F488456

General Info

Members Datasets Scaffolds Average Seq Length
1023 748 506 243

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000046|Ga0500618_000046_78220_79044
Length 274
Sequence MDGDTSGGRRSCGDHRDGYVHAVSVRTVIVRANFRLQRLFIDTPLGVETRHELASEQFNYLANVLRLEAGAKVLVFNGRDGEWLAQVTFPSRKKIVLELTEQTRPQPEASDLHYLFAPLKVGRLDYLVQKAVEMGAGLLQPVMTQHVQGKITNLDRLRANVAEAAEQCGVLSIPDVLEPRKLADLLDHWPSDRRIIYCDEGDEGQNPLPVLANVTERKLALLVGPEGGFSEEERGLLRSLPFVTAIPLGPRILRADTAAVAALAIIQAAVGDWR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
22 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
25 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
26 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
27 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
28 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
29 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
34 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
35 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
36 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
37 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
38 2519899620 Rhizobium sp. Pop5 Isolate Nodule
39 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
40 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
41 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
42 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
43 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
44 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
45 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
46 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
47 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
51 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
52 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
53 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
54 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
55 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
56 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
60 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
61 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
62 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
63 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
64 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
65 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
66 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
67 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
68 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
69 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
70 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
71 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
72 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
73 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
74 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
75 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
76 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
77 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
78 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
79 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
80 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
81 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
82 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
83 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
84 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
85 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
86 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
87 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
88 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
89 2643221557 Ensifer sp. Root558 Isolate Unclassified
90 2643221582 Rhizobium sp. Root651 Isolate Unclassified
91 2643221607 Rhizobium sp. Root73 Isolate Unclassified
92 2643221610 Ensifer sp. Root74 Isolate Unclassified
93 2643221618 Ensifer sp. Root231 Isolate Unclassified
94 2643221626 Ensifer sp. Root31 Isolate Unclassified
95 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
96 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
97 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
98 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
99 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
100 2643221655 Ensifer sp. Root1252 Isolate Unclassified
101 2643221659 Ensifer sp. Root127 Isolate Unclassified
102 2643221668 Ensifer sp. Root423 Isolate Unclassified
103 2643221675 Ensifer sp. Root1298 Isolate Unclassified
104 2643221680 Ensifer sp. Root1312 Isolate Unclassified
105 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
106 2643221688 Rhizobium sp. Root482 Isolate Unclassified
107 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
108 2643221693 Rhizobium sp. Root491 Isolate Unclassified
109 2643221698 Ensifer sp. Root142 Isolate Unclassified
110 2643221712 Ensifer sp. Root258 Isolate Unclassified
111 2643221718 Rhizobium sp. Root268 Isolate Unclassified
112 2643221719 Rhizobium sp. Root274 Isolate Unclassified
113 2643221723 Ensifer sp. Root278 Isolate Unclassified
114 2643221726 Ensifer sp. Root954 Isolate Unclassified
115 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
118 2718217882 Rhizobium sp. N741 Isolate Nodule
119 2718217927 Rhizobium sp. N324 Isolate Nodule
120 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
121 2718218009 Rhizobium sp. N561 Isolate Nodule
122 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
123 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
124 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
125 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
126 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
127 2718218363 Rhizobium sp. N113 Isolate Nodule
128 2718218365 Rhizobium sp. N731 Isolate Nodule
129 2718218366 Rhizobium sp. N621 Isolate Nodule
130 2718218423 Rhizobium sp. N941 Isolate Nodule
131 2721755514 Rhizobium sp. N6212 Isolate Nodule
132 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
133 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
134 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
135 2721755809 Rhizobium sp. N541 Isolate Nodule
136 2721755810 Rhizobium sp. N871 Isolate Nodule
137 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
138 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
139 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
140 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
141 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
142 2728369365 Rhizobium sp. N1341 Isolate Nodule
143 2728369397 Rhizobium sp. N1314 Isolate Nodule
144 2738541293 Rhizobium sp. GV031 Isolate Unclassified
145 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
146 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
147 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
148 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
149 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
150 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
151 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
152 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
153 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
154 2791355256 Rhizobium sp. M10 Isolate Nodule
155 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
156 2791355260 Rhizobium sp. L9 Isolate Nodule
157 2791355262 Rhizobium sp. M1 Isolate Nodule
158 2791355263 Rhizobium chutanense C5 Isolate Nodule
159 2791355264 Rhizobium sp. S9 Isolate Nodule
160 2791355265 Rhizobium sp. H4 Isolate Nodule
161 2791355266 Rhizobium sp. L43 Isolate Nodule
162 2791355267 Rhizobium sp. L18 Isolate Nodule
163 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
164 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
165 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
166 2802429633 Rhizobium anhuiense J3 Isolate Nodule
167 2802429634 Rhizobium anhuiense S10 Isolate Nodule
168 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
169 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
170 2802429637 Rhizobium anhuiense C15 Isolate Nodule
171 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
172 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
173 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
174 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
175 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
176 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
177 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
178 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
179 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
180 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
181 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
182 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
183 2838048938 Rhizobium pisi 27/80 Isolate Nodule
184 2838061910 Rhizobium phaseoli L15 Isolate Nodule
185 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
186 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
187 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
188 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
189 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
190 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
191 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
192 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
193 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
194 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
195 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
196 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
197 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
198 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
199 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
200 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
201 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
202 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
203 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
204 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
205 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
206 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
207 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
208 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
209 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
210 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
211 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
212 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
213 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
214 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
215 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
216 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
217 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
218 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
219 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
220 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
221 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
222 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
223 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
224 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
225 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
226 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
227 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
228 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
229 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
230 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
231 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
232 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
233 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
234 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
235 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
236 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
237 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
238 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
239 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
240 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
241 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
242 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
243 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
244 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
245 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
246 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
247 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
248 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
249 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
250 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
251 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
252 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
253 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
254 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
255 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
256 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
257 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
258 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
259 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
260 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
261 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
262 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
263 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
264 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
265 2844163670 Ensifer sp. 1H6 Isolate Unclassified
266 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
267 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
268 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
269 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
270 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
271 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
272 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
273 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
274 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
275 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
276 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
277 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
278 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
279 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
280 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
281 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
282 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
283 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
284 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
285 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
286 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
287 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
288 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
289 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
290 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
291 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
292 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
293 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
294 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
295 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
296 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
297 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
298 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
299 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
300 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
301 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
302 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
303 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
304 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
305 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
306 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
307 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
308 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
309 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
310 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
311 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
312 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
313 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
314 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
315 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
316 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
317 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
318 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
319 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
320 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
321 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
322 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
323 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
324 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
325 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
326 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
327 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
328 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
329 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
330 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
331 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
332 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
333 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
334 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
335 2933599457 Rhizobium phaseoli M3 Isolate Nodule
336 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
337 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
338 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
339 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
340 2936381700 Rhizobium chutanense C16 Isolate Unclassified
341 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
342 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
343 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
344 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
345 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
346 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
347 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
348 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
349 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
350 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
351 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
352 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
353 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
354 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
355 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
356 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
357 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
358 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
359 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
360 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
361 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
362 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
363 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
364 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
365 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
366 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
367 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
368 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
369 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
370 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
371 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
372 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
373 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
374 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
375 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
376 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
377 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
378 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
379 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
380 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
381 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
382 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
383 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
384 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
385 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
386 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
387 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
388 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
389 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
390 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
391 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
392 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
393 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
394 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
395 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
396 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
397 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
398 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
399 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
400 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
401 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
402 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
403 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
404 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
405 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
406 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
407 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
408 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
409 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
410 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
411 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
412 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
413 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
414 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
415 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
416 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
417 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
418 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
419 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
420 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
421 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
422 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
423 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
424 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
425 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
426 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
427 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
428 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
429 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
430 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
431 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
432 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
433 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
434 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
435 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
436 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
437 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
438 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
439 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
440 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
441 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
442 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
443 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
444 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
445 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
446 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
447 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
448 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
449 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
450 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
451 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
452 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
453 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
454 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
455 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
456 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
457 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
458 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
459 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
460 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
461 2996887358 Rhizobium sp. R711 Isolate Nodule
462 2996893221 Rhizobium sp. R635 Isolate Nodule
463 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
464 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
465 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
466 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
467 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
468 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
469 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
470 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
471 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
472 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
473 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
474 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
475 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
476 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
477 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
478 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
479 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
480 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
481 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
482 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
483 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
484 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
485 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
486 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
487 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
488 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
489 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
490 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
491 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
492 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
493 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
494 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
495 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
496 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
497 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
498 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
499 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
500 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
501 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
502 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
503 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
504 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
505 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
506 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
507 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
508 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
509 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
510 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
511 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
512 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
513 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
514 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
515 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
516 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
517 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
518 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
519 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
520 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
521 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
522 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
523 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
524 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
525 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
526 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
527 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
528 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
529 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
530 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
531 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
532 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
533 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
534 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
535 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
536 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
537 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
539 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
540 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
541 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
542 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
543 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
544 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
545 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
546 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
547 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
548 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
549 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
550 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
551 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
552 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
561 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
563 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
564 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
565 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
567 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
568 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
569 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
570 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
571 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
572 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
573 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
574 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
575 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
576 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
577 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
578 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
579 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
580 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
581 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
582 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
583 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
584 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
585 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
586 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
587 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
588 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
589 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
590 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
591 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
592 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
593 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
594 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
595 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
596 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
597 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
598 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
599 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
600 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
601 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
602 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
603 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
604 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
605 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
606 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
607 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
608 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
609 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
610 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
611 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
612 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
613 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
614 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
615 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
616 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
617 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
618 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
619 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
620 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
621 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
622 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
623 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
624 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
625 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
626 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
627 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
628 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
629 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
630 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
631 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
632 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
633 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
634 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
635 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
636 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
637 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
638 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
639 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
640 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
641 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
642 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
643 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
644 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
645 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
646 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
647 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
648 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
649 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
650 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
651 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
652 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
653 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
654 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
655 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
656 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
657 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
658 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
659 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
660 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
661 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
662 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
663 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
664 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
666 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
667 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
668 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
669 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
670 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
671 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
672 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
673 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
674 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
675 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
676 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
677 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
678 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
679 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
680 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
681 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
682 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
683 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
684 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
685 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
686 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
687 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
688 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
689 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
690 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
691 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
692 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
693 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
694 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
695 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
696 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
697 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
698 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
699 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
700 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
701 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
702 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
703 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
704 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
705 8005258706 Rhizobium sp. R693 Isolate Nodule
706 8005275841 Rhizobium sp. N4311 Isolate Nodule
707 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
708 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
709 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
710 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
711 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
712 8005321885 Rhizobium sp. R72 Isolate Nodule
713 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
714 8005382845 Rhizobium sp. R634 Isolate Nodule
715 8005395548 Rhizobium sp. R339 Isolate Nodule
716 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
717 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
718 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
719 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
720 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
721 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
722 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
723 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
724 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
725 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
726 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
727 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
728 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
729 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
730 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
731 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
732 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
733 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
734 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
735 8018176218 Rhizobium sp. N122 Isolate Nodule
736 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
737 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
738 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
739 8024501048 Rhizobium sp. H4 Isolate Nodule
740 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
741 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
742 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
743 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
744 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
745 8056382006 Rhizobium croatiense 13T Isolate Nodule
746 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
747 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
748 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.46
Metatranscriptomes 0
Isolates 50.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 20.23
Nodule 37.83
Rhizoplane 1.76
Rhizosphere 20.23
Stem 0
Stem Tuber 0
Unclassified 19.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000023 3300002704 Bacteria 136961
2 JGI25156J39149_1000094 3300002705 Bacteria 65145
3 JGI25162J39368_1000177 3300002737 Bacteria 68786
4 JGI25162J39368_1000803 3300002737 Bacteria 20853
5 JGI25154J39366_1000213 3300002738 Bacteria 40261
6 JGI25158J39367_1000091 3300002739 Bacteria 21033
7 JGI25158J39367_1004200 3300002739 Bacteria 2171
8 JGI25157J39369_1000043 3300002741 Bacteria 122537
9 JGI25152J39213_1002205 3300002773 Bacteria 7572
10 JGI25152J39213_1003952 3300002773 Bacteria 4844
11 JGI25152J39213_1004109 3300002773 Bacteria 4703
12 JGI25152J39213_1017526 3300002773 Bacteria 1350
13 JGI25150J39212_1000378 3300002774 Bacteria 21367
14 JGI25159J45721_1000016 3300002987 Bacteria 139656
15 JGI25159J45721_1000279 3300002987 Bacteria 24002
16 JGI25159J45721_1003209 3300002987 Bacteria 5855
17 JGI25151J46595_10000250 3300003187 Bacteria 62876
18 JGI25151J46595_10000565 3300003187 Bacteria 33453
19 JGI25151J46595_10005624 3300003187 Bacteria 6444
20 JGI25151J46595_10012978 3300003187 Bacteria 3764
21 JGI25151J46595_10017052 3300003187 Bacteria 3162
22 JGI25165J46597_1000415 3300003214 Bacteria 44714
23 JGI25165J46597_1000555 3300003214 Bacteria 34009
24 JGI25153J46596_10000833 3300003215 Bacteria 18843
25 JGI25153J46596_10001644 3300003215 Bacteria 13256
26 JGI25153J46596_10009682 3300003215 Bacteria 4439
27 rootH2_10027335 3300003320 Bacteria 10879
28 rootL2_10010419 3300003322 Bacteria 9355
29 rootL2_10126227 3300003322 Bacteria 1756
30 rootH1_10028824 3300003323 Bacteria 8562
31 JGI25160J50197_1000002 3300003354 Bacteria 561707
32 JGI25160J50197_1000046 3300003354 Bacteria 141352
33 JGI25160J50197_1009230 3300003354 Bacteria 3678
34 JGI25160J50197_1016920 3300003354 Bacteria 2331
35 JGI25161J50226_1000031 3300003374 Bacteria 141352
36 JGI25161J50226_1000074 3300003374 Bacteria 85547
37 JGI25161J50226_1000333 3300003374 Bacteria 25481
38 Ga0055526_1000207 3300003771 Bacteria 50680
39 Ga0055526_1004816 3300003771 Bacteria 7975
40 Ga0055526_1007043 3300003771 Bacteria 5946
41 Ga0055526_1007746 3300003771 Bacteria 5512
42 Ga0055526_1022341 3300003771 Bacteria 2155
43 Ga0055524_1001148 3300003775 Bacteria 15947
44 Ga0055524_1007167 3300003775 Bacteria 4771
45 Ga0055524_1008334 3300003775 Bacteria 4312
46 Ga0055524_1015372 3300003775 Bacteria 2793
47 Ga0055524_1026608 3300003775 Bacteria 1782
48 Ga0055524_1030533 3300003775 Bacteria 1569
49 Ga0055536_1005508 3300003781 Bacteria 6165
50 Ga0055528_1000146 3300003790 Bacteria 57915
51 Ga0055528_1000636 3300003790 Bacteria 25725
52 Ga0055528_1002292 3300003790 Bacteria 10366
53 Ga0055528_1004046 3300003790 Bacteria 7168
54 Ga0055528_1006665 3300003790 Bacteria 5210
55 Ga0055528_1007009 3300003790 Bacteria 5040
56 Ga0055530_10012423 3300003791 Bacteria 2971
57 Ga0055530_10018589 3300003791 Bacteria 2136
58 Ga0055540_1000111 3300003792 Bacteria 88263
59 Ga0055540_1002236 3300003792 Bacteria 10477
60 Ga0055540_1016230 3300003792 Bacteria 2129
61 Ga0055531_10006091 3300003794 Bacteria 6907
62 Ga0058692_1001904 3300003856 Bacteria 7317
63 Ga0058692_1001956 3300003856 Bacteria 7180
64 Ga0058692_1020979 3300003856 Bacteria 1364
65 Ga0055543_1000008 3300004625 Bacteria 202062
66 Ga0055543_1000022 3300004625 Bacteria 140745
67 Ga0055543_1000188 3300004625 Bacteria 50290
68 Ga0055543_1000460 3300004625 Bacteria 24085
69 Ga0065165_1000058 3300005262 Bacteria 184784
70 Ga0065165_1000336 3300005262 Bacteria 76934
71 Ga0065165_1003090 3300005262 Bacteria 12404
72 Ga0065165_1024457 3300005262 Bacteria 2027
73 Ga0070670_100000173 3300005331 Bacteria 58127
74 Ga0070668_100032636 3300005347 Bacteria 3963
75 Ga0070669_100025581 3300005353 Bacteria 4241
76 Ga0070671_100013462 3300005355 Bacteria 6595
77 Ga0070663_100105530 3300005455 Bacteria 2109
78 Ga0070665_100002331 3300005548 Bacteria 21067
79 Ga0070665_100042307 3300005548 Bacteria 4579
80 Ga0070665_100399122 3300005548 Bacteria 1383
81 Ga0068856_100060399 3300005614 Bacteria 3745
82 Ga0068856_100810448 3300005614 Bacteria 956
83 Ga0068852_100498891 3300005616 Bacteria 1212
84 Ga0075365_10071101 3300006038 Bacteria 2342
85 Ga0075365_10110557 3300006038 Bacteria 1888
86 Ga0075365_10392305 3300006038 Bacteria 979
87 Ga0075363_100050337 3300006048 Bacteria 2220
88 Ga0075364_10001442 3300006051 Bacteria 12894
89 Ga0075364_10021036 3300006051 Bacteria 4109
90 Ga0075362_10009154 3300006177 Bacteria 3816
91 Ga0075367_10008199 3300006178 Bacteria 5399
92 Ga0075369_10002117 3300006186 Bacteria 7015
93 Ga0075366_10018810 3300006195 Bacteria 3992
94 Ga0075366_10083027 3300006195 Bacteria 1915
95 Ga0075370_10003403 3300006353 Bacteria 7564
96 Ga0075370_10010644 3300006353 Bacteria 4819
97 Ga0099826_10000542 3300006948 Bacteria 18745
98 Ga0099826_10007443 3300006948 Bacteria 8085
99 Ga0105244_10032731 3300009036 Bacteria 2749
100 Ga0105244_10044968 3300009036 Bacteria 2273
101 Ga0105240_10000278 3300009093 Bacteria 101540
102 Ga0105243_10025492 3300009148 Bacteria 4519
103 Ga0105243_10027876 3300009148 Bacteria 4332
104 Ga0105248_10054238 3300009177 Bacteria 4495
105 Ga0105237_10005254 3300009545 Bacteria 14655
106 Ga0123342_1032774 3300009766 Bacteria 2411
107 Ga0105033_102667 3300009986 Bacteria 1480
108 Ga0105239_10005703 3300010375 Bacteria 14538
109 Ga0105239_10515350 3300010375 Bacteria 1360
110 Ga0105246_10227448 3300011119 Bacteria 1466
111 Ga0157347_1008248 3300012502 Bacteria 1056
112 Ga0157373_10010891 3300013100 Bacteria 6694
113 Ga0157371_10000058 3300013102 Bacteria 171756
114 Ga0157370_10001488 3300013104 Bacteria 29012
115 Ga0157370_10003259 3300013104 Bacteria 19131
116 Ga0157370_10031263 3300013104 Bacteria 5209
117 Ga0157369_10069570 3300013105 Bacteria 3781
118 Ga0171463_1001 3300013249 Bacteria 1406070
119 Ga0182005_1001660 3300015265 Bacteria 8643
120 Ga0183363_1107 3300015690 Bacteria 23526
121 Ga0214544_1000008 3300021320 Bacteria 326027
122 Ga0214542_1000010 3300021321 Bacteria 262816
123 Ga0214542_1026881 3300021321 Bacteria 2729
124 Ga0214543_1000003 3300021327 Bacteria 692327
125 Ga0214543_1000004 3300021327 Bacteria 527190
126 Ga0209435_100011 3300025206 Bacteria 413027
127 Ga0209436_100447 3300025208 Bacteria 18524
128 Ga0209436_100516 3300025208 Bacteria 16861
129 Ga0209436_119163 3300025208 Bacteria 955
130 Ga0209437_100036 3300025233 Bacteria 469153
131 Ga0209437_100086 3300025233 Bacteria 254578
132 Ga0207425_1000012 3300025245 Bacteria 528324
133 Ga0207425_1000840 3300025245 Bacteria 15261
134 Ga0207425_1021458 3300025245 Bacteria 1369
135 Ga0207425_1022622 3300025245 Bacteria 1322
136 Ga0209646_1000024 3300025246 Bacteria 413027
137 Ga0209026_1000030 3300025250 Bacteria 329811
138 Ga0209677_100267 3300025253 Bacteria 35499
139 Ga0209759_1000011 3300025256 Bacteria 413027
140 Ga0209129_1000086 3300025258 Bacteria 181543
141 Ga0209129_1000123 3300025258 Bacteria 133661
142 Ga0209129_1000316 3300025258 Bacteria 42919
143 Ga0209129_1001356 3300025258 Bacteria 13800
144 Ga0209129_1001470 3300025258 Bacteria 13111
145 Ga0209129_1012397 3300025258 Bacteria 1959
146 Ga0209233_1000110 3300025261 Bacteria 260825
147 Ga0209233_1000166 3300025261 Bacteria 152270
148 Ga0209233_1000350 3300025261 Bacteria 43454
149 Ga0209455_1017753 3300025272 Bacteria 1481
150 Ga0209673_1000015 3300025273 Bacteria 530618
151 Ga0209673_1000091 3300025273 Bacteria 201875
152 Ga0209673_1000919 3300025273 Bacteria 37355
153 Ga0209673_1002434 3300025273 Bacteria 12926
154 Ga0209673_1002489 3300025273 Bacteria 12699
155 Ga0209673_1006679 3300025273 Bacteria 5507
156 Ga0209673_1010462 3300025273 Bacteria 3912
157 Ga0209673_1012741 3300025273 Bacteria 3365
158 Ga0209130_1000002 3300025284 Bacteria 722648
159 Ga0209130_1000008 3300025284 Bacteria 581232
160 Ga0209130_1000088 3300025284 Bacteria 152927
161 Ga0209130_1036182 3300025284 Bacteria 982
162 Ga0209676_1006633 3300025292 Bacteria 5654
163 Ga0209676_1010742 3300025292 Bacteria 3773
164 Ga0209676_1021677 3300025292 Bacteria 2149
165 Ga0209676_1034700 3300025292 Bacteria 1488
166 Ga0209025_1000024 3300025294 Bacteria 528324
167 Ga0209025_1000407 3300025294 Bacteria 87041
168 Ga0209025_1000469 3300025294 Bacteria 78737
169 Ga0209025_1001129 3300025294 Bacteria 38238
170 Ga0209025_1001232 3300025294 Bacteria 35695
171 Ga0209025_1001360 3300025294 Bacteria 32827
172 Ga0209025_1013476 3300025294 Bacteria 5132
173 Ga0209025_1019467 3300025294 Bacteria 3774
174 Ga0209025_1020353 3300025294 Bacteria 3635
175 Ga0209025_1030915 3300025294 Bacteria 2548
176 Ga0209025_1089964 3300025294 Bacteria 1007
177 Ga0209564_1000091 3300025295 Bacteria 249103
178 Ga0209564_1000845 3300025295 Bacteria 41202
179 Ga0209564_1001820 3300025295 Bacteria 19586
180 Ga0209564_1002233 3300025295 Bacteria 15971
181 Ga0209564_1003141 3300025295 Bacteria 11636
182 Ga0209564_1021873 3300025295 Bacteria 2282
183 Ga0209564_1037278 3300025295 Bacteria 1373
184 Ga0209564_1051467 3300025295 Bacteria 999
185 Ga0209758_1000046 3300025297 Bacteria 364931
186 Ga0209758_1000336 3300025297 Bacteria 87439
187 Ga0209758_1000877 3300025297 Bacteria 41329
188 Ga0209758_1003352 3300025297 Bacteria 14688
189 Ga0209758_1003629 3300025297 Bacteria 13799
190 Ga0209758_1008939 3300025297 Bacteria 6350
191 Ga0209758_1015276 3300025297 Bacteria 3993
192 Ga0209758_1027117 3300025297 Bacteria 2458
193 Ga0209758_1078809 3300025297 Bacteria 1005
194 Ga0209050_1002819 3300025298 Bacteria 13880
195 Ga0209050_1009815 3300025298 Bacteria 4822
196 Ga0209256_1000531 3300025299 Bacteria 55283
197 Ga0209256_1001360 3300025299 Bacteria 25775
198 Ga0209256_1002033 3300025299 Bacteria 17991
199 Ga0209256_1002068 3300025299 Bacteria 17685
200 Ga0209256_1002164 3300025299 Bacteria 16928
201 Ga0209256_1004435 3300025299 Bacteria 8820
202 Ga0209256_1006729 3300025299 Bacteria 5957
203 Ga0209256_1010949 3300025299 Bacteria 3711
204 Ga0207426_1000012 3300025302 Bacteria 730942
205 Ga0207426_1000013 3300025302 Bacteria 721897
206 Ga0207426_1000016 3300025302 Bacteria 581232
207 Ga0207426_1000063 3300025302 Bacteria 358920
208 Ga0207426_1000172 3300025302 Bacteria 163690
209 Ga0207426_1001284 3300025302 Bacteria 21757
210 Ga0209051_1000084 3300025303 Bacteria 190324
211 Ga0209051_1001391 3300025303 Bacteria 20798
212 Ga0209051_1001972 3300025303 Bacteria 15771
213 Ga0209051_1003225 3300025303 Bacteria 10863
214 Ga0209051_1015056 3300025303 Bacteria 3578
215 Ga0209051_1030733 3300025303 Bacteria 2079
216 Ga0209257_1002244 3300025304 Bacteria 19810
217 Ga0209257_1009272 3300025304 Bacteria 5322
218 Ga0209257_1009288 3300025304 Bacteria 5312
219 Ga0209257_1031843 3300025304 Bacteria 1680
220 Ga0207656_10050177 3300025321 Bacteria 1801
221 Ga0207695_10000376 3300025913 Bacteria 101548
222 Ga0207671_10000732 3300025914 Bacteria 41620
223 Ga0207650_10000899 3300025925 Bacteria 22456
224 Ga0207644_10021705 3300025931 Bacteria 4378
225 Ga0207668_10010428 3300025972 Bacteria 5613
226 Ga0207678_10209091 3300026067 Bacteria 1669
227 Ga0207702_10008346 3300026078 Bacteria 8745
228 Ga0207702_10146983 3300026078 Bacteria 2140
229 Ga0207698_10473597 3300026142 Bacteria 1213
230 Ga0209281_1000192 3300027111 Bacteria 140252
231 Ga0209281_1000629 3300027111 Bacteria 39061
232 Ga0209371_1000009 3300027312 Bacteria 963030
233 Ga0209371_1001137 3300027312 Bacteria 19526
234 Ga0209371_1002001 3300027312 Bacteria 12266
235 Ga0209282_1000269 3300027666 Bacteria 25931
236 Ga0268266_10006718 3300028379 Bacteria 10490
237 Ga0268266_10040248 3300028379 Bacteria 3983
238 Ga0268266_10069283 3300028379 Bacteria 3056
239 Ga0268266_10660563 3300028379 Bacteria 1006
240 Ga0307515_10000154 3300028794 Bacteria 166582
241 Ga0307515_10000444 3300028794 Bacteria 99282
242 Ga0307515_10019259 3300028794 Bacteria 12301
243 Ga0268256_1000010 3300030500 Bacteria 963034
244 Ga0268256_1002423 3300030500 Bacteria 9521
245 Ga0268256_1008149 3300030500 Bacteria 3629
246 Ga0307513_10003801 3300031456 Bacteria 20347
247 Ga0307405_10009702 3300031731 Bacteria 4949
248 Ga0307406_10016226 3300031901 Bacteria 4324
249 Ga0307412_10001549 3300031911 Bacteria 12704
250 Ga0307412_10061217 3300031911 Bacteria 2530
251 Ga0307409_100141672 3300031995 Bacteria 2073
252 Ga0307409_100729702 3300031995 Bacteria 993
253 Ga0373935_0129042 3300035692 Bacteria 1697
254 Ga0373927_0000329 3300035695 Bacteria 37272
255 Ga0373925_0006529 3300037068 Bacteria 8576
256 Ga0439436_0000603 3300041404 Bacteria 9514
257 Ga0439438_026976 3300041405 Bacteria 1554
258 Ga0439439_0023101 3300041406 Bacteria 1557
259 Ga0439461_0042684 3300041410 Bacteria 984
260 Ga0439465_0001431 3300041413 Bacteria 7721
261 Ga0439465_0005132 3300041413 Bacteria 4202
262 Ga0451835_0532266 3300041492 Bacteria 4381
263 Ga0451837_1452220 3300041494 Bacteria 1583
264 Ga0451839_0469472 3300041496 Bacteria 1284
265 Ga0451839_1624085 3300041496 Bacteria 886
266 Ga0451841_1381482 3300041498 Bacteria 965
267 Ga0451845_0636985 3300041501 Bacteria 955
268 Ga0451847_0235905 3300041503 Bacteria 2027
269 Ga0451853_1200660 3300041512 Bacteria 1246
270 Ga0439445_0028025 3300042004 Bacteria 1450
271 Ga0439449_0032178 3300042007 Bacteria 1955
272 Ga0439449_0054665 3300042007 Bacteria 1475
273 Ga0439449_0108782 3300042007 Bacteria 1026
274 Ga0439449_0121161 3300042007 Bacteria 971
275 Ga0439462_0017703 3300042015 Bacteria 1846
276 Ga0450920_018160 3300042122 Bacteria 1346
277 Ga0450900_007645 3300042136 Bacteria 1335
278 Ga0450906_011583 3300042145 Bacteria 1646
279 Ga0439434_0012815 3300042435 Bacteria 2485
280 Ga0450918_010064 3300042531 Bacteria 1651
281 Ga0466970_0028741 3300044765 Bacteria 2924
282 Ga0466967_0172131 3300045976 Bacteria 2038
283 Ga0495590_0071343 3300046457 Bacteria 1219
284 Ga0495629_0031294 3300046459 Bacteria 3768
285 Ga0495650_0024370 3300046471 Bacteria 2859
286 Ga0495650_0080590 3300046471 Bacteria 1256
287 Ga0495605_0087296 3300046474 Bacteria 1451
288 Ga0495662_0023435 3300046476 Bacteria 2981
289 Ga0495585_0051289 3300046492 Bacteria 2287
290 Ga0495585_0068360 3300046492 Bacteria 1941
291 Ga0495607_0042109 3300046501 Bacteria 2709
292 Ga0495607_0065801 3300046501 Bacteria 2042
293 Ga0495583_0001834 3300046506 Bacteria 19816
294 Ga0495606_0016727 3300046507 Bacteria 5577
295 Ga0495606_0051734 3300046507 Bacteria 2677
296 Ga0495606_0115194 3300046507 Bacteria 1616
297 Ga0495606_0190950 3300046507 Bacteria 1174
298 Ga0495610_0062537 3300046512 Bacteria 1765
299 Ga0495610_0073621 3300046512 Bacteria 1587
300 Ga0495620_0015977 3300046515 Bacteria 3778
301 Ga0495620_0024808 3300046515 Bacteria 2847
302 Ga0495620_0082314 3300046515 Bacteria 1301
303 Ga0495631_0059477 3300046518 Bacteria 1660
304 Ga0495632_0007410 3300046519 Bacteria 6892
305 Ga0495643_0025235 3300046522 Bacteria 3364
306 Ga0495643_0036630 3300046522 Bacteria 2694
307 Ga0495643_0068980 3300046522 Bacteria 1860
308 Ga0495648_0015099 3300046524 Bacteria 5623
309 Ga0495648_0213108 3300046524 Bacteria 958
310 Ga0495654_0000530 3300046530 Bacteria 30917
311 Ga0495597_0075909 3300046542 Bacteria 1442
312 Ga0495622_0071154 3300046557 Bacteria 1605
313 Ga0495622_0105665 3300046557 Bacteria 1290
314 Ga0495633_0044464 3300046558 Bacteria 2105
315 Ga0495633_0062183 3300046558 Bacteria 1748
316 Ga0495633_0067180 3300046558 Bacteria 1674
317 Ga0495633_0078879 3300046558 Bacteria 1533
318 Ga0495656_0045298 3300046615 Bacteria 1856
319 Ga0495668_0067076 3300046616 Bacteria 1974
320 Ga0495634_0180857 3300046642 Bacteria 1320
321 Ga0495625_0004038 3300046660 Bacteria 14030
322 Ga0495625_0035298 3300046660 Bacteria 3686
323 Ga0495625_0052753 3300046660 Bacteria 2911
324 Ga0495625_0107936 3300046660 Bacteria 1905
325 Ga0495635_0025784 3300046663 Bacteria 4095
326 Ga0495588_0007450 3300046674 Bacteria 4983
327 Ga0495588_0124740 3300046674 Bacteria 1358
328 Ga0495588_0251817 3300046674 Bacteria 931
329 Ga0495657_0120213 3300046675 Bacteria 1655
330 Ga0495658_0083866 3300046683 Bacteria 1875
331 Ga0495624_0327396 3300046690 Bacteria 922
332 Ga0495649_0030284 3300046694 Bacteria 2990
333 Ga0495589_0081044 3300046794 Bacteria 1579
334 Ga0495600_0017187 3300046809 Bacteria 4597
335 Ga0495604_0092081 3300047317 Bacteria 2246
336 Ga0495636_0056117 3300047318 Bacteria 1658
337 Ga0495683_0139790 3300047323 Bacteria 1136
338 Ga0495673_0116321 3300047469 Bacteria 1063
339 Ga0495681_0003498 3300047470 Bacteria 10915
340 Ga0495681_0154310 3300047470 Bacteria 961
341 Ga0495686_0017518 3300047472 Bacteria 4822
342 Ga0495686_0125448 3300047472 Bacteria 1526
343 Ga0495615_0034340 3300048090 Bacteria 1234
344 Ga0495626_0088481 3300048091 Bacteria 1365
345 Ga0496100_0026122 3300048903 Bacteria 3577
346 Ga0496101_0191705 3300048904 Bacteria 1578
347 Ga0496101_0429729 3300048904 Bacteria 1041
348 Ga0496102_0007354 3300048905 Bacteria 9408
349 Ga0496103_0014180 3300048906 Bacteria 4731
350 Ga0496110_0068733 3300048913 Bacteria 3136
351 Ga0496111_0045488 3300048914 Bacteria 3158
352 Ga0496112_0546452 3300048915 Bacteria 1092
353 Ga0496113_0128061 3300048916 Bacteria 1990
354 Ga0496116_0001010 3300048919 Bacteria 34302
355 Ga0496116_0015732 3300048919 Bacteria 5964
356 Ga0496116_0017253 3300048919 Bacteria 5612
357 Ga0496116_0023025 3300048919 Bacteria 4649
358 Ga0496116_0051493 3300048919 Bacteria 2735
359 Ga0496116_0058736 3300048919 Bacteria 2505
360 Ga0496116_0062069 3300048919 Bacteria 2415
361 Ga0496116_0234828 3300048919 Bacteria 926
362 Ga0496117_0000002 3300048920 Bacteria 2483758
363 Ga0496117_0000732 3300048920 Bacteria 51545
364 Ga0496117_0005677 3300048920 Bacteria 13004
365 Ga0496117_0005953 3300048920 Bacteria 12570
366 Ga0496117_0013837 3300048920 Bacteria 7000
367 Ga0496117_0047633 3300048920 Bacteria 3071
368 Ga0496117_0065685 3300048920 Bacteria 2465
369 Ga0496118_0002815 3300048921 Bacteria 22770
370 Ga0496118_0005185 3300048921 Bacteria 14915
371 Ga0496118_0010358 3300048921 Bacteria 9238
372 Ga0496118_0010897 3300048921 Bacteria 8942
373 Ga0496118_0015048 3300048921 Bacteria 7192
374 Ga0496118_0030250 3300048921 Bacteria 4522
375 Ga0496119_0020314 3300048922 Bacteria 4850
376 Ga0496119_0025121 3300048922 Bacteria 4168
377 Ga0496119_0071376 3300048922 Bacteria 2033
378 Ga0496119_0091272 3300048922 Bacteria 1730
379 Ga0496119_0291316 3300048922 Bacteria 808
380 Ga0496120_0000021 3300048923 Bacteria 250966
381 Ga0496120_0008278 3300048923 Bacteria 7589
382 Ga0496120_0071424 3300048923 Bacteria 1906
383 Ga0496120_0102165 3300048923 Bacteria 1512
384 Ga0496120_0165327 3300048923 Bacteria 1099
385 Ga0496120_0216403 3300048923 Bacteria 918
386 Ga0496121_0000001 3300048924 Bacteria 1830318
387 Ga0496121_0000581 3300048924 Bacteria 68614
388 Ga0496121_0003240 3300048924 Bacteria 23396
389 Ga0496121_0024071 3300048924 Bacteria 5835
390 Ga0496121_0061551 3300048924 Bacteria 3079
391 Ga0496121_0137041 3300048924 Bacteria 1822
392 Ga0496121_0153968 3300048924 Bacteria 1688
393 Ga0496121_0224742 3300048924 Bacteria 1319
394 Ga0496121_0272964 3300048924 Bacteria 1161
395 Ga0496121_0402774 3300048924 Bacteria 895
396 Ga0496121_0432265 3300048924 Bacteria 853
397 Ga0496121_0483713 3300048924 Bacteria 790
398 Ga0496122_0000001 3300048925 Bacteria 1827766
399 Ga0496122_0000009 3300048925 Bacteria 584024
400 Ga0496122_0000247 3300048925 Bacteria 121291
401 Ga0496122_0011748 3300048925 Bacteria 8824
402 Ga0496122_0018902 3300048925 Bacteria 6329
403 Ga0496122_0023069 3300048925 Bacteria 5505
404 Ga0496122_0029557 3300048925 Bacteria 4619
405 Ga0496122_0045343 3300048925 Bacteria 3418
406 Ga0496122_0050593 3300048925 Bacteria 3167
407 Ga0496122_0052622 3300048925 Bacteria 3079
408 Ga0496122_0054734 3300048925 Bacteria 2993
409 Ga0496122_0130490 3300048925 Bacteria 1598
410 Ga0496122_0277472 3300048925 Bacteria 918
411 Ga0496123_0000001 3300048926 Bacteria 1831497
412 Ga0496123_0000020 3300048926 Bacteria 388748
413 Ga0496123_0000222 3300048926 Bacteria 115482
414 Ga0496123_0005238 3300048926 Bacteria 13174
415 Ga0496123_0021560 3300048926 Bacteria 5003
416 Ga0496123_0032979 3300048926 Bacteria 3735
417 Ga0496123_0043345 3300048926 Bacteria 3092
418 Ga0496123_0091621 3300048926 Bacteria 1802
419 Ga0496124_0000063 3300048927 Bacteria 229705
420 Ga0496124_0005486 3300048927 Bacteria 14235
421 Ga0496124_0005927 3300048927 Bacteria 13520
422 Ga0496124_0006765 3300048927 Bacteria 12390
423 Ga0496124_0010229 3300048927 Bacteria 9528
424 Ga0496124_0013163 3300048927 Bacteria 8098
425 Ga0496124_0015770 3300048927 Bacteria 7220
426 Ga0496124_0015862 3300048927 Bacteria 7196
427 Ga0496124_0052100 3300048927 Bacteria 3479
428 Ga0496124_0052416 3300048927 Bacteria 3465
429 Ga0496124_0058070 3300048927 Bacteria 3256
430 Ga0496124_0129115 3300048927 Bacteria 2010
431 Ga0496124_0163083 3300048927 Bacteria 1735
432 Ga0496124_0173617 3300048927 Bacteria 1666
433 Ga0496124_0301589 3300048927 Bacteria 1157
434 Ga0496124_0364926 3300048927 Bacteria 1016
435 Ga0496124_0450074 3300048927 Bacteria 878
436 Ga0496125_0000001 3300048928 Bacteria 1766138
437 Ga0496125_0001358 3300048928 Bacteria 36024
438 Ga0496125_0002192 3300048928 Bacteria 26081
439 Ga0496125_0014572 3300048928 Bacteria 7650
440 Ga0496125_0041097 3300048928 Bacteria 3957
441 Ga0496126_0001362 3300048929 Bacteria 38716
442 Ga0496126_0012358 3300048929 Bacteria 8756
443 Ga0496126_0095875 3300048929 Bacteria 2601
444 Ga0496126_0143652 3300048929 Bacteria 2052
445 Ga0496126_0235582 3300048929 Bacteria 1531
446 Ga0496126_0305505 3300048929 Bacteria 1311
447 Ga0501033_0083870 3300049570 Bacteria 2335
448 Ga0501034_0395942 3300049571 Bacteria 1304
449 Ga0501034_0782889 3300049571 Bacteria 847
450 Ga0501034_0799597 3300049571 Bacteria 836
451 Ga0501036_0143387 3300049572 Bacteria 2015
452 Ga0501037_0060722 3300049573 Bacteria 2757
453 Ga0501038_0094553 3300049574 Bacteria 2498
454 Ga0501039_0161708 3300049575 Bacteria 1760
455 Ga0501043_0041168 3300049579 Bacteria 3630
456 Ga0501046_0141505 3300049580 Bacteria 1820
457 Ga0501047_0059074 3300049581 Bacteria 3703
458 Ga0501068_0153090 3300049584 Bacteria 1450
459 Ga0501073_0157608 3300049589 Bacteria 1573
460 Ga0501083_0054490 3300049744 Bacteria 2683
461 Ga0501280_001351 3300049776 Bacteria 4651
462 Ga0501035_0023157 3300049822 Bacteria 5697
463 nmdc:mga03n38_8375_c1 3300050490 Bacteria 3710
464 nmdc:mga00v17_133_c2 3300050491 Bacteria 35968
465 nmdc:mga00v17_1528_c2 3300050491 Bacteria 11579
466 nmdc:mga00v17_257_c1 3300050491 Bacteria 31177
467 nmdc:mga0yw44_279_c1 3300050492 Bacteria 17580
468 nmdc:mga0k408_77084_c1 3300050493 Bacteria 1949
469 nmdc:mga06z11_17846_c1 3300050494 Bacteria 3230
470 nmdc:mga04h51_94105_c1 3300050495 Bacteria 1083
471 nmdc:mga07m45_9227_c1 3300050496 Bacteria 5106
472 nmdc:mga0sz30_38997_c1 3300050516 Bacteria 1992
473 nmdc:mga0sz30_395_c1 3300050516 Bacteria 16600
474 Ga0500578_0158938 3300053086 Bacteria 1403
475 Ga0500578_0305076 3300053086 Bacteria 943
476 Ga0500560_009593 3300053107 Bacteria 2385
477 Ga0500572_001125 3300053111 Bacteria 7800
478 Ga0500607_201336 3300053121 Bacteria 855
479 Ga0500618_000046 3300053125 Bacteria 109891
480 Ga0500618_001284 3300053125 Bacteria 11559
481 Ga0500618_004792 3300053125 Bacteria 4233
482 Ga0500618_015519 3300053125 Bacteria 1923
483 Ga0500618_026040 3300053125 Bacteria 1399
484 Ga0500658_0017210 3300053134 Bacteria 2697
485 Ga0500658_0023874 3300053134 Bacteria 2339
486 Ga0500561_0000284 3300053137 Bacteria 8863
487 Ga0500568_0002051 3300053139 Bacteria 12228
488 Ga0500568_0003923 3300053139 Bacteria 8098
489 Ga0500573_0000491 3300053140 Bacteria 17038
490 Ga0500573_0001555 3300053140 Bacteria 11071
491 Ga0500590_000222 3300053148 Bacteria 17111
492 Ga0500604_0038410 3300053151 Bacteria 1436
493 Ga0500616_0001019 3300053153 Bacteria 29833
494 Ga0500616_0001529 3300053153 Bacteria 21766
495 Ga0500616_0108519 3300053153 Bacteria 1344
496 Ga0500616_0125247 3300053153 Bacteria 1221
497 Ga0500620_107381 3300053155 Bacteria 977
498 Ga0500622_0000653 3300053156 Bacteria 30881
499 Ga0500624_002019 3300053157 Bacteria 2855
500 Ga0500624_013063 3300053157 Bacteria 1237
501 Ga0500627_0116304 3300053158 Bacteria 1205
502 Ga0500627_0140664 3300053158 Bacteria 1090
503 Ga0500634_0079540 3300053161 Bacteria 1693
504 Ga0500636_0000010 3300053177 Bacteria 145932
505 Ga0500645_076790 3300053730 Bacteria 955
506 Ga0466962_0085602 3300061719 Bacteria 1509

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0023101 Ga0439439_0023101_369_1088 225
2 3300048924 Ga0496121_0483713 Ga0496121_0483713_20_703 226
3 3300005262 Ga0065165_1003090 Ga0065165_100309013 235
4 iso_pu_bacteria 2599185156 2599333102 235
5 3300009148 Ga0105243_10025492 Ga0105243_100254925 239
6 3300041410 Ga0439461_0042684 Ga0439461_0042684_250_969 239
7 3300046542 Ga0495597_0075909 Ga0495597_0075909_592_1311 239
8 3300003322 rootL2_10126227 rootL2_101262273 240
9 iso_pu_bacteria 2508501122 2509107161 241
10 iso_pu_bacteria 2509276019 2509374874 241
11 iso_pu_bacteria 2509276021 2509388357 241
12 iso_pu_bacteria 2509276033 2509443921 241
13 iso_pu_bacteria 2510065019 2510131534 241
14 iso_pu_bacteria 2510065057 2510305215 241
15 iso_pu_bacteria 2510461076 2510897838 241
16 iso_pu_bacteria 2510917022 2511136233 241
17 iso_pu_bacteria 2510917026 2511170016 241
18 iso_pu_bacteria 2510917028 2511185635 241
19 iso_pu_bacteria 2510917030 2511196773 241
20 iso_pu_bacteria 2511231052 2511500644 241
21 iso_pu_bacteria 2512047086 2512532068 241
22 iso_pu_bacteria 2513237084 2513571122 241
23 iso_pu_bacteria 2513237085 2513579333 241
24 iso_pu_bacteria 2513237086 2513584224 241
25 iso_pu_bacteria 2513237088 2513596779 241
26 iso_pu_bacteria 2513237091 2513619211 241
27 iso_pu_bacteria 2513237093 2513632215 241
28 iso_pu_bacteria 2513237103 2513713299 241
29 iso_pu_bacteria 2513237140 2513880689 241
30 iso_pu_bacteria 2513237143 2513903402 241
31 iso_pu_bacteria 2513237146 2513928370 241
32 iso_pu_bacteria 2513237159 2513999806 241
33 iso_pu_bacteria 2513237162 2514020956 241
34 iso_pu_bacteria 2515075009 2515110465 241
35 iso_pu_bacteria 2515154107 2515607781 241
36 iso_pu_bacteria 2515154113 2515636933 241
37 iso_pu_bacteria 2515154114 2515642894 241
38 iso_pu_bacteria 2515154116 2515659550 241
39 iso_pu_bacteria 2515154134 2515743023 241
40 iso_pu_bacteria 2516143018 2516208522 241
41 iso_pu_bacteria 2516653046 2516891920 241
42 iso_pu_bacteria 2516653077 2517039166 241
43 iso_pu_bacteria 2516653085 2517079412 241
44 iso_pu_bacteria 2517093000 2517093356 241
45 iso_pu_bacteria 2517287029 2517409582 241
46 iso_pu_bacteria 2519899620 2520376732 241
47 iso_pu_bacteria 2524023207 2524449971 241
48 iso_pu_bacteria 2524023209 2524457566 241
49 iso_pu_bacteria 2529292951 2530647740 241
50 iso_pu_bacteria 2534681796 2535515147 241
51 iso_pu_bacteria 2537561587 2537872881 241
52 iso_pu_bacteria 2551306084 2551681592 241
53 iso_pu_bacteria 2551306085 2551689112 241
54 iso_pu_bacteria 2551306086 2551694118 241
55 iso_pu_bacteria 2551306087 2551701786 241
56 iso_pu_bacteria 2551306090 2551722419 241
57 iso_pu_bacteria 2551306091 2551729962 241
58 iso_pu_bacteria 2551306092 2551737315 241
59 iso_pu_bacteria 2551306093 2551742919 241
60 iso_pu_bacteria 2554235003 2554246684 241
61 iso_pu_bacteria 2558860100 2558863866 241
62 iso_pu_bacteria 2558860242 2559293912 241
63 iso_pu_bacteria 2558860983 2561467381 241
64 iso_pu_bacteria 2582581283 2585165065 241
65 iso_pu_bacteria 2582581298 2585227120 241
66 iso_pu_bacteria 2582581299 2585229039 241
67 iso_pu_bacteria 2582581304 2585259525 241
68 iso_pu_bacteria 2582581306 2585266727 241
69 iso_pu_bacteria 2582581307 2585275396 241
70 iso_pu_bacteria 2582581308 2585282250 241
71 iso_pu_bacteria 2582581315 2585325929 241
72 iso_pu_bacteria 2582581316 2585330100 241
73 iso_pu_bacteria 2582581865 2585387741 241
74 iso_pu_bacteria 2582581866 2585397946 241
75 iso_pu_bacteria 2585427526 2585528369 241
76 iso_pu_bacteria 2585427527 2585536552 241
77 iso_pu_bacteria 2585427528 2585539760 241
78 iso_pu_bacteria 2585427529 2585550455 241
79 iso_pu_bacteria 2585427530 2585557030 241
80 iso_pu_bacteria 2585427531 2585560161 241
81 iso_pu_bacteria 2585427593 2585837743 241
82 iso_pu_bacteria 2585427594 2585844602 241
83 iso_pu_bacteria 2585427608 2585901567 241
84 iso_pu_bacteria 2585427609 2585905657 241
85 iso_pu_bacteria 2585428125 2587979227 241
86 iso_pu_bacteria 2599185170 2599419116 241
87 iso_pu_bacteria 2599185210 2599605463 241
88 iso_pu_bacteria 2599185236 2599719502 241
89 iso_pu_bacteria 2599185352 2600191522 241
90 iso_pu_bacteria 2600254933 2600374772 241
91 iso_pu_bacteria 2600255279 2601609114 241
92 iso_pu_bacteria 2600255308 2601745889 241
93 iso_pu_bacteria 2615840624 2616295734 241
94 iso_pu_bacteria 2615840626 2616306273 241
95 iso_pu_bacteria 2615840698 2616553463 241
96 iso_pu_bacteria 2643221557 2643807627 241
97 iso_pu_bacteria 2643221582 2643921101 241
98 iso_pu_bacteria 2643221607 2644047078 241
99 iso_pu_bacteria 2643221610 2644070039 241
100 iso_pu_bacteria 2643221618 2644103123 241
101 iso_pu_bacteria 2643221626 2644151947 241
102 iso_pu_bacteria 2643221634 2644190655 241
103 iso_pu_bacteria 2643221636 2644203483 241
104 iso_pu_bacteria 2643221637 2644206633 241
105 iso_pu_bacteria 2643221643 2644241492 241
106 iso_pu_bacteria 2643221653 2644297515 241
107 iso_pu_bacteria 2643221655 2644306050 241
108 iso_pu_bacteria 2643221659 2644330358 241
109 iso_pu_bacteria 2643221668 2644381010 241
110 iso_pu_bacteria 2643221675 2644414916 241
111 iso_pu_bacteria 2643221680 2644448573 241
112 iso_pu_bacteria 2643221686 2644479867 241
113 iso_pu_bacteria 2643221688 2644493800 241
114 iso_pu_bacteria 2643221689 2644496675 241
115 iso_pu_bacteria 2643221693 2644519174 241
116 iso_pu_bacteria 2643221698 2644542895 241
117 iso_pu_bacteria 2643221712 2644618999 241
118 iso_pu_bacteria 2643221718 2644650280 241
119 iso_pu_bacteria 2643221719 2644655768 241
120 iso_pu_bacteria 2643221723 2644673965 241
121 iso_pu_bacteria 2643221726 2644689119 241
122 iso_pu_bacteria 2657244999 2657681960 241
123 iso_pu_bacteria 2667528174 2671112417 241
124 iso_pu_bacteria 2690316117 2692317195 241
125 iso_pu_bacteria 2718217882 2719179634 241
126 iso_pu_bacteria 2718217927 2719384244 241
127 iso_pu_bacteria 2718217997 2719663980 241
128 iso_pu_bacteria 2718218009 2719730304 241
129 iso_pu_bacteria 2718218199 2720490399 241
130 iso_pu_bacteria 2718218232 2720611777 241
131 iso_pu_bacteria 2718218233 2720618634 241
132 iso_pu_bacteria 2718218235 2720630033 241
133 iso_pu_bacteria 2718218269 2720773728 241
134 iso_pu_bacteria 2718218363 2721145727 241
135 iso_pu_bacteria 2718218365 2721157259 241
136 iso_pu_bacteria 2718218366 2721162606 241
137 iso_pu_bacteria 2718218423 2721397958 241
138 iso_pu_bacteria 2721755514 2722838776 241
139 iso_pu_bacteria 2721755556 2723025398 241
140 iso_pu_bacteria 2721755684 2723558981 241
141 iso_pu_bacteria 2721755685 2723565588 241
142 iso_pu_bacteria 2721755809 2724036768 241
143 iso_pu_bacteria 2721755810 2724043060 241
144 iso_pu_bacteria 2721755819 2724088335 241
145 iso_pu_bacteria 2721755822 2724102853 241
146 iso_pu_bacteria 2721755823 2724108720 241
147 iso_pu_bacteria 2724679232 2725950182 241
148 iso_pu_bacteria 2728369352 2730106334 241
149 iso_pu_bacteria 2728369365 2730162871 241
150 iso_pu_bacteria 2728369397 2730296891 241
151 iso_pu_bacteria 2738541293 2738803783 241
152 iso_pu_bacteria 2738541317 2738945634 241
153 iso_pu_bacteria 2738541333 2739034619 241
154 iso_pu_bacteria 2765235942 2766065636 241
155 iso_pu_bacteria 2775507049 2776912196 241
156 iso_pu_bacteria 2775507266 2778174222 241
157 iso_pu_bacteria 2791355082 2792583811 241
158 iso_pu_bacteria 2791355091 2792622394 241
159 iso_pu_bacteria 2791355092 2792628040 241
160 iso_pu_bacteria 2791355094 2792638707 241
161 iso_pu_bacteria 2791355256 2793295150 241
162 iso_pu_bacteria 2791355259 2793315363 241
163 iso_pu_bacteria 2791355260 2793320222 241
164 iso_pu_bacteria 2791355262 2793332496 241
165 iso_pu_bacteria 2791355263 2793341738 241
166 iso_pu_bacteria 2791355264 2793350807 241
167 iso_pu_bacteria 2791355265 2793353315 241
168 iso_pu_bacteria 2791355266 2793362700 241
169 iso_pu_bacteria 2791355267 2793364739 241
170 iso_pu_bacteria 2802429268 2804750978 241
171 iso_pu_bacteria 2802429605 2805927520 241
172 iso_pu_bacteria 2802429606 2805932305 241
173 iso_pu_bacteria 2802429633 2806043916 241
174 iso_pu_bacteria 2802429634 2806052266 241
175 iso_pu_bacteria 2802429635 2806058567 241
176 iso_pu_bacteria 2802429636 2806067063 241
177 iso_pu_bacteria 2802429637 2806074808 241
178 iso_pu_bacteria 2808606387 2808986312 241
179 iso_pu_bacteria 2818991272 2819243176 241
180 iso_pu_bacteria 2818991439 2819556444 241
181 iso_pu_bacteria 2818991448 2819608356 241
182 iso_pu_bacteria 2818991453 2819643564 241
183 iso_pu_bacteria 2818991461 2819684646 241
184 iso_pu_bacteria 2821123053 2821123694 241
185 iso_pu_bacteria 2838016132 2838022167 241
186 iso_pu_bacteria 2838022645 2838024580 241
187 iso_pu_bacteria 2838029111 2838029245 241
188 iso_pu_bacteria 2838035591 2838037197 241
189 iso_pu_bacteria 2838042994 2838044353 241
190 iso_pu_bacteria 2838048938 2838051410 241
191 iso_pu_bacteria 2838061910 2838066645 241
192 iso_pu_bacteria 2838068647 2838073698 241
193 iso_pu_bacteria 2838661181 2838663614 241
194 iso_pu_bacteria 2838668709 2838672328 241
195 iso_pu_bacteria 2838675328 2838677174 241
196 iso_pu_bacteria 2838680041 2838680658 241
197 iso_pu_bacteria 2838686498 2838692685 241
198 iso_pu_bacteria 2838694306 2838695309 241
199 iso_pu_bacteria 2838701080 2838703929 241
200 iso_pu_bacteria 2838707686 2838708685 241
201 iso_pu_bacteria 2838714209 2838716062 241
202 iso_pu_bacteria 2838719591 2838720138 241
203 iso_pu_bacteria 2838724970 2838726814 241
204 iso_pu_bacteria 2838729681 2838732757 241
205 iso_pu_bacteria 2838736955 2838739275 241
206 iso_pu_bacteria 2838742623 2838745652 241
207 iso_pu_bacteria 2841840854 2841843173 241
208 iso_pu_bacteria 2841846520 2841847072 241
209 iso_pu_bacteria 2841851746 2841855295 241
210 iso_pu_bacteria 2841859092 2841860396 241
211 iso_pu_bacteria 2841864319 2841866747 241
212 iso_pu_bacteria 2842077413 2842080080 241
213 iso_pu_bacteria 2842110456 2842112271 241
214 iso_pu_bacteria 2842118031 2842120700 241
215 iso_pu_bacteria 2842124991 2842126899 241
216 iso_pu_bacteria 2842130223 2842132067 241
217 iso_pu_bacteria 2842140634 2842142955 241
218 iso_pu_bacteria 2842146304 2842148279 241
219 iso_pu_bacteria 2842152218 2842152764 241
220 iso_pu_bacteria 2842156927 2842161674 241
221 iso_pu_bacteria 2842163707 2842170078 241
222 iso_pu_bacteria 2842170452 2842172307 241
223 iso_pu_bacteria 2842175837 2842176383 241
224 iso_pu_bacteria 2842180545 2842185291 241
225 iso_pu_bacteria 2842187318 2842189169 241
226 iso_pu_bacteria 2842192696 2842192967 241
227 iso_pu_bacteria 2842198810 2842200315 241
228 iso_pu_bacteria 2842205361 2842206864 241
229 iso_pu_bacteria 2842211629 2842213483 241
230 iso_pu_bacteria 2842217011 2842218728 241
231 iso_pu_bacteria 2842224351 2842224899 241
232 iso_pu_bacteria 2842229732 2842233230 241
233 iso_pu_bacteria 2842237096 2842238097 241
234 iso_pu_bacteria 2842243621 2842248767 241
235 iso_pu_bacteria 2842250916 2842253344 241
236 iso_pu_bacteria 2842257432 2842261910 241
237 iso_pu_bacteria 2842264693 2842267376 241
238 iso_pu_bacteria 2842271015 2842277026 241
239 iso_pu_bacteria 2842278818 2842280443 241
240 iso_pu_bacteria 2842285085 2842289389 241
241 iso_pu_bacteria 2842291075 2842293740 241
242 iso_pu_bacteria 2842298080 2842300819 241
243 iso_pu_bacteria 2842304105 2842306418 241
244 iso_pu_bacteria 2842311132 2842312558 241
245 iso_pu_bacteria 2842317721 2842322590 241
246 iso_pu_bacteria 2842341865 2842343011 241
247 iso_pu_bacteria 2842357229 2842358061 241
248 iso_pu_bacteria 2842363717 2842367266 241
249 iso_pu_bacteria 2842370503 2842371121 241
250 iso_pu_bacteria 2842377471 2842380137 241
251 iso_pu_bacteria 2842384541 2842387208 241
252 iso_pu_bacteria 2842395702 2842401230 241
253 iso_pu_bacteria 2842402390 2842406737 241
254 iso_pu_bacteria 2842409023 2842413767 241
255 iso_pu_bacteria 2842415677 2842420271 241
256 iso_pu_bacteria 2842422224 2842427146 241
257 iso_pu_bacteria 2842428310 2842431372 241
258 iso_pu_bacteria 2842434925 2842437707 241
259 iso_pu_bacteria 2842441272 2842444522 241
260 iso_pu_bacteria 2842447887 2842450269 241
261 iso_pu_bacteria 2842462802 2842465650 241
262 iso_pu_bacteria 2842469257 2842472460 241
263 iso_pu_bacteria 2842475841 2842476325 241
264 iso_pu_bacteria 2842482326 2842482401 241
265 iso_pu_bacteria 2842489311 2842492394 241
266 iso_pu_bacteria 2842495871 2842501953 241
267 iso_pu_bacteria 2842502639 2842502773 241
268 iso_pu_bacteria 2842509118 2842509256 241
269 iso_pu_bacteria 2842515876 2842517181 241
270 iso_pu_bacteria 2842521101 2842526378 241
271 iso_pu_bacteria 2842922631 2842923405 241
272 iso_pu_bacteria 2844163670 2844170691 241
273 iso_pu_bacteria 2844454524 2844455911 241
274 iso_pu_bacteria 2847417321 2847417735 241
275 iso_pu_bacteria 2848992105 2848992581 241
276 iso_pu_bacteria 2850079185 2850080096 241
277 iso_pu_bacteria 2852387548 2852388542 241
278 iso_pu_bacteria 2854896431 2854898346 241
279 iso_pu_bacteria 2854916844 2854919059 241
280 iso_pu_bacteria 2855825444 2855831839 241
281 iso_pu_bacteria 2855839649 2855840125 241
282 iso_pu_bacteria 2855872281 2855873136 241
283 iso_pu_bacteria 2857516855 2857522154 241
284 iso_pu_bacteria 2857531043 2857531256 241
285 iso_pu_bacteria 2858800743 2858804033 241
286 iso_pu_bacteria 2891373044 2891376220 241
287 iso_pu_bacteria 2896384573 2896387465 241
288 iso_pu_bacteria 2899792073 2899792463 241
289 iso_pu_bacteria 2899803654 2899804442 241
290 iso_pu_bacteria 2913295892 2913297917 241
291 iso_pu_bacteria 2913308742 2913310687 241
292 iso_pu_bacteria 2915986958 2915990840 241
293 iso_pu_bacteria 2915993759 2915999611 241
294 iso_pu_bacteria 2916000859 2916007226 241
295 iso_pu_bacteria 2916007675 2916013664 241
296 iso_pu_bacteria 2916014648 2916020977 241
297 iso_pu_bacteria 2916021584 2916022599 241
298 iso_pu_bacteria 2916028427 2916034824 241
299 iso_pu_bacteria 2916035215 2916039828 241
300 iso_pu_bacteria 2916041962 2916042856 241
301 iso_pu_bacteria 2916048683 2916051814 241
302 iso_pu_bacteria 2916055098 2916060120 241
303 iso_pu_bacteria 2916068649 2916076340 241
304 iso_pu_bacteria 2916076590 2916080941 241
305 iso_pu_bacteria 2919100787 2919101285 241
306 iso_pu_bacteria 2919114240 2919116265 241
307 iso_pu_bacteria 2919171160 2919172009 241
308 iso_pu_bacteria 2919408235 2919408851 241
309 iso_pu_bacteria 2920760137 2920763263 241
310 iso_pu_bacteria 2920822456 2920823438 241
311 iso_pu_bacteria 2921201388 2921203367 241
312 iso_pu_bacteria 2921208531 2921214969 241
313 iso_pu_bacteria 2921237296 2921239931 241
314 iso_pu_bacteria 2921244191 2921245139 241
315 iso_pu_bacteria 2921257292 2921260242 241
316 iso_pu_bacteria 2921263974 2921269011 241
317 iso_pu_bacteria 2921282425 2921286620 241
318 iso_pu_bacteria 2921289301 2921291879 241
319 iso_pu_bacteria 2923556063 2923557249 241
320 iso_pu_bacteria 2924144063 2924146113 241
321 iso_pu_bacteria 2924150972 2924153854 241
322 iso_pu_bacteria 2924158325 2924163571 241
323 iso_pu_bacteria 2924165586 2924165919 241
324 iso_pu_bacteria 2924172951 2924178221 241
325 iso_pu_bacteria 2924179722 2924185636 241
326 iso_pu_bacteria 2924186466 2924191880 241
327 iso_pu_bacteria 2924193448 2924194230 241
328 iso_pu_bacteria 2924200457 2924202499 241
329 iso_pu_bacteria 2924207177 2924209731 241
330 iso_pu_bacteria 2924214083 2924215092 241
331 iso_pu_bacteria 2924221636 2924226442 241
332 iso_pu_bacteria 2924228884 2924232530 241
333 iso_pu_bacteria 2926754445 2926757219 241
334 iso_pu_bacteria 2926760298 2926761434 241
335 iso_pu_bacteria 2929138655 2929139012 241
336 iso_pu_bacteria 2933006813 2933007409 241
337 iso_pu_bacteria 2933011516 2933012176 241
338 iso_pu_bacteria 2933016740 2933019042 241
339 iso_pu_bacteria 2933570622 2933573487 241
340 iso_pu_bacteria 2933586486 2933587600 241
341 iso_pu_bacteria 2933594066 2933594621 241
342 iso_pu_bacteria 2933599457 2933604126 241
343 iso_pu_bacteria 2935894831 2935895832 241
344 iso_pu_bacteria 2935901341 2935907717 241
345 iso_pu_bacteria 2936367885 2936368851 241
346 iso_pu_bacteria 2936375103 2936377069 241
347 iso_pu_bacteria 2936381700 2936383808 241
348 iso_pu_bacteria 2936996657 2936999762 241
349 iso_pu_bacteria 2937002841 2937004984 241
350 iso_pu_bacteria 2937009748 2937011265 241
351 iso_pu_bacteria 2937016420 2937021041 241
352 iso_pu_bacteria 2937023124 2937023924 241
353 iso_pu_bacteria 2937042894 2937048654 241
354 iso_pu_bacteria 2937049772 2937053921 241
355 iso_pu_bacteria 2937056579 2937057656 241
356 iso_pu_bacteria 2937063883 2937070106 241
357 iso_pu_bacteria 2937071275 2937071457 241
358 iso_pu_bacteria 2937091812 2937097521 241
359 iso_pu_bacteria 2937098957 2937103371 241
360 iso_pu_bacteria 2937106411 2937112673 241
361 iso_pu_bacteria 2937113482 2937114604 241
362 iso_pu_bacteria 2937119839 2937122524 241
363 iso_pu_bacteria 2937126314 2937128401 241
364 iso_pu_bacteria 2941499720 2941500654 241
365 iso_pu_bacteria 2957382221 2957383750 241
366 iso_pu_bacteria 2957388812 2957394144 241
367 iso_pu_bacteria 2957395598 2957399454 241
368 iso_pu_bacteria 2957402308 2957403798 241
369 iso_pu_bacteria 2957408893 2957410975 241
370 iso_pu_bacteria 2957415311 2957421636 241
371 iso_pu_bacteria 2957422303 2957424956 241
372 iso_pu_bacteria 2957430029 2957435500 241
373 iso_pu_bacteria 2957443900 2957447029 241
374 iso_pu_bacteria 2957450854 2957457391 241
375 iso_pu_bacteria 2957457609 2957464339 241
376 iso_pu_bacteria 2957464669 2957466121 241
377 iso_pu_bacteria 2957471148 2957473852 241
378 iso_pu_bacteria 2957478035 2957482945 241
379 iso_pu_bacteria 2957484790 2957491021 241
380 iso_pu_bacteria 2957491536 2957496399 241
381 iso_pu_bacteria 2957498199 2957501978 241
382 iso_pu_bacteria 2957505466 2957511520 241
383 iso_pu_bacteria 2960584000 2960589092 241
384 iso_pu_bacteria 2960597568 2960599676 241
385 iso_pu_bacteria 2960603979 2960605482 241
386 iso_pu_bacteria 2960610863 2960616996 241
387 iso_pu_bacteria 2960617483 2960621825 241
388 iso_pu_bacteria 2960624210 2960630282 241
389 iso_pu_bacteria 2960637947 2960644728 241
390 iso_pu_bacteria 2960645483 2960651782 241
391 iso_pu_bacteria 2960652885 2960653226 241
392 iso_pu_bacteria 2960660292 2960660312 241
393 iso_pu_bacteria 2960667422 2960668363 241
394 iso_pu_bacteria 2960674078 2960675654 241
395 iso_pu_bacteria 2960687367 2960691966 241
396 iso_pu_bacteria 2964607997 2964609437 241
397 iso_pu_bacteria 2964615318 2964619913 241
398 iso_pu_bacteria 2964621998 2964627427 241
399 iso_pu_bacteria 2964628898 2964634396 241
400 iso_pu_bacteria 2964636051 2964636346 241
401 iso_pu_bacteria 2964643177 2964648180 241
402 iso_pu_bacteria 2964649959 2964650408 241
403 iso_pu_bacteria 2964656573 2964660402 241
404 iso_pu_bacteria 2964663802 2964665876 241
405 iso_pu_bacteria 2964678106 2964680683 241
406 iso_pu_bacteria 2964685014 2964687988 241
407 iso_pu_bacteria 2964691889 2964692978 241
408 iso_pu_bacteria 2964698721 2964704476 241
409 iso_pu_bacteria 2964705432 2964711275 241
410 iso_pu_bacteria 2964712639 2964714735 241
411 iso_pu_bacteria 2964719344 2964719828 241
412 iso_pu_bacteria 2967664464 2967670328 241
413 iso_pu_bacteria 2967671571 2967674275 241
414 iso_pu_bacteria 2967678726 2967685034 241
415 iso_pu_bacteria 2967693043 2967695147 241
416 iso_pu_bacteria 2967699805 2967706847 241
417 iso_pu_bacteria 2967706974 2967712839 241
418 iso_pu_bacteria 2967714385 2967714739 241
419 iso_pu_bacteria 2967721400 2967724207 241
420 iso_pu_bacteria 2967735183 2967736254 241
421 iso_pu_bacteria 2967742019 2967744052 241
422 iso_pu_bacteria 2967748971 2967751784 241
423 iso_pu_bacteria 2967755722 2967761402 241
424 iso_pu_bacteria 2967762386 2967762610 241
425 iso_pu_bacteria 2967769361 2967771241 241
426 iso_pu_bacteria 2967775926 2967782411 241
427 iso_pu_bacteria 2970019648 2970025635 241
428 iso_pu_bacteria 2970033650 2970033959 241
429 iso_pu_bacteria 2970040964 2970045566 241
430 iso_pu_bacteria 2970047711 2970052555 241
431 iso_pu_bacteria 2970054988 2970057357 241
432 iso_pu_bacteria 2970061556 2970068051 241
433 iso_pu_bacteria 2970068827 2970071431 241
434 iso_pu_bacteria 2970076120 2970080559 241
435 iso_pu_bacteria 2970082768 2970086079 241
436 iso_pu_bacteria 2970088815 2970091236 241
437 iso_pu_bacteria 2970095765 2970101576 241
438 iso_pu_bacteria 2970102677 2970103470 241
439 iso_pu_bacteria 2970109326 2970115986 241
440 iso_pu_bacteria 2970116247 2970118475 241
441 iso_pu_bacteria 2970129317 2970131645 241
442 iso_pu_bacteria 2970136068 2970136524 241
443 iso_pu_bacteria 2970149975 2970153941 241
444 iso_pu_bacteria 2970156795 2970162680 241
445 iso_pu_bacteria 2970164137 2970170212 241
446 iso_pu_bacteria 2970170962 2970174226 241
447 iso_pu_bacteria 2970177841 2970181801 241
448 iso_pu_bacteria 2970184632 2970190504 241
449 iso_pu_bacteria 2970191845 2970194956 241
450 iso_pu_bacteria 2977516862 2977518931 241
451 iso_pu_bacteria 2977523885 2977529061 241
452 iso_pu_bacteria 2977537788 2977540050 241
453 iso_pu_bacteria 2977551784 2977552853 241
454 iso_pu_bacteria 2977558990 2977559217 241
455 iso_pu_bacteria 2977565890 2977567583 241
456 iso_pu_bacteria 2977572785 2977573083 241
457 iso_pu_bacteria 2977579622 2977580514 241
458 iso_pu_bacteria 2979089926 2979093282 241
459 iso_pu_bacteria 2979095461 2979099333 241
460 iso_pu_bacteria 2979100975 2979105250 241
461 iso_pu_bacteria 2984509177 2984512895 241
462 iso_pu_bacteria 2984518228 2984520741 241
463 iso_pu_bacteria 2984537506 2984540035 241
464 iso_pu_bacteria 2984601300 2984602226 241
465 iso_pu_bacteria 2989349275 2989355455 241
466 iso_pu_bacteria 2989771324 2989774014 241
467 iso_pu_bacteria 2989776772 2989777567 241
468 iso_pu_bacteria 2996887358 2996892130 241
469 iso_pu_bacteria 2996893221 2996893522 241
470 iso_pu_bacteria 3005409236 3005411281 241
471 iso_pu_bacteria 3005416602 3005422761 241
472 iso_pu_bacteria 3005445848 3005446234 241
473 iso_pu_bacteria 3005452660 3005452889 241
474 iso_pu_bacteria 639633055 639646737 241
475 iso_pu_bacteria 643692032 643824594 241
476 iso_pu_bacteria 648276728 648739433 241
477 iso_pu_bacteria 8003570095 8003570106 241
478 iso_pu_bacteria 8003992118 8003992537 241
479 iso_pu_bacteria 8005246636 8005247269 241
480 iso_pu_bacteria 8005258706 8005263543 241
481 iso_pu_bacteria 8005275841 8005278958 241
482 iso_pu_bacteria 8005282627 8005283646 241
483 iso_pu_bacteria 8005289223 8005291016 241
484 iso_pu_bacteria 8005301065 8005303911 241
485 iso_pu_bacteria 8005307578 8005308730 241
486 iso_pu_bacteria 8005314921 8005321703 241
487 iso_pu_bacteria 8005321885 8005326657 241
488 iso_pu_bacteria 8005376324 8005377358 241
489 iso_pu_bacteria 8005382845 8005387227 241
490 iso_pu_bacteria 8005395548 8005401986 241
491 iso_pu_bacteria 8005430974 8005432998 241
492 iso_pu_bacteria 8005460587 8005461104 241
493 iso_pu_bacteria 8005484373 8005486091 241
494 iso_pu_bacteria 8005497431 8005498722 241
495 iso_pu_bacteria 8005542996 8005543823 241
496 iso_pu_bacteria 8005556819 8005560706 241
497 iso_pu_bacteria 8005563573 8005569688 241
498 iso_pu_bacteria 8005570704 8005576995 241
499 iso_pu_bacteria 8005619151 8005619917 241
500 iso_pu_bacteria 8005626139 8005628514 241
501 iso_pu_bacteria 8005645114 8005650197 241
502 iso_pu_bacteria 8005658619 8005661848 241
503 iso_pu_bacteria 8005668836 8005670133 241
504 iso_pu_bacteria 8005682033 8005685067 241
505 iso_pu_bacteria 8005688590 8005690339 241
506 iso_pu_bacteria 8005695170 8005700312 241
507 iso_pu_bacteria 8018127388 8018133196 241
508 iso_pu_bacteria 8018150411 8018151991 241
509 iso_pu_bacteria 8018163183 8018167824 241
510 iso_pu_bacteria 8018176218 8018180249 241
511 iso_pu_bacteria 8023680758 8023684148 241
512 iso_pu_bacteria 8024479707 8024480363 241
513 iso_pu_bacteria 8024486573 8024491374 241
514 iso_pu_bacteria 8024501048 8024503612 241
515 iso_pu_bacteria 8046767195 8046769924 241
516 iso_pu_bacteria 8049293176 8049293554 241
517 iso_pu_bacteria 8054460903 8054461340 241
518 iso_pu_bacteria 8054558443 8054563414 241
519 iso_pu_bacteria 8056375014 8056375696 241
520 iso_pu_bacteria 8056382006 8056386021 241
521 iso_pu_bacteria 8056875544 8056879196 241
522 iso_pu_bacteria 8057575449 8057579888 241
523 iso_pu_bacteria 8057874678 8057880992 241
524 3300002704 JGI25155J39150_1000023 JGI25155J39150_1000023100 245
525 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009443 245
526 3300002737 JGI25162J39368_1000177 JGI25162J39368_100017714 245
527 3300002737 JGI25162J39368_1000803 JGI25162J39368_10008038 245
528 3300002738 JGI25154J39366_1000213 JGI25154J39366_100021314 245
529 3300002739 JGI25158J39367_1000091 JGI25158J39367_100009120 245
530 3300002739 JGI25158J39367_1004200 JGI25158J39367_10042003 245
531 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004327 245
532 3300002773 JGI25152J39213_1002205 JGI25152J39213_10022057 245
533 3300002773 JGI25152J39213_1003952 JGI25152J39213_10039524 245
534 3300002773 JGI25152J39213_1004109 JGI25152J39213_10041093 245
535 3300002773 JGI25152J39213_1017526 JGI25152J39213_10175261 245
536 3300002774 JGI25150J39212_1000378 JGI25150J39212_100037820 245
537 3300002987 JGI25159J45721_1000016 JGI25159J45721_1000016115 245
538 3300002987 JGI25159J45721_1000279 JGI25159J45721_100027922 245
539 3300002987 JGI25159J45721_1003209 JGI25159J45721_10032094 245
540 3300003187 JGI25151J46595_10000250 JGI25151J46595_1000025017 245
541 3300003187 JGI25151J46595_10000565 JGI25151J46595_100005654 245
542 3300003187 JGI25151J46595_10005624 JGI25151J46595_100056246 245
543 3300003187 JGI25151J46595_10012978 JGI25151J46595_100129782 245
544 3300003187 JGI25151J46595_10017052 JGI25151J46595_100170523 245
545 3300003214 JGI25165J46597_1000415 JGI25165J46597_100041514 245
546 3300003214 JGI25165J46597_1000555 JGI25165J46597_100055533 245
547 3300003215 JGI25153J46596_10000833 JGI25153J46596_100008333 245
548 3300003215 JGI25153J46596_10001644 JGI25153J46596_100016443 245
549 3300003215 JGI25153J46596_10009682 JGI25153J46596_100096825 245
550 3300003320 rootH2_10027335 rootH2_100273352 245
551 3300003322 rootL2_10010419 rootL2_100104193 245
552 3300003323 rootH1_10028824 rootH1_100288243 245
553 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002420 245
554 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004659 245
555 3300003354 JGI25160J50197_1009230 JGI25160J50197_10092304 245
556 3300003354 JGI25160J50197_1016920 JGI25160J50197_10169202 245
557 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003159 245
558 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007468 245
559 3300003374 JGI25161J50226_1000333 JGI25161J50226_100033320 245
560 3300003771 Ga0055526_1000207 Ga0055526_100020710 245
561 3300003771 Ga0055526_1004816 Ga0055526_10048164 245
562 3300003771 Ga0055526_1007043 Ga0055526_10070434 245
563 3300003771 Ga0055526_1007746 Ga0055526_10077465 245
564 3300003771 Ga0055526_1022341 Ga0055526_10223412 245
565 3300003775 Ga0055524_1001148 Ga0055524_100114810 245
566 3300003775 Ga0055524_1007167 Ga0055524_10071675 245
567 3300003775 Ga0055524_1008334 Ga0055524_10083342 245
568 3300003775 Ga0055524_1015372 Ga0055524_10153722 245
569 3300003775 Ga0055524_1026608 Ga0055524_10266082 245
570 3300003775 Ga0055524_1030533 Ga0055524_10305332 245
571 3300003781 Ga0055536_1005508 Ga0055536_10055085 245
572 3300003790 Ga0055528_1000146 Ga0055528_100014631 245
573 3300003790 Ga0055528_1000636 Ga0055528_100063628 245
574 3300003790 Ga0055528_1002292 Ga0055528_100229211 245
575 3300003790 Ga0055528_1004046 Ga0055528_10040465 245
576 3300003790 Ga0055528_1006665 Ga0055528_10066654 245
577 3300003790 Ga0055528_1007009 Ga0055528_10070091 245
578 3300003791 Ga0055530_10012423 Ga0055530_100124233 245
579 3300003791 Ga0055530_10018589 Ga0055530_100185893 245
580 3300003792 Ga0055540_1000111 Ga0055540_100011163 245
581 3300003792 Ga0055540_1002236 Ga0055540_10022367 245
582 3300003792 Ga0055540_1016230 Ga0055540_10162302 245
583 3300003794 Ga0055531_10006091 Ga0055531_100060912 245
584 3300003856 Ga0058692_1001904 Ga0058692_10019045 245
585 3300003856 Ga0058692_1001956 Ga0058692_10019562 245
586 3300003856 Ga0058692_1020979 Ga0058692_10209792 245
587 3300004625 Ga0055543_1000008 Ga0055543_1000008190 245
588 3300004625 Ga0055543_1000022 Ga0055543_1000022128 245
589 3300004625 Ga0055543_1000188 Ga0055543_100018841 245
590 3300004625 Ga0055543_1000460 Ga0055543_100046015 245
591 3300005262 Ga0065165_1000058 Ga0065165_100005846 245
592 3300005262 Ga0065165_1000336 Ga0065165_100033663 245
593 3300005262 Ga0065165_1024457 Ga0065165_10244572 245
594 3300005331 Ga0070670_100000173 Ga0070670_10000017322 245
595 3300005347 Ga0070668_100032636 Ga0070668_1000326362 245
596 3300005353 Ga0070669_100025581 Ga0070669_1000255813 245
597 3300005355 Ga0070671_100013462 Ga0070671_1000134625 245
598 3300005455 Ga0070663_100105530 Ga0070663_1001055302 245
599 3300005548 Ga0070665_100002331 Ga0070665_1000023316 245
600 3300005548 Ga0070665_100042307 Ga0070665_1000423074 245
601 3300005548 Ga0070665_100399122 Ga0070665_1003991222 245
602 3300005614 Ga0068856_100060399 Ga0068856_1000603993 245
603 3300005614 Ga0068856_100810448 Ga0068856_1008104481 245
604 3300005616 Ga0068852_100498891 Ga0068852_1004988912 245
605 3300006038 Ga0075365_10071101 Ga0075365_100711012 245
606 3300006038 Ga0075365_10110557 Ga0075365_101105571 245
607 3300006038 Ga0075365_10392305 Ga0075365_103923052 245
608 3300006048 Ga0075363_100050337 Ga0075363_1000503372 245
609 3300006051 Ga0075364_10001442 Ga0075364_100014422 245
610 3300006051 Ga0075364_10021036 Ga0075364_100210362 245
611 3300006177 Ga0075362_10009154 Ga0075362_100091542 245
612 3300006178 Ga0075367_10008199 Ga0075367_100081996 245
613 3300006186 Ga0075369_10002117 Ga0075369_100021176 245
614 3300006195 Ga0075366_10018810 Ga0075366_100188104 245
615 3300006195 Ga0075366_10083027 Ga0075366_100830272 245
616 3300006353 Ga0075370_10003403 Ga0075370_100034034 245
617 3300006353 Ga0075370_10010644 Ga0075370_100106445 245
618 3300006948 Ga0099826_10000542 Ga0099826_100005429 245
619 3300006948 Ga0099826_10007443 Ga0099826_100074432 245
620 3300009036 Ga0105244_10032731 Ga0105244_100327312 245
621 3300009036 Ga0105244_10044968 Ga0105244_100449683 245
622 3300009093 Ga0105240_10000278 Ga0105240_1000027876 245
623 3300009148 Ga0105243_10027876 Ga0105243_100278763 245
624 3300009177 Ga0105248_10054238 Ga0105248_100542382 245
625 3300009545 Ga0105237_10005254 Ga0105237_1000525410 245
626 3300009766 Ga0123342_1032774 Ga0123342_10327742 245
627 3300009986 Ga0105033_102667 Ga0105033_1026671 245
628 3300010375 Ga0105239_10005703 Ga0105239_100057034 245
629 3300010375 Ga0105239_10515350 Ga0105239_105153502 245
630 3300011119 Ga0105246_10227448 Ga0105246_102274482 245
631 3300012502 Ga0157347_1008248 Ga0157347_10082482 245
632 3300013100 Ga0157373_10010891 Ga0157373_100108912 245
633 3300013102 Ga0157371_10000058 Ga0157371_1000005857 245
634 3300013104 Ga0157370_10001488 Ga0157370_1000148819 245
635 3300013104 Ga0157370_10003259 Ga0157370_1000325914 245
636 3300013104 Ga0157370_10031263 Ga0157370_100312634 245
637 3300013105 Ga0157369_10069570 Ga0157369_100695704 245
638 3300013249 Ga0171463_1001 Ga0171463_1001634 245
639 3300015265 Ga0182005_1001660 Ga0182005_10016602 245
640 3300015690 Ga0183363_1107 Ga0183363_11077 245
641 3300021320 Ga0214544_1000008 Ga0214544_1000008297 245
642 3300021321 Ga0214542_1000010 Ga0214542_1000010254 245
643 3300021321 Ga0214542_1026881 Ga0214542_10268812 245
644 3300021327 Ga0214543_1000003 Ga0214543_100000389 245
645 3300021327 Ga0214543_1000004 Ga0214543_1000004276 245
646 3300025206 Ga0209435_100011 Ga0209435_100011274 245
647 3300025208 Ga0209436_100447 Ga0209436_10044712 245
648 3300025208 Ga0209436_100516 Ga0209436_10051613 245
649 3300025208 Ga0209436_119163 Ga0209436_1191631 245
650 3300025233 Ga0209437_100036 Ga0209437_10003679 245
651 3300025233 Ga0209437_100086 Ga0209437_100086171 245
652 3300025245 Ga0207425_1000012 Ga0207425_1000012388 245
653 3300025245 Ga0207425_1000840 Ga0207425_10008402 245
654 3300025245 Ga0207425_1021458 Ga0207425_10214582 245
655 3300025245 Ga0207425_1022622 Ga0207425_10226222 245
656 3300025246 Ga0209646_1000024 Ga0209646_1000024137 245
657 3300025250 Ga0209026_1000030 Ga0209026_1000030137 245
658 3300025253 Ga0209677_100267 Ga0209677_10026729 245
659 3300025256 Ga0209759_1000011 Ga0209759_1000011274 245
660 3300025258 Ga0209129_1000086 Ga0209129_1000086153 245
661 3300025258 Ga0209129_1000123 Ga0209129_1000123101 245
662 3300025258 Ga0209129_1000316 Ga0209129_100031629 245
663 3300025258 Ga0209129_1001356 Ga0209129_100135613 245
664 3300025258 Ga0209129_1001470 Ga0209129_10014705 245
665 3300025258 Ga0209129_1012397 Ga0209129_10123972 245
666 3300025261 Ga0209233_1000110 Ga0209233_100011077 245
667 3300025261 Ga0209233_1000166 Ga0209233_100016679 245
668 3300025261 Ga0209233_1000350 Ga0209233_100035032 245
669 3300025272 Ga0209455_1017753 Ga0209455_10177532 245
670 3300025273 Ga0209673_1000015 Ga0209673_1000015314 245
671 3300025273 Ga0209673_1000091 Ga0209673_1000091178 245
672 3300025273 Ga0209673_1000919 Ga0209673_100091916 245
673 3300025273 Ga0209673_1002434 Ga0209673_10024345 245
674 3300025273 Ga0209673_1002489 Ga0209673_10024899 245
675 3300025273 Ga0209673_1006679 Ga0209673_10066795 245
676 3300025273 Ga0209673_1010462 Ga0209673_10104624 245
677 3300025273 Ga0209673_1012741 Ga0209673_10127412 245
678 3300025284 Ga0209130_1000002 Ga0209130_100000213 245
679 3300025284 Ga0209130_1000008 Ga0209130_1000008123 245
680 3300025284 Ga0209130_1000088 Ga0209130_10000885 245
681 3300025284 Ga0209130_1036182 Ga0209130_10361821 245
682 3300025292 Ga0209676_1006633 Ga0209676_10066333 245
683 3300025292 Ga0209676_1010742 Ga0209676_10107423 245
684 3300025292 Ga0209676_1021677 Ga0209676_10216772 245
685 3300025292 Ga0209676_1034700 Ga0209676_10347002 245
686 3300025294 Ga0209025_1000024 Ga0209025_1000024388 245
687 3300025294 Ga0209025_1000407 Ga0209025_100040730 245
688 3300025294 Ga0209025_1000469 Ga0209025_100046923 245
689 3300025294 Ga0209025_1001129 Ga0209025_100112940 245
690 3300025294 Ga0209025_1001232 Ga0209025_100123238 245
691 3300025294 Ga0209025_1001360 Ga0209025_10013602 245
692 3300025294 Ga0209025_1013476 Ga0209025_10134762 245
693 3300025294 Ga0209025_1019467 Ga0209025_10194671 245
694 3300025294 Ga0209025_1020353 Ga0209025_10203533 245
695 3300025294 Ga0209025_1030915 Ga0209025_10309152 245
696 3300025294 Ga0209025_1089964 Ga0209025_10899641 245
697 3300025295 Ga0209564_1000091 Ga0209564_1000091109 245
698 3300025295 Ga0209564_1000845 Ga0209564_100084520 245
699 3300025295 Ga0209564_1001820 Ga0209564_10018207 245
700 3300025295 Ga0209564_1002233 Ga0209564_10022335 245
701 3300025295 Ga0209564_1003141 Ga0209564_10031419 245
702 3300025295 Ga0209564_1021873 Ga0209564_10218732 245
703 3300025295 Ga0209564_1037278 Ga0209564_10372782 245
704 3300025295 Ga0209564_1051467 Ga0209564_10514671 245
705 3300025297 Ga0209758_1000046 Ga0209758_1000046153 245
706 3300025297 Ga0209758_1000336 Ga0209758_100033658 245
707 3300025297 Ga0209758_1000877 Ga0209758_100087729 245
708 3300025297 Ga0209758_1003352 Ga0209758_10033522 245
709 3300025297 Ga0209758_1003629 Ga0209758_100362913 245
710 3300025297 Ga0209758_1008939 Ga0209758_10089395 245
711 3300025297 Ga0209758_1015276 Ga0209758_10152763 245
712 3300025297 Ga0209758_1027117 Ga0209758_10271171 245
713 3300025297 Ga0209758_1078809 Ga0209758_10788091 245
714 3300025298 Ga0209050_1002819 Ga0209050_10028196 245
715 3300025298 Ga0209050_1009815 Ga0209050_10098155 245
716 3300025299 Ga0209256_1000531 Ga0209256_100053152 245
717 3300025299 Ga0209256_1001360 Ga0209256_10013602 245
718 3300025299 Ga0209256_1002033 Ga0209256_100203310 245
719 3300025299 Ga0209256_1002068 Ga0209256_100206820 245
720 3300025299 Ga0209256_1002164 Ga0209256_10021648 245
721 3300025299 Ga0209256_1004435 Ga0209256_10044359 245
722 3300025299 Ga0209256_1006729 Ga0209256_10067295 245
723 3300025299 Ga0209256_1010949 Ga0209256_10109492 245
724 3300025302 Ga0207426_1000012 Ga0207426_100001260 245
725 3300025302 Ga0207426_1000013 Ga0207426_100001313 245
726 3300025302 Ga0207426_1000016 Ga0207426_1000016438 245
727 3300025302 Ga0207426_1000063 Ga0207426_1000063149 245
728 3300025302 Ga0207426_1000172 Ga0207426_1000172155 245
729 3300025302 Ga0207426_1001284 Ga0207426_100128424 245
730 3300025303 Ga0209051_1000084 Ga0209051_100008472 245
731 3300025303 Ga0209051_1001391 Ga0209051_100139117 245
732 3300025303 Ga0209051_1001972 Ga0209051_10019725 245
733 3300025303 Ga0209051_1003225 Ga0209051_10032256 245
734 3300025303 Ga0209051_1015056 Ga0209051_10150562 245
735 3300025303 Ga0209051_1030733 Ga0209051_10307332 245
736 3300025304 Ga0209257_1002244 Ga0209257_100224415 245
737 3300025304 Ga0209257_1009272 Ga0209257_10092722 245
738 3300025304 Ga0209257_1009288 Ga0209257_10092882 245
739 3300025304 Ga0209257_1031843 Ga0209257_10318432 245
740 3300025321 Ga0207656_10050177 Ga0207656_100501771 245
741 3300025913 Ga0207695_10000376 Ga0207695_1000037676 245
742 3300025914 Ga0207671_10000732 Ga0207671_1000073210 245
743 3300025925 Ga0207650_10000899 Ga0207650_1000089919 245
744 3300025931 Ga0207644_10021705 Ga0207644_100217055 245
745 3300025972 Ga0207668_10010428 Ga0207668_100104282 245
746 3300026067 Ga0207678_10209091 Ga0207678_102090912 245
747 3300026078 Ga0207702_10008346 Ga0207702_100083467 245
748 3300026078 Ga0207702_10146983 Ga0207702_101469832 245
749 3300026142 Ga0207698_10473597 Ga0207698_104735971 245
750 3300027111 Ga0209281_1000192 Ga0209281_100019232 245
751 3300027111 Ga0209281_1000629 Ga0209281_100062921 245
752 3300027312 Ga0209371_1000009 Ga0209371_1000009386 245
753 3300027312 Ga0209371_1001137 Ga0209371_100113713 245
754 3300027312 Ga0209371_1002001 Ga0209371_10020019 245
755 3300027666 Ga0209282_1000269 Ga0209282_100026916 245
756 3300028379 Ga0268266_10006718 Ga0268266_100067185 245
757 3300028379 Ga0268266_10040248 Ga0268266_100402484 245
758 3300028379 Ga0268266_10069283 Ga0268266_100692831 245
759 3300028379 Ga0268266_10660563 Ga0268266_106605631 245
760 3300028794 Ga0307515_10000154 Ga0307515_1000015430 245
761 3300028794 Ga0307515_10000444 Ga0307515_1000044412 245
762 3300028794 Ga0307515_10019259 Ga0307515_100192599 245
763 3300030500 Ga0268256_1000010 Ga0268256_1000010385 245
764 3300030500 Ga0268256_1002423 Ga0268256_10024238 245
765 3300030500 Ga0268256_1008149 Ga0268256_10081492 245
766 3300031456 Ga0307513_10003801 Ga0307513_1000380118 245
767 3300031731 Ga0307405_10009702 Ga0307405_100097024 245
768 3300031901 Ga0307406_10016226 Ga0307406_100162264 245
769 3300031911 Ga0307412_10001549 Ga0307412_100015497 245
770 3300031911 Ga0307412_10061217 Ga0307412_100612171 245
771 3300031995 Ga0307409_100141672 Ga0307409_1001416722 245
772 3300031995 Ga0307409_100729702 Ga0307409_1007297021 245
773 3300035692 Ga0373935_0129042 Ga0373935_0129042_861_1598 245
774 3300035695 Ga0373927_0000329 Ga0373927_0000329_4262_4999 245
775 3300037068 Ga0373925_0006529 Ga0373925_0006529_7356_8093 245
776 3300041404 Ga0439436_0000603 Ga0439436_0000603_7354_8091 245
777 3300041405 Ga0439438_026976 Ga0439438_026976_261_998 245
778 3300041413 Ga0439465_0001431 Ga0439465_0001431_6267_7004 245
779 3300041413 Ga0439465_0005132 Ga0439465_0005132_3030_3767 245
780 3300041492 Ga0451835_0532266 Ga0451835_0532266_199_936 245
781 3300041494 Ga0451837_1452220 Ga0451837_1452220_754_1491 245
782 3300041496 Ga0451839_0469472 Ga0451839_0469472_16_753 245
783 3300041496 Ga0451839_1624085 Ga0451839_1624085_103_840 245
784 3300041498 Ga0451841_1381482 Ga0451841_1381482_192_929 245
785 3300041501 Ga0451845_0636985 Ga0451845_0636985_27_764 245
786 3300041503 Ga0451847_0235905 Ga0451847_0235905_1100_1837 245
787 3300041512 Ga0451853_1200660 Ga0451853_1200660_189_926 245
788 3300042004 Ga0439445_0028025 Ga0439445_0028025_480_1217 245
789 3300042007 Ga0439449_0032178 Ga0439449_0032178_491_1228 245
790 3300042007 Ga0439449_0054665 Ga0439449_0054665_330_1067 245
791 3300042007 Ga0439449_0108782 Ga0439449_0108782_22_759 245
792 3300042007 Ga0439449_0121161 Ga0439449_0121161_93_830 245
793 3300042015 Ga0439462_0017703 Ga0439462_0017703_909_1646 245
794 3300042122 Ga0450920_018160 Ga0450920_018160_186_923 245
795 3300042136 Ga0450900_007645 Ga0450900_007645_450_1187 245
796 3300042145 Ga0450906_011583 Ga0450906_011583_854_1591 245
797 3300042435 Ga0439434_0012815 Ga0439434_0012815_1134_1871 245
798 3300042531 Ga0450918_010064 Ga0450918_010064_381_1118 245
799 3300044765 Ga0466970_0028741 Ga0466970_0028741_1215_1952 245
800 3300045976 Ga0466967_0172131 Ga0466967_0172131_106_843 245
801 3300046457 Ga0495590_0071343 Ga0495590_0071343_409_1146 245
802 3300046459 Ga0495629_0031294 Ga0495629_0031294_765_1502 245
803 3300046471 Ga0495650_0024370 Ga0495650_0024370_89_826 245
804 3300046471 Ga0495650_0080590 Ga0495650_0080590_498_1235 245
805 3300046474 Ga0495605_0087296 Ga0495605_0087296_97_834 245
806 3300046476 Ga0495662_0023435 Ga0495662_0023435_1721_2458 245
807 3300046492 Ga0495585_0051289 Ga0495585_0051289_1085_1822 245
808 3300046492 Ga0495585_0068360 Ga0495585_0068360_198_935 245
809 3300046501 Ga0495607_0042109 Ga0495607_0042109_428_1165 245
810 3300046501 Ga0495607_0065801 Ga0495607_0065801_910_1647 245
811 3300046506 Ga0495583_0001834 Ga0495583_0001834_18093_18830 245
812 3300046507 Ga0495606_0016727 Ga0495606_0016727_4451_5188 245
813 3300046507 Ga0495606_0051734 Ga0495606_0051734_882_1619 245
814 3300046507 Ga0495606_0115194 Ga0495606_0115194_277_1014 245
815 3300046507 Ga0495606_0190950 Ga0495606_0190950_41_778 245
816 3300046512 Ga0495610_0062537 Ga0495610_0062537_133_870 245
817 3300046512 Ga0495610_0073621 Ga0495610_0073621_98_835 245
818 3300046515 Ga0495620_0015977 Ga0495620_0015977_2941_3678 245
819 3300046515 Ga0495620_0024808 Ga0495620_0024808_672_1412 245
820 3300046515 Ga0495620_0082314 Ga0495620_0082314_228_965 245
821 3300046518 Ga0495631_0059477 Ga0495631_0059477_70_807 245
822 3300046519 Ga0495632_0007410 Ga0495632_0007410_3399_4136 245
823 3300046522 Ga0495643_0025235 Ga0495643_0025235_133_870 245
824 3300046522 Ga0495643_0036630 Ga0495643_0036630_1285_2022 245
825 3300046522 Ga0495643_0068980 Ga0495643_0068980_715_1452 245
826 3300046524 Ga0495648_0015099 Ga0495648_0015099_694_1431 245
827 3300046524 Ga0495648_0213108 Ga0495648_0213108_200_937 245
828 3300046530 Ga0495654_0000530 Ga0495654_0000530_27071_27808 245
829 3300046557 Ga0495622_0071154 Ga0495622_0071154_413_1150 245
830 3300046557 Ga0495622_0105665 Ga0495622_0105665_442_1179 245
831 3300046558 Ga0495633_0044464 Ga0495633_0044464_47_784 245
832 3300046558 Ga0495633_0062183 Ga0495633_0062183_975_1712 245
833 3300046558 Ga0495633_0067180 Ga0495633_0067180_561_1298 245
834 3300046558 Ga0495633_0078879 Ga0495633_0078879_740_1477 245
835 3300046615 Ga0495656_0045298 Ga0495656_0045298_1038_1775 245
836 3300046616 Ga0495668_0067076 Ga0495668_0067076_780_1517 245
837 3300046642 Ga0495634_0180857 Ga0495634_0180857_304_1041 245
838 3300046660 Ga0495625_0004038 Ga0495625_0004038_216_953 245
839 3300046660 Ga0495625_0035298 Ga0495625_0035298_99_836 245
840 3300046660 Ga0495625_0052753 Ga0495625_0052753_138_875 245
841 3300046660 Ga0495625_0107936 Ga0495625_0107936_727_1464 245
842 3300046663 Ga0495635_0025784 Ga0495635_0025784_2653_3390 245
843 3300046674 Ga0495588_0007450 Ga0495588_0007450_2425_3162 245
844 3300046674 Ga0495588_0124740 Ga0495588_0124740_350_1087 245
845 3300046674 Ga0495588_0251817 Ga0495588_0251817_121_858 245
846 3300046675 Ga0495657_0120213 Ga0495657_0120213_683_1420 245
847 3300046683 Ga0495658_0083866 Ga0495658_0083866_829_1566 245
848 3300046690 Ga0495624_0327396 Ga0495624_0327396_124_861 245
849 3300046694 Ga0495649_0030284 Ga0495649_0030284_433_1170 245
850 3300046794 Ga0495589_0081044 Ga0495589_0081044_306_1043 245
851 3300046809 Ga0495600_0017187 Ga0495600_0017187_1443_2180 245
852 3300047317 Ga0495604_0092081 Ga0495604_0092081_235_972 245
853 3300047318 Ga0495636_0056117 Ga0495636_0056117_260_997 245
854 3300047323 Ga0495683_0139790 Ga0495683_0139790_376_1113 245
855 3300047469 Ga0495673_0116321 Ga0495673_0116321_193_930 245
856 3300047470 Ga0495681_0003498 Ga0495681_0003498_9519_10256 245
857 3300047470 Ga0495681_0154310 Ga0495681_0154310_64_801 245
858 3300047472 Ga0495686_0017518 Ga0495686_0017518_673_1410 245
859 3300047472 Ga0495686_0125448 Ga0495686_0125448_269_1009 245
860 3300048090 Ga0495615_0034340 Ga0495615_0034340_145_882 245
861 3300048091 Ga0495626_0088481 Ga0495626_0088481_233_970 245
862 3300048903 Ga0496100_0026122 Ga0496100_0026122_1333_2070 245
863 3300048904 Ga0496101_0191705 Ga0496101_0191705_77_814 245
864 3300048904 Ga0496101_0429729 Ga0496101_0429729_251_991 245
865 3300048905 Ga0496102_0007354 Ga0496102_0007354_1652_2389 245
866 3300048906 Ga0496103_0014180 Ga0496103_0014180_2305_3042 245
867 3300048913 Ga0496110_0068733 Ga0496110_0068733_1359_2096 245
868 3300048914 Ga0496111_0045488 Ga0496111_0045488_540_1277 245
869 3300048915 Ga0496112_0546452 Ga0496112_0546452_32_769 245
870 3300048916 Ga0496113_0128061 Ga0496113_0128061_399_1136 245
871 3300048919 Ga0496116_0001010 Ga0496116_0001010_19442_20182 245
872 3300048919 Ga0496116_0015732 Ga0496116_0015732_4207_4944 245
873 3300048919 Ga0496116_0017253 Ga0496116_0017253_1063_1800 245
874 3300048919 Ga0496116_0023025 Ga0496116_0023025_2319_3059 245
875 3300048919 Ga0496116_0051493 Ga0496116_0051493_1677_2414 245
876 3300048919 Ga0496116_0058736 Ga0496116_0058736_1657_2397 245
877 3300048919 Ga0496116_0062069 Ga0496116_0062069_142_882 245
878 3300048919 Ga0496116_0234828 Ga0496116_0234828_82_822 245
879 3300048920 Ga0496117_0000002 Ga0496117_0000002_1906844_1907581 245
880 3300048920 Ga0496117_0000732 Ga0496117_0000732_25057_25794 245
881 3300048920 Ga0496117_0005677 Ga0496117_0005677_11937_12677 245
882 3300048920 Ga0496117_0005953 Ga0496117_0005953_10409_11146 245
883 3300048920 Ga0496117_0013837 Ga0496117_0013837_2261_2998 245
884 3300048920 Ga0496117_0047633 Ga0496117_0047633_142_882 245
885 3300048920 Ga0496117_0065685 Ga0496117_0065685_330_1067 245
886 3300048921 Ga0496118_0002815 Ga0496118_0002815_11504_12241 245
887 3300048921 Ga0496118_0005185 Ga0496118_0005185_9486_10226 245
888 3300048921 Ga0496118_0010358 Ga0496118_0010358_3583_4320 245
889 3300048921 Ga0496118_0010897 Ga0496118_0010897_479_1216 245
890 3300048921 Ga0496118_0015048 Ga0496118_0015048_2985_3722 245
891 3300048921 Ga0496118_0030250 Ga0496118_0030250_2112_2852 245
892 3300048922 Ga0496119_0020314 Ga0496119_0020314_1481_2218 245
893 3300048922 Ga0496119_0025121 Ga0496119_0025121_2667_3404 245
894 3300048922 Ga0496119_0071376 Ga0496119_0071376_407_1147 245
895 3300048922 Ga0496119_0091272 Ga0496119_0091272_101_838 245
896 3300048922 Ga0496119_0291316 Ga0496119_0291316_27_767 245
897 3300048923 Ga0496120_0000021 Ga0496120_0000021_158994_159731 245
898 3300048923 Ga0496120_0008278 Ga0496120_0008278_5124_5861 245
899 3300048923 Ga0496120_0071424 Ga0496120_0071424_352_1089 245
900 3300048923 Ga0496120_0102165 Ga0496120_0102165_454_1191 245
901 3300048923 Ga0496120_0165327 Ga0496120_0165327_40_777 245
902 3300048923 Ga0496120_0216403 Ga0496120_0216403_40_777 245
903 3300048924 Ga0496121_0000001 Ga0496121_0000001_469620_470357 245
904 3300048924 Ga0496121_0000581 Ga0496121_0000581_49564_50301 245
905 3300048924 Ga0496121_0003240 Ga0496121_0003240_10530_11267 245
906 3300048924 Ga0496121_0024071 Ga0496121_0024071_423_1160 245
907 3300048924 Ga0496121_0061551 Ga0496121_0061551_2198_2938 245
908 3300048924 Ga0496121_0137041 Ga0496121_0137041_339_1076 245
909 3300048924 Ga0496121_0153968 Ga0496121_0153968_142_882 245
910 3300048924 Ga0496121_0224742 Ga0496121_0224742_550_1287 245
911 3300048924 Ga0496121_0272964 Ga0496121_0272964_310_1047 245
912 3300048924 Ga0496121_0402774 Ga0496121_0402774_35_772 245
913 3300048924 Ga0496121_0432265 Ga0496121_0432265_82_819 245
914 3300048925 Ga0496122_0000001 Ga0496122_0000001_1277634_1278371 245
915 3300048925 Ga0496122_0000009 Ga0496122_0000009_460115_460852 245
916 3300048925 Ga0496122_0000247 Ga0496122_0000247_24631_25368 245
917 3300048925 Ga0496122_0011748 Ga0496122_0011748_6296_7033 245
918 3300048925 Ga0496122_0018902 Ga0496122_0018902_816_1553 245
919 3300048925 Ga0496122_0023069 Ga0496122_0023069_4750_5487 245
920 3300048925 Ga0496122_0029557 Ga0496122_0029557_2634_3371 245
921 3300048925 Ga0496122_0045343 Ga0496122_0045343_1738_2475 245
922 3300048925 Ga0496122_0050593 Ga0496122_0050593_1968_2705 245
923 3300048925 Ga0496122_0052622 Ga0496122_0052622_2198_2938 245
924 3300048925 Ga0496122_0054734 Ga0496122_0054734_2240_2980 245
925 3300048925 Ga0496122_0130490 Ga0496122_0130490_167_907 245
926 3300048925 Ga0496122_0277472 Ga0496122_0277472_37_777 245
927 3300048926 Ga0496123_0000001 Ga0496123_0000001_1281365_1282102 245
928 3300048926 Ga0496123_0000020 Ga0496123_0000020_264673_265410 245
929 3300048926 Ga0496123_0000222 Ga0496123_0000222_24292_25029 245
930 3300048926 Ga0496123_0005238 Ga0496123_0005238_1913_2650 245
931 3300048926 Ga0496123_0021560 Ga0496123_0021560_50_787 245
932 3300048926 Ga0496123_0032979 Ga0496123_0032979_61_801 245
933 3300048926 Ga0496123_0043345 Ga0496123_0043345_538_1278 245
934 3300048926 Ga0496123_0091621 Ga0496123_0091621_291_1028 245
935 3300048927 Ga0496124_0000063 Ga0496124_0000063_69925_70686 245
936 3300048927 Ga0496124_0005486 Ga0496124_0005486_654_1391 245
937 3300048927 Ga0496124_0005927 Ga0496124_0005927_8429_9166 245
938 3300048927 Ga0496124_0006765 Ga0496124_0006765_9502_10242 245
939 3300048927 Ga0496124_0010229 Ga0496124_0010229_674_1411 245
940 3300048927 Ga0496124_0013163 Ga0496124_0013163_5811_6548 245
941 3300048927 Ga0496124_0015770 Ga0496124_0015770_61_801 245
942 3300048927 Ga0496124_0015862 Ga0496124_0015862_5619_6356 245
943 3300048927 Ga0496124_0052100 Ga0496124_0052100_852_1589 245
944 3300048927 Ga0496124_0052416 Ga0496124_0052416_2254_2991 245
945 3300048927 Ga0496124_0058070 Ga0496124_0058070_1930_2667 245
946 3300048927 Ga0496124_0129115 Ga0496124_0129115_1105_1845 245
947 3300048927 Ga0496124_0163083 Ga0496124_0163083_181_918 245
948 3300048927 Ga0496124_0173617 Ga0496124_0173617_276_1013 245
949 3300048927 Ga0496124_0301589 Ga0496124_0301589_72_809 245
950 3300048927 Ga0496124_0364926 Ga0496124_0364926_113_853 245
951 3300048927 Ga0496124_0450074 Ga0496124_0450074_25_765 245
952 3300048928 Ga0496125_0000001 Ga0496125_0000001_581675_582412 245
953 3300048928 Ga0496125_0001358 Ga0496125_0001358_25997_26734 245
954 3300048928 Ga0496125_0002192 Ga0496125_0002192_17356_18096 245
955 3300048928 Ga0496125_0014572 Ga0496125_0014572_5465_6202 245
956 3300048928 Ga0496125_0041097 Ga0496125_0041097_2287_3024 245
957 3300048929 Ga0496126_0001362 Ga0496126_0001362_29551_30288 245
958 3300048929 Ga0496126_0012358 Ga0496126_0012358_791_1528 245
959 3300048929 Ga0496126_0095875 Ga0496126_0095875_287_1024 245
960 3300048929 Ga0496126_0143652 Ga0496126_0143652_661_1398 245
961 3300048929 Ga0496126_0235582 Ga0496126_0235582_505_1242 245
962 3300048929 Ga0496126_0305505 Ga0496126_0305505_295_1032 245
963 3300049570 Ga0501033_0083870 Ga0501033_0083870_699_1436 245
964 3300049571 Ga0501034_0395942 Ga0501034_0395942_461_1198 245
965 3300049571 Ga0501034_0782889 Ga0501034_0782889_26_763 245
966 3300049571 Ga0501034_0799597 Ga0501034_0799597_84_821 245
967 3300049572 Ga0501036_0143387 Ga0501036_0143387_214_951 245
968 3300049573 Ga0501037_0060722 Ga0501037_0060722_56_793 245
969 3300049574 Ga0501038_0094553 Ga0501038_0094553_714_1451 245
970 3300049575 Ga0501039_0161708 Ga0501039_0161708_873_1610 245
971 3300049579 Ga0501043_0041168 Ga0501043_0041168_10_747 245
972 3300049580 Ga0501046_0141505 Ga0501046_0141505_608_1345 245
973 3300049581 Ga0501047_0059074 Ga0501047_0059074_1329_2066 245
974 3300049584 Ga0501068_0153090 Ga0501068_0153090_308_1045 245
975 3300049589 Ga0501073_0157608 Ga0501073_0157608_375_1112 245
976 3300049744 Ga0501083_0054490 Ga0501083_0054490_1114_1851 245
977 3300049776 Ga0501280_001351 Ga0501280_001351_479_1216 245
978 3300049822 Ga0501035_0023157 Ga0501035_0023157_4664_5401 245
979 3300050490 nmdc:mga03n38_8375_c1 nmdc:mga03n38_8375_c1_1328_2065 245
980 3300050491 nmdc:mga00v17_133_c2 nmdc:mga00v17_133_c2_17662_18399 245
981 3300050491 nmdc:mga00v17_1528_c2 nmdc:mga00v17_1528_c2_2889_3626 245
982 3300050491 nmdc:mga00v17_257_c1 nmdc:mga00v17_257_c1_21351_22088 245
983 3300050492 nmdc:mga0yw44_279_c1 nmdc:mga0yw44_279_c1_11500_12237 245
984 3300050493 nmdc:mga0k408_77084_c1 nmdc:mga0k408_77084_c1_190_927 245
985 3300050494 nmdc:mga06z11_17846_c1 nmdc:mga06z11_17846_c1_581_1318 245
986 3300050495 nmdc:mga04h51_94105_c1 nmdc:mga04h51_94105_c1_176_913 245
987 3300050496 nmdc:mga07m45_9227_c1 nmdc:mga07m45_9227_c1_3343_4080 245
988 3300050516 nmdc:mga0sz30_38997_c1 nmdc:mga0sz30_38997_c1_133_870 245
989 3300050516 nmdc:mga0sz30_395_c1 nmdc:mga0sz30_395_c1_1879_2616 245
990 3300053086 Ga0500578_0158938 Ga0500578_0158938_553_1290 245
991 3300053086 Ga0500578_0305076 Ga0500578_0305076_97_834 245
992 3300053107 Ga0500560_009593 Ga0500560_009593_913_1650 245
993 3300053111 Ga0500572_001125 Ga0500572_001125_5588_6325 245
994 3300053121 Ga0500607_201336 Ga0500607_201336_62_799 245
995 3300053125 Ga0500618_000046 Ga0500618_000046_78220_79044 245
996 3300053125 Ga0500618_001284 Ga0500618_001284_7488_8225 245
997 3300053125 Ga0500618_004792 Ga0500618_004792_2484_3221 245
998 3300053125 Ga0500618_015519 Ga0500618_015519_616_1356 245
999 3300053125 Ga0500618_026040 Ga0500618_026040_80_817 245
1000 3300053134 Ga0500658_0017210 Ga0500658_0017210_352_1089 245
1001 3300053134 Ga0500658_0023874 Ga0500658_0023874_915_1652 245
1002 3300053137 Ga0500561_0000284 Ga0500561_0000284_542_1279 245
1003 3300053139 Ga0500568_0002051 Ga0500568_0002051_8082_8819 245
1004 3300053139 Ga0500568_0003923 Ga0500568_0003923_847_1584 245
1005 3300053140 Ga0500573_0000491 Ga0500573_0000491_13067_13804 245
1006 3300053140 Ga0500573_0001555 Ga0500573_0001555_10198_10935 245
1007 3300053148 Ga0500590_000222 Ga0500590_000222_596_1333 245
1008 3300053151 Ga0500604_0038410 Ga0500604_0038410_166_903 245
1009 3300053153 Ga0500616_0001019 Ga0500616_0001019_6602_7339 245
1010 3300053153 Ga0500616_0001529 Ga0500616_0001529_8225_8962 245
1011 3300053153 Ga0500616_0108519 Ga0500616_0108519_77_814 245
1012 3300053153 Ga0500616_0125247 Ga0500616_0125247_77_814 245
1013 3300053155 Ga0500620_107381 Ga0500620_107381_27_764 245
1014 3300053156 Ga0500622_0000653 Ga0500622_0000653_20993_21730 245
1015 3300053157 Ga0500624_002019 Ga0500624_002019_432_1169 245
1016 3300053157 Ga0500624_013063 Ga0500624_013063_181_918 245
1017 3300053158 Ga0500627_0116304 Ga0500627_0116304_151_888 245
1018 3300053158 Ga0500627_0140664 Ga0500627_0140664_251_988 245
1019 3300053161 Ga0500634_0079540 Ga0500634_0079540_96_833 245
1020 3300053177 Ga0500636_0000010 Ga0500636_0000010_68174_68911 245
1021 3300053730 Ga0500645_076790 Ga0500645_076790_96_833 245
1022 3300061719 Ga0466962_0085602 Ga0466962_0085602_238_975 245
1023 iso_pu_bacteria 650716007 650739101 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20260

PUA_4

RNA methyltransferase PUA domain

53

100

0.95

PF04452

Methyltrans_RNA

RNA methyltransferase domain

106

267

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j3c-assembly1.cif.gz_B crystal structure of 16s ribosomal rna methyltransferase rsme 0.9588 7 245
4j3c-assembly1.cif.gz_B crystal structure of 16s ribosomal rna methyltransferase rsme 0.9549 7 245
4j3c-assembly1.cif.gz_A crystal structure of 16s ribosomal rna methyltransferase rsme 0.9515 7 245
4j3c-assembly1.cif.gz_A crystal structure of 16s ribosomal rna methyltransferase rsme 0.9475 7 245
4e8b-assembly1.cif.gz_A crystal structure of 16s rrna methyltransferase rsme from e.coli 0.8665 7 244
ID Description Score Start End Superfamily
4j3cB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9635 77 245 3.40.1280.10
4j3cB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9577 77 245 3.40.1280.10
4j3cA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8918 8 76 2.40.240.20
4j3cA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8789 8 76 2.40.240.20
5o95A01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8732 6 72 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A5P9D625-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9582 4 245 GO:0005737
GO:0070042
GO:0070475
AF-A0A0F2Q1K1-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.954 1 244 GO:0005737
GO:0070042
GO:0070475
AF-A0A0F2Q1K1-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9501 1 244 GO:0005737
GO:0070042
GO:0070475
AF-A0A1M7AHJ3-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9477 2 245 GO:0005737
GO:0070042
GO:0070475
AF-A0A839AGT6-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9453 2 245 GO:0005737
GO:0070042
GO:0070475

Feature Viewer

pLDDT pTM Quality
87.62 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map