F488549

General Info

Members Datasets Scaffolds Average Seq Length
1028 780 456 343

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10000235|Ga0075364_100002354
Length 354
Sequence MMDFEDFGGGAVVGSPLSQAEKAAAVLLAMGKGVAGKLLKYFTQAELQTIIASAQNLREIPPDELLGLVNEFEDLFTEGAGLMDNAKAIESILEEGLTPEEVDGLLGRRTAFEAYQTSIWDQLQEAEPAFIGKFLLREHPQTIAYILSMIPSAFGAKVLLELPESRRADIMNRTVNMKDVSPKAAQIIENRVIDLVAKIEAERNSNGANKVAELMNELEKPQVDTLLTSLETMSKASVNKVRPKIFLFEDLLAMPQRSRVLLLNDIAGDIITMALRGASVEIKEAVLSAISPRQRRMIESDLAATNAAINPREVAIARRAVAQEAIRLANSGQIQLKDTEAAGDKPAEGAAAAA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
61 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
62 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
63 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
86 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
87 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
88 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
89 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
90 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
91 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
92 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
93 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
96 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221557 Ensifer sp. Root558 Isolate Unclassified
104 2643221558 Rhizobium sp. Root149 Isolate Unclassified
105 2643221568 Rhizobium sp. Root564 Isolate Unclassified
106 2643221582 Rhizobium sp. Root651 Isolate Unclassified
107 2643221599 Rhizobium sp. Root708 Isolate Unclassified
108 2643221607 Rhizobium sp. Root73 Isolate Unclassified
109 2643221610 Ensifer sp. Root74 Isolate Unclassified
110 2643221618 Ensifer sp. Root231 Isolate Unclassified
111 2643221626 Ensifer sp. Root31 Isolate Unclassified
112 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
113 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
114 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
115 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
116 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
117 2643221655 Ensifer sp. Root1252 Isolate Unclassified
118 2643221659 Ensifer sp. Root127 Isolate Unclassified
119 2643221668 Ensifer sp. Root423 Isolate Unclassified
120 2643221675 Ensifer sp. Root1298 Isolate Unclassified
121 2643221680 Ensifer sp. Root1312 Isolate Unclassified
122 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
123 2643221688 Rhizobium sp. Root482 Isolate Unclassified
124 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
125 2643221693 Rhizobium sp. Root491 Isolate Unclassified
126 2643221698 Ensifer sp. Root142 Isolate Unclassified
127 2643221712 Ensifer sp. Root258 Isolate Unclassified
128 2643221718 Rhizobium sp. Root268 Isolate Unclassified
129 2643221719 Rhizobium sp. Root274 Isolate Unclassified
130 2643221723 Ensifer sp. Root278 Isolate Unclassified
131 2643221726 Ensifer sp. Root954 Isolate Unclassified
132 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
133 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
134 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
135 2718217882 Rhizobium sp. N741 Isolate Nodule
136 2718217927 Rhizobium sp. N324 Isolate Nodule
137 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
138 2718218009 Rhizobium sp. N561 Isolate Nodule
139 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
140 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
141 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
142 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
143 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
144 2718218363 Rhizobium sp. N113 Isolate Nodule
145 2718218365 Rhizobium sp. N731 Isolate Nodule
146 2718218366 Rhizobium sp. N621 Isolate Nodule
147 2718218423 Rhizobium sp. N941 Isolate Nodule
148 2721755514 Rhizobium sp. N6212 Isolate Nodule
149 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
150 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
151 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
152 2721755809 Rhizobium sp. N541 Isolate Nodule
153 2721755810 Rhizobium sp. N871 Isolate Nodule
154 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
155 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
156 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
157 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
158 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
159 2728369365 Rhizobium sp. N1341 Isolate Nodule
160 2728369397 Rhizobium sp. N1314 Isolate Nodule
161 2738541293 Rhizobium sp. GV031 Isolate Unclassified
162 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
163 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
164 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
165 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
166 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
167 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
168 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
169 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
170 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
171 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
172 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
173 2791355256 Rhizobium sp. M10 Isolate Nodule
174 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
175 2791355260 Rhizobium sp. L9 Isolate Nodule
176 2791355261 Rhizobium sp. J15 Isolate Nodule
177 2791355262 Rhizobium sp. M1 Isolate Nodule
178 2791355263 Rhizobium chutanense C5 Isolate Nodule
179 2791355264 Rhizobium sp. S9 Isolate Nodule
180 2791355265 Rhizobium sp. H4 Isolate Nodule
181 2791355266 Rhizobium sp. L43 Isolate Nodule
182 2791355267 Rhizobium sp. L18 Isolate Nodule
183 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
184 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
185 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
186 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
187 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
188 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
189 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
190 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
191 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
192 2802429633 Rhizobium anhuiense J3 Isolate Nodule
193 2802429634 Rhizobium anhuiense S10 Isolate Nodule
194 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
195 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
196 2802429637 Rhizobium anhuiense C15 Isolate Nodule
197 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
198 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
199 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
200 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
201 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
202 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
203 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
204 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
205 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
206 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
207 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
208 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
209 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
210 2838048938 Rhizobium pisi 27/80 Isolate Nodule
211 2838061910 Rhizobium phaseoli L15 Isolate Nodule
212 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
213 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
214 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
215 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
216 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
217 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
220 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
221 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
222 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
223 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
224 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
225 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
226 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
227 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
228 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
229 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
230 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
231 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
232 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
233 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
234 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
235 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
236 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
237 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
238 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
239 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
240 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
241 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
242 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
243 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
244 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
245 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
246 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
247 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
248 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
249 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
250 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
251 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
252 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
253 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
254 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
255 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
256 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
257 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
258 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
259 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
260 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
261 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
262 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
263 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
264 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
265 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
266 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
267 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
268 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
269 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
270 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
271 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
272 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
273 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
274 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
275 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
276 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
277 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
278 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
279 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
280 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
281 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
282 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
283 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
284 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
285 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
286 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
287 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
288 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
289 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
290 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
291 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
292 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
293 2844163670 Ensifer sp. 1H6 Isolate Unclassified
294 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
295 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
296 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
297 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
298 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
299 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
300 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
301 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
302 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
303 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
304 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
305 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
306 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
307 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
308 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
309 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
310 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
311 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
312 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
313 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
314 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
315 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
316 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
317 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
318 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
319 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
320 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
321 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
322 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
323 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
324 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
325 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
326 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
327 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
328 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
329 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
330 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
331 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
332 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
333 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
334 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
335 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
336 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
337 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
338 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
339 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
340 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
341 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
342 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
343 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
344 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
345 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
346 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
347 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
348 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
349 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
350 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
351 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
352 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
353 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
354 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
355 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
356 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
357 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
358 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
359 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
360 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
361 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
362 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
363 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
364 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
365 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
366 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
367 2933599457 Rhizobium phaseoli M3 Isolate Nodule
368 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
369 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
370 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
371 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
372 2936381700 Rhizobium chutanense C16 Isolate Unclassified
373 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
374 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
375 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
376 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
377 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
378 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
379 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
380 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
381 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
382 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
383 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
384 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
385 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
386 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
387 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
388 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
389 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
390 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
391 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
392 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
393 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
394 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
395 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
396 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
397 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
398 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
399 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
400 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
401 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
402 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
403 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
404 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
405 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
406 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
407 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
408 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
409 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
410 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
411 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
412 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
413 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
414 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
415 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
416 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
417 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
418 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
419 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
420 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
421 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
422 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
423 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
424 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
425 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
426 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
427 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
428 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
429 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
430 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
431 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
432 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
433 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
434 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
435 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
436 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
437 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
438 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
439 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
440 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
441 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
442 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
443 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
444 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
445 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
446 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
447 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
448 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
449 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
450 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
451 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
452 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
453 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
454 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
455 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
456 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
457 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
458 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
459 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
460 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
461 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
462 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
463 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
464 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
465 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
466 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
467 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
468 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
469 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
470 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
471 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
472 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
473 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
474 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
475 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
476 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
477 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
478 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
479 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
480 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
481 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
482 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
483 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
484 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
485 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
486 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
487 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
488 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
489 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
490 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
491 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
492 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
493 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
494 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
495 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
496 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
497 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
498 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
499 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
500 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
501 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
502 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
503 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
504 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
505 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
506 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
507 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
508 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
509 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
510 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
511 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
512 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
513 2996887358 Rhizobium sp. R711 Isolate Nodule
514 2996893221 Rhizobium sp. R635 Isolate Nodule
515 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
516 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
517 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
518 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
519 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
520 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
521 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
522 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
523 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
524 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
525 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
526 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
527 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
528 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
529 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
530 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
531 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
532 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
533 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
534 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
535 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
536 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
537 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
538 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
539 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
540 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
541 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
542 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
543 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
544 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
545 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
546 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
547 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
548 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
549 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
550 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
551 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
552 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
553 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
554 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
555 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
556 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
557 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
558 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
559 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
560 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
561 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
562 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
563 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
564 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
565 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
566 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
567 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
568 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
569 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
570 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
571 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
572 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
573 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
574 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
575 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
576 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
577 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
578 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
579 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
580 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
581 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
582 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
583 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
584 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
585 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
586 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
587 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
588 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
589 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
590 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
591 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
592 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
593 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
594 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
596 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
597 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
598 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
600 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
602 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
603 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
604 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
606 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
607 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
617 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
618 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
619 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
620 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
621 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
623 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
624 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
625 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
626 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
627 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
628 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
629 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
630 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
631 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
632 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
633 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
634 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
635 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
636 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
637 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
638 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
639 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
640 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
641 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
642 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
643 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
644 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
645 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
646 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
647 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
648 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
649 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
650 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
651 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
652 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
653 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
654 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
655 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
656 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
657 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
658 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
659 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
660 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
661 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
662 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
663 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
664 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
665 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
666 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
667 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
668 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
669 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
670 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
671 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
672 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
673 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
674 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
675 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
676 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
677 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
678 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
679 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
680 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
681 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
682 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
683 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
684 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
685 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
686 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
687 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
688 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
689 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
690 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
691 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
692 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
693 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
694 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
695 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
696 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
697 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
698 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
700 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
701 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
702 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
703 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
704 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
706 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
707 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
708 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
709 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
710 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
711 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
712 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
713 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
714 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
715 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
716 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
717 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
718 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
719 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
720 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
721 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
722 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
723 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
724 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
725 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
726 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
727 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
729 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
730 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
731 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
732 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
733 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
734 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
735 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
736 8005258706 Rhizobium sp. R693 Isolate Nodule
737 8005275841 Rhizobium sp. N4311 Isolate Nodule
738 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
739 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
740 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
741 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
742 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
743 8005321885 Rhizobium sp. R72 Isolate Nodule
744 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
745 8005382845 Rhizobium sp. R634 Isolate Nodule
746 8005395548 Rhizobium sp. R339 Isolate Nodule
747 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
748 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
749 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
750 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
751 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
752 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
753 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
754 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
755 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
756 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
757 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
758 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
759 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
760 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
761 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
762 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
763 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
764 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
765 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
766 8018176218 Rhizobium sp. N122 Isolate Nodule
767 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
768 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
769 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
770 8024501048 Rhizobium sp. H4 Isolate Nodule
771 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
772 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
773 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
774 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
775 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
776 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
777 8056382006 Rhizobium croatiense 13T Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.26
Metatranscriptomes 0.1
Isolates 55.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 19.46
Nodule 42.41
Rhizoplane 1.95
Rhizosphere 17.9
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000016 3300001979 Bacteria 58332
2 JGI25155J39150_1000157 3300002704 Bacteria 30370
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1000508 3300002737 Bacteria 29158
6 JGI25154J39366_1000286 3300002738 Bacteria 30355
7 JGI25158J39367_1000022 3300002739 Bacteria 38866
8 JGI25157J39369_1000247 3300002741 Bacteria 41079
9 JGI25152J39213_1001804 3300002773 Bacteria 8670
10 JGI25152J39213_1001895 3300002773 Bacteria 8384
11 JGI25152J39213_1003592 3300002773 Bacteria 5248
12 JGI25152J39213_1012708 3300002773 Bacteria 1790
13 JGI25150J39212_1000012 3300002774 Bacteria 182468
14 JGI25150J39212_1001293 3300002774 Bacteria 7130
15 JGI25159J45721_1000137 3300002987 Bacteria 34522
16 JGI25159J45721_1000442 3300002987 Bacteria 19125
17 JGI25159J45721_1001365 3300002987 Bacteria 10191
18 JGI25151J46595_10000025 3300003187 Bacteria 213302
19 JGI25151J46595_10006601 3300003187 Bacteria 5799
20 JGI25151J46595_10006776 3300003187 Bacteria 5704
21 JGI25151J46595_10007884 3300003187 Bacteria 5172
22 JGI25151J46595_10021187 3300003187 Bacteria 2723
23 JGI25151J46595_10023480 3300003187 Bacteria 2540
24 JGI25165J46597_1000491 3300003214 Bacteria 38149
25 JGI25165J46597_1002312 3300003214 Bacteria 6486
26 JGI25153J46596_10002932 3300003215 Bacteria 9660
27 JGI25153J46596_10003783 3300003215 Bacteria 8352
28 JGI25153J46596_10006603 3300003215 Bacteria 5844
29 JGI25160J50197_1000003 3300003354 Bacteria 482719
30 JGI25160J50197_1000041 3300003354 Bacteria 152843
31 JGI25160J50197_1002615 3300003354 Bacteria 8297
32 JGI25160J50197_1007291 3300003354 Bacteria 4347
33 JGI25161J50226_1000002 3300003374 Bacteria 420324
34 JGI25161J50226_1000143 3300003374 Bacteria 49711
35 JGI25161J50226_1000665 3300003374 Bacteria 13726
36 JGI25161J50226_1002026 3300003374 Bacteria 5524
37 Ga0055526_1000943 3300003771 Bacteria 21565
38 Ga0055526_1002174 3300003771 Bacteria 13446
39 Ga0055526_1002490 3300003771 Bacteria 12427
40 Ga0055526_1005231 3300003771 Bacteria 7534
41 Ga0055526_1012602 3300003771 Bacteria 3669
42 Ga0055526_1016841 3300003771 Bacteria 2830
43 Ga0055524_1001348 3300003775 Bacteria 14313
44 Ga0055524_1002151 3300003775 Bacteria 10363
45 Ga0055524_1006017 3300003775 Bacteria 5326
46 Ga0055524_1010264 3300003775 Bacteria 3740
47 Ga0055536_1006404 3300003781 Bacteria 5509
48 Ga0055536_1022368 3300003781 Bacteria 1889
49 Ga0055528_1000604 3300003790 Bacteria 26951
50 Ga0055528_1001318 3300003790 Bacteria 15525
51 Ga0055528_1003411 3300003790 Bacteria 7990
52 Ga0055528_1021557 3300003790 Bacteria 2039
53 Ga0055530_10027595 3300003791 Bacteria 1548
54 Ga0055540_1000249 3300003792 Bacteria 49180
55 Ga0055540_1001590 3300003792 Bacteria 13238
56 Ga0055540_1004885 3300003792 Bacteria 5864
57 Ga0055540_1034447 3300003792 Bacteria 1140
58 Ga0055531_10006329 3300003794 Bacteria 6739
59 Ga0055531_10037753 3300003794 Bacteria 1463
60 Ga0058692_1008970 3300003856 Bacteria 2553
61 Ga0055543_1000008 3300004625 Bacteria 202062
62 Ga0055543_1000158 3300004625 Bacteria 56811
63 Ga0055543_1000263 3300004625 Bacteria 39326
64 Ga0055543_1001083 3300004625 Bacteria 11893
65 Ga0065165_1000031 3300005262 Bacteria 216330
66 Ga0065165_1000084 3300005262 Bacteria 154822
67 Ga0070670_100000160 3300005331 Bacteria 61135
68 Ga0070668_100055422 3300005347 Bacteria 3060
69 Ga0070668_100070330 3300005347 Bacteria 2724
70 Ga0070668_100142784 3300005347 Bacteria 1931
71 Ga0070669_100077662 3300005353 Bacteria 2467
72 Ga0070671_100176872 3300005355 Bacteria 1806
73 Ga0070665_100007221 3300005548 Bacteria 11292
74 Ga0070665_100081202 3300005548 Bacteria 3248
75 Ga0068855_100164837 3300005563 Bacteria 2513
76 Ga0068856_100029583 3300005614 Bacteria 5351
77 Ga0068851_10009597 3300005834 Bacteria 4506
78 Ga0075365_10001015 3300006038 Bacteria 12045
79 Ga0075365_10001583 3300006038 Bacteria 10464
80 Ga0075365_10011186 3300006038 Bacteria 5268
81 Ga0075368_10000324 3300006042 Bacteria 13960
82 Ga0075368_10093649 3300006042 Bacteria 1230
83 Ga0075364_10000235 3300006051 Bacteria 26402
84 Ga0075364_10040894 3300006051 Bacteria 3008
85 Ga0075367_10002208 3300006178 Bacteria 8783
86 Ga0075367_10029920 3300006178 Bacteria 3118
87 Ga0075369_10014244 3300006186 Bacteria 3173
88 Ga0075369_10016807 3300006186 Bacteria 2958
89 Ga0075370_10009566 3300006353 Bacteria 5039
90 Ga0075370_10177853 3300006353 Bacteria 1252
91 Ga0079104_1000452 3300006946 Bacteria 46570
92 Ga0099826_10010557 3300006948 Bacteria 6924
93 Ga0099826_10011936 3300006948 Bacteria 6545
94 Ga0099826_10141996 3300006948 Bacteria 1386
95 Ga0105251_10014154 3300009011 Bacteria 4426
96 Ga0105250_10038351 3300009092 Bacteria 1922
97 Ga0105250_10052416 3300009092 Bacteria 1637
98 Ga0105240_10000460 3300009093 Bacteria 74956
99 Ga0105243_10201244 3300009148 Bacteria 1747
100 Ga0105248_10432169 3300009177 Bacteria 1483
101 Ga0105237_10000814 3300009545 Bacteria 42652
102 Ga0105237_10191558 3300009545 Bacteria 2045
103 Ga0105238_10559869 3300009551 Bacteria 1148
104 Ga0123341_1000040 3300009765 Bacteria 59249
105 Ga0123342_1021800 3300009766 Bacteria 4444
106 Ga0123342_1041270 3300009766 Bacteria 1673
107 Ga0105239_10000961 3300010375 Bacteria 40476
108 Ga0105246_10105476 3300011119 Bacteria 2060
109 Ga0157373_10001925 3300013100 Bacteria 15766
110 Ga0157373_10005759 3300013100 Bacteria 9275
111 Ga0157373_10058911 3300013100 Bacteria 2722
112 Ga0157371_10000004 3300013102 Bacteria 512593
113 Ga0157371_10006875 3300013102 Bacteria 9287
114 Ga0157370_10000952 3300013104 Bacteria 36741
115 Ga0157370_10009983 3300013104 Bacteria 10046
116 Ga0157370_10135006 3300013104 Bacteria 2300
117 Ga0157369_10076953 3300013105 Bacteria 3576
118 Ga0157369_10093341 3300013105 Bacteria 3213
119 Ga0157369_10103156 3300013105 Bacteria 3038
120 Ga0171463_1001 3300013249 Bacteria 1406070
121 Ga0157372_10026043 3300013307 Bacteria 6362
122 Ga0157372_10810770 3300013307 Bacteria 1087
123 Ga0182007_10000689 3300015262 Bacteria 19247
124 Ga0182005_1009794 3300015265 Bacteria 2773
125 Ga0183363_1032 3300015690 Bacteria 48614
126 Ga0214544_1000012 3300021320 Bacteria 229808
127 Ga0214542_1000011 3300021321 Bacteria 238260
128 Ga0214542_1019698 3300021321 Bacteria 5214
129 Ga0214543_1000004 3300021327 Bacteria 527190
130 Ga0214543_1000259 3300021327 Bacteria 81880
131 Ga0228711_1000019 3300022739 Bacteria 111795
132 Ga0228710_1000022 3300022740 Bacteria 111795
133 Ga0209435_100011 3300025206 Bacteria 413027
134 Ga0209436_100051 3300025208 Bacteria 64359
135 Ga0209436_101291 3300025208 Bacteria 8941
136 Ga0209563_104002 3300025230 Bacteria 2905
137 Ga0209437_100056 3300025233 Bacteria 363071
138 Ga0209437_100196 3300025233 Bacteria 121199
139 Ga0209437_103752 3300025233 Bacteria 2714
140 Ga0207425_1000012 3300025245 Bacteria 528324
141 Ga0207425_1007595 3300025245 Bacteria 2846
142 Ga0209646_1000024 3300025246 Bacteria 413027
143 Ga0209026_1000030 3300025250 Bacteria 329811
144 Ga0209677_100765 3300025253 Bacteria 16298
145 Ga0209148_1008689 3300025254 Bacteria 2028
146 Ga0209759_1000011 3300025256 Bacteria 413027
147 Ga0209129_1000081 3300025258 Bacteria 183694
148 Ga0209129_1000105 3300025258 Bacteria 159104
149 Ga0209129_1001073 3300025258 Bacteria 16132
150 Ga0209129_1001589 3300025258 Bacteria 12421
151 Ga0209129_1004594 3300025258 Bacteria 5301
152 Ga0209129_1004629 3300025258 Bacteria 5266
153 Ga0209129_1004809 3300025258 Bacteria 5092
154 Ga0209233_1000037 3300025261 Bacteria 554620
155 Ga0209233_1000071 3300025261 Bacteria 363290
156 Ga0209233_1000243 3300025261 Bacteria 90170
157 Ga0209673_1000015 3300025273 Bacteria 530618
158 Ga0209673_1000709 3300025273 Bacteria 46936
159 Ga0209673_1002098 3300025273 Bacteria 14969
160 Ga0209673_1003866 3300025273 Bacteria 8453
161 Ga0209673_1004485 3300025273 Bacteria 7461
162 Ga0209673_1005715 3300025273 Bacteria 6200
163 Ga0209673_1005942 3300025273 Bacteria 6020
164 Ga0209673_1006527 3300025273 Bacteria 5607
165 Ga0209130_1000002 3300025284 Bacteria 722648
166 Ga0209130_1000005 3300025284 Bacteria 599620
167 Ga0209130_1000088 3300025284 Bacteria 152927
168 Ga0209130_1024217 3300025284 Bacteria 1328
169 Ga0209130_1025335 3300025284 Bacteria 1285
170 Ga0209676_1007057 3300025292 Bacteria 5385
171 Ga0209676_1012224 3300025292 Bacteria 3395
172 Ga0209676_1046436 3300025292 Bacteria 1174
173 Ga0209025_1000024 3300025294 Bacteria 528324
174 Ga0209025_1000037 3300025294 Bacteria 383429
175 Ga0209025_1000295 3300025294 Bacteria 111489
176 Ga0209025_1000441 3300025294 Bacteria 81951
177 Ga0209025_1001006 3300025294 Bacteria 41784
178 Ga0209025_1004420 3300025294 Bacteria 12226
179 Ga0209025_1007434 3300025294 Bacteria 8169
180 Ga0209025_1010884 3300025294 Bacteria 6093
181 Ga0209025_1015374 3300025294 Bacteria 4620
182 Ga0209025_1018391 3300025294 Bacteria 3963
183 Ga0209025_1019905 3300025294 Bacteria 3705
184 Ga0209564_1000093 3300025295 Bacteria 245793
185 Ga0209564_1000576 3300025295 Bacteria 58256
186 Ga0209564_1000744 3300025295 Bacteria 46190
187 Ga0209564_1002937 3300025295 Bacteria 12385
188 Ga0209564_1008264 3300025295 Bacteria 5172
189 Ga0209564_1019811 3300025295 Bacteria 2496
190 Ga0209564_1037450 3300025295 Bacteria 1366
191 Ga0209758_1000046 3300025297 Bacteria 364931
192 Ga0209758_1000441 3300025297 Bacteria 69800
193 Ga0209758_1000575 3300025297 Bacteria 57471
194 Ga0209758_1000810 3300025297 Bacteria 44076
195 Ga0209758_1004393 3300025297 Bacteria 11767
196 Ga0209758_1006975 3300025297 Bacteria 7875
197 Ga0209758_1017133 3300025297 Bacteria 3631
198 Ga0209758_1019712 3300025297 Bacteria 3236
199 Ga0209758_1020520 3300025297 Bacteria 3122
200 Ga0209758_1041631 3300025297 Bacteria 1715
201 Ga0209050_1001493 3300025298 Bacteria 24848
202 Ga0209050_1010965 3300025298 Bacteria 4377
203 Ga0209050_1011983 3300025298 Bacteria 4036
204 Ga0209256_1000027 3300025299 Bacteria 423283
205 Ga0209256_1000646 3300025299 Bacteria 47375
206 Ga0209256_1002925 3300025299 Bacteria 12830
207 Ga0209256_1005514 3300025299 Bacteria 7240
208 Ga0209256_1005572 3300025299 Bacteria 7170
209 Ga0209256_1007936 3300025299 Bacteria 5067
210 Ga0209256_1009080 3300025299 Bacteria 4437
211 Ga0209256_1012914 3300025299 Bacteria 3143
212 Ga0207426_1000012 3300025302 Bacteria 730942
213 Ga0207426_1000013 3300025302 Bacteria 721897
214 Ga0207426_1000015 3300025302 Bacteria 599316
215 Ga0207426_1000063 3300025302 Bacteria 358920
216 Ga0207426_1000172 3300025302 Bacteria 163690
217 Ga0207426_1001042 3300025302 Bacteria 26389
218 Ga0209051_1000435 3300025303 Bacteria 56550
219 Ga0209051_1001495 3300025303 Bacteria 19567
220 Ga0209051_1002059 3300025303 Bacteria 15247
221 Ga0209051_1003125 3300025303 Bacteria 11159
222 Ga0209051_1008167 3300025303 Bacteria 5585
223 Ga0209051_1022865 3300025303 Bacteria 2617
224 Ga0209257_1000598 3300025304 Bacteria 59869
225 Ga0209257_1001343 3300025304 Bacteria 29827
226 Ga0209257_1003510 3300025304 Bacteria 13347
227 Ga0207695_10000036 3300025913 Bacteria 477897
228 Ga0207671_10000517 3300025914 Bacteria 52359
229 Ga0207650_10000391 3300025925 Bacteria 40030
230 Ga0207644_10020377 3300025931 Bacteria 4509
231 Ga0207667_10175915 3300025949 Bacteria 2199
232 Ga0207668_10038907 3300025972 Bacteria 3196
233 Ga0207668_10065437 3300025972 Bacteria 2573
234 Ga0207678_10193543 3300026067 Bacteria 1738
235 Ga0207702_10020627 3300026078 Bacteria 5454
236 Ga0209281_1000227 3300027111 Bacteria 119329
237 Ga0209281_1000488 3300027111 Bacteria 54963
238 Ga0209371_1000009 3300027312 Bacteria 963030
239 Ga0209371_1000315 3300027312 Bacteria 53030
240 Ga0209371_1002376 3300027312 Bacteria 10648
241 Ga0209282_1000042 3300027666 Bacteria 119329
242 Ga0209282_1000987 3300027666 Bacteria 14865
243 Ga0209282_1102834 3300027666 Bacteria 1468
244 Ga0209813_10000805 3300027866 Bacteria 7116
245 Ga0268266_10007658 3300028379 Bacteria 9711
246 Ga0268265_10079350 3300028380 Bacteria 2585
247 Ga0307515_10000121 3300028794 Bacteria 188657
248 Ga0307515_10001309 3300028794 Bacteria 56564
249 Ga0307515_10001439 3300028794 Bacteria 53690
250 Ga0268256_1000010 3300030500 Bacteria 963034
251 Ga0268256_1001455 3300030500 Bacteria 14225
252 Ga0307513_10002360 3300031456 Bacteria 26237
253 Ga0307513_10010314 3300031456 Bacteria 11721
254 Ga0307513_10060704 3300031456 Bacteria 4007
255 Ga0307408_100173037 3300031548 Bacteria 1726
256 Ga0307406_10003731 3300031901 Bacteria 8283
257 Ga0307406_10056675 3300031901 Bacteria 2511
258 Ga0307412_10002197 3300031911 Bacteria 10833
259 Ga0307412_10108702 3300031911 Bacteria 1976
260 Ga0315914_1000009 3300031967 Bacteria 182444
261 Ga0307411_10062468 3300032005 Bacteria 2485
262 Ga0315913_1000015 3300033430 Bacteria 119325
263 Ga0315915_1000013 3300033464 Bacteria 182438
264 Ga0373944_0031734 3300035089 Bacteria 1592
265 Ga0373927_0000086 3300035695 Bacteria 69853
266 Ga0373925_0019234 3300037068 Bacteria 4967
267 Ga0395905_0000775 3300037471 Bacteria 42024
268 Ga0395905_0002869 3300037471 Bacteria 18822
269 Ga0395905_0055515 3300037471 Bacteria 3706
270 Ga0395901_0322300 3300038443 Bacteria 1599
271 Ga0439436_0052534 3300041404 Bacteria 1149
272 Ga0439465_0012487 3300041413 Bacteria 2655
273 Ga0439465_0014839 3300041413 Bacteria 2430
274 Ga0451787_500296 3300041441 Bacteria 1559
275 Ga0451793_0815345 3300041452 Bacteria 1444
276 Ga0451833_0246734 3300041491 Bacteria 3153
277 Ga0451839_0113154 3300041496 Bacteria 1974
278 Ga0451847_0562432 3300041503 Bacteria 1997
279 Ga0451851_0911130 3300041507 Bacteria 1916
280 Ga0451853_1363602 3300041512 Bacteria 1675
281 Ga0466968_0113513 3300044735 Bacteria 1220
282 Ga0495592_0058619 3300046454 Bacteria 2839
283 Ga0495638_0000788 3300046460 Bacteria 33436
284 Ga0495638_0006702 3300046460 Bacteria 8346
285 Ga0495638_0006861 3300046460 Bacteria 8219
286 Ga0495605_0008232 3300046474 Bacteria 5897
287 Ga0495662_0015063 3300046476 Bacteria 3757
288 Ga0495585_0030438 3300046492 Bacteria 3069
289 Ga0495583_0006920 3300046506 Bacteria 7289
290 Ga0495606_0004810 3300046507 Bacteria 13260
291 Ga0495606_0020385 3300046507 Bacteria 4890
292 Ga0495606_0095392 3300046507 Bacteria 1822
293 Ga0495610_0018127 3300046512 Bacteria 3985
294 Ga0495610_0100972 3300046512 Bacteria 1292
295 Ga0495620_0013384 3300046515 Bacteria 4201
296 Ga0495620_0024949 3300046515 Bacteria 2837
297 Ga0495631_0004010 3300046518 Bacteria 7931
298 Ga0495643_0005769 3300046522 Bacteria 8284
299 Ga0495643_0031800 3300046522 Bacteria 2934
300 Ga0495648_0025776 3300046524 Bacteria 3973
301 Ga0495648_0122729 3300046524 Bacteria 1393
302 Ga0495652_0064673 3300046529 Bacteria 3076
303 Ga0495654_0000321 3300046530 Bacteria 42082
304 Ga0495625_0005915 3300046660 Bacteria 11006
305 Ga0495625_0020280 3300046660 Bacteria 5135
306 Ga0495625_0149423 3300046660 Bacteria 1571
307 Ga0495661_0023611 3300046665 Bacteria 3989
308 Ga0495588_0010206 3300046674 Bacteria 4358
309 Ga0495657_0014195 3300046675 Bacteria 5853
310 Ga0495658_0124282 3300046683 Bacteria 1564
311 Ga0495649_0029566 3300046694 Bacteria 3030
312 Ga0495604_0076920 3300047317 Bacteria 2509
313 Ga0495681_0008675 3300047470 Bacteria 6346
314 Ga0495686_0000458 3300047472 Bacteria 61256
315 Ga0495626_0066626 3300048091 Bacteria 1628
316 Ga0496100_0076569 3300048903 Bacteria 2247
317 Ga0496101_0280911 3300048904 Bacteria 1301
318 Ga0496102_0070746 3300048905 Bacteria 3203
319 Ga0496103_0057055 3300048906 Bacteria 2424
320 Ga0496104_0130217 3300048907 Bacteria 2417
321 Ga0496106_0000986 3300048909 Bacteria 20772
322 Ga0496106_0234479 3300048909 Bacteria 1466
323 Ga0496113_0029669 3300048916 Bacteria 3954
324 Ga0496114_0066788 3300048917 Bacteria 3016
325 Ga0496116_0000100 3300048919 Bacteria 194740
326 Ga0496116_0009339 3300048919 Bacteria 8380
327 Ga0496116_0019792 3300048919 Bacteria 5141
328 Ga0496116_0022875 3300048919 Bacteria 4667
329 Ga0496117_0000002 3300048920 Bacteria 2483758
330 Ga0496117_0001791 3300048920 Bacteria 29241
331 Ga0496117_0003238 3300048920 Bacteria 19173
332 Ga0496117_0009766 3300048920 Bacteria 8853
333 Ga0496117_0024238 3300048920 Bacteria 4806
334 Ga0496117_0069956 3300048920 Bacteria 2360
335 Ga0496117_0076507 3300048920 Bacteria 2219
336 Ga0496117_0123419 3300048920 Bacteria 1586
337 Ga0496118_0000233 3300048921 Bacteria 97731
338 Ga0496118_0006723 3300048921 Bacteria 12529
339 Ga0496118_0007119 3300048921 Bacteria 12000
340 Ga0496118_0015208 3300048921 Bacteria 7144
341 Ga0496118_0041154 3300048921 Bacteria 3662
342 Ga0496118_0089734 3300048921 Bacteria 2121
343 Ga0496118_0092587 3300048921 Bacteria 2074
344 Ga0496119_0015572 3300048922 Bacteria 5841
345 Ga0496119_0043038 3300048922 Bacteria 2857
346 Ga0496119_0133164 3300048922 Bacteria 1352
347 Ga0496120_0000021 3300048923 Bacteria 250966
348 Ga0496120_0004161 3300048923 Bacteria 12429
349 Ga0496120_0028402 3300048923 Bacteria 3429
350 Ga0496121_0000001 3300048924 Bacteria 1830318
351 Ga0496121_0001709 3300048924 Bacteria 35918
352 Ga0496121_0002141 3300048924 Bacteria 31012
353 Ga0496121_0069922 3300048924 Bacteria 2830
354 Ga0496121_0072966 3300048924 Bacteria 2753
355 Ga0496121_0138200 3300048924 Bacteria 1812
356 Ga0496121_0330071 3300048924 Bacteria 1023
357 Ga0496122_0000001 3300048925 Bacteria 1827766
358 Ga0496122_0000009 3300048925 Bacteria 584024
359 Ga0496122_0000147 3300048925 Bacteria 165589
360 Ga0496122_0002139 3300048925 Bacteria 29041
361 Ga0496122_0004207 3300048925 Bacteria 18095
362 Ga0496122_0004851 3300048925 Bacteria 16373
363 Ga0496122_0048210 3300048925 Bacteria 3279
364 Ga0496123_0000001 3300048926 Bacteria 1831497
365 Ga0496123_0000020 3300048926 Bacteria 388748
366 Ga0496123_0000158 3300048926 Bacteria 136078
367 Ga0496123_0012983 3300048926 Bacteria 7038
368 Ga0496123_0028156 3300048926 Bacteria 4166
369 Ga0496123_0047713 3300048926 Bacteria 2890
370 Ga0496123_0048858 3300048926 Bacteria 2842
371 Ga0496124_0000063 3300048927 Bacteria 229705
372 Ga0496124_0000551 3300048927 Bacteria 63371
373 Ga0496124_0000801 3300048927 Bacteria 51088
374 Ga0496124_0011589 3300048927 Bacteria 8799
375 Ga0496124_0030260 3300048927 Bacteria 4808
376 Ga0496124_0037345 3300048927 Bacteria 4225
377 Ga0496124_0086822 3300048927 Bacteria 2559
378 Ga0496124_0133936 3300048927 Bacteria 1965
379 Ga0496124_0151674 3300048927 Bacteria 1817
380 Ga0496124_0164085 3300048927 Bacteria 1728
381 Ga0496124_0227055 3300048927 Bacteria 1399
382 Ga0496124_0333386 3300048927 Bacteria 1081
383 Ga0496125_0000001 3300048928 Bacteria 1766138
384 Ga0496125_0000981 3300048928 Bacteria 44598
385 Ga0496125_0013463 3300048928 Bacteria 8037
386 Ga0496125_0025237 3300048928 Bacteria 5448
387 Ga0496125_0046632 3300048928 Bacteria 3634
388 Ga0496125_0062884 3300048928 Bacteria 2964
389 Ga0496125_0075468 3300048928 Bacteria 2608
390 Ga0496126_0000094 3300048929 Bacteria 208184
391 Ga0496126_0000195 3300048929 Bacteria 135582
392 Ga0496126_0021447 3300048929 Bacteria 6308
393 Ga0496126_0044771 3300048929 Bacteria 4072
394 Ga0496126_0118371 3300048929 Bacteria 2300
395 Ga0501031_0003356 3300049568 Bacteria 10280
396 Ga0501032_0071593 3300049569 Bacteria 2310
397 Ga0501032_0079300 3300049569 Bacteria 2186
398 Ga0501033_0000396 3300049570 Bacteria 41913
399 Ga0501034_0266464 3300049571 Bacteria 1655
400 Ga0501034_0351853 3300049571 Bacteria 1401
401 Ga0501036_0011900 3300049572 Bacteria 7214
402 Ga0501036_0043526 3300049572 Bacteria 3803
403 Ga0501037_0014020 3300049573 Bacteria 5905
404 Ga0501037_0029252 3300049573 Bacteria 4070
405 Ga0501038_0032328 3300049574 Bacteria 4617
406 Ga0501038_0266984 3300049574 Bacteria 1350
407 Ga0501043_0023215 3300049579 Bacteria 4865
408 Ga0501043_0108763 3300049579 Bacteria 2177
409 Ga0501046_0127846 3300049580 Bacteria 1929
410 Ga0501047_0062982 3300049581 Bacteria 3578
411 Ga0501047_0103372 3300049581 Bacteria 2729
412 Ga0501073_0082098 3300049589 Bacteria 2242
413 Ga0501080_0009732 3300049742 Bacteria 8780
414 Ga0501083_0035512 3300049744 Bacteria 3404
415 Ga0501035_0000647 3300049822 Bacteria 38388
416 Ga0501035_0013597 3300049822 Bacteria 7509
417 Ga0501035_0032335 3300049822 Bacteria 4761
418 Ga0501044_0015317 3300049823 Bacteria 8259
419 Ga0501044_0064074 3300049823 Bacteria 3753
420 nmdc:mga00v17_22507_c1 3300050491 Bacteria 3637
421 nmdc:mga00v17_39_c1 3300050491 Bacteria 82050
422 nmdc:mga00v17_453_c1 3300050491 Bacteria 23007
423 nmdc:mga00v17_84978_c1 3300050491 Bacteria 1981
424 nmdc:mga0yw44_1246_c1 3300050492 Bacteria 9996
425 nmdc:mga06z11_64702_c1 3300050494 Bacteria 1918
426 nmdc:mga07m45_132358_c1 3300050496 Bacteria 1443
427 nmdc:mga07m45_53305_c1 3300050496 Bacteria 2285
428 nmdc:mga07m45_75747_c1 3300050496 Bacteria 1918
429 nmdc:mga0sz30_12629_c1 3300050516 Bacteria 3289
430 Ga0500644_0058527 3300053088 Bacteria 1348
431 Ga0500560_003995 3300053107 Bacteria 3072
432 Ga0500560_013549 3300053107 Bacteria 2147
433 Ga0500572_002101 3300053111 Bacteria 4937
434 Ga0500608_003117 3300053122 Bacteria 6155
435 Ga0500608_036282 3300053122 Bacteria 2353
436 Ga0500618_000119 3300053125 Bacteria 64330
437 Ga0500618_000359 3300053125 Bacteria 31723
438 Ga0500618_021046 3300053125 Bacteria 1594
439 Ga0500658_0005431 3300053134 Bacteria 4738
440 Ga0500658_0020972 3300053134 Bacteria 2471
441 Ga0500559_0002761 3300053136 Bacteria 8906
442 Ga0500559_0132639 3300053136 Bacteria 1164
443 Ga0500561_0000060 3300053137 Bacteria 21720
444 Ga0500568_0001437 3300053139 Bacteria 15433
445 Ga0500568_0005570 3300053139 Bacteria 6486
446 Ga0500573_0000643 3300053140 Bacteria 15414
447 Ga0500604_0014350 3300053151 Bacteria 2157
448 Ga0500604_0050336 3300053151 Bacteria 1284
449 Ga0500616_0002986 3300053153 Bacteria 13387
450 Ga0500616_0003098 3300053153 Bacteria 13035
451 Ga0500622_0002012 3300053156 Bacteria 15189
452 Ga0500622_0002052 3300053156 Bacteria 15003
453 Ga0500624_016423 3300053157 Bacteria 1143
454 Ga0500634_0000466 3300053161 Bacteria 13166
455 Ga0500636_0000006 3300053177 Bacteria 183899
456 Ga0587072_002354 3300059643 Bacteria 2512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2967699805 2967703983 307
2 3300053157 Ga0500624_016423 Ga0500624_016423_29_976 308
3 3300006038 Ga0075365_10001015 Ga0075365_1000101512 313
4 3300025297 Ga0209758_1017133 Ga0209758_10171332 313
5 3300048929 Ga0496126_0118371 Ga0496126_0118371_1151_2203 314
6 3300013307 Ga0157372_10810770 Ga0157372_108107701 317
7 3300048922 Ga0496119_0133164 Ga0496119_0133164_348_1313 317
8 3300048924 Ga0496121_0330071 Ga0496121_0330071_21_974 317
9 3300041452 Ga0451793_0815345 Ga0451793_0815345_470_1426 318
10 3300048909 Ga0496106_0234479 Ga0496106_0234479_56_1015 319
11 3300048927 Ga0496124_0333386 Ga0496124_0333386_23_982 319
12 3300037471 Ga0395905_0000775 Ga0395905_0000775_3298_4332 328
13 3300031901 Ga0307406_10056675 Ga0307406_100566752 331
14 3300046460 Ga0495638_0006861 Ga0495638_0006861_6765_7793 331
15 3300046524 Ga0495648_0025776 Ga0495648_0025776_2959_3954 331
16 3300048927 Ga0496124_0227055 Ga0496124_0227055_285_1325 331
17 3300048925 Ga0496122_0000009 Ga0496122_0000009_579965_581002 334
18 3300048926 Ga0496123_0000020 Ga0496123_0000020_384523_385560 334
19 3300048927 Ga0496124_0030260 Ga0496124_0030260_1963_3000 334
20 3300046660 Ga0495625_0149423 Ga0495625_0149423_305_1348 335
21 3300053125 Ga0500618_000119 Ga0500618_000119_48239_49282 335
22 3300048929 Ga0496126_0021447 Ga0496126_0021447_756_1796 336
23 3300050496 nmdc:mga07m45_132358_c1 nmdc:mga07m45_132358_c1_407_1417 336
24 iso_pu_bacteria 2791355253 2793283879 336
25 3300006051 Ga0075364_10040894 Ga0075364_100408942 337
26 3300013100 Ga0157373_10058911 Ga0157373_100589112 337
27 3300013104 Ga0157370_10009983 Ga0157370_100099839 337
28 3300013105 Ga0157369_10076953 Ga0157369_100769534 337
29 3300048927 Ga0496124_0133936 Ga0496124_0133936_768_1805 337
30 3300050491 nmdc:mga00v17_84978_c1 nmdc:mga00v17_84978_c1_467_1504 337
31 3300003781 Ga0055536_1006404 Ga0055536_10064042 338
32 iso_pu_bacteria 2508501122 2509106975 338
33 iso_pu_bacteria 2509276019 2509375069 338
34 iso_pu_bacteria 2558860100 2558866172 338
35 iso_pu_bacteria 2850079185 2850079911 338
36 3300003215 JGI25153J46596_10006603 JGI25153J46596_100066032 339
37 3300003792 Ga0055540_1004885 Ga0055540_10048853 339
38 3300003794 Ga0055531_10006329 Ga0055531_100063294 339
39 3300025292 Ga0209676_1007057 Ga0209676_10070575 339
40 3300025297 Ga0209758_1000441 Ga0209758_100044114 339
41 3300025298 Ga0209050_1001493 Ga0209050_100149329 339
42 3300025303 Ga0209051_1000435 Ga0209051_100043524 339
43 3300025304 Ga0209257_1000598 Ga0209257_100059828 339
44 3300049571 Ga0501034_0351853 Ga0501034_0351853_76_1095 339
45 iso_pu_bacteria 2511231052 2511500457 339
46 iso_pu_bacteria 2512047086 2512531921 339
47 iso_pu_bacteria 2512875026 2512972753 339
48 iso_pu_bacteria 2513237086 2513585433 339
49 iso_pu_bacteria 2513237089 2513602858 339
50 iso_pu_bacteria 2513237091 2513616682 339
51 iso_pu_bacteria 2513237140 2513885629 339
52 iso_pu_bacteria 2513237143 2513904020 339
53 iso_pu_bacteria 2513237156 2513986182 339
54 iso_pu_bacteria 2513237159 2513996697 339
55 iso_pu_bacteria 2513237160 2514005110 339
56 iso_pu_bacteria 2515154107 2515607659 339
57 iso_pu_bacteria 2516143018 2516204404 339
58 iso_pu_bacteria 2516653046 2516891790 339
59 iso_pu_bacteria 2517487022 2517568588 339
60 iso_pu_bacteria 2524023207 2524450596 339
61 iso_pu_bacteria 2551306084 2551675639 339
62 iso_pu_bacteria 2551306085 2551684045 339
63 iso_pu_bacteria 2551306086 2551691785 339
64 iso_pu_bacteria 2551306087 2551701183 339
65 iso_pu_bacteria 2551306089 2551712206 339
66 iso_pu_bacteria 2551306090 2551721057 339
67 iso_pu_bacteria 2551306091 2551726771 339
68 iso_pu_bacteria 2551306092 2551735667 339
69 iso_pu_bacteria 2551306093 2551740752 339
70 iso_pu_bacteria 2582581283 2585164931 339
71 iso_pu_bacteria 2582581306 2585265307 339
72 iso_pu_bacteria 2582581865 2585385559 339
73 iso_pu_bacteria 2582581866 2585391975 339
74 iso_pu_bacteria 2599185156 2599332945 339
75 iso_pu_bacteria 2599185352 2600191383 339
76 iso_pu_bacteria 2643221557 2643806218 339
77 iso_pu_bacteria 2643221558 2643812848 339
78 iso_pu_bacteria 2643221607 2644047198 339
79 iso_pu_bacteria 2643221610 2644070178 339
80 iso_pu_bacteria 2643221618 2644103314 339
81 iso_pu_bacteria 2643221626 2644144253 339
82 iso_pu_bacteria 2643221636 2644199569 339
83 iso_pu_bacteria 2643221655 2644306244 339
84 iso_pu_bacteria 2643221659 2644330493 339
85 iso_pu_bacteria 2643221668 2644377480 339
86 iso_pu_bacteria 2643221675 2644420940 339
87 iso_pu_bacteria 2643221680 2644454463 339
88 iso_pu_bacteria 2643221686 2644479987 339
89 iso_pu_bacteria 2643221688 2644492313 339
90 iso_pu_bacteria 2643221689 2644496822 339
91 iso_pu_bacteria 2643221698 2644542760 339
92 iso_pu_bacteria 2643221712 2644611855 339
93 iso_pu_bacteria 2643221723 2644671896 339
94 iso_pu_bacteria 2643221726 2644692401 339
95 iso_pu_bacteria 2657244999 2657681831 339
96 iso_pu_bacteria 2690316117 2692317322 339
97 iso_pu_bacteria 2751185821 2753461279 339
98 iso_pu_bacteria 2791355082 2792582987 339
99 iso_pu_bacteria 2791355091 2792623874 339
100 iso_pu_bacteria 2791355092 2792629746 339
101 iso_pu_bacteria 2791355094 2792638079 339
102 iso_pu_bacteria 2802428858 2802720379 339
103 iso_pu_bacteria 2802428859 2802726199 339
104 iso_pu_bacteria 2802428860 2802731637 339
105 iso_pu_bacteria 2802428861 2802739388 339
106 iso_pu_bacteria 2802428862 2802742530 339
107 iso_pu_bacteria 2802428863 2802749235 339
108 iso_pu_bacteria 2802429268 2804750851 339
109 iso_pu_bacteria 2838074704 2838075305 339
110 iso_pu_bacteria 2842521101 2842521628 339
111 iso_pu_bacteria 2842922631 2842923253 339
112 iso_pu_bacteria 2844163670 2844165179 339
113 iso_pu_bacteria 2847417321 2847417610 339
114 iso_pu_bacteria 2848992105 2848992415 339
115 iso_pu_bacteria 2855825444 2855831706 339
116 iso_pu_bacteria 2855839649 2855839930 339
117 iso_pu_bacteria 2855872281 2855874602 339
118 iso_pu_bacteria 2858800743 2858803903 339
119 iso_pu_bacteria 2896384573 2896391622 339
120 iso_pu_bacteria 2899803654 2899805372 339
121 iso_pu_bacteria 2913295892 2913298058 339
122 iso_pu_bacteria 2915980308 2915980718 339
123 iso_pu_bacteria 2915986958 2915987737 339
124 iso_pu_bacteria 2915993759 2915998235 339
125 iso_pu_bacteria 2916000859 2916002561 339
126 iso_pu_bacteria 2916007675 2916011070 339
127 iso_pu_bacteria 2916014648 2916015490 339
128 iso_pu_bacteria 2916021584 2916022097 339
129 iso_pu_bacteria 2916028427 2916031099 339
130 iso_pu_bacteria 2916035215 2916041263 339
131 iso_pu_bacteria 2916041962 2916045637 339
132 iso_pu_bacteria 2916048683 2916053758 339
133 iso_pu_bacteria 2916055098 2916057337 339
134 iso_pu_bacteria 2916061851 2916063715 339
135 iso_pu_bacteria 2916068649 2916071441 339
136 iso_pu_bacteria 2916076590 2916081817 339
137 iso_pu_bacteria 2920760137 2920763462 339
138 iso_pu_bacteria 2920822456 2920823302 339
139 iso_pu_bacteria 2921201388 2921202842 339
140 iso_pu_bacteria 2921208531 2921209287 339
141 iso_pu_bacteria 2921237296 2921242039 339
142 iso_pu_bacteria 2921244191 2921248885 339
143 iso_pu_bacteria 2921250672 2921257224 339
144 iso_pu_bacteria 2921257292 2921263915 339
145 iso_pu_bacteria 2921263974 2921266412 339
146 iso_pu_bacteria 2921282425 2921283165 339
147 iso_pu_bacteria 2921289301 2921294468 339
148 iso_pu_bacteria 2924144063 2924150587 339
149 iso_pu_bacteria 2924150972 2924156570 339
150 iso_pu_bacteria 2924158325 2924163428 339
151 iso_pu_bacteria 2924165586 2924170398 339
152 iso_pu_bacteria 2924172951 2924177681 339
153 iso_pu_bacteria 2924179722 2924180783 339
154 iso_pu_bacteria 2924186466 2924190771 339
155 iso_pu_bacteria 2924193448 2924200000 339
156 iso_pu_bacteria 2924200457 2924202623 339
157 iso_pu_bacteria 2924207177 2924209116 339
158 iso_pu_bacteria 2924214083 2924218635 339
159 iso_pu_bacteria 2924221636 2924222332 339
160 iso_pu_bacteria 2924228884 2924235015 339
161 iso_pu_bacteria 2936996657 2936997865 339
162 iso_pu_bacteria 2937002841 2937009286 339
163 iso_pu_bacteria 2937009748 2937014852 339
164 iso_pu_bacteria 2937016420 2937022404 339
165 iso_pu_bacteria 2937023124 2937028754 339
166 iso_pu_bacteria 2937029754 2937034594 339
167 iso_pu_bacteria 2937036028 2937041245 339
168 iso_pu_bacteria 2937042894 2937045998 339
169 iso_pu_bacteria 2937049772 2937051461 339
170 iso_pu_bacteria 2937056579 2937062630 339
171 iso_pu_bacteria 2937063883 2937068330 339
172 iso_pu_bacteria 2937071275 2937074853 339
173 iso_pu_bacteria 2937078374 2937078806 339
174 iso_pu_bacteria 2937084907 2937089092 339
175 iso_pu_bacteria 2937091812 2937095196 339
176 iso_pu_bacteria 2937098957 2937103515 339
177 iso_pu_bacteria 2937106411 2937111506 339
178 iso_pu_bacteria 2937113482 2937114742 339
179 iso_pu_bacteria 2937119839 2937125630 339
180 iso_pu_bacteria 2937126314 2937132400 339
181 iso_pu_bacteria 2941499720 2941500786 339
182 iso_pu_bacteria 2957375807 2957382122 339
183 iso_pu_bacteria 2957382221 2957388572 339
184 iso_pu_bacteria 2957388812 2957394001 339
185 iso_pu_bacteria 2957395598 2957396108 339
186 iso_pu_bacteria 2957402308 2957408195 339
187 iso_pu_bacteria 2957408893 2957412048 339
188 iso_pu_bacteria 2957415311 2957422079 339
189 iso_pu_bacteria 2957422303 2957423925 339
190 iso_pu_bacteria 2957430029 2957434057 339
191 iso_pu_bacteria 2957437181 2957442573 339
192 iso_pu_bacteria 2957443900 2957447193 339
193 iso_pu_bacteria 2957450854 2957455226 339
194 iso_pu_bacteria 2957457609 2957462757 339
195 iso_pu_bacteria 2957464669 2957466249 339
196 iso_pu_bacteria 2957471148 2957477844 339
197 iso_pu_bacteria 2957478035 2957479718 339
198 iso_pu_bacteria 2957484790 2957484935 339
199 iso_pu_bacteria 2957491536 2957496100 339
200 iso_pu_bacteria 2957498199 2957500562 339
201 iso_pu_bacteria 2957505466 2957508229 339
202 iso_pu_bacteria 2960584000 2960584953 339
203 iso_pu_bacteria 2960591022 2960594701 339
204 iso_pu_bacteria 2960597568 2960603968 339
205 iso_pu_bacteria 2960603979 2960610852 339
206 iso_pu_bacteria 2960610863 2960614420 339
207 iso_pu_bacteria 2960617483 2960621631 339
208 iso_pu_bacteria 2960624210 2960626337 339
209 iso_pu_bacteria 2960631154 2960637522 339
210 iso_pu_bacteria 2960637947 2960643497 339
211 iso_pu_bacteria 2960645483 2960647981 339
212 iso_pu_bacteria 2960652885 2960658358 339
213 iso_pu_bacteria 2960660292 2960660477 339
214 iso_pu_bacteria 2960667422 2960672288 339
215 iso_pu_bacteria 2960674078 2960680271 339
216 iso_pu_bacteria 2960680706 2960686546 339
217 iso_pu_bacteria 2960687367 2960690401 339
218 iso_pu_bacteria 2960693952 2960698889 339
219 iso_pu_bacteria 2964607997 2964613070 339
220 iso_pu_bacteria 2964615318 2964616103 339
221 iso_pu_bacteria 2964621998 2964623690 339
222 iso_pu_bacteria 2964628898 2964632739 339
223 iso_pu_bacteria 2964636051 2964636577 339
224 iso_pu_bacteria 2964643177 2964649279 339
225 iso_pu_bacteria 2964649959 2964650266 339
226 iso_pu_bacteria 2964656573 2964663672 339
227 iso_pu_bacteria 2964663802 2964668197 339
228 iso_pu_bacteria 2964670856 2964674624 339
229 iso_pu_bacteria 2964678106 2964683357 339
230 iso_pu_bacteria 2964685014 2964690636 339
231 iso_pu_bacteria 2964691889 2964692284 339
232 iso_pu_bacteria 2964698721 2964700106 339
233 iso_pu_bacteria 2964705432 2964709910 339
234 iso_pu_bacteria 2964712639 2964713205 339
235 iso_pu_bacteria 2964719344 2964722994 339
236 iso_pu_bacteria 2967664464 2967667231 339
237 iso_pu_bacteria 2967671571 2967675332 339
238 iso_pu_bacteria 2967678726 2967684769 339
239 iso_pu_bacteria 2967686174 2967691460 339
240 iso_pu_bacteria 2967693043 2967695004 339
241 iso_pu_bacteria 2967706974 2967707344 339
242 iso_pu_bacteria 2967714385 2967714598 339
243 iso_pu_bacteria 2967721400 2967722527 339
244 iso_pu_bacteria 2967728569 2967730493 339
245 iso_pu_bacteria 2967735183 2967739348 339
246 iso_pu_bacteria 2967742019 2967748247 339
247 iso_pu_bacteria 2967748971 2967754987 339
248 iso_pu_bacteria 2967755722 2967761829 339
249 iso_pu_bacteria 2967762386 2967763469 339
250 iso_pu_bacteria 2967769361 2967772968 339
251 iso_pu_bacteria 2967775926 2967782529 339
252 iso_pu_bacteria 2970019648 2970022841 339
253 iso_pu_bacteria 2970026789 2970030514 339
254 iso_pu_bacteria 2970033650 2970037010 339
255 iso_pu_bacteria 2970040964 2970041954 339
256 iso_pu_bacteria 2970047711 2970054873 339
257 iso_pu_bacteria 2970054988 2970060879 339
258 iso_pu_bacteria 2970061556 2970064003 339
259 iso_pu_bacteria 2970068827 2970073956 339
260 iso_pu_bacteria 2970076120 2970082339 339
261 iso_pu_bacteria 2970082768 2970088485 339
262 iso_pu_bacteria 2970088815 2970091352 339
263 iso_pu_bacteria 2970095765 2970097205 339
264 iso_pu_bacteria 2970102677 2970108331 339
265 iso_pu_bacteria 2970109326 2970115656 339
266 iso_pu_bacteria 2970116247 2970118630 339
267 iso_pu_bacteria 2970122695 2970124326 339
268 iso_pu_bacteria 2970129317 2970131502 339
269 iso_pu_bacteria 2970136068 2970136470 339
270 iso_pu_bacteria 2970143518 2970148475 339
271 iso_pu_bacteria 2970149975 2970151770 339
272 iso_pu_bacteria 2970156795 2970157480 339
273 iso_pu_bacteria 2970164137 2970170206 339
274 iso_pu_bacteria 2970170962 2970175724 339
275 iso_pu_bacteria 2970177841 2970181964 339
276 iso_pu_bacteria 2970184632 2970191758 339
277 iso_pu_bacteria 2970191845 2970196660 339
278 iso_pu_bacteria 2977516862 2977519973 339
279 iso_pu_bacteria 2977523885 2977529199 339
280 iso_pu_bacteria 2977530762 2977535796 339
281 iso_pu_bacteria 2977537788 2977542060 339
282 iso_pu_bacteria 2977544691 2977549530 339
283 iso_pu_bacteria 2977551784 2977553612 339
284 iso_pu_bacteria 2977558990 2977559431 339
285 iso_pu_bacteria 2977565890 2977571836 339
286 iso_pu_bacteria 2977572785 2977574577 339
287 iso_pu_bacteria 2977579622 2977580372 339
288 iso_pu_bacteria 643692032 643824474 339
289 iso_pu_bacteria 648276728 648740840 339
290 iso_pu_bacteria 8003992118 8003992382 339
291 iso_pu_bacteria 8003999396 8003999711 339
292 iso_pu_bacteria 8049293176 8049293408 339
293 3300003775 Ga0055524_1006017 Ga0055524_10060176 340
294 3300006038 Ga0075365_10011186 Ga0075365_100111863 340
295 3300025292 Ga0209676_1046436 Ga0209676_10464361 340
296 3300025295 Ga0209564_1008264 Ga0209564_10082641 340
297 3300025303 Ga0209051_1008167 Ga0209051_10081675 340
298 3300050496 nmdc:mga07m45_53305_c1 nmdc:mga07m45_53305_c1_927_1967 340
299 iso_pu_bacteria 2599185236 2599719619 340
300 iso_pu_bacteria 2643221637 2644206775 340
301 iso_pu_bacteria 2643221718 2644650423 340
302 iso_pu_bacteria 2818991461 2819686249 340
303 iso_pu_bacteria 2891373044 2891375004 340
304 iso_pu_bacteria 2989771324 2989772722 340
305 iso_pu_bacteria 2510461069 2510841148 341
306 iso_pu_bacteria 2510917026 2511171232 341
307 iso_pu_bacteria 2510917030 2511195314 341
308 iso_pu_bacteria 2582581298 2585223693 341
309 iso_pu_bacteria 2585427529 2585545711 341
310 iso_pu_bacteria 2585427633 2585994324 341
311 iso_pu_bacteria 2585427634 2585998782 341
312 iso_pu_bacteria 2600254933 2600374640 341
313 iso_pu_bacteria 2643221653 2644297704 341
314 iso_pu_bacteria 2643221719 2644655957 341
315 iso_pu_bacteria 2775507049 2776912001 341
316 iso_pu_bacteria 2818991272 2819245254 341
317 iso_pu_bacteria 2837651117 2837651890 341
318 iso_pu_bacteria 2854896431 2854898191 341
319 iso_pu_bacteria 2854916844 2854919873 341
320 iso_pu_bacteria 2919100787 2919101421 341
321 iso_pu_bacteria 2919171160 2919172167 341
322 iso_pu_bacteria 2929138655 2929138842 341
323 iso_pu_bacteria 2989349275 2989351480 341
324 iso_pu_bacteria 2989776772 2989777354 341
325 iso_pu_bacteria 3003930520 3003931883 341
326 iso_pu_bacteria 3005445848 3005446112 341
327 iso_pu_bacteria 639633055 639646578 341
328 iso_pu_bacteria 8005246636 8005247458 341
329 iso_pu_bacteria 8005658619 8005660320 341
330 iso_pu_bacteria 8054558443 8054559279 341
331 3300021321 Ga0214542_1019698 Ga0214542_10196982 342
332 3300021327 Ga0214543_1000259 Ga0214543_100025926 342
333 3300025297 Ga0209758_1041631 Ga0209758_10416312 342
334 3300028794 Ga0307515_10000121 Ga0307515_10000121109 342
335 3300049571 Ga0501034_0266464 Ga0501034_0266464_237_1265 342
336 3300053136 Ga0500559_0002761 Ga0500559_0002761_3909_4937 342
337 iso_pu_bacteria 2509276021 2509388507 342
338 iso_pu_bacteria 2509276033 2509444057 342
339 iso_pu_bacteria 2510065019 2510131346 342
340 iso_pu_bacteria 2510461076 2510897700 342
341 iso_pu_bacteria 2510917028 2511184721 342
342 iso_pu_bacteria 2513237084 2513570564 342
343 iso_pu_bacteria 2513237085 2513580282 342
344 iso_pu_bacteria 2513237088 2513596666 342
345 iso_pu_bacteria 2513237093 2513634183 342
346 iso_pu_bacteria 2513237103 2513707029 342
347 iso_pu_bacteria 2513237138 2513864921 342
348 iso_pu_bacteria 2513237144 2513910285 342
349 iso_pu_bacteria 2513237146 2513929795 342
350 iso_pu_bacteria 2513237162 2514020314 342
351 iso_pu_bacteria 2515075009 2515110299 342
352 iso_pu_bacteria 2515154113 2515634507 342
353 iso_pu_bacteria 2515154114 2515643732 342
354 iso_pu_bacteria 2515154116 2515657130 342
355 iso_pu_bacteria 2515154134 2515743369 342
356 iso_pu_bacteria 2516653077 2517038984 342
357 iso_pu_bacteria 2516653085 2517079250 342
358 iso_pu_bacteria 2517093000 2517093179 342
359 iso_pu_bacteria 2517287029 2517409448 342
360 iso_pu_bacteria 2519899620 2520378934 342
361 iso_pu_bacteria 2529292951 2530647889 342
362 iso_pu_bacteria 2534681796 2535515028 342
363 iso_pu_bacteria 2582581294 2585203605 342
364 iso_pu_bacteria 2582581299 2585229751 342
365 iso_pu_bacteria 2582581304 2585255983 342
366 iso_pu_bacteria 2582581867 2585398618 342
367 iso_pu_bacteria 2585427526 2585529333 342
368 iso_pu_bacteria 2585427528 2585539615 342
369 iso_pu_bacteria 2585427590 2585819232 342
370 iso_pu_bacteria 2585427593 2585837572 342
371 iso_pu_bacteria 2585427594 2585844138 342
372 iso_pu_bacteria 2599185170 2599419257 342
373 iso_pu_bacteria 2615840624 2616297047 342
374 iso_pu_bacteria 2643221599 2644004830 342
375 iso_pu_bacteria 2643221634 2644190507 342
376 iso_pu_bacteria 2643221643 2644241614 342
377 iso_pu_bacteria 2718217882 2719179499 342
378 iso_pu_bacteria 2718217927 2719384055 342
379 iso_pu_bacteria 2718217997 2719663846 342
380 iso_pu_bacteria 2718218009 2719730169 342
381 iso_pu_bacteria 2718218199 2720490265 342
382 iso_pu_bacteria 2718218232 2720611642 342
383 iso_pu_bacteria 2718218233 2720618491 342
384 iso_pu_bacteria 2718218235 2720629899 342
385 iso_pu_bacteria 2718218269 2720773594 342
386 iso_pu_bacteria 2718218363 2721145592 342
387 iso_pu_bacteria 2718218365 2721157109 342
388 iso_pu_bacteria 2718218366 2721162471 342
389 iso_pu_bacteria 2718218423 2721397825 342
390 iso_pu_bacteria 2721755514 2722838641 342
391 iso_pu_bacteria 2721755556 2723025265 342
392 iso_pu_bacteria 2721755684 2723558850 342
393 iso_pu_bacteria 2721755685 2723565420 342
394 iso_pu_bacteria 2721755809 2724036635 342
395 iso_pu_bacteria 2721755810 2724042925 342
396 iso_pu_bacteria 2721755819 2724088201 342
397 iso_pu_bacteria 2721755822 2724102685 342
398 iso_pu_bacteria 2721755823 2724108581 342
399 iso_pu_bacteria 2724679232 2725948924 342
400 iso_pu_bacteria 2728369352 2730106201 342
401 iso_pu_bacteria 2728369365 2730162736 342
402 iso_pu_bacteria 2728369397 2730296741 342
403 iso_pu_bacteria 2738541293 2738801309 342
404 iso_pu_bacteria 2738541333 2739037005 342
405 iso_pu_bacteria 2765235942 2766066635 342
406 iso_pu_bacteria 2791355256 2793295278 342
407 iso_pu_bacteria 2791355259 2793316400 342
408 iso_pu_bacteria 2791355260 2793323370 342
409 iso_pu_bacteria 2791355261 2793326236 342
410 iso_pu_bacteria 2791355262 2793334296 342
411 iso_pu_bacteria 2791355263 2793341876 342
412 iso_pu_bacteria 2791355264 2793348213 342
413 iso_pu_bacteria 2791355265 2793355721 342
414 iso_pu_bacteria 2791355266 2793361582 342
415 iso_pu_bacteria 2791355267 2793364606 342
416 iso_pu_bacteria 2802429605 2805929301 342
417 iso_pu_bacteria 2802429606 2805932440 342
418 iso_pu_bacteria 2802429633 2806047613 342
419 iso_pu_bacteria 2802429634 2806055032 342
420 iso_pu_bacteria 2802429635 2806062066 342
421 iso_pu_bacteria 2802429636 2806067208 342
422 iso_pu_bacteria 2802429637 2806076529 342
423 iso_pu_bacteria 2838016132 2838020214 342
424 iso_pu_bacteria 2838022645 2838025733 342
425 iso_pu_bacteria 2838035591 2838037059 342
426 iso_pu_bacteria 2838042994 2838044499 342
427 iso_pu_bacteria 2838048938 2838051570 342
428 iso_pu_bacteria 2838061910 2838064045 342
429 iso_pu_bacteria 2838068647 2838071040 342
430 iso_pu_bacteria 2838661181 2838663764 342
431 iso_pu_bacteria 2838668709 2838672465 342
432 iso_pu_bacteria 2838680041 2838680513 342
433 iso_pu_bacteria 2838686498 2838691653 342
434 iso_pu_bacteria 2838694306 2838695454 342
435 iso_pu_bacteria 2838701080 2838703793 342
436 iso_pu_bacteria 2838707686 2838708831 342
437 iso_pu_bacteria 2838729681 2838733863 342
438 iso_pu_bacteria 2838742623 2838747073 342
439 iso_pu_bacteria 2841851746 2841856214 342
440 iso_pu_bacteria 2841864319 2841866883 342
441 iso_pu_bacteria 2842077413 2842079934 342
442 iso_pu_bacteria 2842110456 2842112139 342
443 iso_pu_bacteria 2842118031 2842120552 342
444 iso_pu_bacteria 2842146304 2842148415 342
445 iso_pu_bacteria 2842156927 2842162002 342
446 iso_pu_bacteria 2842163707 2842169622 342
447 iso_pu_bacteria 2842180545 2842185844 342
448 iso_pu_bacteria 2842192696 2842192815 342
449 iso_pu_bacteria 2842198810 2842202884 342
450 iso_pu_bacteria 2842205361 2842207022 342
451 iso_pu_bacteria 2842217011 2842218865 342
452 iso_pu_bacteria 2842229732 2842235372 342
453 iso_pu_bacteria 2842237096 2842238242 342
454 iso_pu_bacteria 2842243621 2842248173 342
455 iso_pu_bacteria 2842250916 2842253481 342
456 iso_pu_bacteria 2842257432 2842262233 342
457 iso_pu_bacteria 2842264693 2842268832 342
458 iso_pu_bacteria 2842271015 2842276626 342
459 iso_pu_bacteria 2842278818 2842280285 342
460 iso_pu_bacteria 2842285085 2842286767 342
461 iso_pu_bacteria 2842291075 2842293595 342
462 iso_pu_bacteria 2842304105 2842306572 342
463 iso_pu_bacteria 2842311132 2842312692 342
464 iso_pu_bacteria 2842317721 2842322443 342
465 iso_pu_bacteria 2842341865 2842343145 342
466 iso_pu_bacteria 2842363717 2842367130 342
467 iso_pu_bacteria 2842370503 2842370976 342
468 iso_pu_bacteria 2842377471 2842379992 342
469 iso_pu_bacteria 2842384541 2842387063 342
470 iso_pu_bacteria 2842395702 2842399177 342
471 iso_pu_bacteria 2842402390 2842403680 342
472 iso_pu_bacteria 2842409023 2842410618 342
473 iso_pu_bacteria 2842415677 2842417264 342
474 iso_pu_bacteria 2842422224 2842424655 342
475 iso_pu_bacteria 2842428310 2842432968 342
476 iso_pu_bacteria 2842434925 2842439273 342
477 iso_pu_bacteria 2842441272 2842445902 342
478 iso_pu_bacteria 2842447887 2842451917 342
479 iso_pu_bacteria 2842462802 2842467088 342
480 iso_pu_bacteria 2842469257 2842473884 342
481 iso_pu_bacteria 2842489311 2842492531 342
482 iso_pu_bacteria 2842495871 2842500111 342
483 iso_pu_bacteria 2844454524 2844456062 342
484 iso_pu_bacteria 2857516855 2857521715 342
485 iso_pu_bacteria 2923556063 2923557075 342
486 iso_pu_bacteria 2933570622 2933573641 342
487 iso_pu_bacteria 2933586486 2933587467 342
488 iso_pu_bacteria 2933599457 2933601839 342
489 iso_pu_bacteria 2935894831 2935895978 342
490 iso_pu_bacteria 2935901341 2935907235 342
491 iso_pu_bacteria 2936367885 2936369000 342
492 iso_pu_bacteria 2936375103 2936378384 342
493 iso_pu_bacteria 2936381700 2936383671 342
494 iso_pu_bacteria 2996887358 2996888444 342
495 iso_pu_bacteria 2996893221 2996893363 342
496 iso_pu_bacteria 3005409236 3005411161 342
497 iso_pu_bacteria 3005452660 3005452770 342
498 iso_pu_bacteria 8005258706 8005263408 342
499 iso_pu_bacteria 8005275841 8005278766 342
500 iso_pu_bacteria 8005282627 8005289080 342
501 iso_pu_bacteria 8005289223 8005291154 342
502 iso_pu_bacteria 8005301065 8005301479 342
503 iso_pu_bacteria 8005307578 8005309265 342
504 iso_pu_bacteria 8005321885 8005322971 342
505 iso_pu_bacteria 8005376324 8005377506 342
506 iso_pu_bacteria 8005382845 8005387368 342
507 iso_pu_bacteria 8005395548 8005400054 342
508 iso_pu_bacteria 8005430974 8005432860 342
509 iso_pu_bacteria 8005460587 8005460938 342
510 iso_pu_bacteria 8005497431 8005498590 342
511 iso_pu_bacteria 8005542996 8005543700 342
512 iso_pu_bacteria 8005556819 8005560551 342
513 iso_pu_bacteria 8005563573 8005563991 342
514 iso_pu_bacteria 8005570704 8005576850 342
515 iso_pu_bacteria 8005619151 8005619782 342
516 iso_pu_bacteria 8005626139 8005628354 342
517 iso_pu_bacteria 8005668836 8005670001 342
518 iso_pu_bacteria 8005688590 8005690195 342
519 iso_pu_bacteria 8005695170 8005699325 342
520 iso_pu_bacteria 8018127388 8018133050 342
521 iso_pu_bacteria 8018150411 8018153017 342
522 iso_pu_bacteria 8018163183 8018168952 342
523 iso_pu_bacteria 8018176218 8018178872 342
524 iso_pu_bacteria 8023680758 8023684312 342
525 iso_pu_bacteria 8024479707 8024480205 342
526 iso_pu_bacteria 8024501048 8024501674 342
527 iso_pu_bacteria 8056375014 8056375563 342
528 iso_pu_bacteria 8056382006 8056385877 342
529 iso_pu_bacteria 8057874678 8057875977 342
530 3300002987 JGI25159J45721_1000137 JGI25159J45721_100013721 343
531 3300003187 JGI25151J46595_10006776 JGI25151J46595_100067764 343
532 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003458 343
533 3300003374 JGI25161J50226_1000665 JGI25161J50226_100066514 343
534 3300003771 Ga0055526_1000943 Ga0055526_100094316 343
535 3300003775 Ga0055524_1002151 Ga0055524_100215110 343
536 3300003781 Ga0055536_1022368 Ga0055536_10223682 343
537 3300003791 Ga0055530_10027595 Ga0055530_100275952 343
538 3300003794 Ga0055531_10037753 Ga0055531_100377531 343
539 3300004625 Ga0055543_1000158 Ga0055543_100015848 343
540 3300005262 Ga0065165_1000084 Ga0065165_1000084134 343
541 3300006948 Ga0099826_10141996 Ga0099826_101419961 343
542 3300013249 Ga0171463_1001 Ga0171463_1001763 343
543 3300015690 Ga0183363_1032 Ga0183363_103221 343
544 3300021320 Ga0214544_1000012 Ga0214544_100001281 343
545 3300021321 Ga0214542_1000011 Ga0214542_100001175 343
546 3300021327 Ga0214543_1000004 Ga0214543_1000004425 343
547 3300022739 Ga0228711_1000019 Ga0228711_100001971 343
548 3300022740 Ga0228710_1000022 Ga0228710_100002271 343
549 3300025208 Ga0209436_101291 Ga0209436_1012914 343
550 3300025284 Ga0209130_1000005 Ga0209130_100000518 343
551 3300025292 Ga0209676_1012224 Ga0209676_10122242 343
552 3300025294 Ga0209025_1000295 Ga0209025_100029592 343
553 3300025294 Ga0209025_1018391 Ga0209025_10183911 343
554 3300025295 Ga0209564_1000093 Ga0209564_100009320 343
555 3300025295 Ga0209564_1037450 Ga0209564_10374501 343
556 3300025298 Ga0209050_1011983 Ga0209050_10119832 343
557 3300025299 Ga0209256_1000027 Ga0209256_1000027402 343
558 3300025299 Ga0209256_1002925 Ga0209256_100292510 343
559 3300025302 Ga0207426_1000015 Ga0207426_1000015581 343
560 3300025304 Ga0209257_1001343 Ga0209257_100134316 343
561 3300027111 Ga0209281_1000227 Ga0209281_100022777 343
562 3300027666 Ga0209282_1000042 Ga0209282_100004277 343
563 3300028794 Ga0307515_10001309 Ga0307515_100013093 343
564 3300028794 Ga0307515_10001439 Ga0307515_1000143922 343
565 3300031456 Ga0307513_10002360 Ga0307513_1000236023 343
566 3300031911 Ga0307412_10108702 Ga0307412_101087021 343
567 3300031967 Ga0315914_1000009 Ga0315914_100000950 343
568 3300032005 Ga0307411_10062468 Ga0307411_100624683 343
569 3300033430 Ga0315913_1000015 Ga0315913_100001577 343
570 3300033464 Ga0315915_1000013 Ga0315915_1000013138 343
571 3300037471 Ga0395905_0002869 Ga0395905_0002869_10989_12020 343
572 3300041404 Ga0439436_0052534 Ga0439436_0052534_86_1123 343
573 3300041413 Ga0439465_0014839 Ga0439465_0014839_904_1968 343
574 3300046460 Ga0495638_0006702 Ga0495638_0006702_6797_7828 343
575 3300046660 Ga0495625_0020280 Ga0495625_0020280_2117_3148 343
576 3300048917 Ga0496114_0066788 Ga0496114_0066788_93_1124 343
577 3300053088 Ga0500644_0058527 Ga0500644_0058527_87_1118 343
578 3300053122 Ga0500608_003117 Ga0500608_003117_724_1755 343
579 3300053136 Ga0500559_0132639 Ga0500559_0132639_69_1100 343
580 3300053151 Ga0500604_0050336 Ga0500604_0050336_121_1152 343
581 3300053156 Ga0500622_0002052 Ga0500622_0002052_12255_13286 343
582 iso_pu_bacteria 2510917022 2511134803 343
583 iso_pu_bacteria 2524023209 2524458293 343
584 iso_pu_bacteria 2537561587 2537872757 343
585 iso_pu_bacteria 2554235003 2554246594 343
586 iso_pu_bacteria 2558860242 2559293822 343
587 iso_pu_bacteria 2558860983 2561466829 343
588 iso_pu_bacteria 2582581307 2585273869 343
589 iso_pu_bacteria 2582581308 2585280170 343
590 iso_pu_bacteria 2582581315 2585326049 343
591 iso_pu_bacteria 2582581316 2585330218 343
592 iso_pu_bacteria 2585427527 2585533579 343
593 iso_pu_bacteria 2585427530 2585553168 343
594 iso_pu_bacteria 2585427531 2585560045 343
595 iso_pu_bacteria 2585427608 2585900720 343
596 iso_pu_bacteria 2585427609 2585905775 343
597 iso_pu_bacteria 2585428125 2587979109 343
598 iso_pu_bacteria 2599185210 2599606077 343
599 iso_pu_bacteria 2600255279 2601609205 343
600 iso_pu_bacteria 2600255308 2601745980 343
601 iso_pu_bacteria 2615840626 2616310283 343
602 iso_pu_bacteria 2615840698 2616553336 343
603 iso_pu_bacteria 2617270742 2617380331 343
604 iso_pu_bacteria 2643221568 2643855249 343
605 iso_pu_bacteria 2643221582 2643921189 343
606 iso_pu_bacteria 2643221693 2644519264 343
607 iso_pu_bacteria 2667528174 2671113732 343
608 iso_pu_bacteria 2738541317 2738948317 343
609 iso_pu_bacteria 2775507266 2778179646 343
610 iso_pu_bacteria 2808606387 2808986403 343
611 iso_pu_bacteria 2818991439 2819556533 343
612 iso_pu_bacteria 2818991448 2819608479 343
613 iso_pu_bacteria 2818991453 2819640584 343
614 iso_pu_bacteria 2821123053 2821123567 343
615 iso_pu_bacteria 2838029111 2838029362 343
616 iso_pu_bacteria 2838675328 2838677261 343
617 iso_pu_bacteria 2838714209 2838716149 343
618 iso_pu_bacteria 2838719591 2838720051 343
619 iso_pu_bacteria 2838724970 2838726901 343
620 iso_pu_bacteria 2838736955 2838739399 343
621 iso_pu_bacteria 2841840854 2841843297 343
622 iso_pu_bacteria 2841846520 2841846983 343
623 iso_pu_bacteria 2841859092 2841860488 343
624 iso_pu_bacteria 2842124991 2842126988 343
625 iso_pu_bacteria 2842130223 2842132154 343
626 iso_pu_bacteria 2842140634 2842145982 343
627 iso_pu_bacteria 2842152218 2842152677 343
628 iso_pu_bacteria 2842170452 2842172394 343
629 iso_pu_bacteria 2842175837 2842176296 343
630 iso_pu_bacteria 2842187318 2842189256 343
631 iso_pu_bacteria 2842211629 2842213570 343
632 iso_pu_bacteria 2842224351 2842224812 343
633 iso_pu_bacteria 2842298080 2842299521 343
634 iso_pu_bacteria 2842357229 2842360948 343
635 iso_pu_bacteria 2842475841 2842476208 343
636 iso_pu_bacteria 2842482326 2842487673 343
637 iso_pu_bacteria 2842502639 2842502890 343
638 iso_pu_bacteria 2842509118 2842509134 343
639 iso_pu_bacteria 2842515876 2842517273 343
640 iso_pu_bacteria 2852387548 2852388407 343
641 iso_pu_bacteria 2857531043 2857531131 343
642 iso_pu_bacteria 2899792073 2899792554 343
643 iso_pu_bacteria 2899845264 2899847857 343
644 iso_pu_bacteria 2913308742 2913313341 343
645 iso_pu_bacteria 2919114240 2919116352 343
646 iso_pu_bacteria 2919166419 2919166820 343
647 iso_pu_bacteria 2919408235 2919408729 343
648 iso_pu_bacteria 2926754445 2926757306 343
649 iso_pu_bacteria 2926760298 2926761522 343
650 iso_pu_bacteria 2933006813 2933007322 343
651 iso_pu_bacteria 2933011516 2933015086 343
652 iso_pu_bacteria 2933594066 2933594528 343
653 iso_pu_bacteria 2978969890 2978973236 343
654 iso_pu_bacteria 2979089926 2979093189 343
655 iso_pu_bacteria 2979095461 2979099425 343
656 iso_pu_bacteria 2979100975 2979105158 343
657 iso_pu_bacteria 2984509177 2984512983 343
658 iso_pu_bacteria 2984518228 2984520652 343
659 iso_pu_bacteria 2984537506 2984539945 343
660 iso_pu_bacteria 2984587000 2984591484 343
661 iso_pu_bacteria 2984601300 2984602136 343
662 iso_pu_bacteria 3005416602 3005422879 343
663 iso_pu_bacteria 650716007 650739011 343
664 iso_pu_bacteria 8003570095 8003572645 343
665 iso_pu_bacteria 8005314921 8005321585 343
666 iso_pu_bacteria 8005484373 8005484877 343
667 iso_pu_bacteria 8005645114 8005649571 343
668 iso_pu_bacteria 8005682033 8005685186 343
669 iso_pu_bacteria 8024486573 8024491482 343
670 iso_pu_bacteria 8046767195 8046770773 343
671 iso_pu_bacteria 8054460903 8054461223 343
672 iso_pu_bacteria 8055431914 8055433477 343
673 iso_pu_bacteria 8056875544 8056878974 343
674 iso_pu_bacteria 8057575449 8057577765 343
675 3300003187 JGI25151J46595_10007884 JGI25151J46595_100078844 344
676 3300025258 Ga0209129_1001589 Ga0209129_10015892 344
677 3300025294 Ga0209025_1000037 Ga0209025_1000037361 344
678 3300025294 Ga0209025_1007434 Ga0209025_10074343 344
679 3300025297 Ga0209758_1000810 Ga0209758_100081028 344
680 3300031456 Ga0307513_10060704 Ga0307513_100607044 344
681 3300037471 Ga0395905_0055515 Ga0395905_0055515_2128_3162 344
682 3300038443 Ga0395901_0322300 Ga0395901_0322300_430_1464 344
683 3300048920 Ga0496117_0003238 Ga0496117_0003238_6217_7254 344
684 3300048925 Ga0496122_0000147 Ga0496122_0000147_114453_115490 344
685 3300048926 Ga0496123_0000158 Ga0496123_0000158_98314_99351 344
686 3300048927 Ga0496124_0000551 Ga0496124_0000551_23937_24974 344
687 3300048927 Ga0496124_0037345 Ga0496124_0037345_1301_2353 344
688 3300048928 Ga0496125_0000981 Ga0496125_0000981_27584_28621 344
689 3300048929 Ga0496126_0000195 Ga0496126_0000195_36343_37380 344
690 3300049568 Ga0501031_0003356 Ga0501031_0003356_7125_8162 344
691 3300049569 Ga0501032_0071593 Ga0501032_0071593_28_1065 344
692 3300049572 Ga0501036_0043526 Ga0501036_0043526_146_1183 344
693 3300049573 Ga0501037_0014020 Ga0501037_0014020_2453_3490 344
694 3300049574 Ga0501038_0032328 Ga0501038_0032328_1846_2883 344
695 3300049579 Ga0501043_0023215 Ga0501043_0023215_586_1623 344
696 3300049589 Ga0501073_0082098 Ga0501073_0082098_204_1238 344
697 3300049822 Ga0501035_0013597 Ga0501035_0013597_2817_3854 344
698 3300049823 Ga0501044_0064074 Ga0501044_0064074_466_1503 344
699 3300002739 JGI25158J39367_1000022 JGI25158J39367_100002236 345
700 3300002773 JGI25152J39213_1012708 JGI25152J39213_10127082 345
701 3300002774 JGI25150J39212_1001293 JGI25150J39212_10012935 345
702 3300002987 JGI25159J45721_1000442 JGI25159J45721_100044219 345
703 3300003187 JGI25151J46595_10023480 JGI25151J46595_100234802 345
704 3300003354 JGI25160J50197_1002615 JGI25160J50197_10026156 345
705 3300003374 JGI25161J50226_1000143 JGI25161J50226_100014319 345
706 3300003771 Ga0055526_1002174 Ga0055526_100217410 345
707 3300003790 Ga0055528_1001318 Ga0055528_100131814 345
708 3300003792 Ga0055540_1001590 Ga0055540_10015906 345
709 3300004625 Ga0055543_1000263 Ga0055543_100026319 345
710 3300009545 Ga0105237_10191558 Ga0105237_101915582 345
711 3300009551 Ga0105238_10559869 Ga0105238_105598691 345
712 3300025208 Ga0209436_100051 Ga0209436_10005157 345
713 3300025230 Ga0209563_104002 Ga0209563_1040023 345
714 3300025245 Ga0207425_1007595 Ga0207425_10075953 345
715 3300025258 Ga0209129_1001073 Ga0209129_100107313 345
716 3300025258 Ga0209129_1004629 Ga0209129_10046296 345
717 3300025273 Ga0209673_1002098 Ga0209673_100209814 345
718 3300025284 Ga0209130_1000002 Ga0209130_1000002127 345
719 3300025295 Ga0209564_1000576 Ga0209564_100057622 345
720 3300025297 Ga0209758_1000575 Ga0209758_100057520 345
721 3300025297 Ga0209758_1004393 Ga0209758_100439311 345
722 3300025299 Ga0209256_1005572 Ga0209256_10055727 345
723 3300025299 Ga0209256_1007936 Ga0209256_10079365 345
724 3300025302 Ga0207426_1000013 Ga0207426_1000013127 345
725 3300025302 Ga0207426_1000172 Ga0207426_100017241 345
726 3300025303 Ga0209051_1002059 Ga0209051_100205913 345
727 3300028380 Ga0268265_10079350 Ga0268265_100793503 345
728 3300035089 Ga0373944_0031734 Ga0373944_0031734_215_1252 345
729 3300035695 Ga0373927_0000086 Ga0373927_0000086_51293_52330 345
730 3300037068 Ga0373925_0019234 Ga0373925_0019234_333_1370 345
731 3300046492 Ga0495585_0030438 Ga0495585_0030438_1328_2365 345
732 3300046512 Ga0495610_0018127 Ga0495610_0018127_2088_3125 345
733 3300046522 Ga0495643_0005769 Ga0495643_0005769_4305_5342 345
734 3300046694 Ga0495649_0029566 Ga0495649_0029566_1422_2459 345
735 3300048909 Ga0496106_0000986 Ga0496106_0000986_4741_5778 345
736 3300048919 Ga0496116_0019792 Ga0496116_0019792_3199_4236 345
737 3300048920 Ga0496117_0009766 Ga0496117_0009766_6647_7684 345
738 3300048920 Ga0496117_0123419 Ga0496117_0123419_230_1267 345
739 3300048921 Ga0496118_0007119 Ga0496118_0007119_9593_10630 345
740 3300048921 Ga0496118_0015208 Ga0496118_0015208_3980_5017 345
741 3300048922 Ga0496119_0015572 Ga0496119_0015572_2976_4013 345
742 3300048923 Ga0496120_0004161 Ga0496120_0004161_338_1375 345
743 3300048924 Ga0496121_0000001 Ga0496121_0000001_285235_286272 345
744 3300048924 Ga0496121_0138200 Ga0496121_0138200_186_1238 345
745 3300048925 Ga0496122_0048210 Ga0496122_0048210_2111_3148 345
746 3300048926 Ga0496123_0012983 Ga0496123_0012983_2145_3182 345
747 3300048928 Ga0496125_0000001 Ga0496125_0000001_397261_398298 345
748 3300048928 Ga0496125_0025237 Ga0496125_0025237_4172_5209 345
749 3300048928 Ga0496125_0062884 Ga0496125_0062884_69_1106 345
750 3300048929 Ga0496126_0044771 Ga0496126_0044771_2288_3325 345
751 3300049569 Ga0501032_0079300 Ga0501032_0079300_762_1799 345
752 3300049570 Ga0501033_0000396 Ga0501033_0000396_26664_27704 345
753 3300049579 Ga0501043_0108763 Ga0501043_0108763_468_1505 345
754 3300049580 Ga0501046_0127846 Ga0501046_0127846_218_1255 345
755 3300049581 Ga0501047_0103372 Ga0501047_0103372_900_1937 345
756 3300049744 Ga0501083_0035512 Ga0501083_0035512_2021_3058 345
757 3300049822 Ga0501035_0000647 Ga0501035_0000647_22768_23808 345
758 3300050491 nmdc:mga00v17_22507_c1 nmdc:mga00v17_22507_c1_2405_3442 345
759 3300053134 Ga0500658_0020972 Ga0500658_0020972_121_1158 345
760 3300053139 Ga0500568_0005570 Ga0500568_0005570_4154_5191 345
761 3300053140 Ga0500573_0000643 Ga0500573_0000643_5287_6324 345
762 3300053151 Ga0500604_0014350 Ga0500604_0014350_800_1837 345
763 3300053153 Ga0500616_0002986 Ga0500616_0002986_10284_11336 345
764 3300053156 Ga0500622_0002012 Ga0500622_0002012_9948_10985 345
765 3300002773 JGI25152J39213_1001804 JGI25152J39213_10018045 346
766 3300002773 JGI25152J39213_1001895 JGI25152J39213_10018956 346
767 3300002773 JGI25152J39213_1003592 JGI25152J39213_10035922 346
768 3300002774 JGI25150J39212_1000012 JGI25150J39212_100001219 346
769 3300003187 JGI25151J46595_10000025 JGI25151J46595_1000002559 346
770 3300003187 JGI25151J46595_10006601 JGI25151J46595_100066013 346
771 3300003215 JGI25153J46596_10002932 JGI25153J46596_100029323 346
772 3300003215 JGI25153J46596_10003783 JGI25153J46596_100037832 346
773 3300003354 JGI25160J50197_1007291 JGI25160J50197_10072911 346
774 3300003374 JGI25161J50226_1002026 JGI25161J50226_10020263 346
775 3300003771 Ga0055526_1002490 Ga0055526_100249013 346
776 3300003771 Ga0055526_1005231 Ga0055526_10052311 346
777 3300003771 Ga0055526_1012602 Ga0055526_10126025 346
778 3300003771 Ga0055526_1016841 Ga0055526_10168413 346
779 3300003775 Ga0055524_1001348 Ga0055524_10013486 346
780 3300003775 Ga0055524_1010264 Ga0055524_10102643 346
781 3300003790 Ga0055528_1000604 Ga0055528_100060419 346
782 3300003790 Ga0055528_1003411 Ga0055528_10034119 346
783 3300003790 Ga0055528_1021557 Ga0055528_10215572 346
784 3300003792 Ga0055540_1000249 Ga0055540_10002491 346
785 3300003792 Ga0055540_1034447 Ga0055540_10344471 346
786 3300004625 Ga0055543_1001083 Ga0055543_10010836 346
787 3300005331 Ga0070670_100000160 Ga0070670_1000001606 346
788 3300005347 Ga0070668_100055422 Ga0070668_1000554222 346
789 3300005355 Ga0070671_100176872 Ga0070671_1001768721 346
790 3300006038 Ga0075365_10001583 Ga0075365_1000158310 346
791 3300006042 Ga0075368_10093649 Ga0075368_100936491 346
792 3300006178 Ga0075367_10002208 Ga0075367_100022086 346
793 3300006178 Ga0075367_10029920 Ga0075367_100299203 346
794 3300006186 Ga0075369_10014244 Ga0075369_100142442 346
795 3300006186 Ga0075369_10016807 Ga0075369_100168072 346
796 3300006353 Ga0075370_10177853 Ga0075370_101778531 346
797 3300009011 Ga0105251_10014154 Ga0105251_100141543 346
798 3300009092 Ga0105250_10038351 Ga0105250_100383512 346
799 3300009177 Ga0105248_10432169 Ga0105248_104321692 346
800 3300009765 Ga0123341_1000040 Ga0123341_100004033 346
801 3300009766 Ga0123342_1021800 Ga0123342_10218003 346
802 3300009766 Ga0123342_1041270 Ga0123342_10412701 346
803 3300013104 Ga0157370_10135006 Ga0157370_101350062 346
804 3300025245 Ga0207425_1000012 Ga0207425_1000012222 346
805 3300025258 Ga0209129_1000081 Ga0209129_1000081139 346
806 3300025258 Ga0209129_1000105 Ga0209129_1000105176 346
807 3300025258 Ga0209129_1004594 Ga0209129_10045944 346
808 3300025258 Ga0209129_1004809 Ga0209129_10048096 346
809 3300025273 Ga0209673_1000015 Ga0209673_1000015431 346
810 3300025273 Ga0209673_1000709 Ga0209673_10007093 346
811 3300025273 Ga0209673_1003866 Ga0209673_100386610 346
812 3300025273 Ga0209673_1004485 Ga0209673_10044855 346
813 3300025273 Ga0209673_1005715 Ga0209673_10057156 346
814 3300025273 Ga0209673_1005942 Ga0209673_10059422 346
815 3300025273 Ga0209673_1006527 Ga0209673_10065275 346
816 3300025284 Ga0209130_1024217 Ga0209130_10242171 346
817 3300025284 Ga0209130_1025335 Ga0209130_10253351 346
818 3300025294 Ga0209025_1000024 Ga0209025_1000024222 346
819 3300025294 Ga0209025_1001006 Ga0209025_100100611 346
820 3300025294 Ga0209025_1004420 Ga0209025_10044204 346
821 3300025294 Ga0209025_1010884 Ga0209025_10108844 346
822 3300025294 Ga0209025_1015374 Ga0209025_10153744 346
823 3300025294 Ga0209025_1019905 Ga0209025_10199054 346
824 3300025295 Ga0209564_1000744 Ga0209564_10007441 346
825 3300025295 Ga0209564_1002937 Ga0209564_100293711 346
826 3300025295 Ga0209564_1019811 Ga0209564_10198112 346
827 3300025297 Ga0209758_1000046 Ga0209758_1000046320 346
828 3300025297 Ga0209758_1006975 Ga0209758_10069759 346
829 3300025297 Ga0209758_1019712 Ga0209758_10197124 346
830 3300025297 Ga0209758_1020520 Ga0209758_10205202 346
831 3300025298 Ga0209050_1010965 Ga0209050_10109654 346
832 3300025299 Ga0209256_1000646 Ga0209256_100064628 346
833 3300025299 Ga0209256_1005514 Ga0209256_10055147 346
834 3300025299 Ga0209256_1009080 Ga0209256_10090805 346
835 3300025299 Ga0209256_1012914 Ga0209256_10129143 346
836 3300025302 Ga0207426_1000063 Ga0207426_1000063295 346
837 3300025302 Ga0207426_1001042 Ga0207426_100104219 346
838 3300025303 Ga0209051_1001495 Ga0209051_10014956 346
839 3300025303 Ga0209051_1003125 Ga0209051_10031259 346
840 3300025303 Ga0209051_1022865 Ga0209051_10228652 346
841 3300025304 Ga0209257_1003510 Ga0209257_100351015 346
842 3300025925 Ga0207650_10000391 Ga0207650_1000039119 346
843 3300025931 Ga0207644_10020377 Ga0207644_100203772 346
844 3300025972 Ga0207668_10038907 Ga0207668_100389072 346
845 3300026067 Ga0207678_10193543 Ga0207678_101935432 346
846 3300031456 Ga0307513_10010314 Ga0307513_100103146 346
847 3300031548 Ga0307408_100173037 Ga0307408_1001730372 346
848 3300031901 Ga0307406_10003731 Ga0307406_100037314 346
849 3300031911 Ga0307412_10002197 Ga0307412_100021973 346
850 3300041413 Ga0439465_0012487 Ga0439465_0012487_666_1706 346
851 3300041441 Ga0451787_500296 Ga0451787_500296_65_1105 346
852 3300041491 Ga0451833_0246734 Ga0451833_0246734_1858_2898 346
853 3300041496 Ga0451839_0113154 Ga0451839_0113154_245_1285 346
854 3300041503 Ga0451847_0562432 Ga0451847_0562432_709_1749 346
855 3300041507 Ga0451851_0911130 Ga0451851_0911130_168_1208 346
856 3300041512 Ga0451853_1363602 Ga0451853_1363602_347_1387 346
857 3300044735 Ga0466968_0113513 Ga0466968_0113513_49_1089 346
858 3300046460 Ga0495638_0000788 Ga0495638_0000788_12499_13539 346
859 3300046474 Ga0495605_0008232 Ga0495605_0008232_3183_4223 346
860 3300046506 Ga0495583_0006920 Ga0495583_0006920_4369_5409 346
861 3300046507 Ga0495606_0020385 Ga0495606_0020385_1824_2864 346
862 3300046507 Ga0495606_0095392 Ga0495606_0095392_380_1420 346
863 3300046512 Ga0495610_0100972 Ga0495610_0100972_241_1281 346
864 3300046515 Ga0495620_0013384 Ga0495620_0013384_59_1099 346
865 3300046515 Ga0495620_0024949 Ga0495620_0024949_733_1773 346
866 3300046518 Ga0495631_0004010 Ga0495631_0004010_173_1213 346
867 3300046522 Ga0495643_0031800 Ga0495643_0031800_1731_2771 346
868 3300046660 Ga0495625_0005915 Ga0495625_0005915_1686_2726 346
869 3300046665 Ga0495661_0023611 Ga0495661_0023611_321_1361 346
870 3300047470 Ga0495681_0008675 Ga0495681_0008675_3203_4243 346
871 3300048091 Ga0495626_0066626 Ga0495626_0066626_255_1295 346
872 3300048920 Ga0496117_0069956 Ga0496117_0069956_1172_2212 346
873 3300048921 Ga0496118_0041154 Ga0496118_0041154_1010_2050 346
874 3300048925 Ga0496122_0004207 Ga0496122_0004207_3151_4191 346
875 3300048926 Ga0496123_0028156 Ga0496123_0028156_2532_3572 346
876 3300048927 Ga0496124_0011589 Ga0496124_0011589_2528_3568 346
877 3300050491 nmdc:mga00v17_39_c1 nmdc:mga00v17_39_c1_69426_70487 346
878 3300053122 Ga0500608_036282 Ga0500608_036282_905_1945 346
879 3300053125 Ga0500618_000359 Ga0500618_000359_17953_18993 346
880 3300053134 Ga0500658_0005431 Ga0500658_0005431_2636_3676 346
881 3300053139 Ga0500568_0001437 Ga0500568_0001437_9750_10790 346
882 3300053153 Ga0500616_0003098 Ga0500616_0003098_4774_5814 346
883 3300001979 JGI24740J21852_10000016 JGI24740J21852_100000169 347
884 3300002704 JGI25155J39150_1000157 JGI25155J39150_100015718 347
885 3300002705 JGI25156J39149_1000029 JGI25156J39149_100002918 347
886 3300002737 JGI25162J39368_1000169 JGI25162J39368_10001696 347
887 3300002737 JGI25162J39368_1000508 JGI25162J39368_100050822 347
888 3300002738 JGI25154J39366_1000286 JGI25154J39366_100028618 347
889 3300002741 JGI25157J39369_1000247 JGI25157J39369_100024718 347
890 3300002987 JGI25159J45721_1001365 JGI25159J45721_10013656 347
891 3300003187 JGI25151J46595_10021187 JGI25151J46595_100211871 347
892 3300003214 JGI25165J46597_1000491 JGI25165J46597_100049121 347
893 3300003214 JGI25165J46597_1002312 JGI25165J46597_10023124 347
894 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004146 347
895 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000246 347
896 3300003856 Ga0058692_1008970 Ga0058692_10089702 347
897 3300004625 Ga0055543_1000008 Ga0055543_100000870 347
898 3300005262 Ga0065165_1000031 Ga0065165_100003159 347
899 3300005347 Ga0070668_100070330 Ga0070668_1000703303 347
900 3300005347 Ga0070668_100142784 Ga0070668_1001427842 347
901 3300005353 Ga0070669_100077662 Ga0070669_1000776622 347
902 3300005548 Ga0070665_100007221 Ga0070665_10000722114 347
903 3300005548 Ga0070665_100081202 Ga0070665_1000812022 347
904 3300005563 Ga0068855_100164837 Ga0068855_1001648372 347
905 3300005614 Ga0068856_100029583 Ga0068856_1000295836 347
906 3300005834 Ga0068851_10009597 Ga0068851_100095974 347
907 3300006042 Ga0075368_10000324 Ga0075368_100003247 347
908 3300006051 Ga0075364_10000235 Ga0075364_100002354 347
909 3300006353 Ga0075370_10009566 Ga0075370_100095666 347
910 3300006946 Ga0079104_1000452 Ga0079104_100045232 347
911 3300006948 Ga0099826_10010557 Ga0099826_100105573 347
912 3300006948 Ga0099826_10011936 Ga0099826_100119361 347
913 3300009092 Ga0105250_10052416 Ga0105250_100524162 347
914 3300009093 Ga0105240_10000460 Ga0105240_1000046019 347
915 3300009148 Ga0105243_10201244 Ga0105243_102012442 347
916 3300009545 Ga0105237_10000814 Ga0105237_1000081419 347
917 3300010375 Ga0105239_10000961 Ga0105239_1000096119 347
918 3300011119 Ga0105246_10105476 Ga0105246_101054762 347
919 3300013100 Ga0157373_10001925 Ga0157373_1000192511 347
920 3300013100 Ga0157373_10005759 Ga0157373_100057596 347
921 3300013102 Ga0157371_10000004 Ga0157371_10000004474 347
922 3300013102 Ga0157371_10006875 Ga0157371_100068755 347
923 3300013104 Ga0157370_10000952 Ga0157370_1000095225 347
924 3300013105 Ga0157369_10093341 Ga0157369_100933412 347
925 3300013105 Ga0157369_10103156 Ga0157369_101031563 347
926 3300013307 Ga0157372_10026043 Ga0157372_100260436 347
927 3300015262 Ga0182007_10000689 Ga0182007_1000068910 347
928 3300015265 Ga0182005_1009794 Ga0182005_10097943 347
929 3300025206 Ga0209435_100011 Ga0209435_100011392 347
930 3300025233 Ga0209437_100056 Ga0209437_10005644 347
931 3300025233 Ga0209437_100196 Ga0209437_10019647 347
932 3300025233 Ga0209437_103752 Ga0209437_1037522 347
933 3300025246 Ga0209646_1000024 Ga0209646_100002418 347
934 3300025250 Ga0209026_1000030 Ga0209026_100003018 347
935 3300025253 Ga0209677_100765 Ga0209677_10076513 347
936 3300025254 Ga0209148_1008689 Ga0209148_10086892 347
937 3300025256 Ga0209759_1000011 Ga0209759_1000011392 347
938 3300025261 Ga0209233_1000037 Ga0209233_1000037515 347
939 3300025261 Ga0209233_1000071 Ga0209233_100007144 347
940 3300025261 Ga0209233_1000243 Ga0209233_100024376 347
941 3300025284 Ga0209130_1000088 Ga0209130_1000088124 347
942 3300025294 Ga0209025_1000441 Ga0209025_10004416 347
943 3300025302 Ga0207426_1000012 Ga0207426_1000012179 347
944 3300025913 Ga0207695_10000036 Ga0207695_1000003619 347
945 3300025914 Ga0207671_10000517 Ga0207671_1000051724 347
946 3300025949 Ga0207667_10175915 Ga0207667_101759152 347
947 3300025972 Ga0207668_10065437 Ga0207668_100654373 347
948 3300026078 Ga0207702_10020627 Ga0207702_100206276 347
949 3300027111 Ga0209281_1000488 Ga0209281_100048829 347
950 3300027312 Ga0209371_1000009 Ga0209371_1000009476 347
951 3300027312 Ga0209371_1000315 Ga0209371_100031518 347
952 3300027312 Ga0209371_1002376 Ga0209371_100237610 347
953 3300027666 Ga0209282_1000987 Ga0209282_10009876 347
954 3300027666 Ga0209282_1102834 Ga0209282_11028342 347
955 3300027866 Ga0209813_10000805 Ga0209813_100008052 347
956 3300028379 Ga0268266_10007658 Ga0268266_100076582 347
957 3300030500 Ga0268256_1000010 Ga0268256_1000010475 347
958 3300030500 Ga0268256_1001455 Ga0268256_10014552 347
959 3300046454 Ga0495592_0058619 Ga0495592_0058619_976_2019 347
960 3300046476 Ga0495662_0015063 Ga0495662_0015063_1963_3006 347
961 3300046507 Ga0495606_0004810 Ga0495606_0004810_10711_11754 347
962 3300046524 Ga0495648_0122729 Ga0495648_0122729_236_1279 347
963 3300046529 Ga0495652_0064673 Ga0495652_0064673_204_1247 347
964 3300046530 Ga0495654_0000321 Ga0495654_0000321_22936_23979 347
965 3300046674 Ga0495588_0010206 Ga0495588_0010206_1907_2950 347
966 3300046675 Ga0495657_0014195 Ga0495657_0014195_994_2037 347
967 3300046683 Ga0495658_0124282 Ga0495658_0124282_320_1363 347
968 3300047317 Ga0495604_0076920 Ga0495604_0076920_1061_2104 347
969 3300047472 Ga0495686_0000458 Ga0495686_0000458_9499_10542 347
970 3300048903 Ga0496100_0076569 Ga0496100_0076569_746_1804 347
971 3300048904 Ga0496101_0280911 Ga0496101_0280911_120_1178 347
972 3300048905 Ga0496102_0070746 Ga0496102_0070746_133_1191 347
973 3300048906 Ga0496103_0057055 Ga0496103_0057055_999_2057 347
974 3300048907 Ga0496104_0130217 Ga0496104_0130217_646_1689 347
975 3300048916 Ga0496113_0029669 Ga0496113_0029669_1907_2950 347
976 3300048919 Ga0496116_0000100 Ga0496116_0000100_139753_140799 347
977 3300048919 Ga0496116_0009339 Ga0496116_0009339_5730_6773 347
978 3300048919 Ga0496116_0022875 Ga0496116_0022875_2047_3105 347
979 3300048920 Ga0496117_0000002 Ga0496117_0000002_2007261_2008304 347
980 3300048920 Ga0496117_0001791 Ga0496117_0001791_8490_9548 347
981 3300048920 Ga0496117_0024238 Ga0496117_0024238_1760_2803 347
982 3300048920 Ga0496117_0076507 Ga0496117_0076507_872_1915 347
983 3300048921 Ga0496118_0000233 Ga0496118_0000233_1800_2843 347
984 3300048921 Ga0496118_0006723 Ga0496118_0006723_2187_3245 347
985 3300048921 Ga0496118_0089734 Ga0496118_0089734_624_1667 347
986 3300048921 Ga0496118_0092587 Ga0496118_0092587_193_1239 347
987 3300048922 Ga0496119_0043038 Ga0496119_0043038_1430_2488 347
988 3300048923 Ga0496120_0000021 Ga0496120_0000021_58271_59314 347
989 3300048923 Ga0496120_0028402 Ga0496120_0028402_784_1827 347
990 3300048924 Ga0496121_0001709 Ga0496121_0001709_11574_12632 347
991 3300048924 Ga0496121_0002141 Ga0496121_0002141_2022_3086 347
992 3300048924 Ga0496121_0069922 Ga0496121_0069922_1381_2424 347
993 3300048924 Ga0496121_0072966 Ga0496121_0072966_130_1173 347
994 3300048925 Ga0496122_0000001 Ga0496122_0000001_1378051_1379094 347
995 3300048925 Ga0496122_0002139 Ga0496122_0002139_7225_8283 347
996 3300048925 Ga0496122_0004851 Ga0496122_0004851_4227_5270 347
997 3300048926 Ga0496123_0000001 Ga0496123_0000001_1381782_1382825 347
998 3300048926 Ga0496123_0047713 Ga0496123_0047713_470_1516 347
999 3300048926 Ga0496123_0048858 Ga0496123_0048858_772_1830 347
1000 3300048927 Ga0496124_0000063 Ga0496124_0000063_160777_161820 347
1001 3300048927 Ga0496124_0000801 Ga0496124_0000801_35329_36372 347
1002 3300048927 Ga0496124_0086822 Ga0496124_0086822_1012_2070 347
1003 3300048927 Ga0496124_0151674 Ga0496124_0151674_719_1762 347
1004 3300048927 Ga0496124_0164085 Ga0496124_0164085_20_1066 347
1005 3300048928 Ga0496125_0013463 Ga0496125_0013463_854_1897 347
1006 3300048928 Ga0496125_0046632 Ga0496125_0046632_2116_3174 347
1007 3300048928 Ga0496125_0075468 Ga0496125_0075468_82_1125 347
1008 3300048929 Ga0496126_0000094 Ga0496126_0000094_154861_155907 347
1009 3300049572 Ga0501036_0011900 Ga0501036_0011900_4239_5282 347
1010 3300049573 Ga0501037_0029252 Ga0501037_0029252_917_1960 347
1011 3300049574 Ga0501038_0266984 Ga0501038_0266984_213_1256 347
1012 3300049581 Ga0501047_0062982 Ga0501047_0062982_221_1264 347
1013 3300049742 Ga0501080_0009732 Ga0501080_0009732_4117_5160 347
1014 3300049822 Ga0501035_0032335 Ga0501035_0032335_1075_2118 347
1015 3300049823 Ga0501044_0015317 Ga0501044_0015317_4144_5187 347
1016 3300050491 nmdc:mga00v17_453_c1 nmdc:mga00v17_453_c1_1637_2680 347
1017 3300050492 nmdc:mga0yw44_1246_c1 nmdc:mga0yw44_1246_c1_2827_3870 347
1018 3300050494 nmdc:mga06z11_64702_c1 nmdc:mga06z11_64702_c1_650_1693 347
1019 3300050496 nmdc:mga07m45_75747_c1 nmdc:mga07m45_75747_c1_226_1269 347
1020 3300050516 nmdc:mga0sz30_12629_c1 nmdc:mga0sz30_12629_c1_243_1286 347
1021 3300053107 Ga0500560_003995 Ga0500560_003995_1868_2911 347
1022 3300053107 Ga0500560_013549 Ga0500560_013549_889_1932 347
1023 3300053111 Ga0500572_002101 Ga0500572_002101_1346_2389 347
1024 3300053125 Ga0500618_021046 Ga0500618_021046_489_1547 347
1025 3300053137 Ga0500561_0000060 Ga0500561_0000060_8183_9226 347
1026 3300053161 Ga0500634_0000466 Ga0500634_0000466_2822_3865 347
1027 3300053177 Ga0500636_0000006 Ga0500636_0000006_106507_107550 347
1028 3300059643 Ga0587072_002354 Ga0587072_002354_1446_2489 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01706

FliG_C

FliG C-terminal domain

228

336

0.97

PF14842

FliG_N

FliG N-terminal domain

16

120

0.93

PF14841

FliG_M

FliG middle domain

128

203

0.91

Feature Viewer

pLDDT pTM Quality
74.03 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map