670_0011308
2002 Ga0495670_0618703
2003 Ga0495671_0439482
2004 Ga0495677_0020443
2005 Ga0495677_0196492
2006 Ga0496100_0022281
2007 Ga0496100_0266676
2008 Ga0496100_0318986
2009 Ga0496100_0556035
2010 Ga0496101_0049682
2011 Ga0496101_0294292
2012 Ga0496102_0161723
2013 Ga0496102_0208593
2014 Ga0496102_0302707
2015 Ga0496102_1113417
2016 Ga0496103_0379844
2017 Ga0496103_0799264
2018 Ga0496103_0816550
2019 Ga0496105_0099105
2020 Ga0496106_0446978
2021 Ga0496106_0740003
2022 Ga0496107_0041965
2023 Ga0496107_0046226
2024 Ga0496107_0285552
2025 Ga0496108_0027555
2026 Ga0496108_0057480
2027 Ga0496109_0000610
2028 Ga0496109_0080365
2029 Ga0496109_1954386
2030 Ga0496110_0042470
2031 Ga0496110_0209938
2032 Ga0496111_0122553
2033 Ga0496111_0547946
2034 Ga0496112_0004014
2035 Ga0496112_0055685
2036 Ga0496112_0092290
2037 Ga0496112_0216286
2038 Ga0496112_0355303
2039 Ga0496112_0516506
2040 Ga0496113_0000952
2041 Ga0496113_0158155
2042 Ga0496114_0000016
2043 Ga0496114_0045920
2044 Ga0501292_112198
2045 Ga0501298_042688
2046 Ga0501067_0295719
2047 Ga0501067_0707877
2048 Ga0501068_0295564
2049 Ga0501069_0203005
2050 Ga0501069_1042432
2051 Ga0501071_0280020
2052 Ga0501074_0708082
2053 Ga0501198_055091
2054 Ga0501202_008297
2055 Ga0501217_166429
2056 Ga0501227_118849
2057 Ga0501233_030637
2058 Ga0501238_027609
2059 Ga0501243_075528
2060 Ga0501247_018851
2061 Ga0501257_052611
2062 Ga0501221_028044
2063 Ga0501225_0209700
2064 Ga0501234_018058
2065 Ga0501080_0397204
2066 Ga0501262_005846
2067 Ga0501268_044183
2068 Ga0501270_044020
2069 Ga0501279_058969
2070 Ga0501283_067293
2071 Ga0501212_029334
2072 nmdc:mga07m45_550703_c1
2073 nmdc:mga0n895_681245_c1
2074 Ga0495655_0270679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

22

100

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.761 3 88
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.6358 3 88
8cas-assembly1.cif.gz_Y cryo-em structure of native otu2-bound ubiquitinated 48s initiation complex (partial) 0.5588 14 78
4v6w-assembly1.cif.gz_AN structure of the d. melanogaster 80s ribosome 0.5483 14 78
6okk-assembly1.cif.gz_U cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit 0.5401 17 78
ID Description Score Start End Superfamily
5it9N02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5476 17 72 1.10.287.10
4ukmr02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.543 14 78 1.10.287.10
af_A0A1D6LXR0_391_543_1.20.58.1520 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.542 3 98 1.20.58.1520
6okkU02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5401 17 78 1.10.287.10
4ujhr02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5371 14 78 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A7D4AT38-F1-model_v4 YggT family protein 0.9722 4 90 GO:0016020
AF-A0A3D4MGU8-F1-model_v4 Osmotic-shock protein 0.9696 4 91 GO:0016020
AF-A0A6M8VLT5-F1-model_v4 YggT family protein 0.9665 5 90 GO:0016020
AF-A0A2D7HNT6-F1-model_v4 YggT family protein 0.9658 4 89 GO:0016020
AF-A0A522DDP3-F1-model_v4 YggT family protein 0.9655 4 91 GO:0016020

Map