F488589

General Info

Members Datasets Scaffolds Average Seq Length
1030 762 2060 214

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10002821|JGI24740J21852_100028218
Length 227
Sequence MLAKSIGRMRKSTTAYAVALTGGLLLVPAIASAHPHIFVEARLEVLAGTDGNVQELRNVWRFDEVFSSSVLMDFDKNTNLKLDPDELKEVGKTVRESLADYDYYANLTLNGKAIKVNKPDVINVDFRDGQLLMFFAVKPAEPMPLAKGNKLSFGIYDPTLYTSVDFPSDNELVTEGDAFKSCTHKVVRPNPDEVIAENKSTLTDAFFNDPTGTTMSKLFATRIDVQC

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
69 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
70 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
71 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
72 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
131 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
149 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
152 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
155 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
156 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
157 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
158 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
259 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
260 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
262 2509276019 Ensifer aridi TW10 Isolate Nodule
263 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
264 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
265 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
266 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
267 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
268 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
269 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
270 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
271 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
272 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
273 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
274 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
275 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
276 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
277 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
278 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
279 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
280 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
281 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
282 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
283 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
284 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
285 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
286 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
287 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
288 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
289 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
290 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
291 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
292 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
293 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
294 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
295 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
296 2516143018 Ensifer sp. BR816 Isolate Nodule
297 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
298 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
299 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
300 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
301 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
302 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
303 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
304 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
305 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
306 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
307 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
308 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
309 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
310 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
311 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
312 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
313 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
314 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
315 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
316 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
317 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
318 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
319 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
320 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
321 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
322 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
323 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
324 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
325 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
326 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
327 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
328 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
329 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
330 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
331 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
332 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
333 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
334 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
335 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
336 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
337 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
338 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
339 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
340 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
341 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
342 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
343 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
344 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
345 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
346 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
347 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
348 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
349 2643221557 Ensifer sp. Root558 Isolate Unclassified
350 2643221558 Rhizobium sp. Root149 Isolate Unclassified
351 2643221568 Rhizobium sp. Root564 Isolate Unclassified
352 2643221599 Rhizobium sp. Root708 Isolate Unclassified
353 2643221607 Rhizobium sp. Root73 Isolate Unclassified
354 2643221610 Ensifer sp. Root74 Isolate Unclassified
355 2643221618 Ensifer sp. Root231 Isolate Unclassified
356 2643221626 Ensifer sp. Root31 Isolate Unclassified
357 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
358 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
359 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
360 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
361 2643221655 Ensifer sp. Root1252 Isolate Unclassified
362 2643221659 Ensifer sp. Root127 Isolate Unclassified
363 2643221668 Ensifer sp. Root423 Isolate Unclassified
364 2643221675 Ensifer sp. Root1298 Isolate Unclassified
365 2643221680 Ensifer sp. Root1312 Isolate Unclassified
366 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
367 2643221688 Rhizobium sp. Root482 Isolate Unclassified
368 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
369 2643221698 Ensifer sp. Root142 Isolate Unclassified
370 2643221712 Ensifer sp. Root258 Isolate Unclassified
371 2643221718 Rhizobium sp. Root268 Isolate Unclassified
372 2643221723 Ensifer sp. Root278 Isolate Unclassified
373 2643221726 Ensifer sp. Root954 Isolate Unclassified
374 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
375 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
376 2718217882 Rhizobium sp. N741 Isolate Nodule
377 2718217927 Rhizobium sp. N324 Isolate Nodule
378 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
379 2718218009 Rhizobium sp. N561 Isolate Nodule
380 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
381 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
382 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
383 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
384 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
385 2718218363 Rhizobium sp. N113 Isolate Nodule
386 2718218365 Rhizobium sp. N731 Isolate Nodule
387 2718218366 Rhizobium sp. N621 Isolate Nodule
388 2718218423 Rhizobium sp. N941 Isolate Nodule
389 2721755514 Rhizobium sp. N6212 Isolate Nodule
390 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
391 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
392 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
393 2721755809 Rhizobium sp. N541 Isolate Nodule
394 2721755810 Rhizobium sp. N871 Isolate Nodule
395 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
396 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
397 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
398 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
399 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
400 2728369365 Rhizobium sp. N1341 Isolate Nodule
401 2728369397 Rhizobium sp. N1314 Isolate Nodule
402 2738541293 Rhizobium sp. GV031 Isolate Unclassified
403 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
404 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
405 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
406 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
407 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
408 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
409 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
410 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
411 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
412 2791355256 Rhizobium sp. M10 Isolate Nodule
413 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
414 2791355260 Rhizobium sp. L9 Isolate Nodule
415 2791355261 Rhizobium sp. J15 Isolate Nodule
416 2791355262 Rhizobium sp. M1 Isolate Nodule
417 2791355263 Rhizobium chutanense C5 Isolate Nodule
418 2791355264 Rhizobium sp. S9 Isolate Nodule
419 2791355265 Rhizobium sp. H4 Isolate Nodule
420 2791355266 Rhizobium sp. L43 Isolate Nodule
421 2791355267 Rhizobium sp. L18 Isolate Nodule
422 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
423 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
424 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
425 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
426 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
427 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
428 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
429 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
430 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
431 2802429633 Rhizobium anhuiense J3 Isolate Nodule
432 2802429634 Rhizobium anhuiense S10 Isolate Nodule
433 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
434 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
435 2802429637 Rhizobium anhuiense C15 Isolate Nodule
436 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
437 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
438 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
439 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
440 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
441 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
442 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
443 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
444 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
445 2838048938 Rhizobium pisi 27/80 Isolate Nodule
446 2838061910 Rhizobium phaseoli L15 Isolate Nodule
447 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
448 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
449 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
450 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
451 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
452 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
453 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
454 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
455 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
456 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
457 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
458 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
459 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
460 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
461 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
462 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
463 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
464 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
465 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
466 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
467 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
468 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
469 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
470 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
471 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
472 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
473 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
474 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
475 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
476 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
477 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
478 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
479 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
480 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
481 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
482 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
483 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
484 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
485 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
486 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
487 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
488 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
489 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
490 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
491 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
492 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
493 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
494 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
495 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
496 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
497 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
498 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
499 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
500 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
501 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
502 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
503 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
504 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
505 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
506 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
507 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
508 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
509 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
510 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
511 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
512 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
513 2844163670 Ensifer sp. 1H6 Isolate Unclassified
514 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
515 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
516 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
517 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
518 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
519 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
520 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
521 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
522 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
523 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
524 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
525 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
526 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
527 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
528 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
529 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
530 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
531 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
532 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
533 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
534 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
535 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
536 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
537 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
538 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
539 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
540 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
541 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
542 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
543 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
544 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
545 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
546 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
547 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
548 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
549 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
550 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
551 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
552 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
553 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
554 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
555 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
556 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
557 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
558 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
559 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
560 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
561 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
562 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
563 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
564 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
565 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
566 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
567 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
568 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
569 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
570 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
571 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
572 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
573 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
574 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
575 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
576 2933599457 Rhizobium phaseoli M3 Isolate Nodule
577 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
578 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
579 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
580 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
581 2936381700 Rhizobium chutanense C16 Isolate Unclassified
582 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
583 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
584 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
585 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
586 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
587 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
588 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
589 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
590 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
591 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
592 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
593 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
594 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
595 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
596 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
597 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
598 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
599 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
600 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
601 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
602 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
603 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
604 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
605 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
606 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
607 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
608 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
609 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
610 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
611 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
612 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
613 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
614 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
615 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
616 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
617 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
618 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
619 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
620 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
621 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
622 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
623 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
624 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
625 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
626 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
627 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
628 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
629 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
630 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
631 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
632 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
633 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
634 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
635 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
636 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
637 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
638 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
639 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
640 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
641 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
642 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
643 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
644 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
645 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
646 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
647 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
648 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
649 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
650 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
651 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
652 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
653 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
654 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
655 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
656 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
657 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
658 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
659 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
660 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
661 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
662 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
663 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
664 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
665 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
666 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
667 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
668 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
669 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
670 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
671 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
672 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
673 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
674 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
675 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
676 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
677 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
678 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
679 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
680 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
681 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
682 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
683 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
684 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
685 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
686 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
687 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
688 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
689 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
690 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
691 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
692 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
693 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
694 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
695 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
696 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
697 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
698 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
699 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
700 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
701 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
702 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
703 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
704 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
705 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
706 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
707 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
708 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
709 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
710 2996887358 Rhizobium sp. R711 Isolate Nodule
711 2996893221 Rhizobium sp. R635 Isolate Nodule
712 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
713 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
714 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
715 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
716 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
717 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
718 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
719 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
720 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
721 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
722 8005258706 Rhizobium sp. R693 Isolate Nodule
723 8005275841 Rhizobium sp. N4311 Isolate Nodule
724 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
725 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
726 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
727 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
728 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
729 8005321885 Rhizobium sp. R72 Isolate Nodule
730 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
731 8005382845 Rhizobium sp. R634 Isolate Nodule
732 8005395548 Rhizobium sp. R339 Isolate Nodule
733 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
734 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
735 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
736 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
737 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
738 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
739 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
740 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
741 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
742 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
743 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
744 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
745 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
746 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
747 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
748 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
749 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
750 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
751 8018176218 Rhizobium sp. N122 Isolate Nodule
752 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
753 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
754 8024501048 Rhizobium sp. H4 Isolate Nodule
755 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
756 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
757 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
758 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
759 8056382006 Rhizobium croatiense 13T Isolate Nodule
760 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
761 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
762 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.78
Metatranscriptomes 0.39
Isolates 48.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 20.87
Nodule 39.51
Rhizoplane 1.94
Rhizosphere 21.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002821 3300001979 Bacteria 7771
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1000036 3300002705 Bacteria 110527
4 JGI25162J39368_1000616 3300002737 Bacteria 25562
5 JGI25162J39368_1000674 3300002737 Bacteria 23983
6 JGI25154J39366_1000033 3300002738 Bacteria 184379
7 JGI25158J39367_1000162 3300002739 Bacteria 15940
8 JGI25157J39369_1000457 3300002741 Bacteria 25863
9 JGI25152J39213_1001072 3300002773 Bacteria 12904
10 JGI25152J39213_1006247 3300002773 Bacteria 3295
11 JGI25152J39213_1006470 3300002773 Bacteria 3188
12 JGI25150J39212_1004291 3300002774 Bacteria 3193
13 JGI25150J39212_1023376 3300002774 Bacteria 919
14 JGI25159J45721_1000032 3300002987 Bacteria 90158
15 JGI25159J45721_1000562 3300002987 Bacteria 16698
16 JGI25159J45721_1004059 3300002987 Bacteria 4970
17 JGI25151J46595_10001521 3300003187 Bacteria 15511
18 JGI25151J46595_10003347 3300003187 Bacteria 8883
19 JGI25151J46595_10016794 3300003187 Bacteria 3193
20 JGI25151J46595_10026969 3300003187 Bacteria 2311
21 JGI25165J46597_1000653 3300003214 Bacteria 28392
22 JGI25165J46597_1001558 3300003214 Bacteria 11359
23 JGI25165J46597_1005019 3300003214 Bacteria 2650
24 JGI25153J46596_10001965 3300003215 Bacteria 12188
25 JGI25153J46596_10012168 3300003215 Bacteria 3738
26 JGI25153J46596_10014977 3300003215 Bacteria 3187
27 rootH2_10110427 3300003320 Bacteria 3050
28 rootL2_10025999 3300003322 Bacteria 7648
29 rootH1_10133869 3300003323 Bacteria 3341
30 JGI25160J50197_1000006 3300003354 Bacteria 316247
31 JGI25160J50197_1000009 3300003354 Bacteria 282862
32 JGI25160J50197_1005328 3300003354 Bacteria 5373
33 JGI25160J50197_1040279 3300003354 Bacteria 1085
34 JGI25161J50226_1000004 3300003374 Bacteria 316212
35 JGI25161J50226_1000103 3300003374 Bacteria 67942
36 JGI25161J50226_1009858 3300003374 Bacteria 1321
37 JGI25161J50226_1012711 3300003374 Bacteria 999
38 Ga0055526_1001453 3300003771 Bacteria 16825
39 Ga0055526_1004540 3300003771 Bacteria 8298
40 Ga0055526_1005119 3300003771 Bacteria 7647
41 Ga0055526_1012874 3300003771 Bacteria 3597
42 Ga0055526_1014948 3300003771 Bacteria 3152
43 Ga0055526_1018745 3300003771 Bacteria 2564
44 Ga0055524_1003188 3300003775 Bacteria 8053
45 Ga0055524_1004566 3300003775 Bacteria 6369
46 Ga0055524_1011993 3300003775 Bacteria 3352
47 Ga0055524_1013202 3300003775 Bacteria 3126
48 Ga0055524_1018775 3300003775 Bacteria 2389
49 Ga0055524_1033451 3300003775 Bacteria 1438
50 Ga0055536_1001969 3300003781 Bacteria 11804
51 Ga0055536_1009383 3300003781 Bacteria 4047
52 Ga0055528_1001555 3300003790 Bacteria 13819
53 Ga0055528_1002096 3300003790 Bacteria 11061
54 Ga0055528_1008849 3300003790 Bacteria 4262
55 Ga0055528_1011106 3300003790 Bacteria 3606
56 Ga0055528_1015212 3300003790 Bacteria 2792
57 Ga0055528_1015655 3300003790 Bacteria 2727
58 Ga0055528_1016794 3300003790 Bacteria 2567
59 Ga0055528_1023907 3300003790 Bacteria 1848
60 Ga0055530_10010612 3300003791 Bacteria 3383
61 Ga0055530_10026672 3300003791 Bacteria 1592
62 Ga0055540_1000548 3300003792 Bacteria 28000
63 Ga0055540_1001994 3300003792 Bacteria 11406
64 Ga0055540_1013093 3300003792 Bacteria 2555
65 Ga0055540_1033649 3300003792 Bacteria 1160
66 Ga0055531_10002383 3300003794 Bacteria 12630
67 Ga0055531_10065303 3300003794 Bacteria 866
68 Ga0055543_1000002 3300004625 Bacteria 390020
69 Ga0055543_1000029 3300004625 Bacteria 131452
70 Ga0055543_1000055 3300004625 Bacteria 103837
71 Ga0055543_1001623 3300004625 Bacteria 8584
72 Ga0065165_1002222 3300005262 Bacteria 17329
73 Ga0065165_1002258 3300005262 Bacteria 17029
74 Ga0065165_1006467 3300005262 Bacteria 6130
75 Ga0065165_1025403 3300005262 Bacteria 1971
76 Ga0065165_1039456 3300005262 Bacteria 1414
77 Ga0070668_100026486 3300005347 Bacteria 4400
78 Ga0070668_100444906 3300005347 Bacteria 1113
79 Ga0070668_100526843 3300005347 Bacteria 1026
80 Ga0070669_100039304 3300005353 Bacteria 3438
81 Ga0070671_100250106 3300005355 Bacteria 1506
82 Ga0070667_100133180 3300005367 Bacteria 2171
83 Ga0070663_100125882 3300005455 Bacteria 1941
84 Ga0068853_100466266 3300005539 Bacteria 1189
85 Ga0070672_100561468 3300005543 Bacteria 992
86 Ga0070665_100076701 3300005548 Bacteria 3349
87 Ga0070665_100158192 3300005548 Bacteria 2268
88 Ga0070665_100259294 3300005548 Bacteria 1740
89 Ga0070665_100390754 3300005548 Bacteria 1399
90 Ga0068855_100171386 3300005563 Bacteria 2458
91 Ga0068856_100089232 3300005614 Bacteria 3066
92 Ga0068852_100024530 3300005616 Bacteria 4876
93 Ga0068851_10022098 3300005834 Bacteria 3095
94 Ga0068862_100173014 3300005844 Bacteria 1934
95 Ga0075365_10014002 3300006038 Bacteria 4815
96 Ga0075365_10018357 3300006038 Bacteria 4300
97 Ga0075368_10005916 3300006042 Bacteria 4237
98 Ga0075363_100189478 3300006048 Bacteria 1173
99 Ga0075364_10031187 3300006051 Bacteria 3425
100 Ga0075364_10088938 3300006051 Bacteria 2048
101 Ga0075364_10284853 3300006051 Bacteria 1124
102 Ga0075362_10043558 3300006177 Bacteria 1987
103 Ga0075367_10013599 3300006178 Bacteria 4381
104 Ga0075367_10029718 3300006178 Bacteria 3129
105 Ga0075367_10258518 3300006178 Bacteria 1093
106 Ga0075369_10026306 3300006186 Bacteria 2424
107 Ga0075366_10164519 3300006195 Bacteria 1345
108 Ga0075366_10232685 3300006195 Bacteria 1123
109 Ga0075370_10013300 3300006353 Bacteria 4370
110 Ga0075370_10023326 3300006353 Bacteria 3407
111 Ga0075370_10071005 3300006353 Bacteria 1992
112 Ga0075370_10160158 3300006353 Bacteria 1321
113 Ga0079104_1000042 3300006946 Bacteria 185991
114 Ga0079104_1004737 3300006946 Bacteria 5681
115 Ga0105244_10043527 3300009036 Bacteria 2316
116 Ga0105244_10241981 3300009036 Bacteria 843
117 Ga0105250_10052177 3300009092 Bacteria 1641
118 Ga0105240_10000019 3300009093 Bacteria 406211
119 Ga0105243_10092857 3300009148 Bacteria 2489
120 Ga0105243_10281818 3300009148 Bacteria 1497
121 Ga0105237_10001429 3300009545 Bacteria 31570
122 Ga0105249_11046143 3300009553 Bacteria 886
123 Ga0123341_1000015 3300009765 Bacteria 86184
124 Ga0123341_1025883 3300009765 Bacteria 4684
125 Ga0123342_1008847 3300009766 Bacteria 12412
126 Ga0123342_1013745 3300009766 Bacteria 7997
127 Ga0105239_10005857 3300010375 Bacteria 14331
128 Ga0105239_10103407 3300010375 Bacteria 3152
129 Ga0105246_10420268 3300011119 Bacteria 1115
130 Ga0157370_10051278 3300013104 Bacteria 3941
131 Ga0157370_10143340 3300013104 Bacteria 2225
132 Ga0157369_10192650 3300013105 Bacteria 2142
133 Ga0171463_1006 3300013249 Bacteria 336402
134 Ga0163162_10261892 3300013306 Bacteria 1861
135 Ga0182008_10060107 3300014497 Bacteria 1874
136 Ga0182007_10003217 3300015262 Bacteria 7777
137 Ga0183363_1052 3300015690 Bacteria 37103
138 Ga0214544_1000063 3300021320 Bacteria 129929
139 Ga0214542_1000095 3300021321 Bacteria 116012
140 Ga0214543_1000008 3300021327 Bacteria 385680
141 Ga0214543_1000026 3300021327 Bacteria 220652
142 Ga0228711_1000003 3300022739 Bacteria 258118
143 Ga0228710_1000003 3300022740 Bacteria 262981
144 Ga0209435_100005 3300025206 Bacteria 573745
145 Ga0209760_104496 3300025207 Bacteria 1193
146 Ga0209436_100041 3300025208 Bacteria 74018
147 Ga0209436_100568 3300025208 Bacteria 15875
148 Ga0209436_108338 3300025208 Bacteria 2073
149 Ga0209563_100733 3300025230 Bacteria 10137
150 Ga0209437_100078 3300025233 Bacteria 278088
151 Ga0209437_100174 3300025233 Bacteria 138811
152 Ga0209437_114426 3300025233 Bacteria 1101
153 Ga0207425_1000803 3300025245 Bacteria 15918
154 Ga0207425_1006311 3300025245 Bacteria 3257
155 Ga0207425_1008188 3300025245 Bacteria 2695
156 Ga0209646_1000011 3300025246 Bacteria 573745
157 Ga0209646_1005662 3300025246 Bacteria 2156
158 Ga0209026_1000008 3300025250 Bacteria 573745
159 Ga0209677_100841 3300025253 Bacteria 15210
160 Ga0209148_1004773 3300025254 Bacteria 3250
161 Ga0209759_1000004 3300025256 Bacteria 573745
162 Ga0209759_1014877 3300025256 Bacteria 2033
163 Ga0209129_1000199 3300025258 Bacteria 77091
164 Ga0209129_1000975 3300025258 Bacteria 17204
165 Ga0209129_1003347 3300025258 Bacteria 7060
166 Ga0209129_1007250 3300025258 Bacteria 3348
167 Ga0209129_1007446 3300025258 Bacteria 3258
168 Ga0209129_1019838 3300025258 Bacteria 1262
169 Ga0209233_1000163 3300025261 Bacteria 152912
170 Ga0209233_1000299 3300025261 Bacteria 60375
171 Ga0209233_1000305 3300025261 Bacteria 58381
172 Ga0209673_1000037 3300025273 Bacteria 313804
173 Ga0209673_1000320 3300025273 Bacteria 88073
174 Ga0209673_1000880 3300025273 Bacteria 38918
175 Ga0209673_1008451 3300025273 Bacteria 4584
176 Ga0209673_1010305 3300025273 Bacteria 3945
177 Ga0209673_1011644 3300025273 Bacteria 3610
178 Ga0209673_1018931 3300025273 Bacteria 2487
179 Ga0209673_1019120 3300025273 Bacteria 2470
180 Ga0209673_1020064 3300025273 Bacteria 2378
181 Ga0209130_1000030 3300025284 Bacteria 323323
182 Ga0209130_1000032 3300025284 Bacteria 316240
183 Ga0209130_1000037 3300025284 Bacteria 284019
184 Ga0209130_1007040 3300025284 Bacteria 3537
185 Ga0209130_1007971 3300025284 Bacteria 3187
186 Ga0209130_1018837 3300025284 Bacteria 1612
187 Ga0209675_1015442 3300025291 Bacteria 2267
188 Ga0209676_1005646 3300025292 Bacteria 6446
189 Ga0209676_1010574 3300025292 Bacteria 3823
190 Ga0209676_1015193 3300025292 Bacteria 2846
191 Ga0209025_1000052 3300025294 Bacteria 324648
192 Ga0209025_1000339 3300025294 Bacteria 103239
193 Ga0209025_1000354 3300025294 Bacteria 98665
194 Ga0209025_1000566 3300025294 Bacteria 67702
195 Ga0209025_1002960 3300025294 Bacteria 16882
196 Ga0209025_1008052 3300025294 Bacteria 7675
197 Ga0209025_1018121 3300025294 Bacteria 4017
198 Ga0209025_1036296 3300025294 Bacteria 2210
199 Ga0209564_1000086 3300025295 Bacteria 251385
200 Ga0209564_1000207 3300025295 Bacteria 135313
201 Ga0209564_1000345 3300025295 Bacteria 88073
202 Ga0209564_1001903 3300025295 Bacteria 18682
203 Ga0209564_1003065 3300025295 Bacteria 11870
204 Ga0209564_1015388 3300025295 Bacteria 3114
205 Ga0209758_1000576 3300025297 Bacteria 57318
206 Ga0209758_1001323 3300025297 Bacteria 30082
207 Ga0209758_1005667 3300025297 Bacteria 9449
208 Ga0209758_1008543 3300025297 Bacteria 6600
209 Ga0209758_1011382 3300025297 Bacteria 5161
210 Ga0209758_1013270 3300025297 Bacteria 4511
211 Ga0209758_1015179 3300025297 Bacteria 4015
212 Ga0209758_1019040 3300025297 Bacteria 3333
213 Ga0209758_1019584 3300025297 Bacteria 3256
214 Ga0209050_1009382 3300025298 Bacteria 5018
215 Ga0209050_1022968 3300025298 Bacteria 2213
216 Ga0209256_1000348 3300025299 Bacteria 75070
217 Ga0209256_1000368 3300025299 Bacteria 72598
218 Ga0209256_1002386 3300025299 Bacteria 15481
219 Ga0209256_1003161 3300025299 Bacteria 11937
220 Ga0209256_1007748 3300025299 Bacteria 5197
221 Ga0209256_1011843 3300025299 Bacteria 3428
222 Ga0209256_1015046 3300025299 Bacteria 2734
223 Ga0207426_1000047 3300025302 Bacteria 417011
224 Ga0207426_1000048 3300025302 Bacteria 409127
225 Ga0207426_1000077 3300025302 Bacteria 316246
226 Ga0207426_1000296 3300025302 Bacteria 98032
227 Ga0207426_1002927 3300025302 Bacteria 10058
228 Ga0209051_1000236 3300025303 Bacteria 92738
229 Ga0209051_1003233 3300025303 Bacteria 10837
230 Ga0209051_1012488 3300025303 Bacteria 4105
231 Ga0209051_1022264 3300025303 Bacteria 2671
232 Ga0209051_1025628 3300025303 Bacteria 2394
233 Ga0209051_1044922 3300025303 Bacteria 1534
234 Ga0209257_1001268 3300025304 Bacteria 30983
235 Ga0209257_1007119 3300025304 Bacteria 6892
236 Ga0209257_1009173 3300025304 Bacteria 5378
237 Ga0207680_10132443 3300025903 Bacteria 1644
238 Ga0207695_10000049 3300025913 Bacteria 406233
239 Ga0207671_10000107 3300025914 Bacteria 128950
240 Ga0207681_10022888 3300025923 Bacteria 3990
241 Ga0207644_10057411 3300025931 Bacteria 2810
242 Ga0207709_10377278 3300025935 Bacteria 1078
243 Ga0207667_10169777 3300025949 Bacteria 2242
244 Ga0207668_10051754 3300025972 Bacteria 2838
245 Ga0207640_10096868 3300025981 Bacteria 2058
246 Ga0207658_10126114 3300025986 Bacteria 2049
247 Ga0207639_10188962 3300026041 Bacteria 1758
248 Ga0207678_10239809 3300026067 Bacteria 1553
249 Ga0207702_10424189 3300026078 Bacteria 1287
250 Ga0207698_10179718 3300026142 Bacteria 1873
251 Ga0209281_1000081 3300027111 Bacteria 258084
252 Ga0209281_1000141 3300027111 Bacteria 175634
253 Ga0209281_1000194 3300027111 Bacteria 139318
254 Ga0209371_1001459 3300027312 Bacteria 15961
255 Ga0209282_1000036 3300027666 Bacteria 130242
256 Ga0209813_10064240 3300027866 Bacteria 1179
257 Ga0209813_10101519 3300027866 Bacteria 979
258 Ga0268266_10029313 3300028379 Bacteria 4679
259 Ga0268266_10215898 3300028379 Bacteria 1761
260 Ga0268266_10247133 3300028379 Bacteria 1649
261 Ga0268265_10153035 3300028380 Bacteria 1948
262 Ga0307515_10002397 3300028794 Bacteria 40905
263 Ga0307515_10282871 3300028794 Bacteria 1364
264 Ga0268256_1000985 3300030500 Bacteria 19309
265 Ga0307408_100089717 3300031548 Bacteria 2318
266 Ga0307408_100399713 3300031548 Bacteria 1179
267 Ga0307514_10166451 3300031649 Bacteria 1449
268 Ga0307516_10222686 3300031730 Bacteria 1595
269 Ga0307405_10000942 3300031731 Bacteria 11613
270 Ga0307405_10104206 3300031731 Bacteria 1908
271 Ga0307410_10062071 3300031852 Bacteria 2559
272 Ga0307406_10018985 3300031901 Bacteria 4028
273 Ga0307406_10026120 3300031901 Bacteria 3503
274 Ga0307412_10006576 3300031911 Bacteria 6583
275 Ga0307412_10139877 3300031911 Bacteria 1771
276 Ga0307412_10300861 3300031911 Bacteria 1268
277 Ga0307412_10657392 3300031911 Bacteria 895
278 Ga0315914_1000002 3300031967 Bacteria 365357
279 Ga0307409_100625315 3300031995 Bacteria 1067
280 Ga0307414_10494241 3300032004 Bacteria 1081
281 Ga0315913_1000009 3300033430 Bacteria 149770
282 Ga0315915_1000005 3300033464 Bacteria 397591
283 Ga0373935_0074411 3300035692 Bacteria 2196
284 Ga0373927_0000047 3300035695 Bacteria 87289
285 Ga0373925_0000580 3300037068 Bacteria 35470
286 Ga0395905_0001828 3300037471 Bacteria 24574
287 Ga0395905_0343300 3300037471 Bacteria 1384
288 Ga0395901_0924360 3300038443 Bacteria 853
289 Ga0439436_0062464 3300041404 Bacteria 1042
290 Ga0439466_0069645 3300041411 Bacteria 1122
291 Ga0439465_0010930 3300041413 Bacteria 2848
292 Ga0439465_0029770 3300041413 Bacteria 1735
293 Ga0439465_0184468 3300041413 Bacteria 756
294 Ga0451787_432461 3300041441 Bacteria 1284
295 Ga0451795_0089844 3300041456 Bacteria 1494
296 Ga0451802_0764307 3300041460 Bacteria 818
297 Ga0451833_0456835 3300041491 Bacteria 1673
298 Ga0451835_0882779 3300041492 Bacteria 6379
299 Ga0451837_1754233 3300041494 Bacteria 2637
300 Ga0451839_1369328 3300041496 Bacteria 1352
301 Ga0451841_0635781 3300041498 Bacteria 1895
302 Ga0451845_0318627 3300041501 Bacteria 4546
303 Ga0451846_52688 3300041502 Bacteria 750
304 Ga0451849_0751888 3300041505 Bacteria 4980
305 Ga0451850_27674 3300041506 Bacteria 810
306 Ga0451851_0395503 3300041507 Bacteria 1861
307 Ga0451843_0257433 3300041509 Bacteria 1514
308 Ga0452271_03333 3300041916 Bacteria 820
309 Ga0450920_042201 3300042122 Bacteria 910
310 Ga0450906_025351 3300042145 Bacteria 1054
311 Ga0450907_017402 3300042146 Bacteria 1199
312 Ga0450918_004407 3300042531 Bacteria 2565
313 Ga0495617_012332 3300046452 Bacteria 2912
314 Ga0495592_0058828 3300046454 Bacteria 2833
315 Ga0495638_0000673 3300046460 Bacteria 37126
316 Ga0495638_0020690 3300046460 Bacteria 4344
317 Ga0495638_0201036 3300046460 Bacteria 1125
318 Ga0495605_0003904 3300046474 Bacteria 8835
319 Ga0495605_0018795 3300046474 Bacteria 3699
320 Ga0495585_0063507 3300046492 Bacteria 2026
321 Ga0495607_0058606 3300046501 Bacteria 2200
322 Ga0495607_0084312 3300046501 Bacteria 1739
323 Ga0495583_0007419 3300046506 Bacteria 6892
324 Ga0495583_0052750 3300046506 Bacteria 1848
325 Ga0495606_0003939 3300046507 Bacteria 15274
326 Ga0495606_0028915 3300046507 Bacteria 3902
327 Ga0495606_0033019 3300046507 Bacteria 3576
328 Ga0495606_0073150 3300046507 Bacteria 2152
329 Ga0495610_0001811 3300046512 Bacteria 18572
330 Ga0495610_0020119 3300046512 Bacteria 3713
331 Ga0495610_0132291 3300046512 Bacteria 1082
332 Ga0495616_0058823 3300046513 Bacteria 1892
333 Ga0495618_0402207 3300046514 Bacteria 837
334 Ga0495620_0021024 3300046515 Bacteria 3176
335 Ga0495620_0048003 3300046515 Bacteria 1834
336 Ga0495631_0003519 3300046518 Bacteria 8562
337 Ga0495632_0001545 3300046519 Bacteria 19004
338 Ga0495632_0018030 3300046519 Bacteria 3881
339 Ga0495632_0073262 3300046519 Bacteria 1642
340 Ga0495632_0083990 3300046519 Bacteria 1516
341 Ga0495637_0187148 3300046520 Bacteria 765
342 Ga0495643_0017048 3300046522 Bacteria 4255
343 Ga0495643_0025469 3300046522 Bacteria 3347
344 Ga0495654_0000648 3300046530 Bacteria 27431
345 Ga0495622_0017684 3300046557 Bacteria 3319
346 Ga0495622_0041596 3300046557 Bacteria 2137
347 Ga0495633_0044322 3300046558 Bacteria 2108
348 Ga0495668_0015399 3300046616 Bacteria 4467
349 Ga0495668_0109721 3300046616 Bacteria 1509
350 Ga0495611_0012829 3300046648 Bacteria 3561
351 Ga0495625_0008646 3300046660 Bacteria 8657
352 Ga0495625_0048809 3300046660 Bacteria 3045
353 Ga0495625_0075033 3300046660 Bacteria 2367
354 Ga0495625_0155149 3300046660 Bacteria 1537
355 Ga0495661_0089461 3300046665 Bacteria 1755
356 Ga0495588_0134445 3300046674 Bacteria 1305
357 Ga0495657_0068672 3300046675 Bacteria 2321
358 Ga0495623_0106299 3300046679 Bacteria 1705
359 Ga0495670_0109076 3300046691 Bacteria 1431
360 Ga0495649_0024724 3300046694 Bacteria 3349
361 Ga0495649_0086322 3300046694 Bacteria 1675
362 Ga0495600_0037577 3300046809 Bacteria 3148
363 Ga0495660_0008528 3300046810 Bacteria 5999
364 Ga0495604_0182829 3300047317 Bacteria 1465
365 Ga0495636_0049996 3300047318 Bacteria 1749
366 Ga0495673_0050323 3300047469 Bacteria 1829
367 Ga0495681_0049272 3300047470 Bacteria 1992
368 Ga0495681_0060262 3300047470 Bacteria 1752
369 Ga0495686_0004835 3300047472 Bacteria 10873
370 Ga0495686_0028975 3300047472 Bacteria 3603
371 Ga0495686_0064229 3300047472 Bacteria 2273
372 Ga0495686_0136345 3300047472 Bacteria 1451
373 Ga0495686_0408502 3300047472 Bacteria 728
374 Ga0495602_0212765 3300048088 Bacteria 1466
375 Ga0495615_0088024 3300048090 Bacteria 861
376 Ga0496100_0209119 3300048903 Bacteria 1426
377 Ga0496101_0151129 3300048904 Bacteria 1776
378 Ga0496101_0207995 3300048904 Bacteria 1515
379 Ga0496101_0301529 3300048904 Bacteria 1255
380 Ga0496102_0005636 3300048905 Bacteria 10626
381 Ga0496103_0007797 3300048906 Bacteria 6364
382 Ga0496105_0173267 3300048908 Bacteria 1768
383 Ga0496106_0006329 3300048909 Bacteria 8768
384 Ga0496106_0096493 3300048909 Bacteria 2288
385 Ga0496107_0135373 3300048910 Bacteria 1820
386 Ga0496111_0282941 3300048914 Bacteria 1230
387 Ga0496114_0224406 3300048917 Bacteria 1650
388 Ga0496116_0000097 3300048919 Bacteria 200658
389 Ga0496116_0016194 3300048919 Bacteria 5850
390 Ga0496116_0035030 3300048919 Bacteria 3531
391 Ga0496116_0038618 3300048919 Bacteria 3312
392 Ga0496116_0042216 3300048919 Bacteria 3120
393 Ga0496116_0096812 3300048919 Bacteria 1776
394 Ga0496116_0132147 3300048919 Bacteria 1420
395 Ga0496117_0008970 3300048920 Bacteria 9413
396 Ga0496117_0014826 3300048920 Bacteria 6688
397 Ga0496117_0061676 3300048920 Bacteria 2575
398 Ga0496118_0006549 3300048921 Bacteria 12738
399 Ga0496118_0008092 3300048921 Bacteria 10959
400 Ga0496118_0014398 3300048921 Bacteria 7408
401 Ga0496118_0032388 3300048921 Bacteria 4307
402 Ga0496118_0049324 3300048921 Bacteria 3243
403 Ga0496118_0077713 3300048921 Bacteria 2353
404 Ga0496119_0014910 3300048922 Bacteria 6040
405 Ga0496119_0020783 3300048922 Bacteria 4770
406 Ga0496119_0126051 3300048922 Bacteria 1401
407 Ga0496121_0002286 3300048924 Bacteria 29803
408 Ga0496121_0005619 3300048924 Bacteria 15980
409 Ga0496121_0012820 3300048924 Bacteria 9075
410 Ga0496121_0018500 3300048924 Bacteria 7022
411 Ga0496121_0037208 3300048924 Bacteria 4325
412 Ga0496121_0039122 3300048924 Bacteria 4186
413 Ga0496121_0055821 3300048924 Bacteria 3287
414 Ga0496121_0066591 3300048924 Bacteria 2924
415 Ga0496121_0104618 3300048924 Bacteria 2174
416 Ga0496122_0000024 3300048925 Bacteria 372400
417 Ga0496122_0000107 3300048925 Bacteria 193163
418 Ga0496122_0008285 3300048925 Bacteria 11273
419 Ga0496122_0021084 3300048925 Bacteria 5852
420 Ga0496122_0038159 3300048925 Bacteria 3853
421 Ga0496122_0042749 3300048925 Bacteria 3560
422 Ga0496122_0044336 3300048925 Bacteria 3472
423 Ga0496122_0062551 3300048925 Bacteria 2724
424 Ga0496122_0070497 3300048925 Bacteria 2497
425 Ga0496123_0000063 3300048926 Bacteria 216072
426 Ga0496123_0000086 3300048926 Bacteria 183266
427 Ga0496123_0012749 3300048926 Bacteria 7128
428 Ga0496123_0014897 3300048926 Bacteria 6412
429 Ga0496123_0028519 3300048926 Bacteria 4130
430 Ga0496123_0031517 3300048926 Bacteria 3855
431 Ga0496123_0047610 3300048926 Bacteria 2894
432 Ga0496123_0056128 3300048926 Bacteria 2577
433 Ga0496123_0062039 3300048926 Bacteria 2398
434 Ga0496123_0283730 3300048926 Bacteria 799
435 Ga0496124_0001850 3300048927 Bacteria 29217
436 Ga0496124_0007540 3300048927 Bacteria 11545
437 Ga0496124_0007550 3300048927 Bacteria 11534
438 Ga0496124_0022502 3300048927 Bacteria 5775
439 Ga0496124_0039474 3300048927 Bacteria 4092
440 Ga0496124_0046630 3300048927 Bacteria 3710
441 Ga0496124_0080498 3300048927 Bacteria 2680
442 Ga0496124_0116111 3300048927 Bacteria 2146
443 Ga0496124_0123290 3300048927 Bacteria 2067
444 Ga0496124_0258104 3300048927 Bacteria 1284
445 Ga0496124_0420331 3300048927 Bacteria 921
446 Ga0496125_0008703 3300048928 Bacteria 10564
447 Ga0496125_0041521 3300048928 Bacteria 3931
448 Ga0496125_0043305 3300048928 Bacteria 3823
449 Ga0496125_0110029 3300048928 Bacteria 1999
450 Ga0496125_0243486 3300048928 Bacteria 1140
451 Ga0496126_0000119 3300048929 Bacteria 184211
452 Ga0496126_0000434 3300048929 Bacteria 83949
453 Ga0496126_0005874 3300048929 Bacteria 13845
454 Ga0496126_0045330 3300048929 Bacteria 4042
455 Ga0496126_0068596 3300048929 Bacteria 3165
456 Ga0496126_0083721 3300048929 Bacteria 2815
457 Ga0496126_0222253 3300048929 Bacteria 1586
458 Ga0496126_0273465 3300048929 Bacteria 1401
459 Ga0495678_006119 3300049459 Bacteria 6466
460 Ga0495678_104939 3300049459 Bacteria 974
461 Ga0501031_0046113 3300049568 Bacteria 2843
462 Ga0501032_0017656 3300049569 Bacteria 5008
463 Ga0501032_0063979 3300049569 Bacteria 2463
464 Ga0501032_0097773 3300049569 Bacteria 1945
465 Ga0501032_0129119 3300049569 Bacteria 1668
466 Ga0501033_0000451 3300049570 Bacteria 39040
467 Ga0501033_0172617 3300049570 Bacteria 1552
468 Ga0501034_0156708 3300049571 Bacteria 2250
469 Ga0501034_0442005 3300049571 Bacteria 1219
470 Ga0501036_0019686 3300049572 Bacteria 5666
471 Ga0501037_0371219 3300049573 Bacteria 984
472 Ga0501038_0038323 3300049574 Bacteria 4198
473 Ga0501038_0323502 3300049574 Bacteria 1206
474 Ga0501039_0500881 3300049575 Bacteria 954
475 Ga0501043_0355538 3300049579 Bacteria 1112
476 Ga0501046_0117934 3300049580 Bacteria 2022
477 Ga0501047_0357344 3300049581 Bacteria 1297
478 Ga0501068_0293608 3300049584 Bacteria 1040
479 Ga0501073_0224091 3300049589 Bacteria 1299
480 Ga0501080_0018364 3300049742 Bacteria 6473
481 Ga0501083_0025068 3300049744 Bacteria 4130
482 Ga0501035_0001759 3300049822 Bacteria 21876
483 Ga0501035_0066440 3300049822 Bacteria 3200
484 Ga0501044_0048611 3300049823 Bacteria 4380
485 Ga0501044_0238090 3300049823 Bacteria 1765
486 nmdc:mga03683_20510_c1 3300050489 Bacteria 2536
487 nmdc:mga03n38_201005_c1 3300050490 Bacteria 1031
488 nmdc:mga00v17_21364_c1 3300050491 Bacteria 3721
489 nmdc:mga00v17_79225_c1 3300050491 Bacteria 2048
490 nmdc:mga0k408_39343_c1 3300050493 Bacteria 2716
491 nmdc:mga0k408_423880_c1 3300050493 Bacteria 791
492 nmdc:mga06z11_30824_c1 3300050494 Bacteria 2599
493 nmdc:mga07m45_10089_c1 3300050496 Bacteria 4399
494 nmdc:mga07m45_139087_c1 3300050496 Bacteria 1406
495 nmdc:mga0sz30_101679_c1 3300050516 Bacteria 1256
496 Ga0495601_0144576 3300053077 Bacteria 1552
497 Ga0500610_0016555 3300053079 Bacteria 3518
498 Ga0500578_0121362 3300053086 Bacteria 1642
499 Ga0500643_039791 3300053087 Bacteria 1387
500 Ga0500650_0113736 3300053098 Bacteria 1263
501 Ga0500562_064339 3300053108 Bacteria 987
502 Ga0500569_010293 3300053109 Bacteria 2198
503 Ga0500569_086743 3300053109 Bacteria 1008
504 Ga0500594_0020856 3300053118 Bacteria 1639
505 Ga0500608_040937 3300053122 Bacteria 2221
506 Ga0500618_001209 3300053125 Bacteria 12279
507 Ga0500618_001823 3300053125 Bacteria 8927
508 Ga0500618_007282 3300053125 Bacteria 3173
509 Ga0500618_017475 3300053125 Bacteria 1784
510 Ga0500658_0002830 3300053134 Bacteria 6659
511 Ga0500658_0033023 3300053134 Bacteria 2032
512 Ga0500568_0004715 3300053139 Bacteria 7232
513 Ga0500568_0008575 3300053139 Bacteria 4916
514 Ga0500577_0165902 3300053142 Bacteria 943
515 Ga0500577_0167919 3300053142 Bacteria 937
516 Ga0500588_0104554 3300053146 Bacteria 980
517 Ga0500590_000118 3300053148 Bacteria 21518
518 Ga0500616_0001217 3300053153 Bacteria 26006
519 Ga0500616_0012830 3300053153 Bacteria 4888
520 Ga0500616_0023348 3300053153 Bacteria 3445
521 Ga0500622_0000101 3300053156 Bacteria 86856
522 Ga0500622_0002496 3300053156 Bacteria 13239
523 Ga0500627_0031683 3300053158 Bacteria 2223
524 Ga0500627_0157626 3300053158 Bacteria 1025
525 Ga0500633_0001340 3300053160 Bacteria 4575
526 Ga0500599_019473 3300053736 Bacteria 955
527 Ga0587077_053783 3300059493 Bacteria 851
528 2509110228 2508501122 Bacteria 6292184
529 2509378962 2509276019 Bacteria 6802256
530 2509389800 2509276021 Bacteria 7634384
531 2509447947 2509276033 Bacteria 7180565
532 2510134885 2510065019 Bacteria 6903379
533 2510303727 2510065057 Bacteria 6649661
534 2510896295 2510461076 Bacteria 8618824
535 2511136528 2510917022 Bacteria 6504556
536 2511173307 2510917026 Bacteria 7046020
537 2511187319 2510917028 Bacteria 6185411
538 2511195924 2510917030 Bacteria 7460662
539 2511503024 2511231052 Bacteria 6974333
540 2512534289 2512047086 Bacteria 6850303
541 2512973889 2512875026 Bacteria 6861065
542 2513572648 2513237084 Bacteria 7231967
543 2513580121 2513237085 Bacteria 7695351
544 2513597218 2513237088 Bacteria 6927906
545 2513602394 2513237089 Bacteria 6553624
546 2513617193 2513237091 Bacteria 6900273
547 2513631277 2513237093 Bacteria 7545552
548 2513710828 2513237103 Bacteria 7647401
549 2513868055 2513237138 Bacteria 7368160
550 2513882934 2513237140 Bacteria 7076289
551 2513902963 2513237143 Bacteria 6664116
552 2513908144 2513237144 Bacteria 7530820
553 2513926986 2513237146 Bacteria 7166346
554 2513998124 2513237159 Bacteria 6810126
555 2514004037 2513237160 Bacteria 6650282
556 2514022290 2513237162 Bacteria 7468464
557 2515113968 2515075009 Bacteria 7288508
558 2515610305 2515154107 Bacteria 6795637
559 2515636958 2515154113 Bacteria 7807172
560 2515642987 2515154114 Bacteria 7848616
561 2515656732 2515154116 Bacteria 7552979
562 2515743675 2515154134 Bacteria 7220242
563 2516205286 2516143018 Bacteria 6951533
564 2516894428 2516653046 Bacteria 6989037
565 2517037599 2516653077 Bacteria 7555578
566 2517077886 2516653085 Bacteria 7346596
567 2517096683 2517093000 Bacteria 7412387
568 2517410397 2517287029 Bacteria 6905599
569 2517571049 2517487022 Bacteria 7227575
570 2524451913 2524023207 Bacteria 6813453
571 2524460037 2524023209 Bacteria 6679728
572 2530646994 2529292951 Bacteria 6916614
573 2535519388 2534681796 Bacteria 7146037
574 2551692538 2551306086 Bacteria 6843938
575 2551708880 2551306089 Bacteria 7162724
576 2551724670 2551306091 Bacteria 7086830
577 2551735170 2551306092 Bacteria 6992595
578 2551745374 2551306093 Bacteria 7064773
579 2558860442 2558860100 Bacteria 8458965
580 2585168071 2582581283 Bacteria 6030556
581 2585202427 2582581294 Bacteria 6626667
582 2585224739 2582581298 Bacteria 7315509
583 2585227874 2582581299 Bacteria 6518058
584 2585257889 2582581304 Bacteria 5831370
585 2585269725 2582581306 Bacteria 6450535
586 2585274313 2582581307 Bacteria 6597605
587 2585280271 2582581308 Bacteria 7413247
588 2585322549 2582581315 Bacteria 7318924
589 2585335162 2582581316 Bacteria 7774528
590 2585388614 2582581865 Bacteria 6644329
591 2585392459 2582581866 Bacteria 6859583
592 2585402264 2582581867 Bacteria 7184437
593 2585529037 2585427526 Bacteria 7258840
594 2585532500 2585427527 Bacteria 7273426
595 2585540977 2585427528 Bacteria 6842387
596 2585547295 2585427529 Bacteria 7395659
597 2585554483 2585427530 Bacteria 7383882
598 2585560762 2585427531 Bacteria 6992870
599 2585822436 2585427590 Bacteria 6824633
600 2585839739 2585427593 Bacteria 7141551
601 2585845425 2585427594 Bacteria 6180594
602 2585898967 2585427608 Bacteria 6544331
603 2585903440 2585427609 Bacteria 6667127
604 2585997195 2585427633 Bacteria 6413184
605 2586001793 2585427634 Bacteria 6455027
606 2587981441 2585428125 Bacteria 6662905
607 2599334717 2599185156 Bacteria 5403036
608 2599420520 2599185170 Bacteria 7295545
609 2599720086 2599185236 Bacteria 6875203
610 2600194127 2599185352 Bacteria 7228948
611 2600373615 2600254933 Bacteria 4750527
612 2616295602 2615840624 Bacteria 6557588
613 2616307429 2615840626 Bacteria 7921970
614 2616554971 2615840698 Bacteria 7319877
615 2617383428 2617270742 Bacteria 6808054
616 2643809730 2643221557 Bacteria 7184309
617 2643813279 2643221558 Bacteria 5460675
618 2643858087 2643221568 Bacteria 5187270
619 2644006498 2643221599 Bacteria 6292121
620 2644048348 2643221607 Bacteria 6314006
621 2644063911 2643221610 Bacteria 7480339
622 2644108441 2643221618 Bacteria 7717186
623 2644147589 2643221626 Bacteria 8069654
624 2644195946 2643221634 Bacteria 6705461
625 2644201710 2643221636 Bacteria 6583769
626 2644209844 2643221637 Bacteria 5345260
627 2644241916 2643221643 Bacteria 5749658
628 2644312436 2643221655 Bacteria 7722067
629 2644336064 2643221659 Bacteria 7890716
630 2644381432 2643221668 Bacteria 7306521
631 2644415744 2643221675 Bacteria 7473456
632 2644448784 2643221680 Bacteria 7473610
633 2644481150 2643221686 Bacteria 6310811
634 2644496405 2643221688 Bacteria 5260751
635 2644500161 2643221689 Bacteria 6042950
636 2644546921 2643221698 Bacteria 7756764
637 2644618119 2643221712 Bacteria 7729434
638 2644653395 2643221718 Bacteria 5345506
639 2644676704 2643221723 Bacteria 7095460
640 2644686822 2643221726 Bacteria 7455827
641 2657684451 2657244999 Bacteria 5946535
642 2671112219 2667528174 Bacteria 6435400
643 2719182637 2718217882 Bacteria 6556348
644 2719387308 2718217927 Bacteria 6972593
645 2719666952 2718217997 Bacteria 6740740
646 2719733355 2718218009 Bacteria 6478651
647 2720493372 2718218199 Bacteria 6740745
648 2720614844 2718218232 Bacteria 6720332
649 2720621617 2718218233 Bacteria 6662049
650 2720632945 2718218235 Bacteria 6630699
651 2720776669 2718218269 Bacteria 6906114
652 2721148750 2718218363 Bacteria 6524337
653 2721160134 2718218365 Bacteria 6274507
654 2721165563 2718218366 Bacteria 6425255
655 2721400943 2718218423 Bacteria 6438183
656 2722841733 2721755514 Bacteria 6424414
657 2723028257 2721755556 Bacteria 6745503
658 2723561885 2721755684 Bacteria 6859907
659 2723568517 2721755685 Bacteria 6704835
660 2724039756 2721755809 Bacteria 6438790
661 2724046111 2721755810 Bacteria 6479005
662 2724091276 2721755819 Bacteria 6906405
663 2724105782 2721755822 Bacteria 6726041
664 2724111608 2721755823 Bacteria 6752556
665 2725945425 2724679232 Bacteria 7646494
666 2730109193 2728369352 Bacteria 6745171
667 2730165872 2728369365 Bacteria 6555560
668 2730299766 2728369397 Bacteria 6274511
669 2738800383 2738541293 Bacteria 7065685
670 2739035534 2738541333 Bacteria 7106503
671 2753461049 2751185821 Bacteria 6189929
672 2766065280 2765235942 Bacteria 7445910
673 2778176040 2775507266 Bacteria 7392367
674 2792582517 2791355082 Bacteria 5973319
675 2792624314 2791355091 Bacteria 6135441
676 2792625684 2791355092 Bacteria 6248105
677 2792642757 2791355094 Bacteria 7011481
678 2793281598 2791355253 Bacteria 5171699
679 2793293594 2791355256 Bacteria 6798008
680 2793313035 2791355259 Bacteria 7254731
681 2793319682 2791355260 Bacteria 6598818
682 2793327812 2791355261 Bacteria 6661293
683 2793333421 2791355262 Bacteria 6774204
684 2793342046 2791355263 Bacteria 6872478
685 2793347410 2791355264 Bacteria 6429314
686 2793353741 2791355265 Bacteria 6539969
687 2793359658 2791355266 Bacteria 7116587
688 2793369409 2791355267 Bacteria 7222458
689 2802717861 2802428858 Bacteria 6636079
690 2802725288 2802428859 Bacteria 6667919
691 2802730588 2802428860 Bacteria 6525526
692 2802737935 2802428861 Bacteria 6534206
693 2802744195 2802428862 Bacteria 6633353
694 2802753120 2802428863 Bacteria 6410669
695 2804753354 2802429268 Bacteria 6094027
696 2805929446 2802429605 Bacteria 6875453
697 2805935372 2802429606 Bacteria 6346811
698 2806044520 2802429633 Bacteria 7341974
699 2806052721 2802429634 Bacteria 7083200
700 2806059021 2802429635 Bacteria 7650140
701 2806068316 2802429636 Bacteria 7597525
702 2806074436 2802429637 Bacteria 7067217
703 2819609573 2818991448 Bacteria 6772224
704 2819639670 2818991453 Bacteria 7181617
705 2819686463 2818991461 Bacteria 7026071
706 2821126191 2821123053 Bacteria 7836056
707 2838019149 2838016132 Bacteria 6577831
708 2838024260 2838022645 Bacteria 6494267
709 2838033159 2838029111 Bacteria 6603031
710 2838040808 2838035591 Bacteria 7166484
711 2838047399 2838042994 Bacteria 6046894
712 2838051133 2838048938 Bacteria 6044578
713 2838063889 2838061910 Bacteria 6794874
714 2838073374 2838068647 Bacteria 6208656
715 2838077473 2838074704 Bacteria 6785777
716 2838664802 2838661181 Bacteria 7385261
717 2838671095 2838668709 Bacteria 6671819
718 2838684915 2838680041 Bacteria 6545511
719 2838691278 2838686498 Bacteria 7807632
720 2838699248 2838694306 Bacteria 6853137
721 2838703726 2838701080 Bacteria 6669771
722 2838712729 2838707686 Bacteria 6619912
723 2838735761 2838729681 Bacteria 7400765
724 2838737334 2838736955 Bacteria 5760694
725 2838748663 2838742623 Bacteria 7396178
726 2841842297 2841840854 Bacteria 5761912
727 2841853902 2841851746 Bacteria 7532261
728 2841868130 2841864319 Bacteria 6742987
729 2842082206 2842077413 Bacteria 6508645
730 2842113393 2842110456 Bacteria 7656360
731 2842123131 2842118031 Bacteria 7033875
732 2842142076 2842140634 Bacteria 5759631
733 2842151235 2842146304 Bacteria 5957337
734 2842162580 2842156927 Bacteria 6894975
735 2842169992 2842163707 Bacteria 6916235
736 2842185017 2842180545 Bacteria 6888678
737 2842198220 2842192696 Bacteria 6147454
738 2842199802 2842198810 Bacteria 6608673
739 2842208349 2842205361 Bacteria 6340321
740 2842220035 2842217011 Bacteria 7497767
741 2842235610 2842229732 Bacteria 7475766
742 2842241969 2842237096 Bacteria 6620661
743 2842249356 2842243621 Bacteria 7421798
744 2842256291 2842250916 Bacteria 6579627
745 2842263507 2842257432 Bacteria 7401195
746 2842266648 2842264693 Bacteria 6472963
747 2842275753 2842271015 Bacteria 7807131
748 2842281642 2842278818 Bacteria 6340002
749 2842288757 2842285085 Bacteria 6011953
750 2842296207 2842291075 Bacteria 7076806
751 2842298739 2842298080 Bacteria 6123127
752 2842308263 2842304105 Bacteria 7023636
753 2842316456 2842311132 Bacteria 6616990
754 2842321345 2842317721 Bacteria 6793725
755 2842345050 2842341865 Bacteria 7003929
756 2842359393 2842357229 Bacteria 6485165
757 2842369166 2842363717 Bacteria 6844742
758 2842375591 2842370503 Bacteria 7038661
759 2842382607 2842377471 Bacteria 7140707
760 2842390008 2842384541 Bacteria 7057858
761 2842398467 2842395702 Bacteria 6780583
762 2842406576 2842402390 Bacteria 6681310
763 2842412997 2842409023 Bacteria 6687331
764 2842419640 2842415677 Bacteria 6596907
765 2842427009 2842422224 Bacteria 6239196
766 2842429967 2842428310 Bacteria 6767288
767 2842436373 2842434925 Bacteria 6502746
768 2842444076 2842441272 Bacteria 6769273
769 2842451072 2842447887 Bacteria 6754142
770 2842464388 2842462802 Bacteria 6588055
771 2842470702 2842469257 Bacteria 6752936
772 2842479892 2842475841 Bacteria 6603183
773 2842483359 2842482326 Bacteria 7212537
774 2842493319 2842489311 Bacteria 6620893
775 2842499111 2842495871 Bacteria 6820686
776 2842507068 2842502639 Bacteria 6604161
777 2842510766 2842509118 Bacteria 6850950
778 2842523229 2842521101 Bacteria 6569494
779 2842925840 2842922631 Bacteria 5824079
780 2844169294 2844163670 Bacteria 7266046
781 2844457452 2844454524 Bacteria 7952546
782 2847420482 2847417321 Bacteria 6913799
783 2848995354 2848992105 Bacteria 6810864
784 2850082340 2850079185 Bacteria 6848280
785 2852391252 2852387548 Bacteria 8025568
786 2854897308 2854896431 Bacteria 5869725
787 2854919209 2854916844 Bacteria 5725939
788 2855827064 2855825444 Bacteria 6785811
789 2855842461 2855839649 Bacteria 7135830
790 2855878391 2855872281 Bacteria 6964271
791 2857518860 2857516855 Bacteria 7787325
792 2857532752 2857531043 Bacteria 6754041
793 2858803277 2858800743 Bacteria 6603254
794 2891377484 2891373044 Bacteria 5202277
795 2913299871 2913295892 Bacteria 6333755
796 2915980598 2915980308 Bacteria 6624279
797 2915994910 2915993759 Bacteria 7016183
798 2916006982 2916000859 Bacteria 6865702
799 2916012219 2916007675 Bacteria 6898660
800 2916016884 2916014648 Bacteria 6946486
801 2916027747 2916021584 Bacteria 6854472
802 2916030240 2916028427 Bacteria 6748433
803 2916036797 2916035215 Bacteria 6755766
804 2916044654 2916041962 Bacteria 6820487
805 2916052636 2916048683 Bacteria 6543552
806 2916058366 2916055098 Bacteria 6758838
807 2916065559 2916061851 Bacteria 6737736
808 2916072091 2916068649 Bacteria 6943657
809 2916081367 2916076590 Bacteria 6596108
810 2919104608 2919100787 Bacteria 7710546
811 2919169940 2919166419 Bacteria 4952238
812 2919173489 2919171160 Bacteria 6499771
813 2919410706 2919408235 Bacteria 6149349
814 2920760719 2920760137 Bacteria 7427611
815 2920828449 2920822456 Bacteria 6897201
816 2921201482 2921201388 Bacteria 6926299
817 2921209639 2921208531 Bacteria 6745326
818 2921237565 2921237296 Bacteria 6876710
819 2921244252 2921244191 Bacteria 6568419
820 2921252538 2921250672 Bacteria 6677771
821 2921260597 2921257292 Bacteria 6808382
822 2921265967 2921263974 Bacteria 6864552
823 2921287733 2921282425 Bacteria 6826397
824 2921292874 2921289301 Bacteria 7316391
825 2921298672 2921296804 Bacteria 7176999
826 2923558741 2923556063 Bacteria 6793593
827 2924148785 2924144063 Bacteria 6883928
828 2924152172 2924150972 Bacteria 7169444
829 2924164108 2924158325 Bacteria 7188855
830 2924172806 2924165586 Bacteria 7260590
831 2924174424 2924172951 Bacteria 6749356
832 2924183994 2924179722 Bacteria 6843264
833 2924192926 2924186466 Bacteria 6876637
834 2924193808 2924193448 Bacteria 6955718
835 2924206665 2924200457 Bacteria 6757188
836 2924213097 2924207177 Bacteria 6917007
837 2924221218 2924214083 Bacteria 7080103
838 2924224015 2924221636 Bacteria 7113495
839 2924232048 2924228884 Bacteria 6633132
840 2933020936 2933016740 Bacteria 6355406
841 2933574712 2933570622 Bacteria 7023390
842 2933589317 2933586486 Bacteria 7667493
843 2933603496 2933599457 Bacteria 5858799
844 2935901240 2935894831 Bacteria 6620579
845 2935907513 2935901341 Bacteria 7341747
846 2936374829 2936367885 Bacteria 7324495
847 2936380521 2936375103 Bacteria 6652732
848 2936382312 2936381700 Bacteria 7006523
849 2937000083 2936996657 Bacteria 6298727
850 2937006955 2937002841 Bacteria 6934057
851 2937015425 2937009748 Bacteria 6746052
852 2937018144 2937016420 Bacteria 6782579
853 2937024348 2937023124 Bacteria 6815156
854 2937032959 2937029754 Bacteria 6424026
855 2937042259 2937036028 Bacteria 6846469
856 2937046695 2937042894 Bacteria 6741576
857 2937052311 2937049772 Bacteria 6757901
858 2937063120 2937056579 Bacteria 7107896
859 2937067555 2937063883 Bacteria 7199456
860 2937071369 2937071275 Bacteria 6984483
861 2937078665 2937078374 Bacteria 6610289
862 2937090040 2937084907 Bacteria 6618516
863 2937092924 2937091812 Bacteria 6979387
864 2937104746 2937098957 Bacteria 7249374
865 2937109935 2937106411 Bacteria 6947143
866 2937114543 2937113482 Bacteria 6505872
867 2937123730 2937119839 Bacteria 6597547
868 2937129292 2937126314 Bacteria 6771275
869 2941501655 2941499720 Bacteria 7599444
870 2957376897 2957375807 Bacteria 6425588
871 2957386053 2957382221 Bacteria 6737050
872 2957390137 2957388812 Bacteria 6778072
873 2957396799 2957395598 Bacteria 6822399
874 2957406234 2957402308 Bacteria 6741770
875 2957408987 2957408893 Bacteria 6558585
876 2957422029 2957415311 Bacteria 6991633
877 2957430563 2957430029 Bacteria 7022557
878 2957443163 2957437181 Bacteria 6568994
879 2957444377 2957443900 Bacteria 6869977
880 2957452748 2957450854 Bacteria 6765715
881 2957463101 2957457609 Bacteria 6967680
882 2957468227 2957464669 Bacteria 6568877
883 2957471927 2957471148 Bacteria 6797643
884 2957480988 2957478035 Bacteria 6756658
885 2957488481 2957484790 Bacteria 6703082
886 2957495241 2957491536 Bacteria 6695180
887 2957501909 2957498199 Bacteria 7126688
888 2960584761 2960584000 Bacteria 6864594
889 2960591313 2960591022 Bacteria 6622873
890 2960598746 2960597568 Bacteria 6550735
891 2960610184 2960603979 Bacteria 6898737
892 2960617281 2960610863 Bacteria 6691244
893 2960618727 2960617483 Bacteria 6727748
894 2960629555 2960624210 Bacteria 6875384
895 2960632565 2960631154 Bacteria 6732508
896 2960639580 2960637947 Bacteria 7296468
897 2960653058 2960652885 Bacteria 7083688
898 2960662924 2960660292 Bacteria 7041660
899 2960671466 2960667422 Bacteria 6763020
900 2960674544 2960674078 Bacteria 6609048
901 2960681395 2960680706 Bacteria 6624464
902 2960687902 2960687367 Bacteria 6535474
903 2960697168 2960693952 Bacteria 6749742
904 2964610887 2964607997 Bacteria 7101408
905 2964620372 2964615318 Bacteria 6809089
906 2964625977 2964621998 Bacteria 6834995
907 2964632495 2964628898 Bacteria 7083044
908 2964641731 2964636051 Bacteria 7091832
909 2964647211 2964643177 Bacteria 6820887
910 2964650892 2964649959 Bacteria 6675118
911 2964659004 2964656573 Bacteria 7100150
912 2964668827 2964663802 Bacteria 7019362
913 2964677582 2964670856 Bacteria 6851364
914 2964681761 2964678106 Bacteria 6792020
915 2964688700 2964685014 Bacteria 6839111
916 2964693230 2964691889 Bacteria 6802758
917 2964705162 2964698721 Bacteria 6765331
918 2964706224 2964705432 Bacteria 7114648
919 2964719085 2964712639 Bacteria 6695970
920 2964726734 2964719344 Bacteria 7286602
921 2967666680 2967664464 Bacteria 6948836
922 2967676610 2967671571 Bacteria 7021409
923 2967683021 2967678726 Bacteria 7264382
924 2967686544 2967686174 Bacteria 6678622
925 2967696129 2967693043 Bacteria 6804451
926 2967700466 2967699805 Bacteria 6854538
927 2967708414 2967706974 Bacteria 7186053
928 2967715811 2967714385 Bacteria 7000047
929 2967722000 2967721400 Bacteria 7073753
930 2967732451 2967728569 Bacteria 6641507
931 2967735417 2967735183 Bacteria 6827012
932 2967744148 2967742019 Bacteria 6794534
933 2967750124 2967748971 Bacteria 6733771
934 2967759013 2967755722 Bacteria 6814706
935 2967769054 2967762386 Bacteria 6923502
936 2967774557 2967769361 Bacteria 6587838
937 2967781334 2967775926 Bacteria 6738189
938 2970024965 2970019648 Bacteria 7072033
939 2970029346 2970026789 Bacteria 6785236
940 2970040647 2970033650 Bacteria 7118744
941 2970044361 2970040964 Bacteria 6731123
942 2970052757 2970047711 Bacteria 7088379
943 2970061062 2970054988 Bacteria 6611507
944 2970068153 2970061556 Bacteria 7099761
945 2970069451 2970068827 Bacteria 7123112
946 2970079086 2970076120 Bacteria 6697332
947 2970083394 2970082768 Bacteria 6183754
948 2970095507 2970088815 Bacteria 6933825
949 2970099090 2970095765 Bacteria 6936963
950 2970108835 2970102677 Bacteria 6812532
951 2970115262 2970109326 Bacteria 6863976
952 2970119564 2970116247 Bacteria 6501857
953 2970126429 2970122695 Bacteria 6625855
954 2970134304 2970129317 Bacteria 6806560
955 2970140679 2970136068 Bacteria 7207982
956 2970144578 2970143518 Bacteria 6446480
957 2970155641 2970149975 Bacteria 6779706
958 2970160297 2970156795 Bacteria 7168044
959 2970165886 2970164137 Bacteria 6861252
960 2970173352 2970170962 Bacteria 6876229
961 2970179846 2970177841 Bacteria 6768001
962 2970191427 2970184632 Bacteria 7054431
963 2970195675 2970191845 Bacteria 7032787
964 2977517679 2977516862 Bacteria 6940108
965 2977530078 2977523885 Bacteria 6960446
966 2977532441 2977530762 Bacteria 6951399
967 2977540974 2977537788 Bacteria 6929320
968 2977551120 2977544691 Bacteria 6875412
969 2977556854 2977551784 Bacteria 7125765
970 2977565603 2977558990 Bacteria 6863948
971 2977569116 2977565890 Bacteria 6901543
972 2977578005 2977572785 Bacteria 6763888
973 2977579717 2977579622 Bacteria 6772100
974 2978972392 2978969890 Bacteria 5400756
975 2984590639 2984587000 Bacteria 5263363
976 2989775210 2989771324 Bacteria 5605128
977 2996889246 2996887358 Bacteria 5795980
978 2996894692 2996893221 Bacteria 5823108
979 3003930546 3003930520 Bacteria 5667563
980 3003934967 3003930520 Bacteria 5667563
981 3005415448 3005409236 Bacteria 7188837
982 3005418456 3005416602 Bacteria 7064308
983 3005449315 3005445848 Bacteria 6906074
984 3005455614 3005452660 Bacteria 5889319
985 639650037 639633055 Bacteria 7751309
986 643827118 643692032 Bacteria 6891900
987 648735814 648276728 Bacteria 6968865
988 8003995002 8003992118 Bacteria 7266902
989 8004002766 8003999396 Bacteria 7063185
990 8005264176 8005258706 Bacteria 6184835
991 8005282055 8005275841 Bacteria 6929066
992 8005285129 8005282627 Bacteria 6675747
993 8005294225 8005289223 Bacteria 6634003
994 8005306637 8005301065 Bacteria 6614431
995 8005309428 8005307578 Bacteria 7395396
996 8005318652 8005314921 Bacteria 7072929
997 8005323773 8005321885 Bacteria 5795980
998 8005382745 8005376324 Bacteria 6590079
999 8005383802 8005382845 Bacteria 6732062
1000 8005401128 8005395548 Bacteria 6806915
1001 8005434082 8005430974 Bacteria 6689030
1002 8005464656 8005460587 Bacteria 7157962
1003 8005488463 8005484373 Bacteria 6297373
1004 8005501705 8005497431 Bacteria 6477605
1005 8005547075 8005542996 Bacteria 7077758
1006 8005559125 8005556819 Bacteria 6908598
1007 8005566816 8005563573 Bacteria 7153261
1008 8005574906 8005570704 Bacteria 6957481
1009 8005623059 8005619151 Bacteria 7030230
1010 8005631634 8005626139 Bacteria 6534237
1011 8005648932 8005645114 Bacteria 6950293
1012 8005673127 8005668836 Bacteria 6953162
1013 8005682173 8005682033 Bacteria 6726518
1014 8005693667 8005688590 Bacteria 6610080
1015 8005700906 8005695170 Bacteria 6912330
1016 8018133577 8018127388 Bacteria 7351159
1017 8018152108 8018150411 Bacteria 5549903
1018 8018170259 8018163183 Bacteria 7277977
1019 8018178425 8018176218 Bacteria 6896178
1020 8023687507 8023680758 Bacteria 7729763
1021 8024481991 8024479707 Bacteria 6954785
1022 8024505897 8024501048 Bacteria 6427847
1023 8046773190 8046767195 Bacteria 7547379
1024 8049295971 8049293176 Bacteria 6128433
1025 8054563052 8054558443 Bacteria 5204801
1026 8056381627 8056375014 Bacteria 7006639
1027 8056387064 8056382006 Bacteria 6408074
1028 8056876203 8056875544 Bacteria 4355797
1029 8057581072 8057575449 Bacteria 7367519
1030 8057877031 8057874678 Bacteria 7494653
1031 JGI24740J21852_10002821
1032 JGI25155J39150_1000012
1033 JGI25156J39149_1000036
1034 JGI25162J39368_1000616
1035 JGI25162J39368_1000674
1036 JGI25154J39366_1000033
1037 JGI25158J39367_1000162
1038 JGI25157J39369_1000457
1039 JGI25152J39213_1001072
1040 JGI25152J39213_1006247
1041 JGI25152J39213_1006470
1042 JGI25150J39212_1004291
1043 JGI25150J39212_1023376
1044 JGI25159J45721_1000032
1045 JGI25159J45721_1000562
1046 JGI25159J45721_1004059
1047 JGI25151J46595_10001521
1048 JGI25151J46595_10003347
1049 JGI25151J46595_10016794
1050 JGI25151J46595_10026969
1051 JGI25165J46597_1000653
1052 JGI25165J46597_1001558
1053 JGI25165J46597_1005019
1054 JGI25153J46596_10001965
1055 JGI25153J46596_10012168
1056 JGI25153J46596_10014977
1057 rootH2_10110427
1058 rootL2_10025999
1059 rootH1_10133869
1060 JGI25160J50197_1000006
1061 JGI25160J50197_1000009
1062 JGI25160J50197_1005328
1063 JGI25160J50197_1040279
1064 JGI25161J50226_1000004
1065 JGI25161J50226_1000103
1066 JGI25161J50226_1009858
1067 JGI25161J50226_1012711
1068 Ga0055526_1001453
1069 Ga0055526_1004540
1070 Ga0055526_1005119
1071 Ga0055526_1012874
1072 Ga0055526_1014948
1073 Ga0055526_1018745
1074 Ga0055524_1003188
1075 Ga0055524_1004566
1076 Ga0055524_1011993
1077 Ga0055524_1013202
1078 Ga0055524_1018775
1079 Ga0055524_1033451
1080 Ga0055536_1001969
1081 Ga0055536_1009383
1082 Ga0055528_1001555
1083 Ga0055528_1002096
1084 Ga0055528_1008849
1085 Ga0055528_1011106
1086 Ga0055528_1015212
1087 Ga0055528_1015655
1088 Ga0055528_1016794
1089 Ga0055528_1023907
1090 Ga0055530_10010612
1091 Ga0055530_10026672
1092 Ga0055540_1000548
1093 Ga0055540_1001994
1094 Ga0055540_1013093
1095 Ga0055540_1033649
1096 Ga0055531_10002383
1097 Ga0055531_10065303
1098 Ga0055543_1000002
1099 Ga0055543_1000029
1100 Ga0055543_1000055
1101 Ga0055543_1001623
1102 Ga0065165_1002222
1103 Ga0065165_1002258
1104 Ga0065165_1006467
1105 Ga0065165_1025403
1106 Ga0065165_1039456
1107 Ga0070668_100026486
1108 Ga0070668_100444906
1109 Ga0070668_100526843
1110 Ga0070669_100039304
1111 Ga0070671_100250106
1112 Ga0070667_100133180
1113 Ga0070663_100125882
1114 Ga0068853_100466266
1115 Ga0070672_100561468
1116 Ga0070665_100076701
1117 Ga0070665_100158192
1118 Ga0070665_100259294
1119 Ga0070665_100390754
1120 Ga0068855_100171386
1121 Ga0068856_100089232
1122 Ga0068852_100024530
1123 Ga0068851_10022098
1124 Ga0068862_100173014
1125 Ga0075365_10014002
1126 Ga0075365_10018357
1127 Ga0075368_10005916
1128 Ga0075363_100189478
1129 Ga0075364_10031187
1130 Ga0075364_10088938
1131 Ga0075364_10284853
1132 Ga0075362_10043558
1133 Ga0075367_10013599
1134 Ga0075367_10029718
1135 Ga0075367_10258518
1136 Ga0075369_10026306
1137 Ga0075366_10164519
1138 Ga0075366_10232685
1139 Ga0075370_10013300
1140 Ga0075370_10023326
1141 Ga0075370_10071005
1142 Ga0075370_10160158
1143 Ga0079104_1000042
1144 Ga0079104_1004737
1145 Ga0105244_10043527
1146 Ga0105244_10241981
1147 Ga0105250_10052177
1148 Ga0105240_10000019
1149 Ga0105243_10092857
1150 Ga0105243_10281818
1151 Ga0105237_10001429
1152 Ga0105249_11046143
1153 Ga0123341_1000015
1154 Ga0123341_1025883
1155 Ga0123342_1008847
1156 Ga0123342_1013745
1157 Ga0105239_10005857
1158 Ga0105239_10103407
1159 Ga0105246_10420268
1160 Ga0157370_10051278
1161 Ga0157370_10143340
1162 Ga0157369_10192650
1163 Ga0171463_1006
1164 Ga0163162_10261892
1165 Ga0182008_10060107
1166 Ga0182007_10003217
1167 Ga0183363_1052
1168 Ga0214544_1000063
1169 Ga0214542_1000095
1170 Ga0214543_1000008
1171 Ga0214543_1000026
1172 Ga0228711_1000003
1173 Ga0228710_1000003
1174 Ga0209435_100005
1175 Ga0209760_104496
1176 Ga0209436_100041
1177 Ga0209436_100568
1178 Ga0209436_108338
1179 Ga0209563_100733
1180 Ga0209437_100078
1181 Ga0209437_100174
1182 Ga0209437_114426
1183 Ga0207425_1000803
1184 Ga0207425_1006311
1185 Ga0207425_1008188
1186 Ga0209646_1000011
1187 Ga0209646_1005662
1188 Ga0209026_1000008
1189 Ga0209677_100841
1190 Ga0209148_1004773
1191 Ga0209759_1000004
1192 Ga0209759_1014877
1193 Ga0209129_1000199
1194 Ga0209129_1000975
1195 Ga0209129_1003347
1196 Ga0209129_1007250
1197 Ga0209129_1007446
1198 Ga0209129_1019838
1199 Ga0209233_1000163
1200 Ga0209233_1000299
1201 Ga0209233_1000305
1202 Ga0209673_1000037
1203 Ga0209673_1000320
1204 Ga0209673_1000880
1205 Ga0209673_1008451
1206 Ga0209673_1010305
1207 Ga0209673_1011644
1208 Ga0209673_1018931
1209 Ga0209673_1019120
1210 Ga0209673_1020064
1211 Ga0209130_1000030
1212 Ga0209130_1000032
1213 Ga0209130_1000037
1214 Ga0209130_1007040
1215 Ga0209130_1007971
1216 Ga0209130_1018837
1217 Ga0209675_1015442
1218 Ga0209676_1005646
1219 Ga0209676_1010574
1220 Ga0209676_1015193
1221 Ga0209025_1000052
1222 Ga0209025_1000339
1223 Ga0209025_1000354
1224 Ga0209025_1000566
1225 Ga0209025_1002960
1226 Ga0209025_1008052
1227 Ga0209025_1018121
1228 Ga0209025_1036296
1229 Ga0209564_1000086
1230 Ga0209564_1000207
1231 Ga0209564_1000345
1232 Ga0209564_1001903
1233 Ga0209564_1003065
1234 Ga0209564_1015388
1235 Ga0209758_1000576
1236 Ga0209758_1001323
1237 Ga0209758_1005667
1238 Ga0209758_1008543
1239 Ga0209758_1011382
1240 Ga0209758_1013270
1241 Ga0209758_1015179
1242 Ga0209758_1019040
1243 Ga0209758_1019584
1244 Ga0209050_1009382
1245 Ga0209050_1022968
1246 Ga0209256_1000348
1247 Ga0209256_1000368
1248 Ga0209256_1002386
1249 Ga0209256_1003161
1250 Ga0209256_1007748
1251 Ga0209256_1011843
1252 Ga0209256_1015046
1253 Ga0207426_1000047
1254 Ga0207426_1000048
1255 Ga0207426_1000077
1256 Ga0207426_1000296
1257 Ga0207426_1002927
1258 Ga0209051_1000236
1259 Ga0209051_1003233
1260 Ga0209051_1012488
1261 Ga0209051_1022264
1262 Ga0209051_1025628
1263 Ga0209051_1044922
1264 Ga0209257_1001268
1265 Ga0209257_1007119
1266 Ga0209257_1009173
1267 Ga0207680_10132443
1268 Ga0207695_10000049
1269 Ga0207671_10000107
1270 Ga0207681_10022888
1271 Ga0207644_10057411
1272 Ga0207709_10377278
1273 Ga0207667_10169777
1274 Ga0207668_10051754
1275 Ga0207640_10096868
1276 Ga0207658_10126114
1277 Ga0207639_10188962
1278 Ga0207678_10239809
1279 Ga0207702_10424189
1280 Ga0207698_10179718
1281 Ga0209281_1000081
1282 Ga0209281_1000141
1283 Ga0209281_1000194
1284 Ga0209371_1001459
1285 Ga0209282_1000036
1286 Ga0209813_10064240
1287 Ga0209813_10101519
1288 Ga0268266_10029313
1289 Ga0268266_10215898
1290 Ga0268266_10247133
1291 Ga0268265_10153035
1292 Ga0307515_10002397
1293 Ga0307515_10282871
1294 Ga0268256_1000985
1295 Ga0307408_100089717
1296 Ga0307408_100399713
1297 Ga0307514_10166451
1298 Ga0307516_10222686
1299 Ga0307405_10000942
1300 Ga0307405_10104206
1301 Ga0307410_10062071
1302 Ga0307406_10018985
1303 Ga0307406_10026120
1304 Ga0307412_10006576
1305 Ga0307412_10139877
1306 Ga0307412_10300861
1307 Ga0307412_10657392
1308 Ga0315914_1000002
1309 Ga0307409_100625315
1310 Ga0307414_10494241
1311 Ga0315913_1000009
1312 Ga0315915_1000005
1313 Ga0373935_0074411
1314 Ga0373927_0000047
1315 Ga0373925_0000580
1316 Ga0395905_0001828
1317 Ga0395905_0343300
1318 Ga0395901_0924360
1319 Ga0439436_0062464
1320 Ga0439466_0069645
1321 Ga0439465_0010930
1322 Ga0439465_0029770
1323 Ga0439465_0184468
1324 Ga0451787_432461
1325 Ga0451795_0089844
1326 Ga0451802_0764307
1327 Ga0451833_0456835
1328 Ga0451835_0882779
1329 Ga0451837_1754233
1330 Ga0451839_1369328
1331 Ga0451841_0635781
1332 Ga0451845_0318627
1333 Ga0451846_52688
1334 Ga0451849_0751888
1335 Ga0451850_27674
1336 Ga0451851_0395503
1337 Ga0451843_0257433
1338 Ga0452271_03333
1339 Ga0450920_042201
1340 Ga0450906_025351
1341 Ga0450907_017402
1342 Ga0450918_004407
1343 Ga0495617_012332
1344 Ga0495592_0058828
1345 Ga0495638_0000673
1346 Ga0495638_0020690
1347 Ga0495638_0201036
1348 Ga0495605_0003904
1349 Ga0495605_0018795
1350 Ga0495585_0063507
1351 Ga0495607_0058606
1352 Ga0495607_0084312
1353 Ga0495583_0007419
1354 Ga0495583_0052750
1355 Ga0495606_0003939
1356 Ga0495606_0028915
1357 Ga0495606_0033019
1358 Ga0495606_0073150
1359 Ga0495610_0001811
1360 Ga0495610_0020119
1361 Ga0495610_0132291
1362 Ga0495616_0058823
1363 Ga0495618_0402207
1364 Ga0495620_0021024
1365 Ga0495620_0048003
1366 Ga0495631_0003519
1367 Ga0495632_0001545
1368 Ga0495632_0018030
1369 Ga0495632_0073262
1370 Ga0495632_0083990
1371 Ga0495637_0187148
1372 Ga0495643_0017048
1373 Ga0495643_0025469
1374 Ga0495654_0000648
1375 Ga0495622_0017684
1376 Ga0495622_0041596
1377 Ga0495633_0044322
1378 Ga0495668_0015399
1379 Ga0495668_0109721
1380 Ga0495611_0012829
1381 Ga0495625_0008646
1382 Ga0495625_0048809
1383 Ga0495625_0075033
1384 Ga0495625_0155149
1385 Ga0495661_0089461
1386 Ga0495588_0134445
1387 Ga0495657_0068672
1388 Ga0495623_0106299
1389 Ga0495670_0109076
1390 Ga0495649_0024724
1391 Ga0495649_0086322
1392 Ga0495600_0037577
1393 Ga0495660_0008528
1394 Ga0495604_0182829
1395 Ga0495636_0049996
1396 Ga0495673_0050323
1397 Ga0495681_0049272
1398 Ga0495681_0060262
1399 Ga0495686_0004835
1400 Ga0495686_0028975
1401 Ga0495686_0064229
1402 Ga0495686_0136345
1403 Ga0495686_0408502
1404 Ga0495602_0212765
1405 Ga0495615_0088024
1406 Ga0496100_0209119
1407 Ga0496101_0151129
1408 Ga0496101_0207995
1409 Ga0496101_0301529
1410 Ga0496102_0005636
1411 Ga0496103_0007797
1412 Ga0496105_0173267
1413 Ga0496106_0006329
1414 Ga0496106_0096493
1415 Ga0496107_0135373
1416 Ga0496111_0282941
1417 Ga0496114_0224406
1418 Ga0496116_0000097
1419 Ga0496116_0016194
1420 Ga0496116_0035030
1421 Ga0496116_0038618
1422 Ga0496116_0042216
1423 Ga0496116_0096812
1424 Ga0496116_0132147
1425 Ga0496117_0008970
1426 Ga0496117_0014826
1427 Ga0496117_0061676
1428 Ga0496118_0006549
1429 Ga0496118_0008092
1430 Ga0496118_0014398
1431 Ga0496118_0032388
1432 Ga0496118_0049324
1433 Ga0496118_0077713
1434 Ga0496119_0014910
1435 Ga0496119_0020783
1436 Ga0496119_0126051
1437 Ga0496121_0002286
1438 Ga0496121_0005619
1439 Ga0496121_0012820
1440 Ga0496121_0018500
1441 Ga0496121_0037208
1442 Ga0496121_0039122
1443 Ga0496121_0055821
1444 Ga0496121_0066591
1445 Ga0496121_0104618
1446 Ga0496122_0000024
1447 Ga0496122_0000107
1448 Ga0496122_0008285
1449 Ga0496122_0021084
1450 Ga0496122_0038159
1451 Ga0496122_0042749
1452 Ga0496122_0044336
1453 Ga0496122_0062551
1454 Ga0496122_0070497
1455 Ga0496123_0000063
1456 Ga0496123_0000086
1457 Ga0496123_0012749
1458 Ga0496123_0014897
1459 Ga0496123_0028519
1460 Ga0496123_0031517
1461 Ga0496123_0047610
1462 Ga0496123_0056128
1463 Ga0496123_0062039
1464 Ga0496123_0283730
1465 Ga0496124_0001850
1466 Ga0496124_0007540
1467 Ga0496124_0007550
1468 Ga0496124_0022502
1469 Ga0496124_0039474
1470 Ga0496124_0046630
1471 Ga0496124_0080498
1472 Ga0496124_0116111
1473 Ga0496124_0123290
1474 Ga0496124_0258104
1475 Ga0496124_0420331
1476 Ga0496125_0008703
1477 Ga0496125_0041521
1478 Ga0496125_0043305
1479 Ga0496125_0110029
1480 Ga0496125_0243486
1481 Ga0496126_0000119
1482 Ga0496126_0000434
1483 Ga0496126_0005874
1484 Ga0496126_0045330
1485 Ga0496126_0068596
1486 Ga0496126_0083721
1487 Ga0496126_0222253
1488 Ga0496126_0273465
1489 Ga0495678_006119
1490 Ga0495678_104939
1491 Ga0501031_0046113
1492 Ga0501032_0017656
1493 Ga0501032_0063979
1494 Ga0501032_0097773
1495 Ga0501032_0129119
1496 Ga0501033_0000451
1497 Ga0501033_0172617
1498 Ga0501034_0156708
1499 Ga0501034_0442005
1500 Ga0501036_0019686
1501 Ga0501037_0371219
1502 Ga0501038_0038323
1503 Ga0501038_0323502
1504 Ga0501039_0500881
1505 Ga0501043_0355538
1506 Ga0501046_0117934
1507 Ga0501047_0357344
1508 Ga0501068_0293608
1509 Ga0501073_0224091
1510 Ga0501080_0018364
1511 Ga0501083_0025068
1512 Ga0501035_0001759
1513 Ga0501035_0066440
1514 Ga0501044_0048611
1515 Ga0501044_0238090
1516 nmdc:mga03683_20510_c1
1517 nmdc:mga03n38_201005_c1
1518 nmdc:mga00v17_21364_c1
1519 nmdc:mga00v17_79225_c1
1520 nmdc:mga0k408_39343_c1
1521 nmdc:mga0k408_423880_c1
1522 nmdc:mga06z11_30824_c1
1523 nmdc:mga07m45_10089_c1
1524 nmdc:mga07m45_139087_c1
1525 nmdc:mga0sz30_101679_c1
1526 Ga0495601_0144576
1527 Ga0500610_0016555
1528 Ga0500578_0121362
1529 Ga0500643_039791
1530 Ga0500650_0113736
1531 Ga0500562_064339
1532 Ga0500569_010293
1533 Ga0500569_086743
1534 Ga0500594_0020856
1535 Ga0500608_040937
1536 Ga0500618_001209
1537 Ga0500618_001823
1538 Ga0500618_007282
1539 Ga0500618_017475
1540 Ga0500658_0002830
1541 Ga0500658_0033023
1542 Ga0500568_0004715
1543 Ga0500568_0008575
1544 Ga0500577_0165902
1545 Ga0500577_0167919
1546 Ga0500588_0104554
1547 Ga0500590_000118
1548 Ga0500616_0001217
1549 Ga0500616_0012830
1550 Ga0500616_0023348
1551 Ga0500622_0000101
1552 Ga0500622_0002496
1553 Ga0500627_0031683
1554 Ga0500627_0157626
1555 Ga0500633_0001340
1556 Ga0500599_019473
1557 Ga0587077_053783
1558 2509110228
1559 2509378962
1560 2509389800
1561 2509447947
1562 2510134885
1563 2510303727
1564 2510896295
1565 2511136528
1566 2511173307
1567 2511187319
1568 2511195924
1569 2511503024
1570 2512534289
1571 2512973889
1572 2513572648
1573 2513580121
1574 2513597218
1575 2513602394
1576 2513617193
1577 2513631277
1578 2513710828
1579 2513868055
1580 2513882934
1581 2513902963
1582 2513908144
1583 2513926986
1584 2513998124
1585 2514004037
1586 2514022290
1587 2515113968
1588 2515610305
1589 2515636958
1590 2515642987
1591 2515656732
1592 2515743675
1593 2516205286
1594 2516894428
1595 2517037599
1596 2517077886
1597 2517096683
1598 2517410397
1599 2517571049
1600 2524451913
1601 2524460037
1602 2530646994
1603 2535519388
1604 2551692538
1605 2551708880
1606 2551724670
1607 2551735170
1608 2551745374
1609 2558860442
1610 2585168071
1611 2585202427
1612 2585224739
1613 2585227874
1614 2585257889
1615 2585269725
1616 2585274313
1617 2585280271
1618 2585322549
1619 2585335162
1620 2585388614
1621 2585392459
1622 2585402264
1623 2585529037
1624 2585532500
1625 2585540977
1626 2585547295
1627 2585554483
1628 2585560762
1629 2585822436
1630 2585839739
1631 2585845425
1632 2585898967
1633 2585903440
1634 2585997195
1635 2586001793
1636 2587981441
1637 2599334717
1638 2599420520
1639 2599720086
1640 2600194127
1641 2600373615
1642 2616295602
1643 2616307429
1644 2616554971
1645 2617383428
1646 2643809730
1647 2643813279
1648 2643858087
1649 2644006498
1650 2644048348
1651 2644063911
1652 2644108441
1653 2644147589
1654 2644195946
1655 2644201710
1656 2644209844
1657 2644241916
1658 2644312436
1659 2644336064
1660 2644381432
1661 2644415744
1662 2644448784
1663 2644481150
1664 2644496405
1665 2644500161
1666 2644546921
1667 2644618119
1668 2644653395
1669 2644676704
1670 2644686822
1671 2657684451
1672 2671112219
1673 2719182637
1674 2719387308
1675 2719666952
1676 2719733355
1677 2720493372
1678 2720614844
1679 2720621617
1680 2720632945
1681 2720776669
1682 2721148750
1683 2721160134
1684 2721165563
1685 2721400943
1686 2722841733
1687 2723028257
1688 2723561885
1689 2723568517
1690 2724039756
1691 2724046111
1692 2724091276
1693 2724105782
1694 2724111608
1695 2725945425
1696 2730109193
1697 2730165872
1698 2730299766
1699 2738800383
1700 2739035534
1701 2753461049
1702 2766065280
1703 2778176040
1704 2792582517
1705 2792624314
1706 2792625684
1707 2792642757
1708 2793281598
1709 2793293594
1710 2793313035
1711 2793319682
1712 2793327812
1713 2793333421
1714 2793342046
1715 2793347410
1716 2793353741
1717 2793359658
1718 2793369409
1719 2802717861
1720 2802725288
1721 2802730588
1722 2802737935
1723 2802744195
1724 2802753120
1725 2804753354
1726 2805929446
1727 2805935372
1728 2806044520
1729 2806052721
1730 2806059021
1731 2806068316
1732 2806074436
1733 2819609573
1734 2819639670
1735 2819686463
1736 2821126191
1737 2838019149
1738 2838024260
1739 2838033159
1740 2838040808
1741 2838047399
1742 2838051133
1743 2838063889
1744 2838073374
1745 2838077473
1746 2838664802
1747 2838671095
1748 2838684915
1749 2838691278
1750 2838699248
1751 2838703726
1752 2838712729
1753 2838735761
1754 2838737334
1755 2838748663
1756 2841842297
1757 2841853902
1758 2841868130
1759 2842082206
1760 2842113393
1761 2842123131
1762 2842142076
1763 2842151235
1764 2842162580
1765 2842169992
1766 2842185017
1767 2842198220
1768 2842199802
1769 2842208349
1770 2842220035
1771 2842235610
1772 2842241969
1773 2842249356
1774 2842256291
1775 2842263507
1776 2842266648
1777 2842275753
1778 2842281642
1779 2842288757
1780 2842296207
1781 2842298739
1782 2842308263
1783 2842316456
1784 2842321345
1785 2842345050
1786 2842359393
1787 2842369166
1788 2842375591
1789 2842382607
1790 2842390008
1791 2842398467
1792 2842406576
1793 2842412997
1794 2842419640
1795 2842427009
1796 2842429967
1797 2842436373
1798 2842444076
1799 2842451072
1800 2842464388
1801 2842470702
1802 2842479892
1803 2842483359
1804 2842493319
1805 2842499111
1806 2842507068
1807 2842510766
1808 2842523229
1809 2842925840
1810 2844169294
1811 2844457452
1812 2847420482
1813 2848995354
1814 2850082340
1815 2852391252
1816 2854897308
1817 2854919209
1818 2855827064
1819 2855842461
1820 2855878391
1821 2857518860
1822 2857532752
1823 2858803277
1824 2891377484
1825 2913299871
1826 2915980598
1827 2915994910
1828 2916006982
1829 2916012219
1830 2916016884
1831 2916027747
1832 2916030240
1833 2916036797
1834 2916044654
1835 2916052636
1836 2916058366
1837 2916065559
1838 2916072091
1839 2916081367
1840 2919104608
1841 2919169940
1842 2919173489
1843 2919410706
1844 2920760719
1845 2920828449
1846 2921201482
1847 2921209639
1848 2921237565
1849 2921244252
1850 2921252538
1851 2921260597
1852 2921265967
1853 2921287733
1854 2921292874
1855 2921298672
1856 2923558741
1857 2924148785
1858 2924152172
1859 2924164108
1860 2924172806
1861 2924174424
1862 2924183994
1863 2924192926
1864 2924193808
1865 2924206665
1866 2924213097
1867 2924221218
1868 2924224015
1869 2924232048
1870 2933020936
1871 2933574712
1872 2933589317
1873 2933603496
1874 2935901240
1875 2935907513
1876 2936374829
1877 2936380521
1878 2936382312
1879 2937000083
1880 2937006955
1881 2937015425
1882 2937018144
1883 2937024348
1884 2937032959
1885 2937042259
1886 2937046695
1887 2937052311
1888 2937063120
1889 2937067555
1890 2937071369
1891 2937078665
1892 2937090040
1893 2937092924
1894 2937104746
1895 2937109935
1896 2937114543
1897 2937123730
1898 2937129292
1899 2941501655
1900 2957376897
1901 2957386053
1902 2957390137
1903 2957396799
1904 2957406234
1905 2957408987
1906 2957422029
1907 2957430563
1908 2957443163
1909 2957444377
1910 2957452748
1911 2957463101
1912 2957468227
1913 2957471927
1914 2957480988
1915 2957488481
1916 2957495241
1917 2957501909
1918 2960584761
1919 2960591313
1920 2960598746
1921 2960610184
1922 2960617281
1923 2960618727
1924 2960629555
1925 2960632565
1926 2960639580
1927 2960653058
1928 2960662924
1929 2960671466
1930 2960674544
1931 2960681395
1932 2960687902
1933 2960697168
1934 2964610887
1935 2964620372
1936 2964625977
1937 2964632495
1938 2964641731
1939 2964647211
1940 2964650892
1941 2964659004
1942 2964668827
1943 2964677582
1944 2964681761
1945 2964688700
1946 2964693230
1947 2964705162
1948 2964706224
1949 2964719085
1950 2964726734
1951 2967666680
1952 2967676610
1953 2967683021
1954 2967686544
1955 2967696129
1956 2967700466
1957 2967708414
1958 2967715811
1959 2967722000
1960 2967732451
1961 2967735417
1962 2967744148
1963 2967750124
1964 2967759013
1965 2967769054
1966 2967774557
1967 2967781334
1968 2970024965
1969 2970029346
1970 2970040647
1971 2970044361
1972 2970052757
1973 2970061062
1974 2970068153
1975 2970069451
1976 2970079086
1977 2970083394
1978 2970095507
1979 2970099090
1980 2970108835
1981 2970115262
1982 2970119564
1983 2970126429
1984 2970134304
1985 2970140679
1986 2970144578
1987 2970155641
1988 2970160297
1989 2970165886
1990 2970173352
1991 2970179846
1992 2970191427
1993 2970195675
1994 2977517679
1995 2977530078
1996 2977532441
1997 2977540974
1998 2977551120
1999 2977556854
2000 2977565603
2001 2977569116
2002 2977578005
2003 2977579717
2004 2978972392
2005 2984590639
2006 2989775210
2007 2996889246
2008 2996894692
2009 3003930546
2010 3003934967
2011 3005415448
2012 3005418456
2013 3005449315
2014 3005455614
2015 639650037
2016 643827118
2017 648735814
2018 8003995002
2019 8004002766
2020 8005264176
2021 8005282055
2022 8005285129
2023 8005294225
2024 8005306637
2025 8005309428
2026 8005318652
2027 8005323773
2028 8005382745
2029 8005383802
2030 8005401128
2031 8005434082
2032 8005464656
2033 8005488463
2034 8005501705
2035 8005547075
2036 8005559125
2037 8005566816
2038 8005574906
2039 8005623059
2040 8005631634
2041 8005648932
2042 8005673127
2043 8005682173
2044 8005693667
2045 8005700906
2046 8018133577
2047 8018152108
2048 8018170259
2049 8018178425
2050 8023687507
2051 8024481991
2052 8024505897
2053 8046773190
2054 8049295971
2055 8054563052
2056 8056381627
2057 8056387064
2058 8056876203
2059 8057581072
2060 8057877031

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06226

DUF1007

Protein of unknown function (DUF1007)

19

227

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpv-assembly1.cif.gz_C act domain protein from streptococcus pneumoniae 0.6971 116 141
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.6233 112 141
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.5779 113 143
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.5619 115 138
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.5609 113 139
ID Description Score Start End Superfamily
1s71A01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.6233 112 141 3.30.2350.10
af_O23090_325_423_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6015 39 141 3.30.70.260
af_P9WHP7_7_227_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.589 112 139 3.30.2350.10
af_Q58008_135_385_3.30.2350.20 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;TruD, catalytic domain 0.5672 111 141 3.30.2350.20
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.5618 115 138 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A5C7SIY9-F1-model_v4 DUF1007 family protein 0.9322 53 227
AF-A0A7V8HAY8-F1-model_v4 deleted 0.9287 26 227
AF-A0A529MIP3-F1-model_v4 DUF1007 family protein 0.928 34 144
AF-A0A5C7SIY9-F1-model_v4 DUF1007 family protein 0.9271 53 227
AF-A0A441WTN3-F1-model_v4 DUF1007 family protein 0.9265 31 146

Map