F488527

General Info

Members Datasets Scaffolds Average Seq Length
1026 277 1024 165

Family's Representative Sequence

Representative Sequence 3300049761|Ga0501264_031134|Ga0501264_031134_94_594
Length 160
Sequence MEKSASKEITPTTSYALDDKDLAILRLLQQNAKITVRDIATQIHLSPTPVHERIKRMEEGGIIKQYVALVDHAKVKKGLMVICHNKKSGAKFIKTIHELHEVIECYNISGEFDFMLKVVAENMDAYYDFHVNKLSQIENMGHLQSIFVMGIIKQTHQLVN

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
190 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
240 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
241 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
247 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
248 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
254 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
255 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
260 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
261 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
262 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
263 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 1.07
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10076759 3300001979 Bacteria 883
2 JGI25406J46586_10028193 3300003203 Bacteria 2142
3 rootH2_10000233 3300003320 Bacteria 5177
4 rootH2_10001996 3300003320 Bacteria 3967
5 rootH2_10253139 3300003320 Bacteria 2710
6 rootL2_10020360 3300003322 Bacteria 5929
7 rootL2_10238808 3300003322 Bacteria 1191
8 rootH1_10033722 3300003323 Bacteria 6035
9 rootH1_10086161 3300003323 Bacteria 5195
10 rootH1_10311697 3300003323 Bacteria 1715
11 JGI25160J50197_1013452 3300003354 Bacteria 2789
12 Ga0055530_10039971 3300003791 Bacteria 1155
13 Ga0065714_10069405 3300005288 Bacteria 4214
14 Ga0065712_10008709 3300005290 Bacteria 3149
15 Ga0065712_10184266 3300005290 Bacteria 1177
16 Ga0065712_10201724 3300005290 Bacteria 1106
17 Ga0065712_10376345 3300005290 Bacteria 757
18 Ga0065712_10398852 3300005290 Bacteria 699
19 Ga0065715_10019757 3300005293 Bacteria 2990
20 Ga0070658_10008410 3300005327 Bacteria 8297
21 Ga0070658_10038586 3300005327 Bacteria 3851
22 Ga0070658_10057146 3300005327 Bacteria 3173
23 Ga0070658_10102788 3300005327 Bacteria 2363
24 Ga0070658_10111150 3300005327 Bacteria 2270
25 Ga0070658_10163581 3300005327 Bacteria 1868
26 Ga0070658_10227408 3300005327 Bacteria 1579
27 Ga0070658_10832248 3300005327 Bacteria 802
28 Ga0070658_10917207 3300005327 Bacteria 762
29 Ga0070676_10478965 3300005328 Bacteria 880
30 Ga0070676_10523398 3300005328 Bacteria 845
31 Ga0070683_100002827 3300005329 Bacteria 13893
32 Ga0070683_100050002 3300005329 Bacteria 3868
33 Ga0070683_100056229 3300005329 Bacteria 3653
34 Ga0070683_100497853 3300005329 Unclassified 1164
35 Ga0070683_101448344 3300005329 Bacteria 660
36 Ga0070683_101466021 3300005329 Bacteria 656
37 Ga0070690_100054427 3300005330 Bacteria 2562
38 Ga0070690_100120763 3300005330 Bacteria 1758
39 Ga0070690_100469574 3300005330 Bacteria 936
40 Ga0070670_100079879 3300005331 Bacteria 2811
41 Ga0070670_101379617 3300005331 Bacteria 646
42 Ga0070670_101612755 3300005331 Bacteria 596
43 Ga0068869_100005580 3300005334 Bacteria 7919
44 Ga0068869_100035978 3300005334 Bacteria 3514
45 Ga0068869_100047820 3300005334 Bacteria 3090
46 Ga0068869_100189390 3300005334 Unclassified 1617
47 Ga0068869_100277490 3300005334 Bacteria 1347
48 Ga0068869_101164923 3300005334 Bacteria 676
49 Ga0070666_10000047 3300005335 Bacteria 106512
50 Ga0070666_10084814 3300005335 Bacteria 2169
51 Ga0070680_100024590 3300005336 Bacteria 4813
52 Ga0070680_100054583 3300005336 Bacteria 3263
53 Ga0070680_100063450 3300005336 Bacteria 3026
54 Ga0070680_100738622 3300005336 Unclassified 847
55 Ga0070682_100005602 3300005337 Bacteria 7000
56 Ga0070682_100021930 3300005337 Bacteria 3776
57 Ga0070682_100088031 3300005337 Bacteria 2026
58 Ga0070682_100127058 3300005337 Bacteria 1720
59 Ga0070682_100316030 3300005337 Bacteria 1151
60 Ga0070682_100833278 3300005337 Bacteria 752
61 Ga0068868_100015864 3300005338 Bacteria 5583
62 Ga0068868_100030015 3300005338 Bacteria 4168
63 Ga0068868_100035522 3300005338 Bacteria 3853
64 Ga0068868_100096960 3300005338 Bacteria 2382
65 Ga0068868_100134593 3300005338 Bacteria 2025
66 Ga0068868_100252365 3300005338 Unclassified 1485
67 Ga0068868_100360107 3300005338 Bacteria 1248
68 Ga0068868_100451350 3300005338 Bacteria 1118
69 Ga0068868_101289701 3300005338 Bacteria 678
70 Ga0068868_101596738 3300005338 Bacteria 613
71 Ga0068868_101611164 3300005338 Bacteria 610
72 Ga0070660_100005791 3300005339 Bacteria 8559
73 Ga0070660_100021497 3300005339 Bacteria 4760
74 Ga0070660_100026268 3300005339 Bacteria 4333
75 Ga0070660_100100878 3300005339 Bacteria 2287
76 Ga0070660_100111598 3300005339 Bacteria 2176
77 Ga0070660_100179876 3300005339 Bacteria 1711
78 Ga0070660_100226596 3300005339 Bacteria 1520
79 Ga0070660_100543398 3300005339 Bacteria 969
80 Ga0070689_100005527 3300005340 Bacteria 8643
81 Ga0070689_100010544 3300005340 Bacteria 6586
82 Ga0070689_100102444 3300005340 Bacteria 2268
83 Ga0070689_100733975 3300005340 Bacteria 864
84 Ga0070687_100269505 3300005343 Bacteria 1066
85 Ga0070661_100002424 3300005344 Bacteria 12806
86 Ga0070661_100002937 3300005344 Bacteria 11763
87 Ga0070661_100063582 3300005344 Unclassified 2711
88 Ga0070661_100332248 3300005344 Bacteria 1189
89 Ga0070692_10222052 3300005345 Bacteria 1117
90 Ga0070692_10747800 3300005345 Unclassified 663
91 Ga0070668_100417500 3300005347 Unclassified 1148
92 Ga0070668_100812746 3300005347 Unclassified 831
93 Ga0070668_101094141 3300005347 Bacteria 719
94 Ga0070668_101515995 3300005347 Bacteria 613
95 Ga0070669_100141429 3300005353 Unclassified 1856
96 Ga0070669_100310439 3300005353 Bacteria 1271
97 Ga0070669_100374611 3300005353 Unclassified 1160
98 Ga0070669_100401768 3300005353 Bacteria 1121
99 Ga0070669_100411179 3300005353 Bacteria 1109
100 Ga0070669_100787515 3300005353 Bacteria 808
101 Ga0070669_101136607 3300005353 Unclassified 673
102 Ga0070675_100047513 3300005354 Bacteria 3517
103 Ga0070675_100072740 3300005354 Bacteria 2854
104 Ga0070675_100410283 3300005354 Bacteria 1210
105 Ga0070675_100973225 3300005354 Bacteria 779
106 Ga0070671_100049892 3300005355 Bacteria 3482
107 Ga0070671_100099211 3300005355 Bacteria 2443
108 Ga0070671_100118240 3300005355 Bacteria 2229
109 Ga0070671_100598741 3300005355 Bacteria 952
110 Ga0070674_100670795 3300005356 Unclassified 883
111 Ga0070674_101475706 3300005356 Unclassified 611
112 Ga0070673_100088605 3300005364 Bacteria 2524
113 Ga0070673_100145326 3300005364 Bacteria 2004
114 Ga0070673_100152174 3300005364 Bacteria 1960
115 Ga0070673_100824171 3300005364 Bacteria 858
116 Ga0070673_100842201 3300005364 Bacteria 848
117 Ga0070688_100045499 3300005365 Bacteria 2712
118 Ga0070688_100074812 3300005365 Bacteria 2176
119 Ga0070688_100134011 3300005365 Bacteria 1675
120 Ga0070688_100246440 3300005365 Bacteria 1270
121 Ga0070688_100807408 3300005365 Bacteria 734
122 Ga0070659_100003144 3300005366 Bacteria 11757
123 Ga0070659_100004119 3300005366 Bacteria 10363
124 Ga0070659_100055702 3300005366 Bacteria 3117
125 Ga0070659_100056671 3300005366 Unclassified 3090
126 Ga0070659_101118194 3300005366 Unclassified 695
127 Ga0070667_100006277 3300005367 Bacteria 9880
128 Ga0070667_100007556 3300005367 Bacteria 9016
129 Ga0070667_100088791 3300005367 Bacteria 2655
130 Ga0070667_100388280 3300005367 Unclassified 1269
131 Ga0070667_100447456 3300005367 Unclassified 1180
132 Ga0070667_100461318 3300005367 Bacteria 1162
133 Ga0070701_10375456 3300005438 Bacteria 895
134 Ga0070700_100073387 3300005441 Bacteria 2190
135 Ga0070663_100019256 3300005455 Bacteria 4494
136 Ga0070663_100138473 3300005455 Bacteria 1856
137 Ga0070663_100230799 3300005455 Bacteria 1457
138 Ga0070663_100639817 3300005455 Bacteria 898
139 Ga0070678_100093855 3300005456 Bacteria 2308
140 Ga0070678_100622444 3300005456 Bacteria 966
141 Ga0070662_100011083 3300005457 Bacteria 5936
142 Ga0070662_100107471 3300005457 Bacteria 2121
143 Ga0070662_100111412 3300005457 Unclassified 2085
144 Ga0070662_100296998 3300005457 Bacteria 1311
145 Ga0070681_10015062 3300005458 Bacteria 7692
146 Ga0070681_10085841 3300005458 Bacteria 3100
147 Ga0070681_10086662 3300005458 Bacteria 3085
148 Ga0070681_10198425 3300005458 Bacteria 1925
149 Ga0070681_10754386 3300005458 Unclassified 890
150 Ga0070681_10884389 3300005458 Bacteria 811
151 Ga0068867_100028127 3300005459 Bacteria 4046
152 Ga0068867_100111538 3300005459 Bacteria 2102
153 Ga0068867_100155742 3300005459 Bacteria 1798
154 Ga0068867_100256332 3300005459 Bacteria 1424
155 Ga0068867_100285601 3300005459 Bacteria 1355
156 Ga0068867_100410197 3300005459 Bacteria 1145
157 Ga0068867_100520971 3300005459 Bacteria 1025
158 Ga0068867_100913771 3300005459 Bacteria 791
159 Ga0068867_101005446 3300005459 Unclassified 756
160 Ga0068867_101398567 3300005459 Bacteria 649
161 Ga0070685_10015533 3300005466 Bacteria 4044
162 Ga0070685_10123390 3300005466 Bacteria 1611
163 Ga0070685_10309631 3300005466 Bacteria 1067
164 Ga0070685_10879468 3300005466 Bacteria 665
165 Ga0070679_100010397 3300005530 Bacteria 8828
166 Ga0070679_100024694 3300005530 Bacteria 5889
167 Ga0070679_100029341 3300005530 Bacteria 5428
168 Ga0070679_100061491 3300005530 Bacteria 3743
169 Ga0070679_100075697 3300005530 Bacteria 3355
170 Ga0070679_100188282 3300005530 Unclassified 2033
171 Ga0070679_100339966 3300005530 Unclassified 1449
172 Ga0070679_100670601 3300005530 Unclassified 980
173 Ga0070684_100006880 3300005535 Bacteria 8830
174 Ga0070684_100008725 3300005535 Bacteria 7947
175 Ga0070684_100008853 3300005535 Bacteria 7893
176 Ga0070684_100113504 3300005535 Bacteria 2432
177 Ga0070684_100187969 3300005535 Bacteria 1879
178 Ga0070684_100302816 3300005535 Bacteria 1467
179 Ga0070684_100712138 3300005535 Bacteria 936
180 Ga0070684_100889795 3300005535 Unclassified 834
181 Ga0070684_100947970 3300005535 Bacteria 807
182 Ga0070684_101380187 3300005535 Bacteria 663
183 Ga0068853_100003531 3300005539 Bacteria 11960
184 Ga0068853_100020501 3300005539 Bacteria 5497
185 Ga0068853_100056076 3300005539 Bacteria 3397
186 Ga0068853_100180016 3300005539 Bacteria 1917
187 Ga0068853_100225393 3300005539 Bacteria 1713
188 Ga0068853_100243511 3300005539 Bacteria 1649
189 Ga0068853_100295835 3300005539 Bacteria 1495
190 Ga0068853_100414723 3300005539 Bacteria 1262
191 Ga0068853_100436667 3300005539 Bacteria 1230
192 Ga0068853_100444970 3300005539 Bacteria 1218
193 Ga0068853_100736172 3300005539 Bacteria 942
194 Ga0068853_100738735 3300005539 Bacteria 940
195 Ga0068853_101417253 3300005539 Bacteria 672
196 Ga0068853_101469401 3300005539 Bacteria 660
197 Ga0070672_100021689 3300005543 Bacteria 4703
198 Ga0070672_100022194 3300005543 Bacteria 4657
199 Ga0070672_100184875 3300005543 Bacteria 1738
200 Ga0070672_100296826 3300005543 Unclassified 1369
201 Ga0070672_100393083 3300005543 Bacteria 1187
202 Ga0070686_100308932 3300005544 Bacteria 1175
203 Ga0070686_100392090 3300005544 Bacteria 1054
204 Ga0070693_100103485 3300005547 Bacteria 1739
205 Ga0070693_100200372 3300005547 Bacteria 1296
206 Ga0070693_100557317 3300005547 Unclassified 821
207 Ga0070665_100837076 3300005548 Bacteria 933
208 Ga0070665_101800198 3300005548 Bacteria 619
209 Ga0070665_101990556 3300005548 Unclassified 586
210 Ga0070704_100113437 3300005549 Bacteria 2067
211 Ga0068855_100016809 3300005563 Bacteria 8797
212 Ga0068855_100050589 3300005563 Bacteria 4896
213 Ga0068855_100062918 3300005563 Bacteria 4331
214 Ga0068855_100197993 3300005563 Bacteria 2263
215 Ga0068855_100221817 3300005563 Bacteria 2119
216 Ga0068855_100434277 3300005563 Bacteria 1435
217 Ga0068855_100717282 3300005563 Unclassified 1069
218 Ga0070664_100003096 3300005564 Bacteria 13451
219 Ga0070664_100014083 3300005564 Bacteria 6523
220 Ga0070664_100057717 3300005564 Bacteria 3300
221 Ga0070664_100095395 3300005564 Bacteria 2580
222 Ga0070664_100158808 3300005564 Bacteria 1999
223 Ga0070664_100753294 3300005564 Unclassified 909
224 Ga0070664_100848930 3300005564 Bacteria 855
225 Ga0070664_100849550 3300005564 Bacteria 855
226 Ga0068857_100030628 3300005577 Unclassified 4752
227 Ga0068857_100242051 3300005577 Bacteria 1652
228 Ga0068857_100276281 3300005577 Bacteria 1544
229 Ga0068857_100303444 3300005577 Bacteria 1472
230 Ga0068857_100381332 3300005577 Bacteria 1309
231 Ga0068857_100883939 3300005577 Bacteria 856
232 Ga0068857_101307069 3300005577 Unclassified 704
233 Ga0068857_102282828 3300005577 Unclassified 531
234 Ga0068854_100025298 3300005578 Bacteria 4072
235 Ga0068854_100064400 3300005578 Bacteria 2663
236 Ga0068854_100116646 3300005578 Unclassified 2021
237 Ga0068854_100145726 3300005578 Bacteria 1821
238 Ga0068854_100201784 3300005578 Bacteria 1564
239 Ga0068854_100239915 3300005578 Bacteria 1443
240 Ga0068854_100417320 3300005578 Bacteria 1114
241 Ga0068854_101161808 3300005578 Bacteria 690
242 Ga0068856_100022723 3300005614 Bacteria 6098
243 Ga0068856_100027264 3300005614 Bacteria 5574
244 Ga0068856_100239611 3300005614 Bacteria 1829
245 Ga0068856_100268900 3300005614 Bacteria 1720
246 Ga0068856_100748417 3300005614 Bacteria 997
247 Ga0070702_101166777 3300005615 Unclassified 619
248 Ga0068852_100015532 3300005616 Bacteria 5910
249 Ga0068852_100015696 3300005616 Bacteria 5885
250 Ga0068852_100045174 3300005616 Bacteria 3745
251 Ga0068852_100129121 3300005616 Bacteria 2325
252 Ga0068852_100143323 3300005616 Bacteria 2214
253 Ga0068852_100150864 3300005616 Bacteria 2161
254 Ga0068852_100171997 3300005616 Bacteria 2031
255 Ga0068852_100432007 3300005616 Bacteria 1301
256 Ga0068852_100533666 3300005616 Bacteria 1172
257 Ga0068852_100854535 3300005616 Bacteria 926
258 Ga0068852_101249018 3300005616 Bacteria 764
259 Ga0068859_100000030 3300005617 Bacteria 175435
260 Ga0068859_100010642 3300005617 Bacteria 9259
261 Ga0068859_100012786 3300005617 Bacteria 8434
262 Ga0068859_100023036 3300005617 Bacteria 6245
263 Ga0068859_100030191 3300005617 Bacteria 5439
264 Ga0068859_100044993 3300005617 Unclassified 4435
265 Ga0068859_100062223 3300005617 Unclassified 3762
266 Ga0068859_100214117 3300005617 Bacteria 2014
267 Ga0068859_100381656 3300005617 Bacteria 1504
268 Ga0068859_100520511 3300005617 Bacteria 1284
269 Ga0068859_100566412 3300005617 Bacteria 1230
270 Ga0068864_100003811 3300005618 Bacteria 12432
271 Ga0068864_100004850 3300005618 Bacteria 11017
272 Ga0068864_100051183 3300005618 Bacteria 3557
273 Ga0068864_100068618 3300005618 Bacteria 3080
274 Ga0068864_100282914 3300005618 Bacteria 1548
275 Ga0068864_100601109 3300005618 Bacteria 1067
276 Ga0068864_101166493 3300005618 Bacteria 768
277 Ga0068866_10251704 3300005718 Bacteria 1081
278 Ga0068866_10376561 3300005718 Bacteria 909
279 Ga0068861_100025885 3300005719 Bacteria 4261
280 Ga0068861_100161669 3300005719 Bacteria 1848
281 Ga0068861_100250210 3300005719 Bacteria 1512
282 Ga0068861_100612230 3300005719 Bacteria 1001
283 Ga0068861_100987050 3300005719 Unclassified 803
284 Ga0068861_101639027 3300005719 Bacteria 635
285 Ga0068851_10020419 3300005834 Bacteria 3208
286 Ga0068851_10147086 3300005834 Bacteria 1285
287 Ga0068851_10238785 3300005834 Bacteria 1027
288 Ga0068851_10878870 3300005834 Bacteria 560
289 Ga0068870_10012813 3300005840 Bacteria 3925
290 Ga0068870_10191949 3300005840 Bacteria 1233
291 Ga0068863_100009683 3300005841 Bacteria 9401
292 Ga0068863_100012696 3300005841 Bacteria 8124
293 Ga0068863_100150712 3300005841 Bacteria 2225
294 Ga0068863_100191650 3300005841 Bacteria 1965
295 Ga0068863_100198473 3300005841 Bacteria 1929
296 Ga0068863_100243584 3300005841 Bacteria 1735
297 Ga0068863_100850021 3300005841 Bacteria 911
298 Ga0068858_100001160 3300005842 Bacteria 27302
299 Ga0068858_100167303 3300005842 Unclassified 2072
300 Ga0068858_100258237 3300005842 Bacteria 1656
301 Ga0068858_100377830 3300005842 Bacteria 1359
302 Ga0068858_100501488 3300005842 Bacteria 1173
303 Ga0068858_101926022 3300005842 Bacteria 584
304 Ga0068860_100001563 3300005843 Bacteria 24660
305 Ga0068860_100002875 3300005843 Bacteria 17869
306 Ga0068860_100144276 3300005843 Bacteria 2290
307 Ga0068860_100193071 3300005843 Bacteria 1971
308 Ga0068860_100409119 3300005843 Bacteria 1343
309 Ga0068860_100501735 3300005843 Bacteria 1211
310 Ga0068860_101051908 3300005843 Bacteria 833
311 Ga0068862_100003870 3300005844 Bacteria 12737
312 Ga0068862_100414595 3300005844 Bacteria 1262
313 Ga0070715_10681129 3300006163 Bacteria 612
314 Ga0070716_100311487 3300006173 Bacteria 1099
315 Ga0070716_101247738 3300006173 Bacteria 599
316 Ga0097621_100030030 3300006237 Bacteria 4299
317 Ga0097621_100038084 3300006237 Bacteria 3857
318 Ga0097621_100085343 3300006237 Bacteria 2633
319 Ga0097621_100176949 3300006237 Bacteria 1842
320 Ga0097621_100258160 3300006237 Bacteria 1528
321 Ga0097621_100276775 3300006237 Bacteria 1476
322 Ga0097621_100324717 3300006237 Bacteria 1364
323 Ga0097621_100327432 3300006237 Bacteria 1358
324 Ga0097621_100381119 3300006237 Bacteria 1259
325 Ga0097621_100571085 3300006237 Unclassified 1031
326 Ga0097621_100868538 3300006237 Bacteria 839
327 Ga0068871_100001620 3300006358 Bacteria 15167
328 Ga0068871_100013642 3300006358 Bacteria 6034
329 Ga0068871_100072312 3300006358 Bacteria 2840
330 Ga0068871_100102381 3300006358 Bacteria 2400
331 Ga0068871_100214616 3300006358 Bacteria 1665
332 Ga0068871_100414093 3300006358 Bacteria 1202
333 Ga0068871_100705019 3300006358 Bacteria 925
334 Ga0068871_100815088 3300006358 Bacteria 861
335 Ga0075433_10794443 3300006852 Bacteria 827
336 Ga0075434_100307630 3300006871 Bacteria 1605
337 Ga0068865_100056980 3300006881 Bacteria 2725
338 Ga0068865_100209940 3300006881 Bacteria 1517
339 Ga0068865_100622893 3300006881 Unclassified 914
340 Ga0068865_100673810 3300006881 Unclassified 881
341 Ga0097620_100000030 3300006931 Bacteria 175435
342 Ga0097620_100010642 3300006931 Bacteria 9259
343 Ga0097620_100012786 3300006931 Bacteria 8434
344 Ga0097620_100023036 3300006931 Bacteria 6245
345 Ga0097620_100030192 3300006931 Bacteria 5439
346 Ga0097620_100044993 3300006931 Unclassified 4435
347 Ga0097620_100062214 3300006931 Unclassified 3762
348 Ga0097620_100214105 3300006931 Bacteria 2014
349 Ga0097620_100381661 3300006931 Bacteria 1504
350 Ga0097620_100520533 3300006931 Bacteria 1284
351 Ga0097620_100566433 3300006931 Bacteria 1230
352 Ga0105244_10270420 3300009036 Bacteria 789
353 Ga0105240_10084876 3300009093 Bacteria 3881
354 Ga0105240_10237499 3300009093 Bacteria 2115
355 Ga0105240_10829797 3300009093 Bacteria 999
356 Ga0105240_11212040 3300009093 Bacteria 799
357 Ga0111539_10710766 3300009094 Bacteria 1170
358 Ga0111539_10956778 3300009094 Bacteria 996
359 Ga0105245_10628624 3300009098 Bacteria 1102
360 Ga0105245_10811829 3300009098 Bacteria 974
361 Ga0105247_10000946 3300009101 Bacteria 21902
362 Ga0105247_10032373 3300009101 Bacteria 3177
363 Ga0105247_10325326 3300009101 Bacteria 1074
364 Ga0114129_10882529 3300009147 Bacteria 1134
365 Ga0105243_10222190 3300009148 Bacteria 1670
366 Ga0105241_10000369 3300009174 Bacteria 34233
367 Ga0105241_10030431 3300009174 Bacteria 4034
368 Ga0105241_10437569 3300009174 Bacteria 1154
369 Ga0105241_10711847 3300009174 Bacteria 917
370 Ga0105241_11463677 3300009174 Unclassified 656
371 Ga0105242_10008487 3300009176 Bacteria 7891
372 Ga0105242_10067151 3300009176 Bacteria 2964
373 Ga0105242_10115350 3300009176 Bacteria 2296
374 Ga0105242_10132111 3300009176 Bacteria 2156
375 Ga0105242_10357341 3300009176 Bacteria 1351
376 Ga0105242_10401198 3300009176 Bacteria 1280
377 Ga0105242_10469637 3300009176 Bacteria 1190
378 Ga0105248_10113884 3300009177 Bacteria 3050
379 Ga0105248_10272290 3300009177 Bacteria 1906
380 Ga0105248_10931807 3300009177 Bacteria 981
381 Ga0105237_10004005 3300009545 Bacteria 17226
382 Ga0105237_10010008 3300009545 Bacteria 10117
383 Ga0105237_10034700 3300009545 Bacteria 5106
384 Ga0105237_10349276 3300009545 Bacteria 1483
385 Ga0105237_11025929 3300009545 Bacteria 832
386 Ga0105249_10008727 3300009553 Bacteria 8841
387 Ga0105249_10011907 3300009553 Bacteria 7650
388 Ga0105249_10015473 3300009553 Bacteria 6752
389 Ga0105249_10041854 3300009553 Bacteria 4165
390 Ga0105249_10331428 3300009553 Bacteria 1536
391 Ga0105249_10366172 3300009553 Unclassified 1464
392 Ga0105249_10586854 3300009553 Bacteria 1168
393 Ga0105249_10639403 3300009553 Unclassified 1121
394 Ga0105239_10004037 3300010375 Bacteria 17755
395 Ga0105239_10150347 3300010375 Bacteria 2599
396 Ga0105239_10219178 3300010375 Bacteria 2134
397 Ga0105239_10483579 3300010375 Bacteria 1407
398 Ga0105239_10484902 3300010375 Bacteria 1405
399 Ga0105239_10592093 3300010375 Bacteria 1265
400 Ga0105246_10060979 3300011119 Bacteria 2623
401 Ga0105246_10953708 3300011119 Bacteria 773
402 Ga0157373_10018427 3300013100 Bacteria 5083
403 Ga0157373_10037201 3300013100 Bacteria 3490
404 Ga0157373_10050752 3300013100 Bacteria 2953
405 Ga0157373_10080785 3300013100 Bacteria 2292
406 Ga0157373_10136008 3300013100 Bacteria 1728
407 Ga0157373_10136213 3300013100 Unclassified 1726
408 Ga0157373_10203797 3300013100 Bacteria 1395
409 Ga0157373_10321143 3300013100 Bacteria 1101
410 Ga0157371_10001581 3300013102 Bacteria 23381
411 Ga0157371_10002078 3300013102 Bacteria 19616
412 Ga0157371_10012460 3300013102 Bacteria 6497
413 Ga0157371_10014736 3300013102 Bacteria 5883
414 Ga0157371_10015309 3300013102 Bacteria 5759
415 Ga0157371_10022447 3300013102 Bacteria 4624
416 Ga0157371_10023699 3300013102 Bacteria 4487
417 Ga0157371_10024351 3300013102 Bacteria 4421
418 Ga0157371_10033712 3300013102 Bacteria 3677
419 Ga0157371_10042932 3300013102 Bacteria 3222
420 Ga0157371_10047058 3300013102 Bacteria 3066
421 Ga0157371_10053131 3300013102 Bacteria 2877
422 Ga0157371_10149140 3300013102 Bacteria 1667
423 Ga0157371_10217155 3300013102 Bacteria 1373
424 Ga0157371_10222772 3300013102 Bacteria 1355
425 Ga0157371_10223922 3300013102 Bacteria 1351
426 Ga0157371_10366935 3300013102 Bacteria 1050
427 Ga0157371_10404257 3300013102 Bacteria 999
428 Ga0157370_10000839 3300013104 Bacteria 39014
429 Ga0157370_10009106 3300013104 Bacteria 10650
430 Ga0157370_10009601 3300013104 Bacteria 10298
431 Ga0157370_10092498 3300013104 Bacteria 2839
432 Ga0157370_10181751 3300013104 Bacteria 1954
433 Ga0157370_10202797 3300013104 Bacteria 1840
434 Ga0157370_10301890 3300013104 Bacteria 1478
435 Ga0157370_10434318 3300013104 Bacteria 1207
436 Ga0157370_10894771 3300013104 Bacteria 806
437 Ga0157370_11242964 3300013104 Bacteria 672
438 Ga0157370_11545413 3300013104 Unclassified 596
439 Ga0157369_10022359 3300013105 Bacteria 7058
440 Ga0157369_10037575 3300013105 Bacteria 5301
441 Ga0157369_10051875 3300013105 Bacteria 4439
442 Ga0157369_10055484 3300013105 Bacteria 4277
443 Ga0157369_10077819 3300013105 Bacteria 3555
444 Ga0157369_10082418 3300013105 Bacteria 3441
445 Ga0157369_10263109 3300013105 Bacteria 1799
446 Ga0157369_10291781 3300013105 Bacteria 1698
447 Ga0157369_10424442 3300013105 Bacteria 1378
448 Ga0157369_10499261 3300013105 Bacteria 1259
449 Ga0157369_10550918 3300013105 Unclassified 1192
450 Ga0157369_10703324 3300013105 Bacteria 1041
451 Ga0157374_10000783 3300013296 Bacteria 27852
452 Ga0157374_10001675 3300013296 Bacteria 18564
453 Ga0157374_10014794 3300013296 Bacteria 6834
454 Ga0157374_10079546 3300013296 Bacteria 3107
455 Ga0157374_10158170 3300013296 Bacteria 2206
456 Ga0157374_10314433 3300013296 Bacteria 1551
457 Ga0157374_10495908 3300013296 Bacteria 1225
458 Ga0157374_10710166 3300013296 Bacteria 1019
459 Ga0157374_10794137 3300013296 Unclassified 962
460 Ga0157374_10892480 3300013296 Bacteria 906
461 Ga0157378_10010278 3300013297 Bacteria 8172
462 Ga0157378_10022506 3300013297 Bacteria 5546
463 Ga0157378_10025919 3300013297 Bacteria 5166
464 Ga0157378_10052335 3300013297 Bacteria 3633
465 Ga0157378_10174681 3300013297 Bacteria 2017
466 Ga0157378_10241495 3300013297 Bacteria 1726
467 Ga0157378_10270484 3300013297 Bacteria 1634
468 Ga0157378_10301696 3300013297 Bacteria 1550
469 Ga0157378_10798328 3300013297 Bacteria 969
470 Ga0157378_11053412 3300013297 Bacteria 849
471 Ga0157378_11074914 3300013297 Bacteria 841
472 Ga0157378_11572202 3300013297 Bacteria 703
473 Ga0163162_10000728 3300013306 Bacteria 30520
474 Ga0163162_10015788 3300013306 Bacteria 7380
475 Ga0163162_10050319 3300013306 Bacteria 4179
476 Ga0163162_10076719 3300013306 Bacteria 3405
477 Ga0163162_10091300 3300013306 Bacteria 3128
478 Ga0163162_10181808 3300013306 Bacteria 2229
479 Ga0163162_10384731 3300013306 Bacteria 1536
480 Ga0163162_10617952 3300013306 Unclassified 1209
481 Ga0163162_10761667 3300013306 Bacteria 1087
482 Ga0163162_10789470 3300013306 Bacteria 1067
483 Ga0163162_11536259 3300013306 Bacteria 759
484 Ga0163162_11998703 3300013306 Bacteria 664
485 Ga0157372_10018692 3300013307 Bacteria 7457
486 Ga0157372_10029680 3300013307 Bacteria 5973
487 Ga0157372_10036833 3300013307 Bacteria 5394
488 Ga0157372_10044383 3300013307 Bacteria 4926
489 Ga0157372_10142387 3300013307 Bacteria 2764
490 Ga0157372_10159452 3300013307 Bacteria 2606
491 Ga0157372_10217745 3300013307 Bacteria 2213
492 Ga0157372_10218308 3300013307 Bacteria 2210
493 Ga0157372_10242462 3300013307 Bacteria 2091
494 Ga0157372_10243321 3300013307 Bacteria 2087
495 Ga0157372_10248490 3300013307 Bacteria 2064
496 Ga0157372_10275877 3300013307 Bacteria 1954
497 Ga0157372_10293441 3300013307 Bacteria 1891
498 Ga0157372_10455127 3300013307 Unclassified 1491
499 Ga0157372_10544066 3300013307 Bacteria 1354
500 Ga0157372_10670090 3300013307 Bacteria 1208
501 Ga0157372_10862735 3300013307 Bacteria 1051
502 Ga0157372_11053847 3300013307 Bacteria 941
503 Ga0157372_11221020 3300013307 Bacteria 868
504 Ga0157372_12074016 3300013307 Bacteria 653
505 Ga0157372_12217092 3300013307 Bacteria 631
506 Ga0157372_12236112 3300013307 Unclassified 628
507 Ga0157372_12282896 3300013307 Unclassified 621
508 Ga0157372_12453212 3300013307 Unclassified 599
509 Ga0157375_10009815 3300013308 Bacteria 8415
510 Ga0157375_10081337 3300013308 Bacteria 3279
511 Ga0157375_10104758 3300013308 Bacteria 2918
512 Ga0157375_10223852 3300013308 Bacteria 2040
513 Ga0157375_10238627 3300013308 Bacteria 1977
514 Ga0157375_10357035 3300013308 Bacteria 1627
515 Ga0157375_10650731 3300013308 Bacteria 1210
516 Ga0157375_10724747 3300013308 Bacteria 1147
517 Ga0157375_11113980 3300013308 Unclassified 924
518 Ga0157375_11690548 3300013308 Bacteria 749
519 Ga0157375_13031844 3300013308 Bacteria 561
520 Ga0163163_10000276 3300014325 Bacteria 51378
521 Ga0163163_10126073 3300014325 Bacteria 2598
522 Ga0163163_10302871 3300014325 Bacteria 1651
523 Ga0163163_10333352 3300014325 Bacteria 1572
524 Ga0163163_10600212 3300014325 Unclassified 1164
525 Ga0163163_10915772 3300014325 Bacteria 940
526 Ga0163163_11054393 3300014325 Bacteria 876
527 Ga0163163_11254973 3300014325 Unclassified 803
528 Ga0163163_11328602 3300014325 Unclassified 781
529 Ga0163163_11447514 3300014325 Bacteria 749
530 Ga0163163_11526126 3300014325 Bacteria 729
531 Ga0157380_10013735 3300014326 Bacteria 5912
532 Ga0157380_10266035 3300014326 Bacteria 1560
533 Ga0157380_10361997 3300014326 Bacteria 1361
534 Ga0157377_10004193 3300014745 Bacteria 6592
535 Ga0157377_10142740 3300014745 Bacteria 1473
536 Ga0157377_10338211 3300014745 Bacteria 1006
537 Ga0157379_10326934 3300014968 Bacteria 1400
538 Ga0157379_10329781 3300014968 Bacteria 1394
539 Ga0157379_10405010 3300014968 Bacteria 1254
540 Ga0157379_10769718 3300014968 Bacteria 907
541 Ga0157379_11277938 3300014968 Bacteria 708
542 Ga0157379_11703911 3300014968 Bacteria 617
543 Ga0157376_10005480 3300014969 Bacteria 8874
544 Ga0157376_10010680 3300014969 Bacteria 6731
545 Ga0157376_10125981 3300014969 Bacteria 2278
546 Ga0157376_10264956 3300014969 Bacteria 1612
547 Ga0157376_10713662 3300014969 Bacteria 1009
548 Ga0157376_11248218 3300014969 Bacteria 772
549 Ga0157376_11700134 3300014969 Bacteria 666
550 Ga0157376_12355995 3300014969 Bacteria 572
551 Ga0163161_10728513 3300017792 Bacteria 828
552 Ga0163161_10774122 3300017792 Bacteria 804
553 Ga0163161_11281679 3300017792 Bacteria 636
554 Ga0213876_10003898 3300021384 Bacteria 8432
555 Ga0213876_10034603 3300021384 Bacteria 2664
556 Ga0209050_1005080 3300025298 Bacteria 8496
557 Ga0207426_1000009 3300025302 Bacteria 797229
558 Ga0207697_10225405 3300025315 Bacteria 827
559 Ga0207656_10023047 3300025321 Bacteria 2503
560 Ga0207682_10016021 3300025893 Bacteria 2921
561 Ga0207642_10136125 3300025899 Bacteria 1289
562 Ga0207710_10002870 3300025900 Bacteria 7842
563 Ga0207710_10096777 3300025900 Bacteria 1388
564 Ga0207688_10164712 3300025901 Bacteria 1316
565 Ga0207680_10000084 3300025903 Bacteria 42773
566 Ga0207680_10064379 3300025903 Bacteria 2247
567 Ga0207680_10165480 3300025903 Bacteria 1486
568 Ga0207680_10293065 3300025903 Bacteria 1133
569 Ga0207647_10000251 3300025904 Bacteria 43807
570 Ga0207647_10020208 3300025904 Bacteria 4467
571 Ga0207647_10151964 3300025904 Bacteria 1353
572 Ga0207647_10212579 3300025904 Bacteria 1116
573 Ga0207685_10030553 3300025905 Bacteria 1919
574 Ga0207685_10553503 3300025905 Bacteria 612
575 Ga0207645_10206067 3300025907 Bacteria 1294
576 Ga0207645_10683185 3300025907 Bacteria 698
577 Ga0207643_10003259 3300025908 Bacteria 8763
578 Ga0207643_10242005 3300025908 Bacteria 1109
579 Ga0207643_10308607 3300025908 Bacteria 986
580 Ga0207705_10021200 3300025909 Bacteria 4634
581 Ga0207705_10029489 3300025909 Bacteria 3911
582 Ga0207705_10091251 3300025909 Bacteria 2231
583 Ga0207705_10167826 3300025909 Unclassified 1652
584 Ga0207705_10236648 3300025909 Bacteria 1390
585 Ga0207705_10333815 3300025909 Bacteria 1166
586 Ga0207705_10392912 3300025909 Bacteria 1072
587 Ga0207705_10763126 3300025909 Bacteria 751
588 Ga0207705_11128189 3300025909 Bacteria 603
589 Ga0207654_10031745 3300025911 Bacteria 2912
590 Ga0207654_10068709 3300025911 Bacteria 2097
591 Ga0207654_10792463 3300025911 Bacteria 684
592 Ga0207654_10890640 3300025911 Unclassified 645
593 Ga0207707_10115783 3300025912 Bacteria 2342
594 Ga0207707_10125792 3300025912 Bacteria 2242
595 Ga0207707_10178835 3300025912 Bacteria 1852
596 Ga0207707_10180730 3300025912 Bacteria 1842
597 Ga0207707_10196694 3300025912 Bacteria 1758
598 Ga0207695_10003298 3300025913 Bacteria 22912
599 Ga0207695_10533636 3300025913 Unclassified 1055
600 Ga0207671_10006596 3300025914 Bacteria 10302
601 Ga0207671_10051116 3300025914 Bacteria 3062
602 Ga0207671_10075431 3300025914 Bacteria 2522
603 Ga0207660_10021031 3300025917 Bacteria 4384
604 Ga0207660_10042930 3300025917 Bacteria 3176
605 Ga0207660_10055681 3300025917 Bacteria 2827
606 Ga0207660_10230898 3300025917 Bacteria 1455
607 Ga0207662_10226199 3300025918 Bacteria 1220
608 Ga0207662_10620372 3300025918 Bacteria 754
609 Ga0207657_10005581 3300025919 Bacteria 13138
610 Ga0207657_10011432 3300025919 Bacteria 8813
611 Ga0207657_10011479 3300025919 Bacteria 8795
612 Ga0207657_10099354 3300025919 Bacteria 2417
613 Ga0207657_10120985 3300025919 Bacteria 2154
614 Ga0207657_10209080 3300025919 Bacteria 1567
615 Ga0207657_10402785 3300025919 Bacteria 1076
616 Ga0207657_10657325 3300025919 Bacteria 816
617 Ga0207657_10706613 3300025919 Unclassified 783
618 Ga0207657_10967241 3300025919 Unclassified 654
619 Ga0207657_11009550 3300025919 Bacteria 638
620 Ga0207649_10003539 3300025920 Bacteria 8539
621 Ga0207649_10069788 3300025920 Bacteria 2239
622 Ga0207649_10492002 3300025920 Unclassified 931
623 Ga0207649_10972722 3300025920 Bacteria 667
624 Ga0207652_10000724 3300025921 Bacteria 32030
625 Ga0207652_10000890 3300025921 Bacteria 28278
626 Ga0207652_10010151 3300025921 Bacteria 7585
627 Ga0207652_10034793 3300025921 Bacteria 4248
628 Ga0207652_10093238 3300025921 Bacteria 2650
629 Ga0207652_10152773 3300025921 Bacteria 2067
630 Ga0207652_10172833 3300025921 Bacteria 1939
631 Ga0207652_10656858 3300025921 Bacteria 937
632 Ga0207652_10825052 3300025921 Bacteria 822
633 Ga0207652_11034441 3300025921 Bacteria 721
634 Ga0207681_10091726 3300025923 Bacteria 2171
635 Ga0207681_10139405 3300025923 Bacteria 1804
636 Ga0207681_10221558 3300025923 Unclassified 1464
637 Ga0207681_10279932 3300025923 Unclassified 1313
638 Ga0207681_10338439 3300025923 Bacteria 1201
639 Ga0207650_10011205 3300025925 Bacteria 6166
640 Ga0207650_10052570 3300025925 Bacteria 3018
641 Ga0207650_10077216 3300025925 Bacteria 2517
642 Ga0207650_10253823 3300025925 Bacteria 1424
643 Ga0207650_10275689 3300025925 Bacteria 1368
644 Ga0207650_10978334 3300025925 Bacteria 719
645 Ga0207659_10032943 3300025926 Bacteria 3561
646 Ga0207659_10172249 3300025926 Bacteria 1708
647 Ga0207659_10357295 3300025926 Bacteria 1213
648 Ga0207659_10539303 3300025926 Bacteria 991
649 Ga0207659_10998517 3300025926 Bacteria 720
650 Ga0207644_10042847 3300025931 Bacteria 3210
651 Ga0207644_10129935 3300025931 Bacteria 1927
652 Ga0207690_10008391 3300025932 Bacteria 6134
653 Ga0207690_10207373 3300025932 Bacteria 1492
654 Ga0207690_10283820 3300025932 Bacteria 1290
655 Ga0207690_10577291 3300025932 Bacteria 916
656 Ga0207690_10932730 3300025932 Bacteria 721
657 Ga0207690_11035296 3300025932 Unclassified 683
658 Ga0207690_11060292 3300025932 Bacteria 675
659 Ga0207706_10007504 3300025933 Bacteria 10089
660 Ga0207706_10344200 3300025933 Bacteria 1297
661 Ga0207706_10627942 3300025933 Bacteria 921
662 Ga0207706_11017330 3300025933 Unclassified 696
663 Ga0207706_11121606 3300025933 Bacteria 656
664 Ga0207686_10004756 3300025934 Bacteria 7283
665 Ga0207686_10142552 3300025934 Bacteria 1658
666 Ga0207686_10378850 3300025934 Bacteria 1072
667 Ga0207686_10675151 3300025934 Bacteria 819
668 Ga0207709_10562196 3300025935 Bacteria 898
669 Ga0207670_10019456 3300025936 Bacteria 4148
670 Ga0207670_10067030 3300025936 Bacteria 2468
671 Ga0207670_10085109 3300025936 Bacteria 2221
672 Ga0207670_10116988 3300025936 Bacteria 1931
673 Ga0207669_10286679 3300025937 Bacteria 1245
674 Ga0207704_10064364 3300025938 Bacteria 2290
675 Ga0207704_10143747 3300025938 Bacteria 1673
676 Ga0207704_10156519 3300025938 Bacteria 1616
677 Ga0207665_10626778 3300025939 Bacteria 841
678 Ga0207691_10028610 3300025940 Bacteria 5218
679 Ga0207691_10095141 3300025940 Bacteria 2665
680 Ga0207691_10129821 3300025940 Bacteria 2227
681 Ga0207691_10208706 3300025940 Bacteria 1698
682 Ga0207691_10280921 3300025940 Bacteria 1432
683 Ga0207691_10407535 3300025940 Bacteria 1159
684 Ga0207691_10968110 3300025940 Bacteria 711
685 Ga0207711_10086459 3300025941 Bacteria 2749
686 Ga0207689_10005354 3300025942 Bacteria 11490
687 Ga0207689_10008797 3300025942 Bacteria 8776
688 Ga0207689_10013980 3300025942 Bacteria 6835
689 Ga0207689_10019228 3300025942 Bacteria 5758
690 Ga0207689_10050244 3300025942 Bacteria 3439
691 Ga0207689_10075664 3300025942 Bacteria 2767
692 Ga0207689_10154530 3300025942 Bacteria 1891
693 Ga0207689_11394120 3300025942 Bacteria 587
694 Ga0207661_10010382 3300025944 Bacteria 6703
695 Ga0207661_10043909 3300025944 Bacteria 3529
696 Ga0207661_10048273 3300025944 Bacteria 3382
697 Ga0207661_10091044 3300025944 Unclassified 2541
698 Ga0207661_10281733 3300025944 Bacteria 1486
699 Ga0207661_10884243 3300025944 Bacteria 823
700 Ga0207661_11514815 3300025944 Bacteria 614
701 Ga0207661_11688133 3300025944 Bacteria 579
702 Ga0207661_11750591 3300025944 Unclassified 567
703 Ga0207679_10003868 3300025945 Bacteria 9283
704 Ga0207679_10007517 3300025945 Bacteria 6915
705 Ga0207679_10024741 3300025945 Bacteria 4120
706 Ga0207679_10044607 3300025945 Bacteria 3200
707 Ga0207679_10089289 3300025945 Bacteria 2379
708 Ga0207679_10164617 3300025945 Bacteria 1819
709 Ga0207679_11046043 3300025945 Bacteria 749
710 Ga0207679_11680406 3300025945 Unclassified 581
711 Ga0207667_10000150 3300025949 Bacteria 104244
712 Ga0207667_10006165 3300025949 Bacteria 14561
713 Ga0207667_10056766 3300025949 Bacteria 4112
714 Ga0207667_10129400 3300025949 Bacteria 2600
715 Ga0207667_10410383 3300025949 Bacteria 1379
716 Ga0207667_10483734 3300025949 Bacteria 1256
717 Ga0207667_10587098 3300025949 Unclassified 1124
718 Ga0207667_10605656 3300025949 Bacteria 1104
719 Ga0207651_10065203 3300025960 Bacteria 2553
720 Ga0207651_10175074 3300025960 Bacteria 1696
721 Ga0207651_10616362 3300025960 Bacteria 950
722 Ga0207651_10779937 3300025960 Bacteria 846
723 Ga0207712_10002671 3300025961 Bacteria 11407
724 Ga0207712_10010357 3300025961 Bacteria 5919
725 Ga0207712_10049091 3300025961 Bacteria 2939
726 Ga0207712_10425293 3300025961 Unclassified 1121
727 Ga0207712_10469342 3300025961 Bacteria 1071
728 Ga0207712_10512762 3300025961 Bacteria 1027
729 Ga0207712_10616163 3300025961 Bacteria 940
730 Ga0207712_11105141 3300025961 Bacteria 706
731 Ga0207668_11012250 3300025972 Bacteria 743
732 Ga0207668_11139951 3300025972 Bacteria 700
733 Ga0207640_10049437 3300025981 Bacteria 2723
734 Ga0207640_10228555 3300025981 Bacteria 1429
735 Ga0207640_10401479 3300025981 Unclassified 1116
736 Ga0207640_10623045 3300025981 Bacteria 916
737 Ga0207640_10662774 3300025981 Bacteria 890
738 Ga0207658_10009406 3300025986 Bacteria 6629
739 Ga0207658_10025633 3300025986 Bacteria 4129
740 Ga0207658_10050666 3300025986 Bacteria 3056
741 Ga0207658_10320445 3300025986 Bacteria 1342
742 Ga0207658_10591359 3300025986 Bacteria 996
743 Ga0207658_10695528 3300025986 Unclassified 918
744 Ga0207658_10816247 3300025986 Bacteria 847
745 Ga0207677_10038230 3300026023 Bacteria 3145
746 Ga0207677_10046868 3300026023 Bacteria 2897
747 Ga0207677_10178907 3300026023 Bacteria 1666
748 Ga0207677_10214373 3300026023 Unclassified 1540
749 Ga0207677_10431020 3300026023 Bacteria 1125
750 Ga0207677_10474585 3300026023 Bacteria 1076
751 Ga0207677_10500750 3300026023 Unclassified 1050
752 Ga0207677_10751458 3300026023 Bacteria 869
753 Ga0207677_11308183 3300026023 Bacteria 666
754 Ga0207703_10060109 3300026035 Bacteria 3106
755 Ga0207703_10127595 3300026035 Bacteria 2192
756 Ga0207703_10513635 3300026035 Bacteria 1126
757 Ga0207703_10533647 3300026035 Unclassified 1105
758 Ga0207703_11125784 3300026035 Bacteria 754
759 Ga0207639_10031059 3300026041 Bacteria 3923
760 Ga0207639_10043279 3300026041 Bacteria 3380
761 Ga0207639_10070407 3300026041 Bacteria 2732
762 Ga0207639_10090185 3300026041 Archaea 2451
763 Ga0207639_10153310 3300026041 Unclassified 1932
764 Ga0207639_10258143 3300026041 Bacteria 1523
765 Ga0207639_10465574 3300026041 Bacteria 1150
766 Ga0207639_10656699 3300026041 Bacteria 970
767 Ga0207639_10686999 3300026041 Bacteria 949
768 Ga0207639_10696468 3300026041 Bacteria 942
769 Ga0207639_10720750 3300026041 Bacteria 926
770 Ga0207639_11403453 3300026041 Bacteria 655
771 Ga0207678_10015706 3300026067 Bacteria 6653
772 Ga0207678_10171443 3300026067 Bacteria 1853
773 Ga0207678_10190018 3300026067 Bacteria 1754
774 Ga0207678_10249527 3300026067 Bacteria 1520
775 Ga0207708_10104373 3300026075 Bacteria 2196
776 Ga0207708_10902784 3300026075 Bacteria 765
777 Ga0207702_10026742 3300026078 Bacteria 4791
778 Ga0207702_10090258 3300026078 Bacteria 2681
779 Ga0207702_10172218 3300026078 Bacteria 1986
780 Ga0207702_10962950 3300026078 Bacteria 846
781 Ga0207702_11024638 3300026078 Bacteria 819
782 Ga0207641_10000061 3300026088 Bacteria 160161
783 Ga0207641_10001688 3300026088 Bacteria 21481
784 Ga0207641_10155243 3300026088 Bacteria 2076
785 Ga0207641_10174082 3300026088 Bacteria 1967
786 Ga0207641_10196726 3300026088 Bacteria 1856
787 Ga0207641_10485470 3300026088 Bacteria 1198
788 Ga0207648_10011328 3300026089 Bacteria 8404
789 Ga0207648_10039542 3300026089 Bacteria 4147
790 Ga0207648_10052521 3300026089 Bacteria 3564
791 Ga0207648_10211727 3300026089 Bacteria 1721
792 Ga0207648_10270967 3300026089 Unclassified 1517
793 Ga0207648_10278477 3300026089 Bacteria 1496
794 Ga0207676_10004974 3300026095 Bacteria 9415
795 Ga0207676_10157279 3300026095 Bacteria 1965
796 Ga0207676_10209456 3300026095 Bacteria 1728
797 Ga0207676_10290674 3300026095 Bacteria 1488
798 Ga0207676_10303655 3300026095 Bacteria 1458
799 Ga0207676_10352295 3300026095 Bacteria 1362
800 Ga0207676_10395937 3300026095 Bacteria 1290
801 Ga0207676_10906317 3300026095 Bacteria 865
802 Ga0207676_11046261 3300026095 Bacteria 806
803 Ga0207676_11548494 3300026095 Unclassified 660
804 Ga0207674_10007610 3300026116 Bacteria 12620
805 Ga0207674_10026567 3300026116 Bacteria 6144
806 Ga0207674_10061389 3300026116 Bacteria 3798
807 Ga0207674_10126236 3300026116 Bacteria 2524
808 Ga0207674_10324895 3300026116 Bacteria 1488
809 Ga0207674_10596562 3300026116 Bacteria 1067
810 Ga0207674_10639229 3300026116 Bacteria 1027
811 Ga0207674_11059916 3300026116 Bacteria 780
812 Ga0207674_12027392 3300026116 Unclassified 540
813 Ga0207675_100016243 3300026118 Bacteria 6948
814 Ga0207675_100187437 3300026118 Bacteria 1983
815 Ga0207675_100254082 3300026118 Bacteria 1702
816 Ga0207675_100439897 3300026118 Bacteria 1290
817 Ga0207675_100567502 3300026118 Bacteria 1135
818 Ga0207675_100605736 3300026118 Bacteria 1099
819 Ga0207675_100683627 3300026118 Bacteria 1034
820 Ga0207675_100901788 3300026118 Unclassified 900
821 Ga0207683_10296987 3300026121 Bacteria 1478
822 Ga0207683_10424151 3300026121 Bacteria 1225
823 Ga0207698_10004824 3300026142 Bacteria 8258
824 Ga0207698_10017946 3300026142 Bacteria 4811
825 Ga0207698_10036197 3300026142 Bacteria 3620
826 Ga0207698_10179378 3300026142 Bacteria 1874
827 Ga0207698_10335479 3300026142 Bacteria 1422
828 Ga0207698_10400446 3300026142 Bacteria 1312
829 Ga0207698_10424176 3300026142 Unclassified 1277
830 Ga0207698_10505264 3300026142 Bacteria 1177
831 Ga0207698_10788637 3300026142 Bacteria 951
832 Ga0207698_11232611 3300026142 Unclassified 762
833 Ga0207698_11285889 3300026142 Bacteria 746
834 Ga0209969_1013246 3300027360 Bacteria 1193
835 Ga0207428_10069781 3300027907 Bacteria 2763
836 Ga0268266_10261163 3300028379 Bacteria 1605
837 Ga0268266_11325197 3300028379 Bacteria 695
838 Ga0268264_10001112 3300028381 Bacteria 26576
839 Ga0268264_10002062 3300028381 Bacteria 17926
840 Ga0268264_10008950 3300028381 Bacteria 8310
841 Ga0268264_10115124 3300028381 Bacteria 2362
842 Ga0268264_10169204 3300028381 Bacteria 1975
843 Ga0268264_10216274 3300028381 Bacteria 1762
844 Ga0268264_10216716 3300028381 Bacteria 1760
845 Ga0268264_11448476 3300028381 Bacteria 697
846 Ga0268264_11777915 3300028381 Bacteria 627
847 Ga0268264_12126135 3300028381 Unclassified 570
848 Ga0307515_10000001 3300028794 Bacteria 4259510
849 Ga0307515_10000057 3300028794 Bacteria 261695
850 Ga0265324_10030428 3300029957 Bacteria 1894
851 Ga0265327_10000561 3300031251 Bacteria 63538
852 Ga0265327_10000644 3300031251 Bacteria 56620
853 Ga0265327_10004289 3300031251 Bacteria 12741
854 Ga0265316_10125612 3300031344 Bacteria 1935
855 Ga0307513_10209698 3300031456 Bacteria 1781
856 Ga0307509_10101308 3300031507 Bacteria 2915
857 Ga0307509_10219600 3300031507 Bacteria 1716
858 Ga0307509_10369614 3300031507 Bacteria 1151
859 Ga0265313_10026133 3300031595 Bacteria 3082
860 Ga0307508_10001547 3300031616 Bacteria 25744
861 Ga0307508_10448338 3300031616 Bacteria 883
862 Ga0307516_10000659 3300031730 Bacteria 46694
863 Ga0307410_10467752 3300031852 Bacteria 1032
864 Ga0307412_10073392 3300031911 Bacteria 2341
865 Ga0373937_0020123 3300036401 Bacteria 5980
866 Ga0373937_0287977 3300036401 Bacteria 1552
867 Ga0395899_0004711 3300037312 Bacteria 10638
868 Ga0395899_0008459 3300037312 Bacteria 7927
869 Ga0395899_0018136 3300037312 Bacteria 5355
870 Ga0395899_0341255 3300037312 Bacteria 1004
871 Ga0395900_0029140 3300037418 Bacteria 5662
872 Ga0395900_0100541 3300037418 Bacteria 2970
873 Ga0395900_0105919 3300037418 Bacteria 2888
874 Ga0395900_0130037 3300037418 Bacteria 2581
875 Ga0395900_0130238 3300037418 Bacteria 2578
876 Ga0395900_0141624 3300037418 Bacteria 2462
877 Ga0395898_0005225 3300037466 Bacteria 14035
878 Ga0395898_0006375 3300037466 Bacteria 12604
879 Ga0395898_0006854 3300037466 Bacteria 12115
880 Ga0395898_0038783 3300037466 Bacteria 4719
881 Ga0395898_0109198 3300037466 Bacteria 2652
882 Ga0395898_0223593 3300037466 Bacteria 1796
883 Ga0395905_0063908 3300037471 Bacteria 3444
884 Ga0395905_0157537 3300037471 Bacteria 2135
885 Ga0395905_0221396 3300037471 Bacteria 1771
886 Ga0395905_0583558 3300037471 Bacteria 1019
887 Ga0395901_0067999 3300038443 Bacteria 3711
888 Ga0395901_0068548 3300038443 Bacteria 3695
889 Ga0395901_0596168 3300038443 Bacteria 1114
890 Ga0395901_1038104 3300038443 Bacteria 793
891 Ga0436365_0292805 3300039437 Bacteria 3389
892 Ga0436365_0679026 3300039437 Bacteria 1099
893 Ga0436365_1777169 3300039437 Bacteria 24248
894 Ga0436365_1787697 3300039437 Bacteria 7313
895 Ga0436365_1843588 3300039437 Bacteria 2101
896 Ga0451789_1232955 3300041443 Bacteria 584
897 Ga0451791_0337579 3300041451 Bacteria 758
898 Ga0451793_1328930 3300041452 Bacteria 724
899 Ga0451793_1844920 3300041452 Bacteria 1075
900 Ga0451807_0280556 3300041486 Bacteria 945
901 Ga0451807_0964785 3300041486 Bacteria 1026
902 Ga0451807_1126478 3300041486 Bacteria 1722
903 Ga0451807_1819433 3300041486 Bacteria 1463
904 Ga0451577_0004346 3300042876 Bacteria 15018
905 Ga0451577_0032851 3300042876 Bacteria 4678
906 Ga0453683_0220314 3300044673 Bacteria 1206
907 Ga0453684_0297203 3300044712 Bacteria 1836
908 Ga0495603_0806838 3300046455 Unclassified 535
909 Ga0495629_0220671 3300046459 Bacteria 1308
910 Ga0495629_0324750 3300046459 Bacteria 1052
911 Ga0495638_0000015 3300046460 Bacteria 414645
912 Ga0495653_0132222 3300046463 Bacteria 1765
913 Ga0495650_0108216 3300046471 Bacteria 1035
914 Ga0495594_0074879 3300046499 Bacteria 1887
915 Ga0495628_0028878 3300046516 Bacteria 4503
916 Ga0495630_0006489 3300046517 Bacteria 8328
917 Ga0495586_0127380 3300046535 Bacteria 1425
918 Ga0495645_0194987 3300046543 Bacteria 1378
919 Ga0495633_0225790 3300046558 Unclassified 857
920 Ga0495668_0000414 3300046616 Bacteria 55752
921 Ga0495668_0000687 3300046616 Bacteria 40657
922 Ga0495668_0330834 3300046616 Unclassified 836
923 Ga0495634_0027496 3300046642 Bacteria 3957
924 Ga0495625_0164929 3300046660 Bacteria 1482
925 Ga0495635_0072475 3300046663 Bacteria 2360
926 Ga0495670_0279397 3300046691 Bacteria 893
927 Ga0495581_0500692 3300047315 Bacteria 706
928 Ga0495604_0219214 3300047317 Unclassified 1311
929 Ga0495672_0221366 3300047320 Bacteria 934
930 Ga0495686_0000365 3300047472 Bacteria 73281
931 Ga0495602_0948768 3300048088 Bacteria 570
932 Ga0496108_0459993 3300048911 Bacteria 1112
933 Ga0496114_0000228 3300048917 Bacteria 40947
934 Ga0496114_0215217 3300048917 Bacteria 1686
935 Ga0496124_0039130 3300048927 Bacteria 4113
936 Ga0501290_043200 3300049513 Bacteria 681
937 Ga0501292_014182 3300049515 Bacteria 1233
938 Ga0501298_000846 3300049521 Bacteria 4312
939 Ga0501298_099476 3300049521 Bacteria 662
940 Ga0501299_026758 3300049522 Bacteria 1091
941 Ga0501032_0307165 3300049569 Bacteria 1025
942 Ga0501033_0213874 3300049570 Bacteria 1374
943 Ga0501034_0000373 3300049571 Bacteria 76337
944 Ga0501034_0043414 3300049571 Bacteria 4550
945 Ga0501034_0048735 3300049571 Bacteria 4275
946 Ga0501034_0056988 3300049571 Bacteria 3929
947 Ga0501034_0064577 3300049571 Bacteria 3674
948 Ga0501034_0241423 3300049571 Bacteria 1753
949 Ga0501036_0020566 3300049572 Bacteria 5543
950 Ga0501037_0242918 3300049573 Bacteria 1262
951 Ga0501038_0189249 3300049574 Bacteria 1657
952 Ga0501038_0451888 3300049574 Bacteria 988
953 Ga0501043_0043358 3300049579 Bacteria 3536
954 Ga0501043_0215461 3300049579 Bacteria 1487
955 Ga0501046_0017842 3300049580 Bacteria 5917
956 Ga0501046_0313920 3300049580 Bacteria 1143
957 Ga0501047_0462972 3300049581 Bacteria 1097
958 Ga0501048_0052938 3300049582 Unclassified 2888
959 Ga0501067_0086356 3300049583 Bacteria 1741
960 Ga0501070_0040540 3300049586 Bacteria 3883
961 Ga0501070_0157999 3300049586 Bacteria 1870
962 Ga0501070_0242131 3300049586 Bacteria 1476
963 Ga0501070_1359240 3300049586 Unclassified 541
964 Ga0501073_0241423 3300049589 Bacteria 1247
965 Ga0501074_0092220 3300049590 Bacteria 2169
966 Ga0501198_025778 3300049649 Bacteria 957
967 Ga0501201_022292 3300049651 Unclassified 679
968 Ga0501202_000117 3300049652 Bacteria 9215
969 Ga0501207_008644 3300049654 Bacteria 1475
970 Ga0501207_022469 3300049654 Bacteria 1019
971 Ga0501217_007565 3300049661 Bacteria 2331
972 Ga0501217_019999 3300049661 Bacteria 1568
973 Ga0501217_025137 3300049661 Bacteria 1430
974 Ga0501222_002596 3300049662 Bacteria 2495
975 Ga0501223_000917 3300049663 Bacteria 6955
976 Ga0501223_053674 3300049663 Bacteria 783
977 Ga0501235_001601 3300049669 Bacteria 4851
978 Ga0501240_005695 3300049673 Bacteria 1503
979 Ga0501242_006915 3300049674 Bacteria 1302
980 Ga0501243_008127 3300049675 Bacteria 1613
981 Ga0501257_005273 3300049686 Unclassified 2845
982 Ga0501257_131596 3300049686 Bacteria 677
983 Ga0501259_003424 3300049688 Bacteria 2530
984 Ga0501260_016409 3300049689 Bacteria 779
985 Ga0501225_0003109 3300049705 Bacteria 5073
986 Ga0501229_012511 3300049706 Bacteria 1084
987 Ga0501234_018598 3300049707 Bacteria 1100
988 Ga0501245_003515 3300049708 Bacteria 2131
989 Ga0501079_0191548 3300049741 Bacteria 1596
990 Ga0501080_0137740 3300049742 Bacteria 2258
991 Ga0501080_0508015 3300049742 Bacteria 1076
992 Ga0501080_1073363 3300049742 Bacteria 696
993 Ga0501083_0166502 3300049744 Bacteria 1441
994 Ga0501232_000601 3300049757 Bacteria 2476
995 Ga0501264_000281 3300049761 Bacteria 8030
996 Ga0501264_031134 3300049761 Bacteria 614
997 Ga0501268_039146 3300049765 Unclassified 887
998 Ga0501269_006739 3300049766 Bacteria 1388
999 Ga0501271_046959 3300049768 Bacteria 577
1000 Ga0501035_0026460 3300049822 Bacteria 5307
1001 Ga0501035_0210161 3300049822 Bacteria 1665
1002 Ga0501035_0351325 3300049822 Bacteria 1233
1003 Ga0501044_0036351 3300049823 Bacteria 5153
1004 Ga0501044_0070147 3300049823 Bacteria 3566
1005 Ga0501044_0086882 3300049823 Bacteria 3159
1006 Ga0501044_0134272 3300049823 Bacteria 2467
1007 Ga0501044_1119370 3300049823 Bacteria 656
1008 Ga0501212_002304 3300049851 Bacteria 2288
1009 Ga0501212_039993 3300049851 Bacteria 773
1010 nmdc:mga08y16_61001_c1 3300050511 Bacteria 3938
1011 nmdc:mga08y16_901854_c1 3300050511 Bacteria 870
1012 nmdc:mga0n895_323285_c1 3300050512 Bacteria 1563
1013 Ga0495619_0553392 3300053085 Unclassified 789
1014 Ga0500644_0054102 3300053088 Bacteria 1388
1015 Ga0500556_0020343 3300053104 Bacteria 2123
1016 Ga0500562_000007 3300053108 Bacteria 241755
1017 Ga0500642_0313814 3300053130 Bacteria 705
1018 Ga0500616_0000043 3300053153 Bacteria 342930
1019 Ga0500616_0003144 3300053153 Bacteria 12891
1020 Ga0500616_0022134 3300053153 Bacteria 3553
1021 Ga0500622_0000575 3300053156 Bacteria 33359
1022 Ga0500622_0154667 3300053156 Bacteria 1081
1023 Ga0500661_010455 3300055283 Bacteria 1690
1024 Ga0501082_0408595 3300060353 Bacteria 1185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_12453212 Ga0157372_124532121 139
2 3300005338 Ga0068868_101596738 Ga0068868_1015967381 153
3 3300005535 Ga0070684_101380187 Ga0070684_1013801871 153
4 3300026116 Ga0207674_10126236 Ga0207674_101262365 154
5 3300006173 Ga0070716_101247738 Ga0070716_1012477381 155
6 3300025909 Ga0207705_11128189 Ga0207705_111281891 155
7 3300049586 Ga0501070_1359240 Ga0501070_1359240_23_508 155
8 3300048917 Ga0496114_0215217 Ga0496114_0215217_1090_1560 156
9 3300003323 rootH1_10086161 rootH1_100861613 160
10 3300005547 Ga0070693_100200372 Ga0070693_1002003722 160
11 3300049761 Ga0501264_031134 Ga0501264_031134_94_594 160
12 3300046616 Ga0495668_0330834 Ga0495668_0330834_272_757 161
13 3300048917 Ga0496114_0000228 Ga0496114_0000228_4364_4852 161
14 3300049686 Ga0501257_005273 Ga0501257_005273_1470_1955 161
15 3300049761 Ga0501264_000281 Ga0501264_000281_1270_1755 161
16 3300005290 Ga0065712_10376345 Ga0065712_103763452 162
17 3300005339 Ga0070660_100226596 Ga0070660_1002265962 162
18 3300005354 Ga0070675_100973225 Ga0070675_1009732252 162
19 3300005366 Ga0070659_101118194 Ga0070659_1011181941 162
20 3300005535 Ga0070684_100889795 Ga0070684_1008897951 162
21 3300005539 Ga0068853_100436667 Ga0068853_1004366672 162
22 3300005539 Ga0068853_101417253 Ga0068853_1014172531 162
23 3300005577 Ga0068857_101307069 Ga0068857_1013070692 162
24 3300005834 Ga0068851_10147086 Ga0068851_101470862 162
25 3300005834 Ga0068851_10238785 Ga0068851_102387852 162
26 3300013100 Ga0157373_10203797 Ga0157373_102037972 162
27 3300013102 Ga0157371_10149140 Ga0157371_101491402 162
28 3300013104 Ga0157370_10301890 Ga0157370_103018902 162
29 3300013104 Ga0157370_11545413 Ga0157370_115454131 162
30 3300013307 Ga0157372_10243321 Ga0157372_102433212 162
31 3300013307 Ga0157372_10248490 Ga0157372_102484902 162
32 3300013307 Ga0157372_10275877 Ga0157372_102758772 162
33 3300013307 Ga0157372_10670090 Ga0157372_106700901 162
34 3300013307 Ga0157372_11221020 Ga0157372_112210202 162
35 3300014325 Ga0163163_10126073 Ga0163163_101260732 162
36 3300025919 Ga0207657_10402785 Ga0207657_104027851 162
37 3300025925 Ga0207650_10011205 Ga0207650_100112054 162
38 3300025926 Ga0207659_10998517 Ga0207659_109985171 162
39 3300025932 Ga0207690_11035296 Ga0207690_110352961 162
40 3300025944 Ga0207661_10281733 Ga0207661_102817332 162
41 3300025945 Ga0207679_11680406 Ga0207679_116804062 162
42 3300026041 Ga0207639_10465574 Ga0207639_104655742 162
43 3300026041 Ga0207639_10656699 Ga0207639_106566992 162
44 3300026116 Ga0207674_11059916 Ga0207674_110599161 162
45 3300026142 Ga0207698_11232611 Ga0207698_112326111 162
46 3300026142 Ga0207698_11285889 Ga0207698_112858891 162
47 3300027360 Ga0209969_1013246 Ga0209969_10132461 162
48 3300037471 Ga0395905_0583558 Ga0395905_0583558_155_643 162
49 3300041486 Ga0451807_0280556 Ga0451807_0280556_149_637 162
50 3300048911 Ga0496108_0459993 Ga0496108_0459993_94_582 162
51 3300049654 Ga0501207_022469 Ga0501207_022469_430_918 162
52 3300049661 Ga0501217_019999 Ga0501217_019999_758_1246 162
53 3300049686 Ga0501257_131596 Ga0501257_131596_140_628 162
54 3300049851 Ga0501212_039993 Ga0501212_039993_143_631 162
55 iso_pu_bacteria 2929154850 2929156231 162
56 3300003322 rootL2_10020360 rootL2_100203603 163
57 3300003323 rootH1_10033722 rootH1_100337228 163
58 3300003323 rootH1_10311697 rootH1_103116973 163
59 3300003791 Ga0055530_10039971 Ga0055530_100399712 163
60 3300005535 Ga0070684_100947970 Ga0070684_1009479701 163
61 3300025298 Ga0209050_1005080 Ga0209050_10050806 163
62 3300031251 Ga0265327_10004289 Ga0265327_1000428913 163
63 3300031456 Ga0307513_10209698 Ga0307513_102096982 163
64 3300031911 Ga0307412_10073392 Ga0307412_100733922 163
65 3300046460 Ga0495638_0000015 Ga0495638_0000015_351827_352318 163
66 3300053153 Ga0500616_0000043 Ga0500616_0000043_153184_153675 163
67 3300053156 Ga0500622_0154667 Ga0500622_0154667_285_776 163
68 iso_pu_bacteria 2818991444 2819589667 163
69 3300003322 rootL2_10238808 rootL2_102388082 164
70 3300005290 Ga0065712_10008709 Ga0065712_100087095 164
71 3300005290 Ga0065712_10184266 Ga0065712_101842662 164
72 3300005290 Ga0065712_10201724 Ga0065712_102017242 164
73 3300005290 Ga0065712_10398852 Ga0065712_103988521 164
74 3300005293 Ga0065715_10019757 Ga0065715_100197575 164
75 3300005327 Ga0070658_10102788 Ga0070658_101027882 164
76 3300005327 Ga0070658_10917207 Ga0070658_109172072 164
77 3300005328 Ga0070676_10478965 Ga0070676_104789651 164
78 3300005329 Ga0070683_100002827 Ga0070683_10000282711 164
79 3300005329 Ga0070683_100050002 Ga0070683_1000500022 164
80 3300005329 Ga0070683_100497853 Ga0070683_1004978532 164
81 3300005329 Ga0070683_101448344 Ga0070683_1014483441 164
82 3300005330 Ga0070690_100054427 Ga0070690_1000544273 164
83 3300005330 Ga0070690_100120763 Ga0070690_1001207633 164
84 3300005331 Ga0070670_101379617 Ga0070670_1013796171 164
85 3300005334 Ga0068869_100035978 Ga0068869_1000359786 164
86 3300005334 Ga0068869_100047820 Ga0068869_1000478203 164
87 3300005334 Ga0068869_100189390 Ga0068869_1001893901 164
88 3300005335 Ga0070666_10084814 Ga0070666_100848144 164
89 3300005336 Ga0070680_100054583 Ga0070680_1000545832 164
90 3300005337 Ga0070682_100021930 Ga0070682_1000219304 164
91 3300005337 Ga0070682_100316030 Ga0070682_1003160301 164
92 3300005337 Ga0070682_100833278 Ga0070682_1008332781 164
93 3300005338 Ga0068868_100015864 Ga0068868_1000158641 164
94 3300005338 Ga0068868_100030015 Ga0068868_1000300153 164
95 3300005338 Ga0068868_100252365 Ga0068868_1002523653 164
96 3300005338 Ga0068868_100360107 Ga0068868_1003601072 164
97 3300005338 Ga0068868_100451350 Ga0068868_1004513502 164
98 3300005339 Ga0070660_100021497 Ga0070660_1000214974 164
99 3300005340 Ga0070689_100005527 Ga0070689_1000055276 164
100 3300005340 Ga0070689_100010544 Ga0070689_1000105442 164
101 3300005340 Ga0070689_100102444 Ga0070689_1001024442 164
102 3300005340 Ga0070689_100733975 Ga0070689_1007339751 164
103 3300005343 Ga0070687_100269505 Ga0070687_1002695051 164
104 3300005344 Ga0070661_100002424 Ga0070661_10000242411 164
105 3300005344 Ga0070661_100063582 Ga0070661_1000635821 164
106 3300005345 Ga0070692_10222052 Ga0070692_102220522 164
107 3300005347 Ga0070668_100417500 Ga0070668_1004175001 164
108 3300005347 Ga0070668_100812746 Ga0070668_1008127462 164
109 3300005347 Ga0070668_101515995 Ga0070668_1015159951 164
110 3300005353 Ga0070669_100310439 Ga0070669_1003104391 164
111 3300005353 Ga0070669_100374611 Ga0070669_1003746112 164
112 3300005353 Ga0070669_100787515 Ga0070669_1007875151 164
113 3300005354 Ga0070675_100047513 Ga0070675_1000475132 164
114 3300005354 Ga0070675_100072740 Ga0070675_1000727405 164
115 3300005355 Ga0070671_100598741 Ga0070671_1005987412 164
116 3300005356 Ga0070674_100670795 Ga0070674_1006707951 164
117 3300005356 Ga0070674_101475706 Ga0070674_1014757061 164
118 3300005364 Ga0070673_100145326 Ga0070673_1001453263 164
119 3300005364 Ga0070673_100152174 Ga0070673_1001521742 164
120 3300005365 Ga0070688_100045499 Ga0070688_1000454992 164
121 3300005365 Ga0070688_100074812 Ga0070688_1000748122 164
122 3300005365 Ga0070688_100134011 Ga0070688_1001340111 164
123 3300005365 Ga0070688_100246440 Ga0070688_1002464403 164
124 3300005367 Ga0070667_100447456 Ga0070667_1004474562 164
125 3300005367 Ga0070667_100461318 Ga0070667_1004613183 164
126 3300005438 Ga0070701_10375456 Ga0070701_103754561 164
127 3300005441 Ga0070700_100073387 Ga0070700_1000733874 164
128 3300005455 Ga0070663_100230799 Ga0070663_1002307993 164
129 3300005456 Ga0070678_100093855 Ga0070678_1000938551 164
130 3300005456 Ga0070678_100622444 Ga0070678_1006224441 164
131 3300005457 Ga0070662_100011083 Ga0070662_1000110832 164
132 3300005457 Ga0070662_100107471 Ga0070662_1001074712 164
133 3300005457 Ga0070662_100111412 Ga0070662_1001114124 164
134 3300005459 Ga0068867_100111538 Ga0068867_1001115382 164
135 3300005459 Ga0068867_100285601 Ga0068867_1002856011 164
136 3300005466 Ga0070685_10015533 Ga0070685_100155332 164
137 3300005466 Ga0070685_10309631 Ga0070685_103096312 164
138 3300005530 Ga0070679_100010397 Ga0070679_1000103973 164
139 3300005530 Ga0070679_100670601 Ga0070679_1006706012 164
140 3300005535 Ga0070684_100006880 Ga0070684_1000068801 164
141 3300005535 Ga0070684_100008725 Ga0070684_1000087257 164
142 3300005535 Ga0070684_100187969 Ga0070684_1001879692 164
143 3300005535 Ga0070684_100302816 Ga0070684_1003028162 164
144 3300005539 Ga0068853_100003531 Ga0068853_1000035315 164
145 3300005539 Ga0068853_100243511 Ga0068853_1002435112 164
146 3300005543 Ga0070672_100021689 Ga0070672_1000216896 164
147 3300005543 Ga0070672_100022194 Ga0070672_1000221946 164
148 3300005544 Ga0070686_100308932 Ga0070686_1003089321 164
149 3300005544 Ga0070686_100392090 Ga0070686_1003920901 164
150 3300005547 Ga0070693_100557317 Ga0070693_1005573171 164
151 3300005549 Ga0070704_100113437 Ga0070704_1001134372 164
152 3300005564 Ga0070664_100003096 Ga0070664_10000309612 164
153 3300005564 Ga0070664_100057717 Ga0070664_1000577172 164
154 3300005564 Ga0070664_100158808 Ga0070664_1001588083 164
155 3300005564 Ga0070664_100753294 Ga0070664_1007532942 164
156 3300005564 Ga0070664_100848930 Ga0070664_1008489302 164
157 3300005577 Ga0068857_100030628 Ga0068857_1000306286 164
158 3300005577 Ga0068857_100242051 Ga0068857_1002420512 164
159 3300005577 Ga0068857_100276281 Ga0068857_1002762813 164
160 3300005578 Ga0068854_100064400 Ga0068854_1000644002 164
161 3300005578 Ga0068854_100201784 Ga0068854_1002017843 164
162 3300005578 Ga0068854_100417320 Ga0068854_1004173203 164
163 3300005616 Ga0068852_100015532 Ga0068852_1000155325 164
164 3300005616 Ga0068852_100143323 Ga0068852_1001433234 164
165 3300005616 Ga0068852_100150864 Ga0068852_1001508642 164
166 3300005616 Ga0068852_100533666 Ga0068852_1005336662 164
167 3300005616 Ga0068852_101249018 Ga0068852_1012490181 164
168 3300005617 Ga0068859_100044993 Ga0068859_1000449936 164
169 3300005617 Ga0068859_100214117 Ga0068859_1002141173 164
170 3300005617 Ga0068859_100381656 Ga0068859_1003816562 164
171 3300005617 Ga0068859_100520511 Ga0068859_1005205112 164
172 3300005617 Ga0068859_100566412 Ga0068859_1005664122 164
173 3300005618 Ga0068864_100004850 Ga0068864_1000048509 164
174 3300005618 Ga0068864_100601109 Ga0068864_1006011092 164
175 3300005718 Ga0068866_10251704 Ga0068866_102517042 164
176 3300005719 Ga0068861_100025885 Ga0068861_1000258852 164
177 3300005719 Ga0068861_100161669 Ga0068861_1001616692 164
178 3300005719 Ga0068861_100612230 Ga0068861_1006122301 164
179 3300005719 Ga0068861_100987050 Ga0068861_1009870501 164
180 3300005719 Ga0068861_101639027 Ga0068861_1016390271 164
181 3300005840 Ga0068870_10012813 Ga0068870_100128132 164
182 3300005840 Ga0068870_10191949 Ga0068870_101919492 164
183 3300005841 Ga0068863_100009683 Ga0068863_10000968312 164
184 3300005841 Ga0068863_100150712 Ga0068863_1001507123 164
185 3300005841 Ga0068863_100243584 Ga0068863_1002435842 164
186 3300005841 Ga0068863_100850021 Ga0068863_1008500212 164
187 3300005842 Ga0068858_100258237 Ga0068858_1002582372 164
188 3300005842 Ga0068858_100377830 Ga0068858_1003778302 164
189 3300005842 Ga0068858_100501488 Ga0068858_1005014881 164
190 3300005843 Ga0068860_101051908 Ga0068860_1010519082 164
191 3300005844 Ga0068862_100414595 Ga0068862_1004145952 164
192 3300006163 Ga0070715_10681129 Ga0070715_106811291 164
193 3300006237 Ga0097621_100030030 Ga0097621_1000300303 164
194 3300006237 Ga0097621_100258160 Ga0097621_1002581602 164
195 3300006237 Ga0097621_100324717 Ga0097621_1003247172 164
196 3300006358 Ga0068871_100013642 Ga0068871_1000136427 164
197 3300006358 Ga0068871_100072312 Ga0068871_1000723123 164
198 3300006358 Ga0068871_100102381 Ga0068871_1001023811 164
199 3300006871 Ga0075434_100307630 Ga0075434_1003076301 164
200 3300006881 Ga0068865_100056980 Ga0068865_1000569802 164
201 3300006881 Ga0068865_100209940 Ga0068865_1002099402 164
202 3300006881 Ga0068865_100673810 Ga0068865_1006738101 164
203 3300006931 Ga0097620_100044993 Ga0097620_1000449932 164
204 3300006931 Ga0097620_100214105 Ga0097620_1002141053 164
205 3300006931 Ga0097620_100381661 Ga0097620_1003816612 164
206 3300006931 Ga0097620_100520533 Ga0097620_1005205332 164
207 3300006931 Ga0097620_100566433 Ga0097620_1005664332 164
208 3300009036 Ga0105244_10270420 Ga0105244_102704201 164
209 3300009093 Ga0105240_10237499 Ga0105240_102374993 164
210 3300009094 Ga0111539_10710766 Ga0111539_107107661 164
211 3300009094 Ga0111539_10956778 Ga0111539_109567781 164
212 3300009098 Ga0105245_10811829 Ga0105245_108118292 164
213 3300009147 Ga0114129_10882529 Ga0114129_108825292 164
214 3300009176 Ga0105242_10008487 Ga0105242_100084879 164
215 3300009176 Ga0105242_10067151 Ga0105242_100671512 164
216 3300009176 Ga0105242_10132111 Ga0105242_101321112 164
217 3300009176 Ga0105242_10357341 Ga0105242_103573411 164
218 3300009176 Ga0105242_10469637 Ga0105242_104696372 164
219 3300009177 Ga0105248_10113884 Ga0105248_101138843 164
220 3300009177 Ga0105248_10272290 Ga0105248_102722903 164
221 3300009545 Ga0105237_10349276 Ga0105237_103492762 164
222 3300009545 Ga0105237_11025929 Ga0105237_110259291 164
223 3300009553 Ga0105249_10015473 Ga0105249_100154739 164
224 3300009553 Ga0105249_10041854 Ga0105249_100418544 164
225 3300009553 Ga0105249_10331428 Ga0105249_103314282 164
226 3300009553 Ga0105249_10586854 Ga0105249_105868543 164
227 3300010375 Ga0105239_10484902 Ga0105239_104849022 164
228 3300011119 Ga0105246_10060979 Ga0105246_100609793 164
229 3300013100 Ga0157373_10080785 Ga0157373_100807852 164
230 3300013102 Ga0157371_10222772 Ga0157371_102227722 164
231 3300013102 Ga0157371_10223922 Ga0157371_102239223 164
232 3300013104 Ga0157370_10181751 Ga0157370_101817512 164
233 3300013105 Ga0157369_10082418 Ga0157369_100824182 164
234 3300013296 Ga0157374_10000783 Ga0157374_1000078312 164
235 3300013296 Ga0157374_10079546 Ga0157374_100795462 164
236 3300013296 Ga0157374_10158170 Ga0157374_101581701 164
237 3300013297 Ga0157378_10022506 Ga0157378_100225061 164
238 3300013297 Ga0157378_10174681 Ga0157378_101746812 164
239 3300013297 Ga0157378_11074914 Ga0157378_110749142 164
240 3300013306 Ga0163162_10050319 Ga0163162_100503193 164
241 3300013306 Ga0163162_10076719 Ga0163162_100767193 164
242 3300013306 Ga0163162_10181808 Ga0163162_101818082 164
243 3300013306 Ga0163162_10761667 Ga0163162_107616672 164
244 3300013306 Ga0163162_11536259 Ga0163162_115362591 164
245 3300013307 Ga0157372_10217745 Ga0157372_102177452 164
246 3300013307 Ga0157372_12236112 Ga0157372_122361121 164
247 3300013308 Ga0157375_10009815 Ga0157375_100098153 164
248 3300013308 Ga0157375_10104758 Ga0157375_101047582 164
249 3300013308 Ga0157375_10223852 Ga0157375_102238521 164
250 3300013308 Ga0157375_10357035 Ga0157375_103570352 164
251 3300013308 Ga0157375_10650731 Ga0157375_106507312 164
252 3300013308 Ga0157375_10724747 Ga0157375_107247471 164
253 3300014325 Ga0163163_10000276 Ga0163163_1000027614 164
254 3300014325 Ga0163163_10600212 Ga0163163_106002122 164
255 3300014325 Ga0163163_10915772 Ga0163163_109157721 164
256 3300014325 Ga0163163_11328602 Ga0163163_113286021 164
257 3300014326 Ga0157380_10013735 Ga0157380_100137352 164
258 3300014326 Ga0157380_10266035 Ga0157380_102660352 164
259 3300014326 Ga0157380_10361997 Ga0157380_103619972 164
260 3300014745 Ga0157377_10004193 Ga0157377_100041934 164
261 3300014745 Ga0157377_10142740 Ga0157377_101427402 164
262 3300014745 Ga0157377_10338211 Ga0157377_103382111 164
263 3300014968 Ga0157379_10326934 Ga0157379_103269343 164
264 3300014968 Ga0157379_10405010 Ga0157379_104050102 164
265 3300014968 Ga0157379_11277938 Ga0157379_112779381 164
266 3300014969 Ga0157376_10010680 Ga0157376_100106806 164
267 3300014969 Ga0157376_10125981 Ga0157376_101259813 164
268 3300014969 Ga0157376_10264956 Ga0157376_102649562 164
269 3300014969 Ga0157376_11700134 Ga0157376_117001341 164
270 3300017792 Ga0163161_10728513 Ga0163161_107285131 164
271 3300017792 Ga0163161_10774122 Ga0163161_107741221 164
272 3300025315 Ga0207697_10225405 Ga0207697_102254052 164
273 3300025893 Ga0207682_10016021 Ga0207682_100160212 164
274 3300025901 Ga0207688_10164712 Ga0207688_101647121 164
275 3300025903 Ga0207680_10064379 Ga0207680_100643792 164
276 3300025903 Ga0207680_10293065 Ga0207680_102930651 164
277 3300025905 Ga0207685_10030553 Ga0207685_100305532 164
278 3300025905 Ga0207685_10553503 Ga0207685_105535031 164
279 3300025907 Ga0207645_10206067 Ga0207645_102060672 164
280 3300025908 Ga0207643_10003259 Ga0207643_100032597 164
281 3300025908 Ga0207643_10242005 Ga0207643_102420051 164
282 3300025909 Ga0207705_10333815 Ga0207705_103338152 164
283 3300025909 Ga0207705_10392912 Ga0207705_103929121 164
284 3300025911 Ga0207654_10792463 Ga0207654_107924631 164
285 3300025911 Ga0207654_10890640 Ga0207654_108906401 164
286 3300025917 Ga0207660_10042930 Ga0207660_100429303 164
287 3300025918 Ga0207662_10226199 Ga0207662_102261992 164
288 3300025918 Ga0207662_10620372 Ga0207662_106203721 164
289 3300025919 Ga0207657_10011479 Ga0207657_100114792 164
290 3300025920 Ga0207649_10003539 Ga0207649_100035396 164
291 3300025920 Ga0207649_10492002 Ga0207649_104920022 164
292 3300025920 Ga0207649_10972722 Ga0207649_109727222 164
293 3300025921 Ga0207652_10010151 Ga0207652_100101512 164
294 3300025923 Ga0207681_10091726 Ga0207681_100917264 164
295 3300025923 Ga0207681_10338439 Ga0207681_103384392 164
296 3300025925 Ga0207650_10275689 Ga0207650_102756892 164
297 3300025926 Ga0207659_10357295 Ga0207659_103572952 164
298 3300025926 Ga0207659_10539303 Ga0207659_105393032 164
299 3300025932 Ga0207690_10932730 Ga0207690_109327301 164
300 3300025932 Ga0207690_11060292 Ga0207690_110602921 164
301 3300025933 Ga0207706_10344200 Ga0207706_103442001 164
302 3300025934 Ga0207686_10004756 Ga0207686_100047564 164
303 3300025934 Ga0207686_10378850 Ga0207686_103788502 164
304 3300025934 Ga0207686_10675151 Ga0207686_106751511 164
305 3300025936 Ga0207670_10019456 Ga0207670_100194566 164
306 3300025936 Ga0207670_10067030 Ga0207670_100670304 164
307 3300025936 Ga0207670_10085109 Ga0207670_100851093 164
308 3300025937 Ga0207669_10286679 Ga0207669_102866792 164
309 3300025938 Ga0207704_10064364 Ga0207704_100643643 164
310 3300025938 Ga0207704_10143747 Ga0207704_101437471 164
311 3300025938 Ga0207704_10156519 Ga0207704_101565191 164
312 3300025940 Ga0207691_10028610 Ga0207691_100286108 164
313 3300025940 Ga0207691_10095141 Ga0207691_100951412 164
314 3300025941 Ga0207711_10086459 Ga0207711_100864593 164
315 3300025942 Ga0207689_10005354 Ga0207689_1000535410 164
316 3300025942 Ga0207689_10019228 Ga0207689_100192285 164
317 3300025942 Ga0207689_10050244 Ga0207689_100502445 164
318 3300025944 Ga0207661_10010382 Ga0207661_100103825 164
319 3300025944 Ga0207661_10048273 Ga0207661_100482734 164
320 3300025944 Ga0207661_10091044 Ga0207661_100910441 164
321 3300025944 Ga0207661_10884243 Ga0207661_108842431 164
322 3300025944 Ga0207661_11514815 Ga0207661_115148151 164
323 3300025944 Ga0207661_11688133 Ga0207661_116881331 164
324 3300025945 Ga0207679_10003868 Ga0207679_100038682 164
325 3300025945 Ga0207679_10024741 Ga0207679_100247415 164
326 3300025945 Ga0207679_10044607 Ga0207679_100446075 164
327 3300025945 Ga0207679_10164617 Ga0207679_101646172 164
328 3300025945 Ga0207679_11046043 Ga0207679_110460431 164
329 3300025949 Ga0207667_10410383 Ga0207667_104103832 164
330 3300025949 Ga0207667_10605656 Ga0207667_106056562 164
331 3300025960 Ga0207651_10175074 Ga0207651_101750741 164
332 3300025960 Ga0207651_10779937 Ga0207651_107799371 164
333 3300025961 Ga0207712_10010357 Ga0207712_100103576 164
334 3300025961 Ga0207712_10469342 Ga0207712_104693422 164
335 3300025961 Ga0207712_10616163 Ga0207712_106161631 164
336 3300025961 Ga0207712_11105141 Ga0207712_111051411 164
337 3300025972 Ga0207668_11012250 Ga0207668_110122501 164
338 3300025972 Ga0207668_11139951 Ga0207668_111399511 164
339 3300025981 Ga0207640_10049437 Ga0207640_100494374 164
340 3300025981 Ga0207640_10228555 Ga0207640_102285552 164
341 3300025986 Ga0207658_10009406 Ga0207658_100094062 164
342 3300025986 Ga0207658_10695528 Ga0207658_106955281 164
343 3300026023 Ga0207677_10046868 Ga0207677_100468683 164
344 3300026023 Ga0207677_10214373 Ga0207677_102143731 164
345 3300026023 Ga0207677_10474585 Ga0207677_104745852 164
346 3300026023 Ga0207677_10751458 Ga0207677_107514582 164
347 3300026035 Ga0207703_10127595 Ga0207703_101275953 164
348 3300026035 Ga0207703_10513635 Ga0207703_105136352 164
349 3300026035 Ga0207703_11125784 Ga0207703_111257841 164
350 3300026041 Ga0207639_10153310 Ga0207639_101533103 164
351 3300026067 Ga0207678_10249527 Ga0207678_102495272 164
352 3300026075 Ga0207708_10104373 Ga0207708_101043734 164
353 3300026075 Ga0207708_10902784 Ga0207708_109027841 164
354 3300026088 Ga0207641_10001688 Ga0207641_1000168813 164
355 3300026088 Ga0207641_10196726 Ga0207641_101967262 164
356 3300026088 Ga0207641_10485470 Ga0207641_104854702 164
357 3300026089 Ga0207648_10052521 Ga0207648_100525215 164
358 3300026089 Ga0207648_10211727 Ga0207648_102117272 164
359 3300026095 Ga0207676_10209456 Ga0207676_102094562 164
360 3300026095 Ga0207676_10352295 Ga0207676_103522952 164
361 3300026095 Ga0207676_11046261 Ga0207676_110462612 164
362 3300026116 Ga0207674_10007610 Ga0207674_100076105 164
363 3300026116 Ga0207674_10026567 Ga0207674_100265676 164
364 3300026116 Ga0207674_10324895 Ga0207674_103248952 164
365 3300026118 Ga0207675_100016243 Ga0207675_1000162436 164
366 3300026118 Ga0207675_100187437 Ga0207675_1001874372 164
367 3300026118 Ga0207675_100683627 Ga0207675_1006836271 164
368 3300026118 Ga0207675_100901788 Ga0207675_1009017881 164
369 3300026121 Ga0207683_10424151 Ga0207683_104241511 164
370 3300026142 Ga0207698_10017946 Ga0207698_100179464 164
371 3300026142 Ga0207698_10335479 Ga0207698_103354792 164
372 3300026142 Ga0207698_10505264 Ga0207698_105052641 164
373 3300026142 Ga0207698_10788637 Ga0207698_107886371 164
374 3300027907 Ga0207428_10069781 Ga0207428_100697815 164
375 3300028381 Ga0268264_10216274 Ga0268264_102162744 164
376 3300028381 Ga0268264_11777915 Ga0268264_117779151 164
377 3300031595 Ga0265313_10026133 Ga0265313_100261334 164
378 3300036401 Ga0373937_0020123 Ga0373937_0020123_3931_4425 164
379 3300041486 Ga0451807_1819433 Ga0451807_1819433_66_560 164
380 3300042876 Ga0451577_0032851 Ga0451577_0032851_901_1395 164
381 3300044712 Ga0453684_0297203 Ga0453684_0297203_383_877 164
382 3300046455 Ga0495603_0806838 Ga0495603_0806838_15_509 164
383 3300046459 Ga0495629_0220671 Ga0495629_0220671_340_834 164
384 3300046459 Ga0495629_0324750 Ga0495629_0324750_122_616 164
385 3300046463 Ga0495653_0132222 Ga0495653_0132222_1172_1666 164
386 3300046499 Ga0495594_0074879 Ga0495594_0074879_76_570 164
387 3300046516 Ga0495628_0028878 Ga0495628_0028878_3385_3879 164
388 3300046517 Ga0495630_0006489 Ga0495630_0006489_4333_4827 164
389 3300046535 Ga0495586_0127380 Ga0495586_0127380_606_1100 164
390 3300046558 Ga0495633_0225790 Ga0495633_0225790_155_649 164
391 3300046642 Ga0495634_0027496 Ga0495634_0027496_2395_2889 164
392 3300046663 Ga0495635_0072475 Ga0495635_0072475_1377_1871 164
393 3300046691 Ga0495670_0279397 Ga0495670_0279397_272_766 164
394 3300047317 Ga0495604_0219214 Ga0495604_0219214_162_656 164
395 3300049571 Ga0501034_0048735 Ga0501034_0048735_3006_3500 164
396 3300049572 Ga0501036_0020566 Ga0501036_0020566_3365_3859 164
397 3300049574 Ga0501038_0451888 Ga0501038_0451888_242_736 164
398 3300049579 Ga0501043_0043358 Ga0501043_0043358_1954_2448 164
399 3300049580 Ga0501046_0017842 Ga0501046_0017842_2439_2933 164
400 3300049582 Ga0501048_0052938 Ga0501048_0052938_117_611 164
401 3300049583 Ga0501067_0086356 Ga0501067_0086356_91_585 164
402 3300049586 Ga0501070_0040540 Ga0501070_0040540_1291_1785 164
403 3300049589 Ga0501073_0241423 Ga0501073_0241423_511_1005 164
404 3300049590 Ga0501074_0092220 Ga0501074_0092220_100_594 164
405 3300049741 Ga0501079_0191548 Ga0501079_0191548_234_728 164
406 3300049742 Ga0501080_0508015 Ga0501080_0508015_193_687 164
407 3300049744 Ga0501083_0166502 Ga0501083_0166502_849_1343 164
408 3300049822 Ga0501035_0026460 Ga0501035_0026460_4425_4919 164
409 3300049823 Ga0501044_0086882 Ga0501044_0086882_938_1432 164
410 3300050511 nmdc:mga08y16_61001_c1 nmdc:mga08y16_61001_c1_258_752 164
411 3300050511 nmdc:mga08y16_901854_c1 nmdc:mga08y16_901854_c1_348_842 164
412 3300050512 nmdc:mga0n895_323285_c1 nmdc:mga0n895_323285_c1_921_1415 164
413 3300053085 Ga0495619_0553392 Ga0495619_0553392_92_586 164
414 3300060353 Ga0501082_0408595 Ga0501082_0408595_602_1096 164
415 3300005327 Ga0070658_10163581 Ga0070658_101635813 165
416 3300005328 Ga0070676_10523398 Ga0070676_105233981 165
417 3300005330 Ga0070690_100469574 Ga0070690_1004695741 165
418 3300005331 Ga0070670_100079879 Ga0070670_1000798793 165
419 3300005334 Ga0068869_100005580 Ga0068869_1000055804 165
420 3300005335 Ga0070666_10000047 Ga0070666_1000004721 165
421 3300005338 Ga0068868_100096960 Ga0068868_1000969603 165
422 3300005338 Ga0068868_101289701 Ga0068868_1012897011 165
423 3300005339 Ga0070660_100026268 Ga0070660_1000262685 165
424 3300005347 Ga0070668_101094141 Ga0070668_1010941411 165
425 3300005353 Ga0070669_100141429 Ga0070669_1001414291 165
426 3300005353 Ga0070669_100401768 Ga0070669_1004017682 165
427 3300005353 Ga0070669_101136607 Ga0070669_1011366071 165
428 3300005355 Ga0070671_100099211 Ga0070671_1000992113 165
429 3300005355 Ga0070671_100118240 Ga0070671_1001182401 165
430 3300005367 Ga0070667_100006277 Ga0070667_1000062778 165
431 3300005367 Ga0070667_100007556 Ga0070667_1000075567 165
432 3300005367 Ga0070667_100088791 Ga0070667_1000887912 165
433 3300005459 Ga0068867_100256332 Ga0068867_1002563322 165
434 3300005459 Ga0068867_100913771 Ga0068867_1009137711 165
435 3300005459 Ga0068867_101005446 Ga0068867_1010054461 165
436 3300005466 Ga0070685_10123390 Ga0070685_101233902 165
437 3300005539 Ga0068853_100295835 Ga0068853_1002958351 165
438 3300005543 Ga0070672_100393083 Ga0070672_1003930832 165
439 3300005548 Ga0070665_101990556 Ga0070665_1019905561 165
440 3300005577 Ga0068857_100883939 Ga0068857_1008839392 165
441 3300005577 Ga0068857_102282828 Ga0068857_1022828281 165
442 3300005615 Ga0070702_101166777 Ga0070702_1011667771 165
443 3300005616 Ga0068852_100015696 Ga0068852_1000156964 165
444 3300005616 Ga0068852_100854535 Ga0068852_1008545352 165
445 3300005617 Ga0068859_100000030 Ga0068859_100000030122 165
446 3300005617 Ga0068859_100010642 Ga0068859_1000106422 165
447 3300005617 Ga0068859_100023036 Ga0068859_1000230368 165
448 3300005617 Ga0068859_100030191 Ga0068859_1000301916 165
449 3300005618 Ga0068864_100003811 Ga0068864_10000381114 165
450 3300005618 Ga0068864_100051183 Ga0068864_1000511833 165
451 3300005618 Ga0068864_100068618 Ga0068864_1000686181 165
452 3300005618 Ga0068864_101166493 Ga0068864_1011664931 165
453 3300005719 Ga0068861_100250210 Ga0068861_1002502102 165
454 3300005834 Ga0068851_10020419 Ga0068851_100204192 165
455 3300005834 Ga0068851_10878870 Ga0068851_108788701 165
456 3300005841 Ga0068863_100012696 Ga0068863_1000126963 165
457 3300005841 Ga0068863_100198473 Ga0068863_1001984732 165
458 3300005842 Ga0068858_100001160 Ga0068858_10000116017 165
459 3300005842 Ga0068858_100167303 Ga0068858_1001673033 165
460 3300005843 Ga0068860_100001563 Ga0068860_1000015636 165
461 3300005843 Ga0068860_100002875 Ga0068860_10000287515 165
462 3300005843 Ga0068860_100193071 Ga0068860_1001930712 165
463 3300005843 Ga0068860_100501735 Ga0068860_1005017352 165
464 3300005844 Ga0068862_100003870 Ga0068862_1000038705 165
465 3300006237 Ga0097621_100085343 Ga0097621_1000853432 165
466 3300006237 Ga0097621_100327432 Ga0097621_1003274322 165
467 3300006237 Ga0097621_100868538 Ga0097621_1008685382 165
468 3300006358 Ga0068871_100414093 Ga0068871_1004140931 165
469 3300006358 Ga0068871_100705019 Ga0068871_1007050191 165
470 3300006881 Ga0068865_100622893 Ga0068865_1006228932 165
471 3300006931 Ga0097620_100000030 Ga0097620_10000003026 165
472 3300006931 Ga0097620_100010642 Ga0097620_1000106422 165
473 3300006931 Ga0097620_100023036 Ga0097620_1000230368 165
474 3300006931 Ga0097620_100030192 Ga0097620_1000301926 165
475 3300009093 Ga0105240_11212040 Ga0105240_112120402 165
476 3300009098 Ga0105245_10628624 Ga0105245_106286242 165
477 3300009101 Ga0105247_10000946 Ga0105247_1000094623 165
478 3300009101 Ga0105247_10032373 Ga0105247_100323733 165
479 3300009101 Ga0105247_10325326 Ga0105247_103253262 165
480 3300009148 Ga0105243_10222190 Ga0105243_102221902 165
481 3300009174 Ga0105241_10000369 Ga0105241_100003699 165
482 3300009174 Ga0105241_10711847 Ga0105241_107118472 165
483 3300009176 Ga0105242_10115350 Ga0105242_101153504 165
484 3300009177 Ga0105248_10931807 Ga0105248_109318072 165
485 3300009545 Ga0105237_10034700 Ga0105237_100347002 165
486 3300009553 Ga0105249_10008727 Ga0105249_100087272 165
487 3300009553 Ga0105249_10011907 Ga0105249_100119071 165
488 3300009553 Ga0105249_10639403 Ga0105249_106394032 165
489 3300010375 Ga0105239_10219178 Ga0105239_102191782 165
490 3300013296 Ga0157374_10314433 Ga0157374_103144332 165
491 3300013296 Ga0157374_10495908 Ga0157374_104959082 165
492 3300013296 Ga0157374_10710166 Ga0157374_107101662 165
493 3300013297 Ga0157378_10010278 Ga0157378_100102786 165
494 3300013297 Ga0157378_10025919 Ga0157378_100259193 165
495 3300013297 Ga0157378_10241495 Ga0157378_102414952 165
496 3300013297 Ga0157378_10301696 Ga0157378_103016963 165
497 3300013306 Ga0163162_10015788 Ga0163162_100157884 165
498 3300013306 Ga0163162_10091300 Ga0163162_100913002 165
499 3300013306 Ga0163162_10384731 Ga0163162_103847312 165
500 3300013306 Ga0163162_10617952 Ga0163162_106179522 165
501 3300013308 Ga0157375_10238627 Ga0157375_102386273 165
502 3300014325 Ga0163163_10333352 Ga0163163_103333522 165
503 3300014325 Ga0163163_11254973 Ga0163163_112549731 165
504 3300014325 Ga0163163_11447514 Ga0163163_114475141 165
505 3300014968 Ga0157379_10329781 Ga0157379_103297811 165
506 3300014968 Ga0157379_11703911 Ga0157379_117039111 165
507 3300014969 Ga0157376_10005480 Ga0157376_100054803 165
508 3300014969 Ga0157376_10713662 Ga0157376_107136622 165
509 3300025321 Ga0207656_10023047 Ga0207656_100230471 165
510 3300025900 Ga0207710_10002870 Ga0207710_100028702 165
511 3300025900 Ga0207710_10096777 Ga0207710_100967772 165
512 3300025903 Ga0207680_10000084 Ga0207680_1000008423 165
513 3300025907 Ga0207645_10683185 Ga0207645_106831851 165
514 3300025909 Ga0207705_10167826 Ga0207705_101678263 165
515 3300025911 Ga0207654_10031745 Ga0207654_100317452 165
516 3300025913 Ga0207695_10533636 Ga0207695_105336362 165
517 3300025914 Ga0207671_10006596 Ga0207671_100065963 165
518 3300025919 Ga0207657_10706613 Ga0207657_107066131 165
519 3300025923 Ga0207681_10139405 Ga0207681_101394052 165
520 3300025923 Ga0207681_10221558 Ga0207681_102215581 165
521 3300025923 Ga0207681_10279932 Ga0207681_102799322 165
522 3300025925 Ga0207650_10052570 Ga0207650_100525702 165
523 3300025925 Ga0207650_10077216 Ga0207650_100772163 165
524 3300025931 Ga0207644_10129935 Ga0207644_101299352 165
525 3300025934 Ga0207686_10142552 Ga0207686_101425522 165
526 3300025935 Ga0207709_10562196 Ga0207709_105621961 165
527 3300025940 Ga0207691_10208706 Ga0207691_102087063 165
528 3300025942 Ga0207689_10008797 Ga0207689_100087978 165
529 3300025942 Ga0207689_10013980 Ga0207689_100139804 165
530 3300025942 Ga0207689_10075664 Ga0207689_100756644 165
531 3300025960 Ga0207651_10616362 Ga0207651_106163621 165
532 3300025961 Ga0207712_10002671 Ga0207712_100026718 165
533 3300025961 Ga0207712_10425293 Ga0207712_104252932 165
534 3300025961 Ga0207712_10512762 Ga0207712_105127622 165
535 3300025986 Ga0207658_10025633 Ga0207658_100256336 165
536 3300025986 Ga0207658_10050666 Ga0207658_100506664 165
537 3300025986 Ga0207658_10816247 Ga0207658_108162472 165
538 3300026023 Ga0207677_10178907 Ga0207677_101789072 165
539 3300026023 Ga0207677_10500750 Ga0207677_105007502 165
540 3300026023 Ga0207677_11308183 Ga0207677_113081831 165
541 3300026035 Ga0207703_10060109 Ga0207703_100601094 165
542 3300026035 Ga0207703_10533647 Ga0207703_105336471 165
543 3300026041 Ga0207639_10258143 Ga0207639_102581432 165
544 3300026078 Ga0207702_11024638 Ga0207702_110246381 165
545 3300026088 Ga0207641_10000061 Ga0207641_1000006149 165
546 3300026088 Ga0207641_10155243 Ga0207641_101552431 165
547 3300026088 Ga0207641_10174082 Ga0207641_101740823 165
548 3300026089 Ga0207648_10278477 Ga0207648_102784771 165
549 3300026095 Ga0207676_10004974 Ga0207676_100049748 165
550 3300026095 Ga0207676_10157279 Ga0207676_101572792 165
551 3300026095 Ga0207676_10303655 Ga0207676_103036551 165
552 3300026095 Ga0207676_10906317 Ga0207676_109063171 165
553 3300026116 Ga0207674_12027392 Ga0207674_120273921 165
554 3300026118 Ga0207675_100254082 Ga0207675_1002540822 165
555 3300026118 Ga0207675_100439897 Ga0207675_1004398971 165
556 3300026142 Ga0207698_10004824 Ga0207698_100048246 165
557 3300026142 Ga0207698_10400446 Ga0207698_104004461 165
558 3300028379 Ga0268266_11325197 Ga0268266_113251971 165
559 3300028381 Ga0268264_10001112 Ga0268264_100011122 165
560 3300028381 Ga0268264_10002062 Ga0268264_100020626 165
561 3300028381 Ga0268264_10008950 Ga0268264_100089505 165
562 3300028381 Ga0268264_10216716 Ga0268264_102167162 165
563 3300028381 Ga0268264_12126135 Ga0268264_121261351 165
564 3300028794 Ga0307515_10000057 Ga0307515_10000057182 165
565 3300031507 Ga0307509_10101308 Ga0307509_101013084 165
566 3300031507 Ga0307509_10219600 Ga0307509_102196002 165
567 3300031507 Ga0307509_10369614 Ga0307509_103696141 165
568 3300031616 Ga0307508_10001547 Ga0307508_1000154711 165
569 3300031616 Ga0307508_10448338 Ga0307508_104483381 165
570 3300041443 Ga0451789_1232955 Ga0451789_1232955_22_519 165
571 3300041452 Ga0451793_1844920 Ga0451793_1844920_52_549 165
572 3300042876 Ga0451577_0004346 Ga0451577_0004346_9907_10404 165
573 3300044673 Ga0453683_0220314 Ga0453683_0220314_405_902 165
574 3300046471 Ga0495650_0108216 Ga0495650_0108216_441_938 165
575 3300046660 Ga0495625_0164929 Ga0495625_0164929_727_1224 165
576 3300047320 Ga0495672_0221366 Ga0495672_0221366_328_825 165
577 3300049569 Ga0501032_0307165 Ga0501032_0307165_85_582 165
578 3300049571 Ga0501034_0000373 Ga0501034_0000373_39206_39709 165
579 3300049573 Ga0501037_0242918 Ga0501037_0242918_638_1135 165
580 3300049581 Ga0501047_0462972 Ga0501047_0462972_131_628 165
581 3300049823 Ga0501044_0070147 Ga0501044_0070147_1257_1754 165
582 3300053153 Ga0500616_0022134 Ga0500616_0022134_2273_2770 165
583 3300001979 JGI24740J21852_10076759 JGI24740J21852_100767591 166
584 3300003203 JGI25406J46586_10028193 JGI25406J46586_100281931 166
585 3300003320 rootH2_10000233 rootH2_100002337 166
586 3300003320 rootH2_10001996 rootH2_100019965 166
587 3300003320 rootH2_10253139 rootH2_102531392 166
588 3300003354 JGI25160J50197_1013452 JGI25160J50197_10134522 166
589 3300005288 Ga0065714_10069405 Ga0065714_100694053 166
590 3300005327 Ga0070658_10008410 Ga0070658_100084105 166
591 3300005327 Ga0070658_10038586 Ga0070658_100385862 166
592 3300005327 Ga0070658_10057146 Ga0070658_100571462 166
593 3300005327 Ga0070658_10111150 Ga0070658_101111501 166
594 3300005327 Ga0070658_10227408 Ga0070658_102274082 166
595 3300005327 Ga0070658_10832248 Ga0070658_108322482 166
596 3300005329 Ga0070683_100056229 Ga0070683_1000562295 166
597 3300005329 Ga0070683_101466021 Ga0070683_1014660211 166
598 3300005331 Ga0070670_101612755 Ga0070670_1016127551 166
599 3300005334 Ga0068869_100277490 Ga0068869_1002774902 166
600 3300005334 Ga0068869_101164923 Ga0068869_1011649231 166
601 3300005336 Ga0070680_100024590 Ga0070680_1000245902 166
602 3300005336 Ga0070680_100063450 Ga0070680_1000634503 166
603 3300005336 Ga0070680_100738622 Ga0070680_1007386221 166
604 3300005337 Ga0070682_100005602 Ga0070682_1000056022 166
605 3300005337 Ga0070682_100088031 Ga0070682_1000880312 166
606 3300005337 Ga0070682_100127058 Ga0070682_1001270582 166
607 3300005338 Ga0068868_100035522 Ga0068868_1000355224 166
608 3300005338 Ga0068868_100134593 Ga0068868_1001345932 166
609 3300005338 Ga0068868_101611164 Ga0068868_1016111641 166
610 3300005339 Ga0070660_100005791 Ga0070660_1000057914 166
611 3300005339 Ga0070660_100100878 Ga0070660_1001008782 166
612 3300005339 Ga0070660_100111598 Ga0070660_1001115982 166
613 3300005339 Ga0070660_100179876 Ga0070660_1001798761 166
614 3300005339 Ga0070660_100543398 Ga0070660_1005433982 166
615 3300005344 Ga0070661_100002937 Ga0070661_1000029377 166
616 3300005344 Ga0070661_100332248 Ga0070661_1003322481 166
617 3300005345 Ga0070692_10747800 Ga0070692_107478001 166
618 3300005353 Ga0070669_100411179 Ga0070669_1004111791 166
619 3300005354 Ga0070675_100410283 Ga0070675_1004102832 166
620 3300005355 Ga0070671_100049892 Ga0070671_1000498922 166
621 3300005364 Ga0070673_100088605 Ga0070673_1000886053 166
622 3300005364 Ga0070673_100824171 Ga0070673_1008241711 166
623 3300005364 Ga0070673_100842201 Ga0070673_1008422011 166
624 3300005365 Ga0070688_100807408 Ga0070688_1008074081 166
625 3300005366 Ga0070659_100003144 Ga0070659_1000031443 166
626 3300005366 Ga0070659_100004119 Ga0070659_1000041196 166
627 3300005366 Ga0070659_100055702 Ga0070659_1000557023 166
628 3300005366 Ga0070659_100056671 Ga0070659_1000566711 166
629 3300005367 Ga0070667_100388280 Ga0070667_1003882801 166
630 3300005455 Ga0070663_100019256 Ga0070663_1000192561 166
631 3300005455 Ga0070663_100138473 Ga0070663_1001384732 166
632 3300005455 Ga0070663_100639817 Ga0070663_1006398172 166
633 3300005457 Ga0070662_100296998 Ga0070662_1002969982 166
634 3300005458 Ga0070681_10015062 Ga0070681_100150622 166
635 3300005458 Ga0070681_10085841 Ga0070681_100858413 166
636 3300005458 Ga0070681_10086662 Ga0070681_100866623 166
637 3300005458 Ga0070681_10198425 Ga0070681_101984252 166
638 3300005458 Ga0070681_10754386 Ga0070681_107543862 166
639 3300005458 Ga0070681_10884389 Ga0070681_108843892 166
640 3300005459 Ga0068867_100028127 Ga0068867_1000281274 166
641 3300005459 Ga0068867_100155742 Ga0068867_1001557422 166
642 3300005459 Ga0068867_100410197 Ga0068867_1004101971 166
643 3300005459 Ga0068867_100520971 Ga0068867_1005209712 166
644 3300005459 Ga0068867_101398567 Ga0068867_1013985671 166
645 3300005466 Ga0070685_10879468 Ga0070685_108794681 166
646 3300005530 Ga0070679_100024694 Ga0070679_1000246945 166
647 3300005530 Ga0070679_100029341 Ga0070679_1000293412 166
648 3300005530 Ga0070679_100061491 Ga0070679_1000614913 166
649 3300005530 Ga0070679_100075697 Ga0070679_1000756973 166
650 3300005530 Ga0070679_100188282 Ga0070679_1001882821 166
651 3300005530 Ga0070679_100339966 Ga0070679_1003399662 166
652 3300005535 Ga0070684_100008853 Ga0070684_1000088535 166
653 3300005535 Ga0070684_100113504 Ga0070684_1001135042 166
654 3300005535 Ga0070684_100712138 Ga0070684_1007121382 166
655 3300005539 Ga0068853_100020501 Ga0068853_1000205014 166
656 3300005539 Ga0068853_100056076 Ga0068853_1000560765 166
657 3300005539 Ga0068853_100180016 Ga0068853_1001800161 166
658 3300005539 Ga0068853_100225393 Ga0068853_1002253932 166
659 3300005539 Ga0068853_100414723 Ga0068853_1004147231 166
660 3300005539 Ga0068853_100444970 Ga0068853_1004449701 166
661 3300005539 Ga0068853_100736172 Ga0068853_1007361721 166
662 3300005539 Ga0068853_100738735 Ga0068853_1007387351 166
663 3300005539 Ga0068853_101469401 Ga0068853_1014694011 166
664 3300005543 Ga0070672_100184875 Ga0070672_1001848752 166
665 3300005543 Ga0070672_100296826 Ga0070672_1002968261 166
666 3300005547 Ga0070693_100103485 Ga0070693_1001034852 166
667 3300005548 Ga0070665_100837076 Ga0070665_1008370761 166
668 3300005548 Ga0070665_101800198 Ga0070665_1018001981 166
669 3300005563 Ga0068855_100016809 Ga0068855_1000168095 166
670 3300005563 Ga0068855_100050589 Ga0068855_1000505895 166
671 3300005563 Ga0068855_100062918 Ga0068855_1000629183 166
672 3300005563 Ga0068855_100197993 Ga0068855_1001979931 166
673 3300005563 Ga0068855_100221817 Ga0068855_1002218172 166
674 3300005563 Ga0068855_100434277 Ga0068855_1004342772 166
675 3300005563 Ga0068855_100717282 Ga0068855_1007172822 166
676 3300005564 Ga0070664_100014083 Ga0070664_1000140832 166
677 3300005564 Ga0070664_100095395 Ga0070664_1000953952 166
678 3300005564 Ga0070664_100849550 Ga0070664_1008495501 166
679 3300005577 Ga0068857_100303444 Ga0068857_1003034442 166
680 3300005577 Ga0068857_100381332 Ga0068857_1003813321 166
681 3300005578 Ga0068854_100025298 Ga0068854_1000252985 166
682 3300005578 Ga0068854_100116646 Ga0068854_1001166463 166
683 3300005578 Ga0068854_100145726 Ga0068854_1001457262 166
684 3300005578 Ga0068854_100239915 Ga0068854_1002399151 166
685 3300005578 Ga0068854_101161808 Ga0068854_1011618082 166
686 3300005614 Ga0068856_100022723 Ga0068856_1000227236 166
687 3300005614 Ga0068856_100027264 Ga0068856_1000272647 166
688 3300005614 Ga0068856_100239611 Ga0068856_1002396112 166
689 3300005614 Ga0068856_100268900 Ga0068856_1002689003 166
690 3300005614 Ga0068856_100748417 Ga0068856_1007484172 166
691 3300005616 Ga0068852_100045174 Ga0068852_1000451743 166
692 3300005616 Ga0068852_100129121 Ga0068852_1001291213 166
693 3300005616 Ga0068852_100171997 Ga0068852_1001719972 166
694 3300005616 Ga0068852_100432007 Ga0068852_1004320072 166
695 3300005617 Ga0068859_100012786 Ga0068859_1000127867 166
696 3300005617 Ga0068859_100062223 Ga0068859_1000622236 166
697 3300005618 Ga0068864_100282914 Ga0068864_1002829142 166
698 3300005718 Ga0068866_10376561 Ga0068866_103765612 166
699 3300005841 Ga0068863_100191650 Ga0068863_1001916502 166
700 3300005842 Ga0068858_101926022 Ga0068858_1019260221 166
701 3300005843 Ga0068860_100144276 Ga0068860_1001442763 166
702 3300005843 Ga0068860_100409119 Ga0068860_1004091192 166
703 3300006173 Ga0070716_100311487 Ga0070716_1003114872 166
704 3300006237 Ga0097621_100038084 Ga0097621_1000380842 166
705 3300006237 Ga0097621_100176949 Ga0097621_1001769493 166
706 3300006237 Ga0097621_100276775 Ga0097621_1002767752 166
707 3300006237 Ga0097621_100381119 Ga0097621_1003811191 166
708 3300006237 Ga0097621_100571085 Ga0097621_1005710851 166
709 3300006358 Ga0068871_100001620 Ga0068871_1000016207 166
710 3300006358 Ga0068871_100214616 Ga0068871_1002146162 166
711 3300006358 Ga0068871_100815088 Ga0068871_1008150882 166
712 3300006852 Ga0075433_10794443 Ga0075433_107944432 166
713 3300006931 Ga0097620_100012786 Ga0097620_1000127867 166
714 3300006931 Ga0097620_100062214 Ga0097620_1000622146 166
715 3300009093 Ga0105240_10084876 Ga0105240_100848763 166
716 3300009093 Ga0105240_10829797 Ga0105240_108297971 166
717 3300009174 Ga0105241_10030431 Ga0105241_100304313 166
718 3300009174 Ga0105241_10437569 Ga0105241_104375692 166
719 3300009174 Ga0105241_11463677 Ga0105241_114636772 166
720 3300009176 Ga0105242_10401198 Ga0105242_104011981 166
721 3300009545 Ga0105237_10004005 Ga0105237_100040052 166
722 3300009545 Ga0105237_10010008 Ga0105237_100100089 166
723 3300009553 Ga0105249_10366172 Ga0105249_103661723 166
724 3300010375 Ga0105239_10004037 Ga0105239_100040376 166
725 3300010375 Ga0105239_10150347 Ga0105239_101503471 166
726 3300010375 Ga0105239_10483579 Ga0105239_104835791 166
727 3300010375 Ga0105239_10592093 Ga0105239_105920932 166
728 3300011119 Ga0105246_10953708 Ga0105246_109537081 166
729 3300013100 Ga0157373_10018427 Ga0157373_100184276 166
730 3300013100 Ga0157373_10037201 Ga0157373_100372013 166
731 3300013100 Ga0157373_10050752 Ga0157373_100507522 166
732 3300013100 Ga0157373_10136008 Ga0157373_101360082 166
733 3300013100 Ga0157373_10136213 Ga0157373_101362132 166
734 3300013100 Ga0157373_10321143 Ga0157373_103211431 166
735 3300013102 Ga0157371_10001581 Ga0157371_1000158117 166
736 3300013102 Ga0157371_10002078 Ga0157371_1000207815 166
737 3300013102 Ga0157371_10012460 Ga0157371_100124604 166
738 3300013102 Ga0157371_10014736 Ga0157371_100147365 166
739 3300013102 Ga0157371_10015309 Ga0157371_100153092 166
740 3300013102 Ga0157371_10022447 Ga0157371_100224472 166
741 3300013102 Ga0157371_10023699 Ga0157371_100236992 166
742 3300013102 Ga0157371_10024351 Ga0157371_100243512 166
743 3300013102 Ga0157371_10033712 Ga0157371_100337122 166
744 3300013102 Ga0157371_10042932 Ga0157371_100429322 166
745 3300013102 Ga0157371_10047058 Ga0157371_100470585 166
746 3300013102 Ga0157371_10053131 Ga0157371_100531313 166
747 3300013102 Ga0157371_10217155 Ga0157371_102171552 166
748 3300013102 Ga0157371_10366935 Ga0157371_103669352 166
749 3300013102 Ga0157371_10404257 Ga0157371_104042572 166
750 3300013104 Ga0157370_10000839 Ga0157370_100008396 166
751 3300013104 Ga0157370_10009106 Ga0157370_100091063 166
752 3300013104 Ga0157370_10009601 Ga0157370_100096012 166
753 3300013104 Ga0157370_10092498 Ga0157370_100924982 166
754 3300013104 Ga0157370_10202797 Ga0157370_102027972 166
755 3300013104 Ga0157370_10434318 Ga0157370_104343181 166
756 3300013104 Ga0157370_10894771 Ga0157370_108947712 166
757 3300013104 Ga0157370_11242964 Ga0157370_112429641 166
758 3300013105 Ga0157369_10022359 Ga0157369_100223594 166
759 3300013105 Ga0157369_10037575 Ga0157369_100375753 166
760 3300013105 Ga0157369_10051875 Ga0157369_100518754 166
761 3300013105 Ga0157369_10055484 Ga0157369_100554843 166
762 3300013105 Ga0157369_10077819 Ga0157369_100778195 166
763 3300013105 Ga0157369_10263109 Ga0157369_102631092 166
764 3300013105 Ga0157369_10291781 Ga0157369_102917811 166
765 3300013105 Ga0157369_10424442 Ga0157369_104244422 166
766 3300013105 Ga0157369_10499261 Ga0157369_104992612 166
767 3300013105 Ga0157369_10550918 Ga0157369_105509182 166
768 3300013105 Ga0157369_10703324 Ga0157369_107033242 166
769 3300013296 Ga0157374_10001675 Ga0157374_100016756 166
770 3300013296 Ga0157374_10014794 Ga0157374_100147943 166
771 3300013296 Ga0157374_10794137 Ga0157374_107941372 166
772 3300013296 Ga0157374_10892480 Ga0157374_108924801 166
773 3300013297 Ga0157378_10052335 Ga0157378_100523354 166
774 3300013297 Ga0157378_10270484 Ga0157378_102704842 166
775 3300013297 Ga0157378_10798328 Ga0157378_107983282 166
776 3300013297 Ga0157378_11053412 Ga0157378_110534121 166
777 3300013297 Ga0157378_11572202 Ga0157378_115722022 166
778 3300013306 Ga0163162_10000728 Ga0163162_100007287 166
779 3300013306 Ga0163162_10789470 Ga0163162_107894701 166
780 3300013306 Ga0163162_11998703 Ga0163162_119987031 166
781 3300013307 Ga0157372_10018692 Ga0157372_1001869210 166
782 3300013307 Ga0157372_10029680 Ga0157372_100296804 166
783 3300013307 Ga0157372_10036833 Ga0157372_100368333 166
784 3300013307 Ga0157372_10044383 Ga0157372_100443833 166
785 3300013307 Ga0157372_10142387 Ga0157372_101423873 166
786 3300013307 Ga0157372_10159452 Ga0157372_101594522 166
787 3300013307 Ga0157372_10218308 Ga0157372_102183082 166
788 3300013307 Ga0157372_10242462 Ga0157372_102424621 166
789 3300013307 Ga0157372_10293441 Ga0157372_102934413 166
790 3300013307 Ga0157372_10455127 Ga0157372_104551271 166
791 3300013307 Ga0157372_10544066 Ga0157372_105440661 166
792 3300013307 Ga0157372_10862735 Ga0157372_108627352 166
793 3300013307 Ga0157372_11053847 Ga0157372_110538471 166
794 3300013307 Ga0157372_12074016 Ga0157372_120740161 166
795 3300013307 Ga0157372_12217092 Ga0157372_122170921 166
796 3300013307 Ga0157372_12282896 Ga0157372_122828961 166
797 3300013308 Ga0157375_10081337 Ga0157375_100813372 166
798 3300013308 Ga0157375_11113980 Ga0157375_111139802 166
799 3300013308 Ga0157375_11690548 Ga0157375_116905481 166
800 3300013308 Ga0157375_13031844 Ga0157375_130318441 166
801 3300014325 Ga0163163_10302871 Ga0163163_103028712 166
802 3300014325 Ga0163163_11054393 Ga0163163_110543931 166
803 3300014325 Ga0163163_11526126 Ga0163163_115261261 166
804 3300014968 Ga0157379_10769718 Ga0157379_107697181 166
805 3300014969 Ga0157376_11248218 Ga0157376_112482181 166
806 3300014969 Ga0157376_12355995 Ga0157376_123559951 166
807 3300017792 Ga0163161_11281679 Ga0163161_112816791 166
808 3300021384 Ga0213876_10003898 Ga0213876_100038981 166
809 3300021384 Ga0213876_10034603 Ga0213876_100346031 166
810 3300025302 Ga0207426_1000009 Ga0207426_1000009168 166
811 3300025899 Ga0207642_10136125 Ga0207642_101361252 166
812 3300025903 Ga0207680_10165480 Ga0207680_101654802 166
813 3300025904 Ga0207647_10000251 Ga0207647_100002517 166
814 3300025904 Ga0207647_10020208 Ga0207647_100202083 166
815 3300025904 Ga0207647_10151964 Ga0207647_101519642 166
816 3300025904 Ga0207647_10212579 Ga0207647_102125792 166
817 3300025908 Ga0207643_10308607 Ga0207643_103086071 166
818 3300025909 Ga0207705_10021200 Ga0207705_100212003 166
819 3300025909 Ga0207705_10029489 Ga0207705_100294893 166
820 3300025909 Ga0207705_10091251 Ga0207705_100912512 166
821 3300025909 Ga0207705_10236648 Ga0207705_102366482 166
822 3300025909 Ga0207705_10763126 Ga0207705_107631261 166
823 3300025911 Ga0207654_10068709 Ga0207654_100687092 166
824 3300025912 Ga0207707_10115783 Ga0207707_101157832 166
825 3300025912 Ga0207707_10125792 Ga0207707_101257922 166
826 3300025912 Ga0207707_10178835 Ga0207707_101788352 166
827 3300025912 Ga0207707_10180730 Ga0207707_101807302 166
828 3300025912 Ga0207707_10196694 Ga0207707_101966942 166
829 3300025913 Ga0207695_10003298 Ga0207695_100032984 166
830 3300025914 Ga0207671_10051116 Ga0207671_100511162 166
831 3300025914 Ga0207671_10075431 Ga0207671_100754313 166
832 3300025917 Ga0207660_10021031 Ga0207660_100210313 166
833 3300025917 Ga0207660_10055681 Ga0207660_100556812 166
834 3300025917 Ga0207660_10230898 Ga0207660_102308981 166
835 3300025919 Ga0207657_10005581 Ga0207657_1000558111 166
836 3300025919 Ga0207657_10011432 Ga0207657_100114322 166
837 3300025919 Ga0207657_10099354 Ga0207657_100993542 166
838 3300025919 Ga0207657_10120985 Ga0207657_101209852 166
839 3300025919 Ga0207657_10209080 Ga0207657_102090802 166
840 3300025919 Ga0207657_10657325 Ga0207657_106573251 166
841 3300025919 Ga0207657_10967241 Ga0207657_109672411 166
842 3300025919 Ga0207657_11009550 Ga0207657_110095501 166
843 3300025920 Ga0207649_10069788 Ga0207649_100697882 166
844 3300025921 Ga0207652_10000724 Ga0207652_1000072410 166
845 3300025921 Ga0207652_10000890 Ga0207652_1000089020 166
846 3300025921 Ga0207652_10034793 Ga0207652_100347935 166
847 3300025921 Ga0207652_10093238 Ga0207652_100932382 166
848 3300025921 Ga0207652_10152773 Ga0207652_101527731 166
849 3300025921 Ga0207652_10172833 Ga0207652_101728332 166
850 3300025921 Ga0207652_10656858 Ga0207652_106568581 166
851 3300025921 Ga0207652_10825052 Ga0207652_108250521 166
852 3300025921 Ga0207652_11034441 Ga0207652_110344412 166
853 3300025925 Ga0207650_10253823 Ga0207650_102538232 166
854 3300025925 Ga0207650_10978334 Ga0207650_109783341 166
855 3300025926 Ga0207659_10032943 Ga0207659_100329432 166
856 3300025926 Ga0207659_10172249 Ga0207659_101722492 166
857 3300025931 Ga0207644_10042847 Ga0207644_100428472 166
858 3300025932 Ga0207690_10008391 Ga0207690_100083915 166
859 3300025932 Ga0207690_10207373 Ga0207690_102073731 166
860 3300025932 Ga0207690_10283820 Ga0207690_102838201 166
861 3300025932 Ga0207690_10577291 Ga0207690_105772912 166
862 3300025933 Ga0207706_10007504 Ga0207706_1000750410 166
863 3300025933 Ga0207706_10627942 Ga0207706_106279422 166
864 3300025933 Ga0207706_11017330 Ga0207706_110173301 166
865 3300025933 Ga0207706_11121606 Ga0207706_111216061 166
866 3300025936 Ga0207670_10116988 Ga0207670_101169882 166
867 3300025939 Ga0207665_10626778 Ga0207665_106267782 166
868 3300025940 Ga0207691_10129821 Ga0207691_101298212 166
869 3300025940 Ga0207691_10280921 Ga0207691_102809212 166
870 3300025940 Ga0207691_10407535 Ga0207691_104075352 166
871 3300025940 Ga0207691_10968110 Ga0207691_109681101 166
872 3300025942 Ga0207689_10154530 Ga0207689_101545302 166
873 3300025942 Ga0207689_11394120 Ga0207689_113941201 166
874 3300025944 Ga0207661_10043909 Ga0207661_100439094 166
875 3300025944 Ga0207661_11750591 Ga0207661_117505911 166
876 3300025945 Ga0207679_10007517 Ga0207679_100075177 166
877 3300025945 Ga0207679_10089289 Ga0207679_100892892 166
878 3300025949 Ga0207667_10000150 Ga0207667_1000015079 166
879 3300025949 Ga0207667_10006165 Ga0207667_100061653 166
880 3300025949 Ga0207667_10056766 Ga0207667_100567665 166
881 3300025949 Ga0207667_10129400 Ga0207667_101294001 166
882 3300025949 Ga0207667_10483734 Ga0207667_104837342 166
883 3300025949 Ga0207667_10587098 Ga0207667_105870982 166
884 3300025960 Ga0207651_10065203 Ga0207651_100652032 166
885 3300025961 Ga0207712_10049091 Ga0207712_100490912 166
886 3300025981 Ga0207640_10401479 Ga0207640_104014792 166
887 3300025981 Ga0207640_10623045 Ga0207640_106230452 166
888 3300025981 Ga0207640_10662774 Ga0207640_106627741 166
889 3300025986 Ga0207658_10320445 Ga0207658_103204451 166
890 3300025986 Ga0207658_10591359 Ga0207658_105913592 166
891 3300026023 Ga0207677_10038230 Ga0207677_100382302 166
892 3300026023 Ga0207677_10431020 Ga0207677_104310202 166
893 3300026041 Ga0207639_10031059 Ga0207639_100310592 166
894 3300026041 Ga0207639_10043279 Ga0207639_100432795 166
895 3300026041 Ga0207639_10070407 Ga0207639_100704073 166
896 3300026041 Ga0207639_10090185 Ga0207639_100901852 166
897 3300026041 Ga0207639_10686999 Ga0207639_106869992 166
898 3300026041 Ga0207639_10696468 Ga0207639_106964682 166
899 3300026041 Ga0207639_10720750 Ga0207639_107207502 166
900 3300026041 Ga0207639_11403453 Ga0207639_114034531 166
901 3300026067 Ga0207678_10015706 Ga0207678_100157063 166
902 3300026067 Ga0207678_10171443 Ga0207678_101714431 166
903 3300026067 Ga0207678_10190018 Ga0207678_101900182 166
904 3300026078 Ga0207702_10026742 Ga0207702_100267422 166
905 3300026078 Ga0207702_10090258 Ga0207702_100902582 166
906 3300026078 Ga0207702_10172218 Ga0207702_101722182 166
907 3300026078 Ga0207702_10962950 Ga0207702_109629501 166
908 3300026089 Ga0207648_10011328 Ga0207648_100113282 166
909 3300026089 Ga0207648_10039542 Ga0207648_100395422 166
910 3300026089 Ga0207648_10270967 Ga0207648_102709672 166
911 3300026095 Ga0207676_10290674 Ga0207676_102906742 166
912 3300026095 Ga0207676_10395937 Ga0207676_103959372 166
913 3300026095 Ga0207676_11548494 Ga0207676_115484941 166
914 3300026116 Ga0207674_10061389 Ga0207674_100613892 166
915 3300026116 Ga0207674_10596562 Ga0207674_105965621 166
916 3300026116 Ga0207674_10639229 Ga0207674_106392292 166
917 3300026118 Ga0207675_100567502 Ga0207675_1005675022 166
918 3300026118 Ga0207675_100605736 Ga0207675_1006057362 166
919 3300026121 Ga0207683_10296987 Ga0207683_102969872 166
920 3300026142 Ga0207698_10036197 Ga0207698_100361973 166
921 3300026142 Ga0207698_10179378 Ga0207698_101793782 166
922 3300026142 Ga0207698_10424176 Ga0207698_104241762 166
923 3300028379 Ga0268266_10261163 Ga0268266_102611631 166
924 3300028381 Ga0268264_10115124 Ga0268264_101151243 166
925 3300028381 Ga0268264_10169204 Ga0268264_101692042 166
926 3300028381 Ga0268264_11448476 Ga0268264_114484761 166
927 3300028794 Ga0307515_10000001 Ga0307515_1000000178 166
928 3300029957 Ga0265324_10030428 Ga0265324_100304282 166
929 3300031251 Ga0265327_10000561 Ga0265327_1000056156 166
930 3300031251 Ga0265327_10000644 Ga0265327_1000064443 166
931 3300031344 Ga0265316_10125612 Ga0265316_101256122 166
932 3300031730 Ga0307516_10000659 Ga0307516_100006597 166
933 3300031852 Ga0307410_10467752 Ga0307410_104677522 166
934 3300036401 Ga0373937_0287977 Ga0373937_0287977_611_1111 166
935 3300037312 Ga0395899_0004711 Ga0395899_0004711_7596_8102 166
936 3300037312 Ga0395899_0008459 Ga0395899_0008459_1622_2128 166
937 3300037312 Ga0395899_0018136 Ga0395899_0018136_3794_4303 166
938 3300037312 Ga0395899_0341255 Ga0395899_0341255_259_765 166
939 3300037418 Ga0395900_0029140 Ga0395900_0029140_4466_4972 166
940 3300037418 Ga0395900_0100541 Ga0395900_0100541_1695_2201 166
941 3300037418 Ga0395900_0105919 Ga0395900_0105919_1150_1656 166
942 3300037418 Ga0395900_0130037 Ga0395900_0130037_1835_2344 166
943 3300037418 Ga0395900_0130238 Ga0395900_0130238_912_1418 166
944 3300037418 Ga0395900_0141624 Ga0395900_0141624_571_1077 166
945 3300037466 Ga0395898_0005225 Ga0395898_0005225_2973_3479 166
946 3300037466 Ga0395898_0006375 Ga0395898_0006375_11657_12166 166
947 3300037466 Ga0395898_0006854 Ga0395898_0006854_321_827 166
948 3300037466 Ga0395898_0038783 Ga0395898_0038783_2138_2644 166
949 3300037466 Ga0395898_0109198 Ga0395898_0109198_1695_2201 166
950 3300037466 Ga0395898_0223593 Ga0395898_0223593_825_1331 166
951 3300037471 Ga0395905_0063908 Ga0395905_0063908_2193_2693 166
952 3300037471 Ga0395905_0157537 Ga0395905_0157537_1315_1821 166
953 3300037471 Ga0395905_0221396 Ga0395905_0221396_65_571 166
954 3300038443 Ga0395901_0067999 Ga0395901_0067999_944_1450 166
955 3300038443 Ga0395901_0068548 Ga0395901_0068548_141_647 166
956 3300038443 Ga0395901_0596168 Ga0395901_0596168_223_729 166
957 3300038443 Ga0395901_1038104 Ga0395901_1038104_175_681 166
958 3300039437 Ga0436365_0292805 Ga0436365_0292805_1904_2404 166
959 3300039437 Ga0436365_0679026 Ga0436365_0679026_396_896 166
960 3300039437 Ga0436365_1777169 Ga0436365_1777169_198_698 166
961 3300039437 Ga0436365_1787697 Ga0436365_1787697_141_641 166
962 3300039437 Ga0436365_1843588 Ga0436365_1843588_1042_1548 166
963 3300041451 Ga0451791_0337579 Ga0451791_0337579_181_684 166
964 3300041452 Ga0451793_1328930 Ga0451793_1328930_70_570 166
965 3300041486 Ga0451807_0964785 Ga0451807_0964785_479_979 166
966 3300041486 Ga0451807_1126478 Ga0451807_1126478_263_763 166
967 3300046543 Ga0495645_0194987 Ga0495645_0194987_680_1180 166
968 3300046616 Ga0495668_0000414 Ga0495668_0000414_39712_40212 166
969 3300046616 Ga0495668_0000687 Ga0495668_0000687_28864_29364 166
970 3300047315 Ga0495581_0500692 Ga0495581_0500692_101_601 166
971 3300047472 Ga0495686_0000365 Ga0495686_0000365_12425_12925 166
972 3300048088 Ga0495602_0948768 Ga0495602_0948768_12_512 166
973 3300048927 Ga0496124_0039130 Ga0496124_0039130_1382_1885 166
974 3300049513 Ga0501290_043200 Ga0501290_043200_153_653 166
975 3300049515 Ga0501292_014182 Ga0501292_014182_243_743 166
976 3300049521 Ga0501298_000846 Ga0501298_000846_1495_1995 166
977 3300049521 Ga0501298_099476 Ga0501298_099476_69_569 166
978 3300049522 Ga0501299_026758 Ga0501299_026758_159_659 166
979 3300049570 Ga0501033_0213874 Ga0501033_0213874_124_624 166
980 3300049571 Ga0501034_0043414 Ga0501034_0043414_2638_3138 166
981 3300049571 Ga0501034_0056988 Ga0501034_0056988_237_737 166
982 3300049571 Ga0501034_0064577 Ga0501034_0064577_1977_2477 166
983 3300049571 Ga0501034_0241423 Ga0501034_0241423_812_1321 166
984 3300049574 Ga0501038_0189249 Ga0501038_0189249_155_655 166
985 3300049579 Ga0501043_0215461 Ga0501043_0215461_155_655 166
986 3300049580 Ga0501046_0313920 Ga0501046_0313920_16_516 166
987 3300049586 Ga0501070_0157999 Ga0501070_0157999_693_1193 166
988 3300049586 Ga0501070_0242131 Ga0501070_0242131_358_864 166
989 3300049649 Ga0501198_025778 Ga0501198_025778_161_661 166
990 3300049651 Ga0501201_022292 Ga0501201_022292_33_533 166
991 3300049652 Ga0501202_000117 Ga0501202_000117_6651_7151 166
992 3300049654 Ga0501207_008644 Ga0501207_008644_307_807 166
993 3300049661 Ga0501217_007565 Ga0501217_007565_242_742 166
994 3300049661 Ga0501217_025137 Ga0501217_025137_560_1060 166
995 3300049662 Ga0501222_002596 Ga0501222_002596_1328_1828 166
996 3300049663 Ga0501223_000917 Ga0501223_000917_613_1113 166
997 3300049663 Ga0501223_053674 Ga0501223_053674_97_597 166
998 3300049669 Ga0501235_001601 Ga0501235_001601_2047_2547 166
999 3300049673 Ga0501240_005695 Ga0501240_005695_302_802 166
1000 3300049674 Ga0501242_006915 Ga0501242_006915_161_661 166
1001 3300049675 Ga0501243_008127 Ga0501243_008127_667_1167 166
1002 3300049688 Ga0501259_003424 Ga0501259_003424_1584_2084 166
1003 3300049689 Ga0501260_016409 Ga0501260_016409_51_551 166
1004 3300049705 Ga0501225_0003109 Ga0501225_0003109_863_1363 166
1005 3300049706 Ga0501229_012511 Ga0501229_012511_492_992 166
1006 3300049707 Ga0501234_018598 Ga0501234_018598_404_904 166
1007 3300049708 Ga0501245_003515 Ga0501245_003515_863_1363 166
1008 3300049742 Ga0501080_0137740 Ga0501080_0137740_1426_1926 166
1009 3300049742 Ga0501080_1073363 Ga0501080_1073363_109_636 166
1010 3300049757 Ga0501232_000601 Ga0501232_000601_165_665 166
1011 3300049765 Ga0501268_039146 Ga0501268_039146_180_680 166
1012 3300049766 Ga0501269_006739 Ga0501269_006739_74_574 166
1013 3300049768 Ga0501271_046959 Ga0501271_046959_65_565 166
1014 3300049822 Ga0501035_0210161 Ga0501035_0210161_76_582 166
1015 3300049822 Ga0501035_0351325 Ga0501035_0351325_19_519 166
1016 3300049823 Ga0501044_0036351 Ga0501044_0036351_666_1166 166
1017 3300049823 Ga0501044_0134272 Ga0501044_0134272_130_636 166
1018 3300049823 Ga0501044_1119370 Ga0501044_1119370_16_516 166
1019 3300049851 Ga0501212_002304 Ga0501212_002304_1155_1655 166
1020 3300053088 Ga0500644_0054102 Ga0500644_0054102_388_888 166
1021 3300053104 Ga0500556_0020343 Ga0500556_0020343_849_1349 166
1022 3300053108 Ga0500562_000007 Ga0500562_000007_200531_201031 166
1023 3300053130 Ga0500642_0313814 Ga0500642_0313814_45_545 166
1024 3300053153 Ga0500616_0003144 Ga0500616_0003144_2775_3275 166
1025 3300053156 Ga0500622_0000575 Ga0500622_0000575_26083_26583 166
1026 3300055283 Ga0500661_010455 Ga0500661_010455_1145_1645 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

17

58

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

17

64

0.99

PF01047

MarR

MarR family

17

67

0.94

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

79

151

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qww-assembly3.cif.gz_F crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9051 17 61
2qww-assembly2.cif.gz_D crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.892 17 61
4rgr-assembly1.cif.gz_A crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp 0.8759 17 61
4rgx-assembly1.cif.gz_B-2 crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid 0.8757 17 61
5hsm-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis marr family protein rv2887 0.8727 17 65
ID Description Score Start End Superfamily
1i1gA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9822 17 66 1.10.10.10
2znyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9737 17 68 1.10.10.10
1i1gB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9729 17 66 1.10.10.10
2cfxE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9715 15 64 1.10.10.10
2vbwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9711 18 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6P1B4N1-F1-model_v4 deleted 0.9344 81 156
AF-A0A6P1B4N1-F1-model_v4 deleted 0.9112 81 156
AF-M7U6E1-F1-model_v4 deleted 0.8931 78 154
AF-X1HMR2-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.8893 78 156
AF-A0A842SQG5-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.8842 79 156

Feature Viewer

pLDDT pTM Quality
81.52 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map