F488456
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 748 | 506 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_000046|Ga0500618_000046_78220_79044 |
| Length | 274 |
| Sequence | MDGDTSGGRRSCGDHRDGYVHAVSVRTVIVRANFRLQRLFIDTPLGVETRHELASEQFNYLANVLRLEAGAKVLVFNGRDGEWLAQVTFPSRKKIVLELTEQTRPQPEASDLHYLFAPLKVGRLDYLVQKAVEMGAGLLQPVMTQHVQGKITNLDRLRANVAEAAEQCGVLSIPDVLEPRKLADLLDHWPSDRRIIYCDEGDEGQNPLPVLANVTERKLALLVGPEGGFSEEERGLLRSLPFVTAIPLGPRILRADTAAVAALAIIQAAVGDWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 22 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 23 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 24 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 25 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 26 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 27 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 28 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 29 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 30 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 31 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 32 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 33 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 34 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 35 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 36 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 37 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 38 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 39 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 40 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 41 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 42 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 43 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 44 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 45 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 46 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 47 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 48 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 49 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 50 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 51 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 52 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 53 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 54 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 55 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 56 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 57 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 58 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 59 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 60 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 61 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 62 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 63 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 64 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 65 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 66 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 67 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 68 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 69 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 70 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 71 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 72 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 73 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 74 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 75 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 76 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 77 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 78 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 79 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 80 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 81 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 82 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 83 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 84 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 85 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 86 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 87 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 88 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 89 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 90 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 91 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 92 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 93 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 94 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 95 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 96 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 97 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 98 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 99 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 100 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 101 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 102 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 103 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 104 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 105 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 106 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 107 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 108 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 109 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 110 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 111 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 112 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 113 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 114 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 115 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 116 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 117 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 118 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 119 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 120 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 121 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 122 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 123 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 124 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 125 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 126 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 127 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 128 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 129 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 130 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 131 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 132 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 133 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 134 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 135 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 136 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 137 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 138 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 139 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 140 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 141 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 142 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 143 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 144 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 145 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 146 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 147 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 148 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 149 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 150 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 151 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 152 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 153 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 154 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 155 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 156 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 157 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 158 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 159 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 160 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 161 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 162 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 163 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 164 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 165 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 166 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 167 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 168 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 169 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 170 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 171 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 172 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 173 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 174 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 175 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 176 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 177 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 178 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 179 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 180 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 181 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 182 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 183 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 184 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 185 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 186 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 187 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 188 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 189 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 190 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 191 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 192 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 193 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 194 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 195 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 196 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 197 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 198 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 199 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 200 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 201 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 202 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 203 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 204 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 205 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 206 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 207 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 208 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 209 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 210 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 211 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 212 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 213 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 214 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 215 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 216 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 217 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 218 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 219 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 220 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 221 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 222 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 223 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 224 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 225 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 226 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 227 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 228 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 229 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 230 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 231 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 232 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 233 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 234 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 235 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 236 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 237 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 238 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 239 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 240 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 241 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 242 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 243 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 244 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 245 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 246 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 247 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 248 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 249 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 250 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 251 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 252 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 253 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 254 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 255 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 256 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 257 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 258 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 259 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 260 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 261 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 262 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 263 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 264 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 265 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 266 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 267 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 268 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 269 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 270 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 271 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 272 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 273 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 274 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 275 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 276 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 277 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 278 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 279 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 280 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 281 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 282 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 283 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 284 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 285 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 286 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 287 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 288 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 289 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 290 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 291 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 292 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 293 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 294 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 295 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 296 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 297 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 298 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 299 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 300 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 301 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 302 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 303 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 304 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 305 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 306 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 307 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 308 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 309 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 310 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 311 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 312 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 313 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 314 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 315 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 316 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 317 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 318 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 319 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 320 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 321 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 322 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 323 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 324 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 325 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 326 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 327 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 328 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 329 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 330 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 331 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 332 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 333 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 334 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 335 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 336 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 337 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 338 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 339 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 340 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 341 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 342 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 343 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 344 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 345 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 346 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 347 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 348 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 349 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 350 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 351 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 352 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 353 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 354 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 355 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 356 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 357 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 358 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 359 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 360 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 361 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 362 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 363 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 364 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 365 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 366 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 367 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 368 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 369 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 370 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 371 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 372 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 373 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 374 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 375 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 376 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 377 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 378 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 379 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 380 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 381 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 382 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 383 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 384 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 385 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 386 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 387 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 388 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 389 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 390 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 391 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 392 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 393 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 394 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 395 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 396 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 397 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 398 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 399 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 400 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 401 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 402 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 403 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 404 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 405 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 406 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 407 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 408 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 409 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 410 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 411 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 412 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 413 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 414 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 415 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 416 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 417 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 418 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 419 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 420 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 421 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 422 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 423 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 424 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 425 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 426 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 427 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 428 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 429 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 430 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 431 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 432 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 433 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 434 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 435 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 436 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 437 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 438 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 439 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 440 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 441 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 442 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 443 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 444 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 445 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 446 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 447 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 448 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 449 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 450 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 451 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 452 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 453 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 454 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 455 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 456 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 457 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 458 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 459 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 460 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 461 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 462 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 463 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 464 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 465 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 466 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 467 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 468 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 469 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 470 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 471 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 472 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 473 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 474 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 475 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 476 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 477 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 478 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 479 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 480 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 481 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 482 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 483 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 484 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 485 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 486 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 487 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 488 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 489 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 490 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 491 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 492 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 493 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 494 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 495 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 500 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 501 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 502 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 503 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 504 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 505 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 506 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 507 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 508 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 509 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 510 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 511 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 512 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 513 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 514 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 515 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 516 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 517 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 518 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 520 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 521 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 522 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 523 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 524 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 525 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 526 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 527 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 528 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 529 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 530 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 531 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 532 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 534 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 535 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 536 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 537 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 538 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 539 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 540 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 541 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 542 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 543 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 545 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 547 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 549 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 550 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 551 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 563 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 565 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 567 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 568 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 569 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 570 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 571 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 572 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 573 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 574 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 575 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 576 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 577 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 578 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 579 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 580 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 581 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 582 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 583 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 584 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 585 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 586 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 587 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 588 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 589 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 590 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 591 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 592 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 593 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 594 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 595 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 596 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 597 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 598 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 638 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 639 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 640 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 641 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 642 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 643 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 644 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 645 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 646 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 647 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 648 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 649 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 650 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 651 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 652 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 653 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 654 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 655 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 656 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 657 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 660 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 661 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 663 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 664 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 669 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 670 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 671 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 672 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 674 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 675 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 676 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 677 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 679 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 680 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 681 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 682 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 683 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 684 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 685 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 686 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 687 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 688 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 689 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 690 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 691 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 692 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 693 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 694 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 695 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 696 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 697 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 698 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 699 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 700 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 701 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 702 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 703 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 704 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 705 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 706 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 707 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 708 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 709 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 710 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 711 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 712 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 713 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 714 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 715 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 716 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 717 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 718 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 719 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 720 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 721 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 722 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 723 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 724 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 725 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 726 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 727 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 728 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 729 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 730 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 731 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 732 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 733 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 734 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 735 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 736 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 737 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 738 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 739 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 740 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 741 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 742 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 743 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 744 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 745 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 746 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 747 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 748 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.46 |
| Metatranscriptomes | 0 |
| Isolates | 50.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.39 |
| Bulb | 0 |
| Endosphere | 20.23 |
| Nodule | 37.83 |
| Rhizoplane | 1.76 |
| Rhizosphere | 20.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000023 | 3300002704 | Bacteria | 136961 |
| 2 | JGI25156J39149_1000094 | 3300002705 | Bacteria | 65145 |
| 3 | JGI25162J39368_1000177 | 3300002737 | Bacteria | 68786 |
| 4 | JGI25162J39368_1000803 | 3300002737 | Bacteria | 20853 |
| 5 | JGI25154J39366_1000213 | 3300002738 | Bacteria | 40261 |
| 6 | JGI25158J39367_1000091 | 3300002739 | Bacteria | 21033 |
| 7 | JGI25158J39367_1004200 | 3300002739 | Bacteria | 2171 |
| 8 | JGI25157J39369_1000043 | 3300002741 | Bacteria | 122537 |
| 9 | JGI25152J39213_1002205 | 3300002773 | Bacteria | 7572 |
| 10 | JGI25152J39213_1003952 | 3300002773 | Bacteria | 4844 |
| 11 | JGI25152J39213_1004109 | 3300002773 | Bacteria | 4703 |
| 12 | JGI25152J39213_1017526 | 3300002773 | Bacteria | 1350 |
| 13 | JGI25150J39212_1000378 | 3300002774 | Bacteria | 21367 |
| 14 | JGI25159J45721_1000016 | 3300002987 | Bacteria | 139656 |
| 15 | JGI25159J45721_1000279 | 3300002987 | Bacteria | 24002 |
| 16 | JGI25159J45721_1003209 | 3300002987 | Bacteria | 5855 |
| 17 | JGI25151J46595_10000250 | 3300003187 | Bacteria | 62876 |
| 18 | JGI25151J46595_10000565 | 3300003187 | Bacteria | 33453 |
| 19 | JGI25151J46595_10005624 | 3300003187 | Bacteria | 6444 |
| 20 | JGI25151J46595_10012978 | 3300003187 | Bacteria | 3764 |
| 21 | JGI25151J46595_10017052 | 3300003187 | Bacteria | 3162 |
| 22 | JGI25165J46597_1000415 | 3300003214 | Bacteria | 44714 |
| 23 | JGI25165J46597_1000555 | 3300003214 | Bacteria | 34009 |
| 24 | JGI25153J46596_10000833 | 3300003215 | Bacteria | 18843 |
| 25 | JGI25153J46596_10001644 | 3300003215 | Bacteria | 13256 |
| 26 | JGI25153J46596_10009682 | 3300003215 | Bacteria | 4439 |
| 27 | rootH2_10027335 | 3300003320 | Bacteria | 10879 |
| 28 | rootL2_10010419 | 3300003322 | Bacteria | 9355 |
| 29 | rootL2_10126227 | 3300003322 | Bacteria | 1756 |
| 30 | rootH1_10028824 | 3300003323 | Bacteria | 8562 |
| 31 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 32 | JGI25160J50197_1000046 | 3300003354 | Bacteria | 141352 |
| 33 | JGI25160J50197_1009230 | 3300003354 | Bacteria | 3678 |
| 34 | JGI25160J50197_1016920 | 3300003354 | Bacteria | 2331 |
| 35 | JGI25161J50226_1000031 | 3300003374 | Bacteria | 141352 |
| 36 | JGI25161J50226_1000074 | 3300003374 | Bacteria | 85547 |
| 37 | JGI25161J50226_1000333 | 3300003374 | Bacteria | 25481 |
| 38 | Ga0055526_1000207 | 3300003771 | Bacteria | 50680 |
| 39 | Ga0055526_1004816 | 3300003771 | Bacteria | 7975 |
| 40 | Ga0055526_1007043 | 3300003771 | Bacteria | 5946 |
| 41 | Ga0055526_1007746 | 3300003771 | Bacteria | 5512 |
| 42 | Ga0055526_1022341 | 3300003771 | Bacteria | 2155 |
| 43 | Ga0055524_1001148 | 3300003775 | Bacteria | 15947 |
| 44 | Ga0055524_1007167 | 3300003775 | Bacteria | 4771 |
| 45 | Ga0055524_1008334 | 3300003775 | Bacteria | 4312 |
| 46 | Ga0055524_1015372 | 3300003775 | Bacteria | 2793 |
| 47 | Ga0055524_1026608 | 3300003775 | Bacteria | 1782 |
| 48 | Ga0055524_1030533 | 3300003775 | Bacteria | 1569 |
| 49 | Ga0055536_1005508 | 3300003781 | Bacteria | 6165 |
| 50 | Ga0055528_1000146 | 3300003790 | Bacteria | 57915 |
| 51 | Ga0055528_1000636 | 3300003790 | Bacteria | 25725 |
| 52 | Ga0055528_1002292 | 3300003790 | Bacteria | 10366 |
| 53 | Ga0055528_1004046 | 3300003790 | Bacteria | 7168 |
| 54 | Ga0055528_1006665 | 3300003790 | Bacteria | 5210 |
| 55 | Ga0055528_1007009 | 3300003790 | Bacteria | 5040 |
| 56 | Ga0055530_10012423 | 3300003791 | Bacteria | 2971 |
| 57 | Ga0055530_10018589 | 3300003791 | Bacteria | 2136 |
| 58 | Ga0055540_1000111 | 3300003792 | Bacteria | 88263 |
| 59 | Ga0055540_1002236 | 3300003792 | Bacteria | 10477 |
| 60 | Ga0055540_1016230 | 3300003792 | Bacteria | 2129 |
| 61 | Ga0055531_10006091 | 3300003794 | Bacteria | 6907 |
| 62 | Ga0058692_1001904 | 3300003856 | Bacteria | 7317 |
| 63 | Ga0058692_1001956 | 3300003856 | Bacteria | 7180 |
| 64 | Ga0058692_1020979 | 3300003856 | Bacteria | 1364 |
| 65 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 66 | Ga0055543_1000022 | 3300004625 | Bacteria | 140745 |
| 67 | Ga0055543_1000188 | 3300004625 | Bacteria | 50290 |
| 68 | Ga0055543_1000460 | 3300004625 | Bacteria | 24085 |
| 69 | Ga0065165_1000058 | 3300005262 | Bacteria | 184784 |
| 70 | Ga0065165_1000336 | 3300005262 | Bacteria | 76934 |
| 71 | Ga0065165_1003090 | 3300005262 | Bacteria | 12404 |
| 72 | Ga0065165_1024457 | 3300005262 | Bacteria | 2027 |
| 73 | Ga0070670_100000173 | 3300005331 | Bacteria | 58127 |
| 74 | Ga0070668_100032636 | 3300005347 | Bacteria | 3963 |
| 75 | Ga0070669_100025581 | 3300005353 | Bacteria | 4241 |
| 76 | Ga0070671_100013462 | 3300005355 | Bacteria | 6595 |
| 77 | Ga0070663_100105530 | 3300005455 | Bacteria | 2109 |
| 78 | Ga0070665_100002331 | 3300005548 | Bacteria | 21067 |
| 79 | Ga0070665_100042307 | 3300005548 | Bacteria | 4579 |
| 80 | Ga0070665_100399122 | 3300005548 | Bacteria | 1383 |
| 81 | Ga0068856_100060399 | 3300005614 | Bacteria | 3745 |
| 82 | Ga0068856_100810448 | 3300005614 | Bacteria | 956 |
| 83 | Ga0068852_100498891 | 3300005616 | Bacteria | 1212 |
| 84 | Ga0075365_10071101 | 3300006038 | Bacteria | 2342 |
| 85 | Ga0075365_10110557 | 3300006038 | Bacteria | 1888 |
| 86 | Ga0075365_10392305 | 3300006038 | Bacteria | 979 |
| 87 | Ga0075363_100050337 | 3300006048 | Bacteria | 2220 |
| 88 | Ga0075364_10001442 | 3300006051 | Bacteria | 12894 |
| 89 | Ga0075364_10021036 | 3300006051 | Bacteria | 4109 |
| 90 | Ga0075362_10009154 | 3300006177 | Bacteria | 3816 |
| 91 | Ga0075367_10008199 | 3300006178 | Bacteria | 5399 |
| 92 | Ga0075369_10002117 | 3300006186 | Bacteria | 7015 |
| 93 | Ga0075366_10018810 | 3300006195 | Bacteria | 3992 |
| 94 | Ga0075366_10083027 | 3300006195 | Bacteria | 1915 |
| 95 | Ga0075370_10003403 | 3300006353 | Bacteria | 7564 |
| 96 | Ga0075370_10010644 | 3300006353 | Bacteria | 4819 |
| 97 | Ga0099826_10000542 | 3300006948 | Bacteria | 18745 |
| 98 | Ga0099826_10007443 | 3300006948 | Bacteria | 8085 |
| 99 | Ga0105244_10032731 | 3300009036 | Bacteria | 2749 |
| 100 | Ga0105244_10044968 | 3300009036 | Bacteria | 2273 |
| 101 | Ga0105240_10000278 | 3300009093 | Bacteria | 101540 |
| 102 | Ga0105243_10025492 | 3300009148 | Bacteria | 4519 |
| 103 | Ga0105243_10027876 | 3300009148 | Bacteria | 4332 |
| 104 | Ga0105248_10054238 | 3300009177 | Bacteria | 4495 |
| 105 | Ga0105237_10005254 | 3300009545 | Bacteria | 14655 |
| 106 | Ga0123342_1032774 | 3300009766 | Bacteria | 2411 |
| 107 | Ga0105033_102667 | 3300009986 | Bacteria | 1480 |
| 108 | Ga0105239_10005703 | 3300010375 | Bacteria | 14538 |
| 109 | Ga0105239_10515350 | 3300010375 | Bacteria | 1360 |
| 110 | Ga0105246_10227448 | 3300011119 | Bacteria | 1466 |
| 111 | Ga0157347_1008248 | 3300012502 | Bacteria | 1056 |
| 112 | Ga0157373_10010891 | 3300013100 | Bacteria | 6694 |
| 113 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 114 | Ga0157370_10001488 | 3300013104 | Bacteria | 29012 |
| 115 | Ga0157370_10003259 | 3300013104 | Bacteria | 19131 |
| 116 | Ga0157370_10031263 | 3300013104 | Bacteria | 5209 |
| 117 | Ga0157369_10069570 | 3300013105 | Bacteria | 3781 |
| 118 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 119 | Ga0182005_1001660 | 3300015265 | Bacteria | 8643 |
| 120 | Ga0183363_1107 | 3300015690 | Bacteria | 23526 |
| 121 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 122 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 123 | Ga0214542_1026881 | 3300021321 | Bacteria | 2729 |
| 124 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 125 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 126 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 127 | Ga0209436_100447 | 3300025208 | Bacteria | 18524 |
| 128 | Ga0209436_100516 | 3300025208 | Bacteria | 16861 |
| 129 | Ga0209436_119163 | 3300025208 | Bacteria | 955 |
| 130 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 131 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 132 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 133 | Ga0207425_1000840 | 3300025245 | Bacteria | 15261 |
| 134 | Ga0207425_1021458 | 3300025245 | Bacteria | 1369 |
| 135 | Ga0207425_1022622 | 3300025245 | Bacteria | 1322 |
| 136 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 137 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 138 | Ga0209677_100267 | 3300025253 | Bacteria | 35499 |
| 139 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 140 | Ga0209129_1000086 | 3300025258 | Bacteria | 181543 |
| 141 | Ga0209129_1000123 | 3300025258 | Bacteria | 133661 |
| 142 | Ga0209129_1000316 | 3300025258 | Bacteria | 42919 |
| 143 | Ga0209129_1001356 | 3300025258 | Bacteria | 13800 |
| 144 | Ga0209129_1001470 | 3300025258 | Bacteria | 13111 |
| 145 | Ga0209129_1012397 | 3300025258 | Bacteria | 1959 |
| 146 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 147 | Ga0209233_1000166 | 3300025261 | Bacteria | 152270 |
| 148 | Ga0209233_1000350 | 3300025261 | Bacteria | 43454 |
| 149 | Ga0209455_1017753 | 3300025272 | Bacteria | 1481 |
| 150 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 151 | Ga0209673_1000091 | 3300025273 | Bacteria | 201875 |
| 152 | Ga0209673_1000919 | 3300025273 | Bacteria | 37355 |
| 153 | Ga0209673_1002434 | 3300025273 | Bacteria | 12926 |
| 154 | Ga0209673_1002489 | 3300025273 | Bacteria | 12699 |
| 155 | Ga0209673_1006679 | 3300025273 | Bacteria | 5507 |
| 156 | Ga0209673_1010462 | 3300025273 | Bacteria | 3912 |
| 157 | Ga0209673_1012741 | 3300025273 | Bacteria | 3365 |
| 158 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 159 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 160 | Ga0209130_1000088 | 3300025284 | Bacteria | 152927 |
| 161 | Ga0209130_1036182 | 3300025284 | Bacteria | 982 |
| 162 | Ga0209676_1006633 | 3300025292 | Bacteria | 5654 |
| 163 | Ga0209676_1010742 | 3300025292 | Bacteria | 3773 |
| 164 | Ga0209676_1021677 | 3300025292 | Bacteria | 2149 |
| 165 | Ga0209676_1034700 | 3300025292 | Bacteria | 1488 |
| 166 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 167 | Ga0209025_1000407 | 3300025294 | Bacteria | 87041 |
| 168 | Ga0209025_1000469 | 3300025294 | Bacteria | 78737 |
| 169 | Ga0209025_1001129 | 3300025294 | Bacteria | 38238 |
| 170 | Ga0209025_1001232 | 3300025294 | Bacteria | 35695 |
| 171 | Ga0209025_1001360 | 3300025294 | Bacteria | 32827 |
| 172 | Ga0209025_1013476 | 3300025294 | Bacteria | 5132 |
| 173 | Ga0209025_1019467 | 3300025294 | Bacteria | 3774 |
| 174 | Ga0209025_1020353 | 3300025294 | Bacteria | 3635 |
| 175 | Ga0209025_1030915 | 3300025294 | Bacteria | 2548 |
| 176 | Ga0209025_1089964 | 3300025294 | Bacteria | 1007 |
| 177 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 178 | Ga0209564_1000845 | 3300025295 | Bacteria | 41202 |
| 179 | Ga0209564_1001820 | 3300025295 | Bacteria | 19586 |
| 180 | Ga0209564_1002233 | 3300025295 | Bacteria | 15971 |
| 181 | Ga0209564_1003141 | 3300025295 | Bacteria | 11636 |
| 182 | Ga0209564_1021873 | 3300025295 | Bacteria | 2282 |
| 183 | Ga0209564_1037278 | 3300025295 | Bacteria | 1373 |
| 184 | Ga0209564_1051467 | 3300025295 | Bacteria | 999 |
| 185 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 186 | Ga0209758_1000336 | 3300025297 | Bacteria | 87439 |
| 187 | Ga0209758_1000877 | 3300025297 | Bacteria | 41329 |
| 188 | Ga0209758_1003352 | 3300025297 | Bacteria | 14688 |
| 189 | Ga0209758_1003629 | 3300025297 | Bacteria | 13799 |
| 190 | Ga0209758_1008939 | 3300025297 | Bacteria | 6350 |
| 191 | Ga0209758_1015276 | 3300025297 | Bacteria | 3993 |
| 192 | Ga0209758_1027117 | 3300025297 | Bacteria | 2458 |
| 193 | Ga0209758_1078809 | 3300025297 | Bacteria | 1005 |
| 194 | Ga0209050_1002819 | 3300025298 | Bacteria | 13880 |
| 195 | Ga0209050_1009815 | 3300025298 | Bacteria | 4822 |
| 196 | Ga0209256_1000531 | 3300025299 | Bacteria | 55283 |
| 197 | Ga0209256_1001360 | 3300025299 | Bacteria | 25775 |
| 198 | Ga0209256_1002033 | 3300025299 | Bacteria | 17991 |
| 199 | Ga0209256_1002068 | 3300025299 | Bacteria | 17685 |
| 200 | Ga0209256_1002164 | 3300025299 | Bacteria | 16928 |
| 201 | Ga0209256_1004435 | 3300025299 | Bacteria | 8820 |
| 202 | Ga0209256_1006729 | 3300025299 | Bacteria | 5957 |
| 203 | Ga0209256_1010949 | 3300025299 | Bacteria | 3711 |
| 204 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 205 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 206 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 207 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 208 | Ga0207426_1000172 | 3300025302 | Bacteria | 163690 |
| 209 | Ga0207426_1001284 | 3300025302 | Bacteria | 21757 |
| 210 | Ga0209051_1000084 | 3300025303 | Bacteria | 190324 |
| 211 | Ga0209051_1001391 | 3300025303 | Bacteria | 20798 |
| 212 | Ga0209051_1001972 | 3300025303 | Bacteria | 15771 |
| 213 | Ga0209051_1003225 | 3300025303 | Bacteria | 10863 |
| 214 | Ga0209051_1015056 | 3300025303 | Bacteria | 3578 |
| 215 | Ga0209051_1030733 | 3300025303 | Bacteria | 2079 |
| 216 | Ga0209257_1002244 | 3300025304 | Bacteria | 19810 |
| 217 | Ga0209257_1009272 | 3300025304 | Bacteria | 5322 |
| 218 | Ga0209257_1009288 | 3300025304 | Bacteria | 5312 |
| 219 | Ga0209257_1031843 | 3300025304 | Bacteria | 1680 |
| 220 | Ga0207656_10050177 | 3300025321 | Bacteria | 1801 |
| 221 | Ga0207695_10000376 | 3300025913 | Bacteria | 101548 |
| 222 | Ga0207671_10000732 | 3300025914 | Bacteria | 41620 |
| 223 | Ga0207650_10000899 | 3300025925 | Bacteria | 22456 |
| 224 | Ga0207644_10021705 | 3300025931 | Bacteria | 4378 |
| 225 | Ga0207668_10010428 | 3300025972 | Bacteria | 5613 |
| 226 | Ga0207678_10209091 | 3300026067 | Bacteria | 1669 |
| 227 | Ga0207702_10008346 | 3300026078 | Bacteria | 8745 |
| 228 | Ga0207702_10146983 | 3300026078 | Bacteria | 2140 |
| 229 | Ga0207698_10473597 | 3300026142 | Bacteria | 1213 |
| 230 | Ga0209281_1000192 | 3300027111 | Bacteria | 140252 |
| 231 | Ga0209281_1000629 | 3300027111 | Bacteria | 39061 |
| 232 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 233 | Ga0209371_1001137 | 3300027312 | Bacteria | 19526 |
| 234 | Ga0209371_1002001 | 3300027312 | Bacteria | 12266 |
| 235 | Ga0209282_1000269 | 3300027666 | Bacteria | 25931 |
| 236 | Ga0268266_10006718 | 3300028379 | Bacteria | 10490 |
| 237 | Ga0268266_10040248 | 3300028379 | Bacteria | 3983 |
| 238 | Ga0268266_10069283 | 3300028379 | Bacteria | 3056 |
| 239 | Ga0268266_10660563 | 3300028379 | Bacteria | 1006 |
| 240 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 241 | Ga0307515_10000444 | 3300028794 | Bacteria | 99282 |
| 242 | Ga0307515_10019259 | 3300028794 | Bacteria | 12301 |
| 243 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 244 | Ga0268256_1002423 | 3300030500 | Bacteria | 9521 |
| 245 | Ga0268256_1008149 | 3300030500 | Bacteria | 3629 |
| 246 | Ga0307513_10003801 | 3300031456 | Bacteria | 20347 |
| 247 | Ga0307405_10009702 | 3300031731 | Bacteria | 4949 |
| 248 | Ga0307406_10016226 | 3300031901 | Bacteria | 4324 |
| 249 | Ga0307412_10001549 | 3300031911 | Bacteria | 12704 |
| 250 | Ga0307412_10061217 | 3300031911 | Bacteria | 2530 |
| 251 | Ga0307409_100141672 | 3300031995 | Bacteria | 2073 |
| 252 | Ga0307409_100729702 | 3300031995 | Bacteria | 993 |
| 253 | Ga0373935_0129042 | 3300035692 | Bacteria | 1697 |
| 254 | Ga0373927_0000329 | 3300035695 | Bacteria | 37272 |
| 255 | Ga0373925_0006529 | 3300037068 | Bacteria | 8576 |
| 256 | Ga0439436_0000603 | 3300041404 | Bacteria | 9514 |
| 257 | Ga0439438_026976 | 3300041405 | Bacteria | 1554 |
| 258 | Ga0439439_0023101 | 3300041406 | Bacteria | 1557 |
| 259 | Ga0439461_0042684 | 3300041410 | Bacteria | 984 |
| 260 | Ga0439465_0001431 | 3300041413 | Bacteria | 7721 |
| 261 | Ga0439465_0005132 | 3300041413 | Bacteria | 4202 |
| 262 | Ga0451835_0532266 | 3300041492 | Bacteria | 4381 |
| 263 | Ga0451837_1452220 | 3300041494 | Bacteria | 1583 |
| 264 | Ga0451839_0469472 | 3300041496 | Bacteria | 1284 |
| 265 | Ga0451839_1624085 | 3300041496 | Bacteria | 886 |
| 266 | Ga0451841_1381482 | 3300041498 | Bacteria | 965 |
| 267 | Ga0451845_0636985 | 3300041501 | Bacteria | 955 |
| 268 | Ga0451847_0235905 | 3300041503 | Bacteria | 2027 |
| 269 | Ga0451853_1200660 | 3300041512 | Bacteria | 1246 |
| 270 | Ga0439445_0028025 | 3300042004 | Bacteria | 1450 |
| 271 | Ga0439449_0032178 | 3300042007 | Bacteria | 1955 |
| 272 | Ga0439449_0054665 | 3300042007 | Bacteria | 1475 |
| 273 | Ga0439449_0108782 | 3300042007 | Bacteria | 1026 |
| 274 | Ga0439449_0121161 | 3300042007 | Bacteria | 971 |
| 275 | Ga0439462_0017703 | 3300042015 | Bacteria | 1846 |
| 276 | Ga0450920_018160 | 3300042122 | Bacteria | 1346 |
| 277 | Ga0450900_007645 | 3300042136 | Bacteria | 1335 |
| 278 | Ga0450906_011583 | 3300042145 | Bacteria | 1646 |
| 279 | Ga0439434_0012815 | 3300042435 | Bacteria | 2485 |
| 280 | Ga0450918_010064 | 3300042531 | Bacteria | 1651 |
| 281 | Ga0466970_0028741 | 3300044765 | Bacteria | 2924 |
| 282 | Ga0466967_0172131 | 3300045976 | Bacteria | 2038 |
| 283 | Ga0495590_0071343 | 3300046457 | Bacteria | 1219 |
| 284 | Ga0495629_0031294 | 3300046459 | Bacteria | 3768 |
| 285 | Ga0495650_0024370 | 3300046471 | Bacteria | 2859 |
| 286 | Ga0495650_0080590 | 3300046471 | Bacteria | 1256 |
| 287 | Ga0495605_0087296 | 3300046474 | Bacteria | 1451 |
| 288 | Ga0495662_0023435 | 3300046476 | Bacteria | 2981 |
| 289 | Ga0495585_0051289 | 3300046492 | Bacteria | 2287 |
| 290 | Ga0495585_0068360 | 3300046492 | Bacteria | 1941 |
| 291 | Ga0495607_0042109 | 3300046501 | Bacteria | 2709 |
| 292 | Ga0495607_0065801 | 3300046501 | Bacteria | 2042 |
| 293 | Ga0495583_0001834 | 3300046506 | Bacteria | 19816 |
| 294 | Ga0495606_0016727 | 3300046507 | Bacteria | 5577 |
| 295 | Ga0495606_0051734 | 3300046507 | Bacteria | 2677 |
| 296 | Ga0495606_0115194 | 3300046507 | Bacteria | 1616 |
| 297 | Ga0495606_0190950 | 3300046507 | Bacteria | 1174 |
| 298 | Ga0495610_0062537 | 3300046512 | Bacteria | 1765 |
| 299 | Ga0495610_0073621 | 3300046512 | Bacteria | 1587 |
| 300 | Ga0495620_0015977 | 3300046515 | Bacteria | 3778 |
| 301 | Ga0495620_0024808 | 3300046515 | Bacteria | 2847 |
| 302 | Ga0495620_0082314 | 3300046515 | Bacteria | 1301 |
| 303 | Ga0495631_0059477 | 3300046518 | Bacteria | 1660 |
| 304 | Ga0495632_0007410 | 3300046519 | Bacteria | 6892 |
| 305 | Ga0495643_0025235 | 3300046522 | Bacteria | 3364 |
| 306 | Ga0495643_0036630 | 3300046522 | Bacteria | 2694 |
| 307 | Ga0495643_0068980 | 3300046522 | Bacteria | 1860 |
| 308 | Ga0495648_0015099 | 3300046524 | Bacteria | 5623 |
| 309 | Ga0495648_0213108 | 3300046524 | Bacteria | 958 |
| 310 | Ga0495654_0000530 | 3300046530 | Bacteria | 30917 |
| 311 | Ga0495597_0075909 | 3300046542 | Bacteria | 1442 |
| 312 | Ga0495622_0071154 | 3300046557 | Bacteria | 1605 |
| 313 | Ga0495622_0105665 | 3300046557 | Bacteria | 1290 |
| 314 | Ga0495633_0044464 | 3300046558 | Bacteria | 2105 |
| 315 | Ga0495633_0062183 | 3300046558 | Bacteria | 1748 |
| 316 | Ga0495633_0067180 | 3300046558 | Bacteria | 1674 |
| 317 | Ga0495633_0078879 | 3300046558 | Bacteria | 1533 |
| 318 | Ga0495656_0045298 | 3300046615 | Bacteria | 1856 |
| 319 | Ga0495668_0067076 | 3300046616 | Bacteria | 1974 |
| 320 | Ga0495634_0180857 | 3300046642 | Bacteria | 1320 |
| 321 | Ga0495625_0004038 | 3300046660 | Bacteria | 14030 |
| 322 | Ga0495625_0035298 | 3300046660 | Bacteria | 3686 |
| 323 | Ga0495625_0052753 | 3300046660 | Bacteria | 2911 |
| 324 | Ga0495625_0107936 | 3300046660 | Bacteria | 1905 |
| 325 | Ga0495635_0025784 | 3300046663 | Bacteria | 4095 |
| 326 | Ga0495588_0007450 | 3300046674 | Bacteria | 4983 |
| 327 | Ga0495588_0124740 | 3300046674 | Bacteria | 1358 |
| 328 | Ga0495588_0251817 | 3300046674 | Bacteria | 931 |
| 329 | Ga0495657_0120213 | 3300046675 | Bacteria | 1655 |
| 330 | Ga0495658_0083866 | 3300046683 | Bacteria | 1875 |
| 331 | Ga0495624_0327396 | 3300046690 | Bacteria | 922 |
| 332 | Ga0495649_0030284 | 3300046694 | Bacteria | 2990 |
| 333 | Ga0495589_0081044 | 3300046794 | Bacteria | 1579 |
| 334 | Ga0495600_0017187 | 3300046809 | Bacteria | 4597 |
| 335 | Ga0495604_0092081 | 3300047317 | Bacteria | 2246 |
| 336 | Ga0495636_0056117 | 3300047318 | Bacteria | 1658 |
| 337 | Ga0495683_0139790 | 3300047323 | Bacteria | 1136 |
| 338 | Ga0495673_0116321 | 3300047469 | Bacteria | 1063 |
| 339 | Ga0495681_0003498 | 3300047470 | Bacteria | 10915 |
| 340 | Ga0495681_0154310 | 3300047470 | Bacteria | 961 |
| 341 | Ga0495686_0017518 | 3300047472 | Bacteria | 4822 |
| 342 | Ga0495686_0125448 | 3300047472 | Bacteria | 1526 |
| 343 | Ga0495615_0034340 | 3300048090 | Bacteria | 1234 |
| 344 | Ga0495626_0088481 | 3300048091 | Bacteria | 1365 |
| 345 | Ga0496100_0026122 | 3300048903 | Bacteria | 3577 |
| 346 | Ga0496101_0191705 | 3300048904 | Bacteria | 1578 |
| 347 | Ga0496101_0429729 | 3300048904 | Bacteria | 1041 |
| 348 | Ga0496102_0007354 | 3300048905 | Bacteria | 9408 |
| 349 | Ga0496103_0014180 | 3300048906 | Bacteria | 4731 |
| 350 | Ga0496110_0068733 | 3300048913 | Bacteria | 3136 |
| 351 | Ga0496111_0045488 | 3300048914 | Bacteria | 3158 |
| 352 | Ga0496112_0546452 | 3300048915 | Bacteria | 1092 |
| 353 | Ga0496113_0128061 | 3300048916 | Bacteria | 1990 |
| 354 | Ga0496116_0001010 | 3300048919 | Bacteria | 34302 |
| 355 | Ga0496116_0015732 | 3300048919 | Bacteria | 5964 |
| 356 | Ga0496116_0017253 | 3300048919 | Bacteria | 5612 |
| 357 | Ga0496116_0023025 | 3300048919 | Bacteria | 4649 |
| 358 | Ga0496116_0051493 | 3300048919 | Bacteria | 2735 |
| 359 | Ga0496116_0058736 | 3300048919 | Bacteria | 2505 |
| 360 | Ga0496116_0062069 | 3300048919 | Bacteria | 2415 |
| 361 | Ga0496116_0234828 | 3300048919 | Bacteria | 926 |
| 362 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 363 | Ga0496117_0000732 | 3300048920 | Bacteria | 51545 |
| 364 | Ga0496117_0005677 | 3300048920 | Bacteria | 13004 |
| 365 | Ga0496117_0005953 | 3300048920 | Bacteria | 12570 |
| 366 | Ga0496117_0013837 | 3300048920 | Bacteria | 7000 |
| 367 | Ga0496117_0047633 | 3300048920 | Bacteria | 3071 |
| 368 | Ga0496117_0065685 | 3300048920 | Bacteria | 2465 |
| 369 | Ga0496118_0002815 | 3300048921 | Bacteria | 22770 |
| 370 | Ga0496118_0005185 | 3300048921 | Bacteria | 14915 |
| 371 | Ga0496118_0010358 | 3300048921 | Bacteria | 9238 |
| 372 | Ga0496118_0010897 | 3300048921 | Bacteria | 8942 |
| 373 | Ga0496118_0015048 | 3300048921 | Bacteria | 7192 |
| 374 | Ga0496118_0030250 | 3300048921 | Bacteria | 4522 |
| 375 | Ga0496119_0020314 | 3300048922 | Bacteria | 4850 |
| 376 | Ga0496119_0025121 | 3300048922 | Bacteria | 4168 |
| 377 | Ga0496119_0071376 | 3300048922 | Bacteria | 2033 |
| 378 | Ga0496119_0091272 | 3300048922 | Bacteria | 1730 |
| 379 | Ga0496119_0291316 | 3300048922 | Bacteria | 808 |
| 380 | Ga0496120_0000021 | 3300048923 | Bacteria | 250966 |
| 381 | Ga0496120_0008278 | 3300048923 | Bacteria | 7589 |
| 382 | Ga0496120_0071424 | 3300048923 | Bacteria | 1906 |
| 383 | Ga0496120_0102165 | 3300048923 | Bacteria | 1512 |
| 384 | Ga0496120_0165327 | 3300048923 | Bacteria | 1099 |
| 385 | Ga0496120_0216403 | 3300048923 | Bacteria | 918 |
| 386 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 387 | Ga0496121_0000581 | 3300048924 | Bacteria | 68614 |
| 388 | Ga0496121_0003240 | 3300048924 | Bacteria | 23396 |
| 389 | Ga0496121_0024071 | 3300048924 | Bacteria | 5835 |
| 390 | Ga0496121_0061551 | 3300048924 | Bacteria | 3079 |
| 391 | Ga0496121_0137041 | 3300048924 | Bacteria | 1822 |
| 392 | Ga0496121_0153968 | 3300048924 | Bacteria | 1688 |
| 393 | Ga0496121_0224742 | 3300048924 | Bacteria | 1319 |
| 394 | Ga0496121_0272964 | 3300048924 | Bacteria | 1161 |
| 395 | Ga0496121_0402774 | 3300048924 | Bacteria | 895 |
| 396 | Ga0496121_0432265 | 3300048924 | Bacteria | 853 |
| 397 | Ga0496121_0483713 | 3300048924 | Bacteria | 790 |
| 398 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 399 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 400 | Ga0496122_0000247 | 3300048925 | Bacteria | 121291 |
| 401 | Ga0496122_0011748 | 3300048925 | Bacteria | 8824 |
| 402 | Ga0496122_0018902 | 3300048925 | Bacteria | 6329 |
| 403 | Ga0496122_0023069 | 3300048925 | Bacteria | 5505 |
| 404 | Ga0496122_0029557 | 3300048925 | Bacteria | 4619 |
| 405 | Ga0496122_0045343 | 3300048925 | Bacteria | 3418 |
| 406 | Ga0496122_0050593 | 3300048925 | Bacteria | 3167 |
| 407 | Ga0496122_0052622 | 3300048925 | Bacteria | 3079 |
| 408 | Ga0496122_0054734 | 3300048925 | Bacteria | 2993 |
| 409 | Ga0496122_0130490 | 3300048925 | Bacteria | 1598 |
| 410 | Ga0496122_0277472 | 3300048925 | Bacteria | 918 |
| 411 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 412 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 413 | Ga0496123_0000222 | 3300048926 | Bacteria | 115482 |
| 414 | Ga0496123_0005238 | 3300048926 | Bacteria | 13174 |
| 415 | Ga0496123_0021560 | 3300048926 | Bacteria | 5003 |
| 416 | Ga0496123_0032979 | 3300048926 | Bacteria | 3735 |
| 417 | Ga0496123_0043345 | 3300048926 | Bacteria | 3092 |
| 418 | Ga0496123_0091621 | 3300048926 | Bacteria | 1802 |
| 419 | Ga0496124_0000063 | 3300048927 | Bacteria | 229705 |
| 420 | Ga0496124_0005486 | 3300048927 | Bacteria | 14235 |
| 421 | Ga0496124_0005927 | 3300048927 | Bacteria | 13520 |
| 422 | Ga0496124_0006765 | 3300048927 | Bacteria | 12390 |
| 423 | Ga0496124_0010229 | 3300048927 | Bacteria | 9528 |
| 424 | Ga0496124_0013163 | 3300048927 | Bacteria | 8098 |
| 425 | Ga0496124_0015770 | 3300048927 | Bacteria | 7220 |
| 426 | Ga0496124_0015862 | 3300048927 | Bacteria | 7196 |
| 427 | Ga0496124_0052100 | 3300048927 | Bacteria | 3479 |
| 428 | Ga0496124_0052416 | 3300048927 | Bacteria | 3465 |
| 429 | Ga0496124_0058070 | 3300048927 | Bacteria | 3256 |
| 430 | Ga0496124_0129115 | 3300048927 | Bacteria | 2010 |
| 431 | Ga0496124_0163083 | 3300048927 | Bacteria | 1735 |
| 432 | Ga0496124_0173617 | 3300048927 | Bacteria | 1666 |
| 433 | Ga0496124_0301589 | 3300048927 | Bacteria | 1157 |
| 434 | Ga0496124_0364926 | 3300048927 | Bacteria | 1016 |
| 435 | Ga0496124_0450074 | 3300048927 | Bacteria | 878 |
| 436 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 437 | Ga0496125_0001358 | 3300048928 | Bacteria | 36024 |
| 438 | Ga0496125_0002192 | 3300048928 | Bacteria | 26081 |
| 439 | Ga0496125_0014572 | 3300048928 | Bacteria | 7650 |
| 440 | Ga0496125_0041097 | 3300048928 | Bacteria | 3957 |
| 441 | Ga0496126_0001362 | 3300048929 | Bacteria | 38716 |
| 442 | Ga0496126_0012358 | 3300048929 | Bacteria | 8756 |
| 443 | Ga0496126_0095875 | 3300048929 | Bacteria | 2601 |
| 444 | Ga0496126_0143652 | 3300048929 | Bacteria | 2052 |
| 445 | Ga0496126_0235582 | 3300048929 | Bacteria | 1531 |
| 446 | Ga0496126_0305505 | 3300048929 | Bacteria | 1311 |
| 447 | Ga0501033_0083870 | 3300049570 | Bacteria | 2335 |
| 448 | Ga0501034_0395942 | 3300049571 | Bacteria | 1304 |
| 449 | Ga0501034_0782889 | 3300049571 | Bacteria | 847 |
| 450 | Ga0501034_0799597 | 3300049571 | Bacteria | 836 |
| 451 | Ga0501036_0143387 | 3300049572 | Bacteria | 2015 |
| 452 | Ga0501037_0060722 | 3300049573 | Bacteria | 2757 |
| 453 | Ga0501038_0094553 | 3300049574 | Bacteria | 2498 |
| 454 | Ga0501039_0161708 | 3300049575 | Bacteria | 1760 |
| 455 | Ga0501043_0041168 | 3300049579 | Bacteria | 3630 |
| 456 | Ga0501046_0141505 | 3300049580 | Bacteria | 1820 |
| 457 | Ga0501047_0059074 | 3300049581 | Bacteria | 3703 |
| 458 | Ga0501068_0153090 | 3300049584 | Bacteria | 1450 |
| 459 | Ga0501073_0157608 | 3300049589 | Bacteria | 1573 |
| 460 | Ga0501083_0054490 | 3300049744 | Bacteria | 2683 |
| 461 | Ga0501280_001351 | 3300049776 | Bacteria | 4651 |
| 462 | Ga0501035_0023157 | 3300049822 | Bacteria | 5697 |
| 463 | nmdc:mga03n38_8375_c1 | 3300050490 | Bacteria | 3710 |
| 464 | nmdc:mga00v17_133_c2 | 3300050491 | Bacteria | 35968 |
| 465 | nmdc:mga00v17_1528_c2 | 3300050491 | Bacteria | 11579 |
| 466 | nmdc:mga00v17_257_c1 | 3300050491 | Bacteria | 31177 |
| 467 | nmdc:mga0yw44_279_c1 | 3300050492 | Bacteria | 17580 |
| 468 | nmdc:mga0k408_77084_c1 | 3300050493 | Bacteria | 1949 |
| 469 | nmdc:mga06z11_17846_c1 | 3300050494 | Bacteria | 3230 |
| 470 | nmdc:mga04h51_94105_c1 | 3300050495 | Bacteria | 1083 |
| 471 | nmdc:mga07m45_9227_c1 | 3300050496 | Bacteria | 5106 |
| 472 | nmdc:mga0sz30_38997_c1 | 3300050516 | Bacteria | 1992 |
| 473 | nmdc:mga0sz30_395_c1 | 3300050516 | Bacteria | 16600 |
| 474 | Ga0500578_0158938 | 3300053086 | Bacteria | 1403 |
| 475 | Ga0500578_0305076 | 3300053086 | Bacteria | 943 |
| 476 | Ga0500560_009593 | 3300053107 | Bacteria | 2385 |
| 477 | Ga0500572_001125 | 3300053111 | Bacteria | 7800 |
| 478 | Ga0500607_201336 | 3300053121 | Bacteria | 855 |
| 479 | Ga0500618_000046 | 3300053125 | Bacteria | 109891 |
| 480 | Ga0500618_001284 | 3300053125 | Bacteria | 11559 |
| 481 | Ga0500618_004792 | 3300053125 | Bacteria | 4233 |
| 482 | Ga0500618_015519 | 3300053125 | Bacteria | 1923 |
| 483 | Ga0500618_026040 | 3300053125 | Bacteria | 1399 |
| 484 | Ga0500658_0017210 | 3300053134 | Bacteria | 2697 |
| 485 | Ga0500658_0023874 | 3300053134 | Bacteria | 2339 |
| 486 | Ga0500561_0000284 | 3300053137 | Bacteria | 8863 |
| 487 | Ga0500568_0002051 | 3300053139 | Bacteria | 12228 |
| 488 | Ga0500568_0003923 | 3300053139 | Bacteria | 8098 |
| 489 | Ga0500573_0000491 | 3300053140 | Bacteria | 17038 |
| 490 | Ga0500573_0001555 | 3300053140 | Bacteria | 11071 |
| 491 | Ga0500590_000222 | 3300053148 | Bacteria | 17111 |
| 492 | Ga0500604_0038410 | 3300053151 | Bacteria | 1436 |
| 493 | Ga0500616_0001019 | 3300053153 | Bacteria | 29833 |
| 494 | Ga0500616_0001529 | 3300053153 | Bacteria | 21766 |
| 495 | Ga0500616_0108519 | 3300053153 | Bacteria | 1344 |
| 496 | Ga0500616_0125247 | 3300053153 | Bacteria | 1221 |
| 497 | Ga0500620_107381 | 3300053155 | Bacteria | 977 |
| 498 | Ga0500622_0000653 | 3300053156 | Bacteria | 30881 |
| 499 | Ga0500624_002019 | 3300053157 | Bacteria | 2855 |
| 500 | Ga0500624_013063 | 3300053157 | Bacteria | 1237 |
| 501 | Ga0500627_0116304 | 3300053158 | Bacteria | 1205 |
| 502 | Ga0500627_0140664 | 3300053158 | Bacteria | 1090 |
| 503 | Ga0500634_0079540 | 3300053161 | Bacteria | 1693 |
| 504 | Ga0500636_0000010 | 3300053177 | Bacteria | 145932 |
| 505 | Ga0500645_076790 | 3300053730 | Bacteria | 955 |
| 506 | Ga0466962_0085602 | 3300061719 | Bacteria | 1509 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041406 | Ga0439439_0023101 | Ga0439439_0023101_369_1088 | 225 |
| 2 | 3300048924 | Ga0496121_0483713 | Ga0496121_0483713_20_703 | 226 |
| 3 | 3300005262 | Ga0065165_1003090 | Ga0065165_100309013 | 235 |
| 4 | iso_pu_bacteria | 2599185156 | 2599333102 | 235 |
| 5 | 3300009148 | Ga0105243_10025492 | Ga0105243_100254925 | 239 |
| 6 | 3300041410 | Ga0439461_0042684 | Ga0439461_0042684_250_969 | 239 |
| 7 | 3300046542 | Ga0495597_0075909 | Ga0495597_0075909_592_1311 | 239 |
| 8 | 3300003322 | rootL2_10126227 | rootL2_101262273 | 240 |
| 9 | iso_pu_bacteria | 2508501122 | 2509107161 | 241 |
| 10 | iso_pu_bacteria | 2509276019 | 2509374874 | 241 |
| 11 | iso_pu_bacteria | 2509276021 | 2509388357 | 241 |
| 12 | iso_pu_bacteria | 2509276033 | 2509443921 | 241 |
| 13 | iso_pu_bacteria | 2510065019 | 2510131534 | 241 |
| 14 | iso_pu_bacteria | 2510065057 | 2510305215 | 241 |
| 15 | iso_pu_bacteria | 2510461076 | 2510897838 | 241 |
| 16 | iso_pu_bacteria | 2510917022 | 2511136233 | 241 |
| 17 | iso_pu_bacteria | 2510917026 | 2511170016 | 241 |
| 18 | iso_pu_bacteria | 2510917028 | 2511185635 | 241 |
| 19 | iso_pu_bacteria | 2510917030 | 2511196773 | 241 |
| 20 | iso_pu_bacteria | 2511231052 | 2511500644 | 241 |
| 21 | iso_pu_bacteria | 2512047086 | 2512532068 | 241 |
| 22 | iso_pu_bacteria | 2513237084 | 2513571122 | 241 |
| 23 | iso_pu_bacteria | 2513237085 | 2513579333 | 241 |
| 24 | iso_pu_bacteria | 2513237086 | 2513584224 | 241 |
| 25 | iso_pu_bacteria | 2513237088 | 2513596779 | 241 |
| 26 | iso_pu_bacteria | 2513237091 | 2513619211 | 241 |
| 27 | iso_pu_bacteria | 2513237093 | 2513632215 | 241 |
| 28 | iso_pu_bacteria | 2513237103 | 2513713299 | 241 |
| 29 | iso_pu_bacteria | 2513237140 | 2513880689 | 241 |
| 30 | iso_pu_bacteria | 2513237143 | 2513903402 | 241 |
| 31 | iso_pu_bacteria | 2513237146 | 2513928370 | 241 |
| 32 | iso_pu_bacteria | 2513237159 | 2513999806 | 241 |
| 33 | iso_pu_bacteria | 2513237162 | 2514020956 | 241 |
| 34 | iso_pu_bacteria | 2515075009 | 2515110465 | 241 |
| 35 | iso_pu_bacteria | 2515154107 | 2515607781 | 241 |
| 36 | iso_pu_bacteria | 2515154113 | 2515636933 | 241 |
| 37 | iso_pu_bacteria | 2515154114 | 2515642894 | 241 |
| 38 | iso_pu_bacteria | 2515154116 | 2515659550 | 241 |
| 39 | iso_pu_bacteria | 2515154134 | 2515743023 | 241 |
| 40 | iso_pu_bacteria | 2516143018 | 2516208522 | 241 |
| 41 | iso_pu_bacteria | 2516653046 | 2516891920 | 241 |
| 42 | iso_pu_bacteria | 2516653077 | 2517039166 | 241 |
| 43 | iso_pu_bacteria | 2516653085 | 2517079412 | 241 |
| 44 | iso_pu_bacteria | 2517093000 | 2517093356 | 241 |
| 45 | iso_pu_bacteria | 2517287029 | 2517409582 | 241 |
| 46 | iso_pu_bacteria | 2519899620 | 2520376732 | 241 |
| 47 | iso_pu_bacteria | 2524023207 | 2524449971 | 241 |
| 48 | iso_pu_bacteria | 2524023209 | 2524457566 | 241 |
| 49 | iso_pu_bacteria | 2529292951 | 2530647740 | 241 |
| 50 | iso_pu_bacteria | 2534681796 | 2535515147 | 241 |
| 51 | iso_pu_bacteria | 2537561587 | 2537872881 | 241 |
| 52 | iso_pu_bacteria | 2551306084 | 2551681592 | 241 |
| 53 | iso_pu_bacteria | 2551306085 | 2551689112 | 241 |
| 54 | iso_pu_bacteria | 2551306086 | 2551694118 | 241 |
| 55 | iso_pu_bacteria | 2551306087 | 2551701786 | 241 |
| 56 | iso_pu_bacteria | 2551306090 | 2551722419 | 241 |
| 57 | iso_pu_bacteria | 2551306091 | 2551729962 | 241 |
| 58 | iso_pu_bacteria | 2551306092 | 2551737315 | 241 |
| 59 | iso_pu_bacteria | 2551306093 | 2551742919 | 241 |
| 60 | iso_pu_bacteria | 2554235003 | 2554246684 | 241 |
| 61 | iso_pu_bacteria | 2558860100 | 2558863866 | 241 |
| 62 | iso_pu_bacteria | 2558860242 | 2559293912 | 241 |
| 63 | iso_pu_bacteria | 2558860983 | 2561467381 | 241 |
| 64 | iso_pu_bacteria | 2582581283 | 2585165065 | 241 |
| 65 | iso_pu_bacteria | 2582581298 | 2585227120 | 241 |
| 66 | iso_pu_bacteria | 2582581299 | 2585229039 | 241 |
| 67 | iso_pu_bacteria | 2582581304 | 2585259525 | 241 |
| 68 | iso_pu_bacteria | 2582581306 | 2585266727 | 241 |
| 69 | iso_pu_bacteria | 2582581307 | 2585275396 | 241 |
| 70 | iso_pu_bacteria | 2582581308 | 2585282250 | 241 |
| 71 | iso_pu_bacteria | 2582581315 | 2585325929 | 241 |
| 72 | iso_pu_bacteria | 2582581316 | 2585330100 | 241 |
| 73 | iso_pu_bacteria | 2582581865 | 2585387741 | 241 |
| 74 | iso_pu_bacteria | 2582581866 | 2585397946 | 241 |
| 75 | iso_pu_bacteria | 2585427526 | 2585528369 | 241 |
| 76 | iso_pu_bacteria | 2585427527 | 2585536552 | 241 |
| 77 | iso_pu_bacteria | 2585427528 | 2585539760 | 241 |
| 78 | iso_pu_bacteria | 2585427529 | 2585550455 | 241 |
| 79 | iso_pu_bacteria | 2585427530 | 2585557030 | 241 |
| 80 | iso_pu_bacteria | 2585427531 | 2585560161 | 241 |
| 81 | iso_pu_bacteria | 2585427593 | 2585837743 | 241 |
| 82 | iso_pu_bacteria | 2585427594 | 2585844602 | 241 |
| 83 | iso_pu_bacteria | 2585427608 | 2585901567 | 241 |
| 84 | iso_pu_bacteria | 2585427609 | 2585905657 | 241 |
| 85 | iso_pu_bacteria | 2585428125 | 2587979227 | 241 |
| 86 | iso_pu_bacteria | 2599185170 | 2599419116 | 241 |
| 87 | iso_pu_bacteria | 2599185210 | 2599605463 | 241 |
| 88 | iso_pu_bacteria | 2599185236 | 2599719502 | 241 |
| 89 | iso_pu_bacteria | 2599185352 | 2600191522 | 241 |
| 90 | iso_pu_bacteria | 2600254933 | 2600374772 | 241 |
| 91 | iso_pu_bacteria | 2600255279 | 2601609114 | 241 |
| 92 | iso_pu_bacteria | 2600255308 | 2601745889 | 241 |
| 93 | iso_pu_bacteria | 2615840624 | 2616295734 | 241 |
| 94 | iso_pu_bacteria | 2615840626 | 2616306273 | 241 |
| 95 | iso_pu_bacteria | 2615840698 | 2616553463 | 241 |
| 96 | iso_pu_bacteria | 2643221557 | 2643807627 | 241 |
| 97 | iso_pu_bacteria | 2643221582 | 2643921101 | 241 |
| 98 | iso_pu_bacteria | 2643221607 | 2644047078 | 241 |
| 99 | iso_pu_bacteria | 2643221610 | 2644070039 | 241 |
| 100 | iso_pu_bacteria | 2643221618 | 2644103123 | 241 |
| 101 | iso_pu_bacteria | 2643221626 | 2644151947 | 241 |
| 102 | iso_pu_bacteria | 2643221634 | 2644190655 | 241 |
| 103 | iso_pu_bacteria | 2643221636 | 2644203483 | 241 |
| 104 | iso_pu_bacteria | 2643221637 | 2644206633 | 241 |
| 105 | iso_pu_bacteria | 2643221643 | 2644241492 | 241 |
| 106 | iso_pu_bacteria | 2643221653 | 2644297515 | 241 |
| 107 | iso_pu_bacteria | 2643221655 | 2644306050 | 241 |
| 108 | iso_pu_bacteria | 2643221659 | 2644330358 | 241 |
| 109 | iso_pu_bacteria | 2643221668 | 2644381010 | 241 |
| 110 | iso_pu_bacteria | 2643221675 | 2644414916 | 241 |
| 111 | iso_pu_bacteria | 2643221680 | 2644448573 | 241 |
| 112 | iso_pu_bacteria | 2643221686 | 2644479867 | 241 |
| 113 | iso_pu_bacteria | 2643221688 | 2644493800 | 241 |
| 114 | iso_pu_bacteria | 2643221689 | 2644496675 | 241 |
| 115 | iso_pu_bacteria | 2643221693 | 2644519174 | 241 |
| 116 | iso_pu_bacteria | 2643221698 | 2644542895 | 241 |
| 117 | iso_pu_bacteria | 2643221712 | 2644618999 | 241 |
| 118 | iso_pu_bacteria | 2643221718 | 2644650280 | 241 |
| 119 | iso_pu_bacteria | 2643221719 | 2644655768 | 241 |
| 120 | iso_pu_bacteria | 2643221723 | 2644673965 | 241 |
| 121 | iso_pu_bacteria | 2643221726 | 2644689119 | 241 |
| 122 | iso_pu_bacteria | 2657244999 | 2657681960 | 241 |
| 123 | iso_pu_bacteria | 2667528174 | 2671112417 | 241 |
| 124 | iso_pu_bacteria | 2690316117 | 2692317195 | 241 |
| 125 | iso_pu_bacteria | 2718217882 | 2719179634 | 241 |
| 126 | iso_pu_bacteria | 2718217927 | 2719384244 | 241 |
| 127 | iso_pu_bacteria | 2718217997 | 2719663980 | 241 |
| 128 | iso_pu_bacteria | 2718218009 | 2719730304 | 241 |
| 129 | iso_pu_bacteria | 2718218199 | 2720490399 | 241 |
| 130 | iso_pu_bacteria | 2718218232 | 2720611777 | 241 |
| 131 | iso_pu_bacteria | 2718218233 | 2720618634 | 241 |
| 132 | iso_pu_bacteria | 2718218235 | 2720630033 | 241 |
| 133 | iso_pu_bacteria | 2718218269 | 2720773728 | 241 |
| 134 | iso_pu_bacteria | 2718218363 | 2721145727 | 241 |
| 135 | iso_pu_bacteria | 2718218365 | 2721157259 | 241 |
| 136 | iso_pu_bacteria | 2718218366 | 2721162606 | 241 |
| 137 | iso_pu_bacteria | 2718218423 | 2721397958 | 241 |
| 138 | iso_pu_bacteria | 2721755514 | 2722838776 | 241 |
| 139 | iso_pu_bacteria | 2721755556 | 2723025398 | 241 |
| 140 | iso_pu_bacteria | 2721755684 | 2723558981 | 241 |
| 141 | iso_pu_bacteria | 2721755685 | 2723565588 | 241 |
| 142 | iso_pu_bacteria | 2721755809 | 2724036768 | 241 |
| 143 | iso_pu_bacteria | 2721755810 | 2724043060 | 241 |
| 144 | iso_pu_bacteria | 2721755819 | 2724088335 | 241 |
| 145 | iso_pu_bacteria | 2721755822 | 2724102853 | 241 |
| 146 | iso_pu_bacteria | 2721755823 | 2724108720 | 241 |
| 147 | iso_pu_bacteria | 2724679232 | 2725950182 | 241 |
| 148 | iso_pu_bacteria | 2728369352 | 2730106334 | 241 |
| 149 | iso_pu_bacteria | 2728369365 | 2730162871 | 241 |
| 150 | iso_pu_bacteria | 2728369397 | 2730296891 | 241 |
| 151 | iso_pu_bacteria | 2738541293 | 2738803783 | 241 |
| 152 | iso_pu_bacteria | 2738541317 | 2738945634 | 241 |
| 153 | iso_pu_bacteria | 2738541333 | 2739034619 | 241 |
| 154 | iso_pu_bacteria | 2765235942 | 2766065636 | 241 |
| 155 | iso_pu_bacteria | 2775507049 | 2776912196 | 241 |
| 156 | iso_pu_bacteria | 2775507266 | 2778174222 | 241 |
| 157 | iso_pu_bacteria | 2791355082 | 2792583811 | 241 |
| 158 | iso_pu_bacteria | 2791355091 | 2792622394 | 241 |
| 159 | iso_pu_bacteria | 2791355092 | 2792628040 | 241 |
| 160 | iso_pu_bacteria | 2791355094 | 2792638707 | 241 |
| 161 | iso_pu_bacteria | 2791355256 | 2793295150 | 241 |
| 162 | iso_pu_bacteria | 2791355259 | 2793315363 | 241 |
| 163 | iso_pu_bacteria | 2791355260 | 2793320222 | 241 |
| 164 | iso_pu_bacteria | 2791355262 | 2793332496 | 241 |
| 165 | iso_pu_bacteria | 2791355263 | 2793341738 | 241 |
| 166 | iso_pu_bacteria | 2791355264 | 2793350807 | 241 |
| 167 | iso_pu_bacteria | 2791355265 | 2793353315 | 241 |
| 168 | iso_pu_bacteria | 2791355266 | 2793362700 | 241 |
| 169 | iso_pu_bacteria | 2791355267 | 2793364739 | 241 |
| 170 | iso_pu_bacteria | 2802429268 | 2804750978 | 241 |
| 171 | iso_pu_bacteria | 2802429605 | 2805927520 | 241 |
| 172 | iso_pu_bacteria | 2802429606 | 2805932305 | 241 |
| 173 | iso_pu_bacteria | 2802429633 | 2806043916 | 241 |
| 174 | iso_pu_bacteria | 2802429634 | 2806052266 | 241 |
| 175 | iso_pu_bacteria | 2802429635 | 2806058567 | 241 |
| 176 | iso_pu_bacteria | 2802429636 | 2806067063 | 241 |
| 177 | iso_pu_bacteria | 2802429637 | 2806074808 | 241 |
| 178 | iso_pu_bacteria | 2808606387 | 2808986312 | 241 |
| 179 | iso_pu_bacteria | 2818991272 | 2819243176 | 241 |
| 180 | iso_pu_bacteria | 2818991439 | 2819556444 | 241 |
| 181 | iso_pu_bacteria | 2818991448 | 2819608356 | 241 |
| 182 | iso_pu_bacteria | 2818991453 | 2819643564 | 241 |
| 183 | iso_pu_bacteria | 2818991461 | 2819684646 | 241 |
| 184 | iso_pu_bacteria | 2821123053 | 2821123694 | 241 |
| 185 | iso_pu_bacteria | 2838016132 | 2838022167 | 241 |
| 186 | iso_pu_bacteria | 2838022645 | 2838024580 | 241 |
| 187 | iso_pu_bacteria | 2838029111 | 2838029245 | 241 |
| 188 | iso_pu_bacteria | 2838035591 | 2838037197 | 241 |
| 189 | iso_pu_bacteria | 2838042994 | 2838044353 | 241 |
| 190 | iso_pu_bacteria | 2838048938 | 2838051410 | 241 |
| 191 | iso_pu_bacteria | 2838061910 | 2838066645 | 241 |
| 192 | iso_pu_bacteria | 2838068647 | 2838073698 | 241 |
| 193 | iso_pu_bacteria | 2838661181 | 2838663614 | 241 |
| 194 | iso_pu_bacteria | 2838668709 | 2838672328 | 241 |
| 195 | iso_pu_bacteria | 2838675328 | 2838677174 | 241 |
| 196 | iso_pu_bacteria | 2838680041 | 2838680658 | 241 |
| 197 | iso_pu_bacteria | 2838686498 | 2838692685 | 241 |
| 198 | iso_pu_bacteria | 2838694306 | 2838695309 | 241 |
| 199 | iso_pu_bacteria | 2838701080 | 2838703929 | 241 |
| 200 | iso_pu_bacteria | 2838707686 | 2838708685 | 241 |
| 201 | iso_pu_bacteria | 2838714209 | 2838716062 | 241 |
| 202 | iso_pu_bacteria | 2838719591 | 2838720138 | 241 |
| 203 | iso_pu_bacteria | 2838724970 | 2838726814 | 241 |
| 204 | iso_pu_bacteria | 2838729681 | 2838732757 | 241 |
| 205 | iso_pu_bacteria | 2838736955 | 2838739275 | 241 |
| 206 | iso_pu_bacteria | 2838742623 | 2838745652 | 241 |
| 207 | iso_pu_bacteria | 2841840854 | 2841843173 | 241 |
| 208 | iso_pu_bacteria | 2841846520 | 2841847072 | 241 |
| 209 | iso_pu_bacteria | 2841851746 | 2841855295 | 241 |
| 210 | iso_pu_bacteria | 2841859092 | 2841860396 | 241 |
| 211 | iso_pu_bacteria | 2841864319 | 2841866747 | 241 |
| 212 | iso_pu_bacteria | 2842077413 | 2842080080 | 241 |
| 213 | iso_pu_bacteria | 2842110456 | 2842112271 | 241 |
| 214 | iso_pu_bacteria | 2842118031 | 2842120700 | 241 |
| 215 | iso_pu_bacteria | 2842124991 | 2842126899 | 241 |
| 216 | iso_pu_bacteria | 2842130223 | 2842132067 | 241 |
| 217 | iso_pu_bacteria | 2842140634 | 2842142955 | 241 |
| 218 | iso_pu_bacteria | 2842146304 | 2842148279 | 241 |
| 219 | iso_pu_bacteria | 2842152218 | 2842152764 | 241 |
| 220 | iso_pu_bacteria | 2842156927 | 2842161674 | 241 |
| 221 | iso_pu_bacteria | 2842163707 | 2842170078 | 241 |
| 222 | iso_pu_bacteria | 2842170452 | 2842172307 | 241 |
| 223 | iso_pu_bacteria | 2842175837 | 2842176383 | 241 |
| 224 | iso_pu_bacteria | 2842180545 | 2842185291 | 241 |
| 225 | iso_pu_bacteria | 2842187318 | 2842189169 | 241 |
| 226 | iso_pu_bacteria | 2842192696 | 2842192967 | 241 |
| 227 | iso_pu_bacteria | 2842198810 | 2842200315 | 241 |
| 228 | iso_pu_bacteria | 2842205361 | 2842206864 | 241 |
| 229 | iso_pu_bacteria | 2842211629 | 2842213483 | 241 |
| 230 | iso_pu_bacteria | 2842217011 | 2842218728 | 241 |
| 231 | iso_pu_bacteria | 2842224351 | 2842224899 | 241 |
| 232 | iso_pu_bacteria | 2842229732 | 2842233230 | 241 |
| 233 | iso_pu_bacteria | 2842237096 | 2842238097 | 241 |
| 234 | iso_pu_bacteria | 2842243621 | 2842248767 | 241 |
| 235 | iso_pu_bacteria | 2842250916 | 2842253344 | 241 |
| 236 | iso_pu_bacteria | 2842257432 | 2842261910 | 241 |
| 237 | iso_pu_bacteria | 2842264693 | 2842267376 | 241 |
| 238 | iso_pu_bacteria | 2842271015 | 2842277026 | 241 |
| 239 | iso_pu_bacteria | 2842278818 | 2842280443 | 241 |
| 240 | iso_pu_bacteria | 2842285085 | 2842289389 | 241 |
| 241 | iso_pu_bacteria | 2842291075 | 2842293740 | 241 |
| 242 | iso_pu_bacteria | 2842298080 | 2842300819 | 241 |
| 243 | iso_pu_bacteria | 2842304105 | 2842306418 | 241 |
| 244 | iso_pu_bacteria | 2842311132 | 2842312558 | 241 |
| 245 | iso_pu_bacteria | 2842317721 | 2842322590 | 241 |
| 246 | iso_pu_bacteria | 2842341865 | 2842343011 | 241 |
| 247 | iso_pu_bacteria | 2842357229 | 2842358061 | 241 |
| 248 | iso_pu_bacteria | 2842363717 | 2842367266 | 241 |
| 249 | iso_pu_bacteria | 2842370503 | 2842371121 | 241 |
| 250 | iso_pu_bacteria | 2842377471 | 2842380137 | 241 |
| 251 | iso_pu_bacteria | 2842384541 | 2842387208 | 241 |
| 252 | iso_pu_bacteria | 2842395702 | 2842401230 | 241 |
| 253 | iso_pu_bacteria | 2842402390 | 2842406737 | 241 |
| 254 | iso_pu_bacteria | 2842409023 | 2842413767 | 241 |
| 255 | iso_pu_bacteria | 2842415677 | 2842420271 | 241 |
| 256 | iso_pu_bacteria | 2842422224 | 2842427146 | 241 |
| 257 | iso_pu_bacteria | 2842428310 | 2842431372 | 241 |
| 258 | iso_pu_bacteria | 2842434925 | 2842437707 | 241 |
| 259 | iso_pu_bacteria | 2842441272 | 2842444522 | 241 |
| 260 | iso_pu_bacteria | 2842447887 | 2842450269 | 241 |
| 261 | iso_pu_bacteria | 2842462802 | 2842465650 | 241 |
| 262 | iso_pu_bacteria | 2842469257 | 2842472460 | 241 |
| 263 | iso_pu_bacteria | 2842475841 | 2842476325 | 241 |
| 264 | iso_pu_bacteria | 2842482326 | 2842482401 | 241 |
| 265 | iso_pu_bacteria | 2842489311 | 2842492394 | 241 |
| 266 | iso_pu_bacteria | 2842495871 | 2842501953 | 241 |
| 267 | iso_pu_bacteria | 2842502639 | 2842502773 | 241 |
| 268 | iso_pu_bacteria | 2842509118 | 2842509256 | 241 |
| 269 | iso_pu_bacteria | 2842515876 | 2842517181 | 241 |
| 270 | iso_pu_bacteria | 2842521101 | 2842526378 | 241 |
| 271 | iso_pu_bacteria | 2842922631 | 2842923405 | 241 |
| 272 | iso_pu_bacteria | 2844163670 | 2844170691 | 241 |
| 273 | iso_pu_bacteria | 2844454524 | 2844455911 | 241 |
| 274 | iso_pu_bacteria | 2847417321 | 2847417735 | 241 |
| 275 | iso_pu_bacteria | 2848992105 | 2848992581 | 241 |
| 276 | iso_pu_bacteria | 2850079185 | 2850080096 | 241 |
| 277 | iso_pu_bacteria | 2852387548 | 2852388542 | 241 |
| 278 | iso_pu_bacteria | 2854896431 | 2854898346 | 241 |
| 279 | iso_pu_bacteria | 2854916844 | 2854919059 | 241 |
| 280 | iso_pu_bacteria | 2855825444 | 2855831839 | 241 |
| 281 | iso_pu_bacteria | 2855839649 | 2855840125 | 241 |
| 282 | iso_pu_bacteria | 2855872281 | 2855873136 | 241 |
| 283 | iso_pu_bacteria | 2857516855 | 2857522154 | 241 |
| 284 | iso_pu_bacteria | 2857531043 | 2857531256 | 241 |
| 285 | iso_pu_bacteria | 2858800743 | 2858804033 | 241 |
| 286 | iso_pu_bacteria | 2891373044 | 2891376220 | 241 |
| 287 | iso_pu_bacteria | 2896384573 | 2896387465 | 241 |
| 288 | iso_pu_bacteria | 2899792073 | 2899792463 | 241 |
| 289 | iso_pu_bacteria | 2899803654 | 2899804442 | 241 |
| 290 | iso_pu_bacteria | 2913295892 | 2913297917 | 241 |
| 291 | iso_pu_bacteria | 2913308742 | 2913310687 | 241 |
| 292 | iso_pu_bacteria | 2915986958 | 2915990840 | 241 |
| 293 | iso_pu_bacteria | 2915993759 | 2915999611 | 241 |
| 294 | iso_pu_bacteria | 2916000859 | 2916007226 | 241 |
| 295 | iso_pu_bacteria | 2916007675 | 2916013664 | 241 |
| 296 | iso_pu_bacteria | 2916014648 | 2916020977 | 241 |
| 297 | iso_pu_bacteria | 2916021584 | 2916022599 | 241 |
| 298 | iso_pu_bacteria | 2916028427 | 2916034824 | 241 |
| 299 | iso_pu_bacteria | 2916035215 | 2916039828 | 241 |
| 300 | iso_pu_bacteria | 2916041962 | 2916042856 | 241 |
| 301 | iso_pu_bacteria | 2916048683 | 2916051814 | 241 |
| 302 | iso_pu_bacteria | 2916055098 | 2916060120 | 241 |
| 303 | iso_pu_bacteria | 2916068649 | 2916076340 | 241 |
| 304 | iso_pu_bacteria | 2916076590 | 2916080941 | 241 |
| 305 | iso_pu_bacteria | 2919100787 | 2919101285 | 241 |
| 306 | iso_pu_bacteria | 2919114240 | 2919116265 | 241 |
| 307 | iso_pu_bacteria | 2919171160 | 2919172009 | 241 |
| 308 | iso_pu_bacteria | 2919408235 | 2919408851 | 241 |
| 309 | iso_pu_bacteria | 2920760137 | 2920763263 | 241 |
| 310 | iso_pu_bacteria | 2920822456 | 2920823438 | 241 |
| 311 | iso_pu_bacteria | 2921201388 | 2921203367 | 241 |
| 312 | iso_pu_bacteria | 2921208531 | 2921214969 | 241 |
| 313 | iso_pu_bacteria | 2921237296 | 2921239931 | 241 |
| 314 | iso_pu_bacteria | 2921244191 | 2921245139 | 241 |
| 315 | iso_pu_bacteria | 2921257292 | 2921260242 | 241 |
| 316 | iso_pu_bacteria | 2921263974 | 2921269011 | 241 |
| 317 | iso_pu_bacteria | 2921282425 | 2921286620 | 241 |
| 318 | iso_pu_bacteria | 2921289301 | 2921291879 | 241 |
| 319 | iso_pu_bacteria | 2923556063 | 2923557249 | 241 |
| 320 | iso_pu_bacteria | 2924144063 | 2924146113 | 241 |
| 321 | iso_pu_bacteria | 2924150972 | 2924153854 | 241 |
| 322 | iso_pu_bacteria | 2924158325 | 2924163571 | 241 |
| 323 | iso_pu_bacteria | 2924165586 | 2924165919 | 241 |
| 324 | iso_pu_bacteria | 2924172951 | 2924178221 | 241 |
| 325 | iso_pu_bacteria | 2924179722 | 2924185636 | 241 |
| 326 | iso_pu_bacteria | 2924186466 | 2924191880 | 241 |
| 327 | iso_pu_bacteria | 2924193448 | 2924194230 | 241 |
| 328 | iso_pu_bacteria | 2924200457 | 2924202499 | 241 |
| 329 | iso_pu_bacteria | 2924207177 | 2924209731 | 241 |
| 330 | iso_pu_bacteria | 2924214083 | 2924215092 | 241 |
| 331 | iso_pu_bacteria | 2924221636 | 2924226442 | 241 |
| 332 | iso_pu_bacteria | 2924228884 | 2924232530 | 241 |
| 333 | iso_pu_bacteria | 2926754445 | 2926757219 | 241 |
| 334 | iso_pu_bacteria | 2926760298 | 2926761434 | 241 |
| 335 | iso_pu_bacteria | 2929138655 | 2929139012 | 241 |
| 336 | iso_pu_bacteria | 2933006813 | 2933007409 | 241 |
| 337 | iso_pu_bacteria | 2933011516 | 2933012176 | 241 |
| 338 | iso_pu_bacteria | 2933016740 | 2933019042 | 241 |
| 339 | iso_pu_bacteria | 2933570622 | 2933573487 | 241 |
| 340 | iso_pu_bacteria | 2933586486 | 2933587600 | 241 |
| 341 | iso_pu_bacteria | 2933594066 | 2933594621 | 241 |
| 342 | iso_pu_bacteria | 2933599457 | 2933604126 | 241 |
| 343 | iso_pu_bacteria | 2935894831 | 2935895832 | 241 |
| 344 | iso_pu_bacteria | 2935901341 | 2935907717 | 241 |
| 345 | iso_pu_bacteria | 2936367885 | 2936368851 | 241 |
| 346 | iso_pu_bacteria | 2936375103 | 2936377069 | 241 |
| 347 | iso_pu_bacteria | 2936381700 | 2936383808 | 241 |
| 348 | iso_pu_bacteria | 2936996657 | 2936999762 | 241 |
| 349 | iso_pu_bacteria | 2937002841 | 2937004984 | 241 |
| 350 | iso_pu_bacteria | 2937009748 | 2937011265 | 241 |
| 351 | iso_pu_bacteria | 2937016420 | 2937021041 | 241 |
| 352 | iso_pu_bacteria | 2937023124 | 2937023924 | 241 |
| 353 | iso_pu_bacteria | 2937042894 | 2937048654 | 241 |
| 354 | iso_pu_bacteria | 2937049772 | 2937053921 | 241 |
| 355 | iso_pu_bacteria | 2937056579 | 2937057656 | 241 |
| 356 | iso_pu_bacteria | 2937063883 | 2937070106 | 241 |
| 357 | iso_pu_bacteria | 2937071275 | 2937071457 | 241 |
| 358 | iso_pu_bacteria | 2937091812 | 2937097521 | 241 |
| 359 | iso_pu_bacteria | 2937098957 | 2937103371 | 241 |
| 360 | iso_pu_bacteria | 2937106411 | 2937112673 | 241 |
| 361 | iso_pu_bacteria | 2937113482 | 2937114604 | 241 |
| 362 | iso_pu_bacteria | 2937119839 | 2937122524 | 241 |
| 363 | iso_pu_bacteria | 2937126314 | 2937128401 | 241 |
| 364 | iso_pu_bacteria | 2941499720 | 2941500654 | 241 |
| 365 | iso_pu_bacteria | 2957382221 | 2957383750 | 241 |
| 366 | iso_pu_bacteria | 2957388812 | 2957394144 | 241 |
| 367 | iso_pu_bacteria | 2957395598 | 2957399454 | 241 |
| 368 | iso_pu_bacteria | 2957402308 | 2957403798 | 241 |
| 369 | iso_pu_bacteria | 2957408893 | 2957410975 | 241 |
| 370 | iso_pu_bacteria | 2957415311 | 2957421636 | 241 |
| 371 | iso_pu_bacteria | 2957422303 | 2957424956 | 241 |
| 372 | iso_pu_bacteria | 2957430029 | 2957435500 | 241 |
| 373 | iso_pu_bacteria | 2957443900 | 2957447029 | 241 |
| 374 | iso_pu_bacteria | 2957450854 | 2957457391 | 241 |
| 375 | iso_pu_bacteria | 2957457609 | 2957464339 | 241 |
| 376 | iso_pu_bacteria | 2957464669 | 2957466121 | 241 |
| 377 | iso_pu_bacteria | 2957471148 | 2957473852 | 241 |
| 378 | iso_pu_bacteria | 2957478035 | 2957482945 | 241 |
| 379 | iso_pu_bacteria | 2957484790 | 2957491021 | 241 |
| 380 | iso_pu_bacteria | 2957491536 | 2957496399 | 241 |
| 381 | iso_pu_bacteria | 2957498199 | 2957501978 | 241 |
| 382 | iso_pu_bacteria | 2957505466 | 2957511520 | 241 |
| 383 | iso_pu_bacteria | 2960584000 | 2960589092 | 241 |
| 384 | iso_pu_bacteria | 2960597568 | 2960599676 | 241 |
| 385 | iso_pu_bacteria | 2960603979 | 2960605482 | 241 |
| 386 | iso_pu_bacteria | 2960610863 | 2960616996 | 241 |
| 387 | iso_pu_bacteria | 2960617483 | 2960621825 | 241 |
| 388 | iso_pu_bacteria | 2960624210 | 2960630282 | 241 |
| 389 | iso_pu_bacteria | 2960637947 | 2960644728 | 241 |
| 390 | iso_pu_bacteria | 2960645483 | 2960651782 | 241 |
| 391 | iso_pu_bacteria | 2960652885 | 2960653226 | 241 |
| 392 | iso_pu_bacteria | 2960660292 | 2960660312 | 241 |
| 393 | iso_pu_bacteria | 2960667422 | 2960668363 | 241 |
| 394 | iso_pu_bacteria | 2960674078 | 2960675654 | 241 |
| 395 | iso_pu_bacteria | 2960687367 | 2960691966 | 241 |
| 396 | iso_pu_bacteria | 2964607997 | 2964609437 | 241 |
| 397 | iso_pu_bacteria | 2964615318 | 2964619913 | 241 |
| 398 | iso_pu_bacteria | 2964621998 | 2964627427 | 241 |
| 399 | iso_pu_bacteria | 2964628898 | 2964634396 | 241 |
| 400 | iso_pu_bacteria | 2964636051 | 2964636346 | 241 |
| 401 | iso_pu_bacteria | 2964643177 | 2964648180 | 241 |
| 402 | iso_pu_bacteria | 2964649959 | 2964650408 | 241 |
| 403 | iso_pu_bacteria | 2964656573 | 2964660402 | 241 |
| 404 | iso_pu_bacteria | 2964663802 | 2964665876 | 241 |
| 405 | iso_pu_bacteria | 2964678106 | 2964680683 | 241 |
| 406 | iso_pu_bacteria | 2964685014 | 2964687988 | 241 |
| 407 | iso_pu_bacteria | 2964691889 | 2964692978 | 241 |
| 408 | iso_pu_bacteria | 2964698721 | 2964704476 | 241 |
| 409 | iso_pu_bacteria | 2964705432 | 2964711275 | 241 |
| 410 | iso_pu_bacteria | 2964712639 | 2964714735 | 241 |
| 411 | iso_pu_bacteria | 2964719344 | 2964719828 | 241 |
| 412 | iso_pu_bacteria | 2967664464 | 2967670328 | 241 |
| 413 | iso_pu_bacteria | 2967671571 | 2967674275 | 241 |
| 414 | iso_pu_bacteria | 2967678726 | 2967685034 | 241 |
| 415 | iso_pu_bacteria | 2967693043 | 2967695147 | 241 |
| 416 | iso_pu_bacteria | 2967699805 | 2967706847 | 241 |
| 417 | iso_pu_bacteria | 2967706974 | 2967712839 | 241 |
| 418 | iso_pu_bacteria | 2967714385 | 2967714739 | 241 |
| 419 | iso_pu_bacteria | 2967721400 | 2967724207 | 241 |
| 420 | iso_pu_bacteria | 2967735183 | 2967736254 | 241 |
| 421 | iso_pu_bacteria | 2967742019 | 2967744052 | 241 |
| 422 | iso_pu_bacteria | 2967748971 | 2967751784 | 241 |
| 423 | iso_pu_bacteria | 2967755722 | 2967761402 | 241 |
| 424 | iso_pu_bacteria | 2967762386 | 2967762610 | 241 |
| 425 | iso_pu_bacteria | 2967769361 | 2967771241 | 241 |
| 426 | iso_pu_bacteria | 2967775926 | 2967782411 | 241 |
| 427 | iso_pu_bacteria | 2970019648 | 2970025635 | 241 |
| 428 | iso_pu_bacteria | 2970033650 | 2970033959 | 241 |
| 429 | iso_pu_bacteria | 2970040964 | 2970045566 | 241 |
| 430 | iso_pu_bacteria | 2970047711 | 2970052555 | 241 |
| 431 | iso_pu_bacteria | 2970054988 | 2970057357 | 241 |
| 432 | iso_pu_bacteria | 2970061556 | 2970068051 | 241 |
| 433 | iso_pu_bacteria | 2970068827 | 2970071431 | 241 |
| 434 | iso_pu_bacteria | 2970076120 | 2970080559 | 241 |
| 435 | iso_pu_bacteria | 2970082768 | 2970086079 | 241 |
| 436 | iso_pu_bacteria | 2970088815 | 2970091236 | 241 |
| 437 | iso_pu_bacteria | 2970095765 | 2970101576 | 241 |
| 438 | iso_pu_bacteria | 2970102677 | 2970103470 | 241 |
| 439 | iso_pu_bacteria | 2970109326 | 2970115986 | 241 |
| 440 | iso_pu_bacteria | 2970116247 | 2970118475 | 241 |
| 441 | iso_pu_bacteria | 2970129317 | 2970131645 | 241 |
| 442 | iso_pu_bacteria | 2970136068 | 2970136524 | 241 |
| 443 | iso_pu_bacteria | 2970149975 | 2970153941 | 241 |
| 444 | iso_pu_bacteria | 2970156795 | 2970162680 | 241 |
| 445 | iso_pu_bacteria | 2970164137 | 2970170212 | 241 |
| 446 | iso_pu_bacteria | 2970170962 | 2970174226 | 241 |
| 447 | iso_pu_bacteria | 2970177841 | 2970181801 | 241 |
| 448 | iso_pu_bacteria | 2970184632 | 2970190504 | 241 |
| 449 | iso_pu_bacteria | 2970191845 | 2970194956 | 241 |
| 450 | iso_pu_bacteria | 2977516862 | 2977518931 | 241 |
| 451 | iso_pu_bacteria | 2977523885 | 2977529061 | 241 |
| 452 | iso_pu_bacteria | 2977537788 | 2977540050 | 241 |
| 453 | iso_pu_bacteria | 2977551784 | 2977552853 | 241 |
| 454 | iso_pu_bacteria | 2977558990 | 2977559217 | 241 |
| 455 | iso_pu_bacteria | 2977565890 | 2977567583 | 241 |
| 456 | iso_pu_bacteria | 2977572785 | 2977573083 | 241 |
| 457 | iso_pu_bacteria | 2977579622 | 2977580514 | 241 |
| 458 | iso_pu_bacteria | 2979089926 | 2979093282 | 241 |
| 459 | iso_pu_bacteria | 2979095461 | 2979099333 | 241 |
| 460 | iso_pu_bacteria | 2979100975 | 2979105250 | 241 |
| 461 | iso_pu_bacteria | 2984509177 | 2984512895 | 241 |
| 462 | iso_pu_bacteria | 2984518228 | 2984520741 | 241 |
| 463 | iso_pu_bacteria | 2984537506 | 2984540035 | 241 |
| 464 | iso_pu_bacteria | 2984601300 | 2984602226 | 241 |
| 465 | iso_pu_bacteria | 2989349275 | 2989355455 | 241 |
| 466 | iso_pu_bacteria | 2989771324 | 2989774014 | 241 |
| 467 | iso_pu_bacteria | 2989776772 | 2989777567 | 241 |
| 468 | iso_pu_bacteria | 2996887358 | 2996892130 | 241 |
| 469 | iso_pu_bacteria | 2996893221 | 2996893522 | 241 |
| 470 | iso_pu_bacteria | 3005409236 | 3005411281 | 241 |
| 471 | iso_pu_bacteria | 3005416602 | 3005422761 | 241 |
| 472 | iso_pu_bacteria | 3005445848 | 3005446234 | 241 |
| 473 | iso_pu_bacteria | 3005452660 | 3005452889 | 241 |
| 474 | iso_pu_bacteria | 639633055 | 639646737 | 241 |
| 475 | iso_pu_bacteria | 643692032 | 643824594 | 241 |
| 476 | iso_pu_bacteria | 648276728 | 648739433 | 241 |
| 477 | iso_pu_bacteria | 8003570095 | 8003570106 | 241 |
| 478 | iso_pu_bacteria | 8003992118 | 8003992537 | 241 |
| 479 | iso_pu_bacteria | 8005246636 | 8005247269 | 241 |
| 480 | iso_pu_bacteria | 8005258706 | 8005263543 | 241 |
| 481 | iso_pu_bacteria | 8005275841 | 8005278958 | 241 |
| 482 | iso_pu_bacteria | 8005282627 | 8005283646 | 241 |
| 483 | iso_pu_bacteria | 8005289223 | 8005291016 | 241 |
| 484 | iso_pu_bacteria | 8005301065 | 8005303911 | 241 |
| 485 | iso_pu_bacteria | 8005307578 | 8005308730 | 241 |
| 486 | iso_pu_bacteria | 8005314921 | 8005321703 | 241 |
| 487 | iso_pu_bacteria | 8005321885 | 8005326657 | 241 |
| 488 | iso_pu_bacteria | 8005376324 | 8005377358 | 241 |
| 489 | iso_pu_bacteria | 8005382845 | 8005387227 | 241 |
| 490 | iso_pu_bacteria | 8005395548 | 8005401986 | 241 |
| 491 | iso_pu_bacteria | 8005430974 | 8005432998 | 241 |
| 492 | iso_pu_bacteria | 8005460587 | 8005461104 | 241 |
| 493 | iso_pu_bacteria | 8005484373 | 8005486091 | 241 |
| 494 | iso_pu_bacteria | 8005497431 | 8005498722 | 241 |
| 495 | iso_pu_bacteria | 8005542996 | 8005543823 | 241 |
| 496 | iso_pu_bacteria | 8005556819 | 8005560706 | 241 |
| 497 | iso_pu_bacteria | 8005563573 | 8005569688 | 241 |
| 498 | iso_pu_bacteria | 8005570704 | 8005576995 | 241 |
| 499 | iso_pu_bacteria | 8005619151 | 8005619917 | 241 |
| 500 | iso_pu_bacteria | 8005626139 | 8005628514 | 241 |
| 501 | iso_pu_bacteria | 8005645114 | 8005650197 | 241 |
| 502 | iso_pu_bacteria | 8005658619 | 8005661848 | 241 |
| 503 | iso_pu_bacteria | 8005668836 | 8005670133 | 241 |
| 504 | iso_pu_bacteria | 8005682033 | 8005685067 | 241 |
| 505 | iso_pu_bacteria | 8005688590 | 8005690339 | 241 |
| 506 | iso_pu_bacteria | 8005695170 | 8005700312 | 241 |
| 507 | iso_pu_bacteria | 8018127388 | 8018133196 | 241 |
| 508 | iso_pu_bacteria | 8018150411 | 8018151991 | 241 |
| 509 | iso_pu_bacteria | 8018163183 | 8018167824 | 241 |
| 510 | iso_pu_bacteria | 8018176218 | 8018180249 | 241 |
| 511 | iso_pu_bacteria | 8023680758 | 8023684148 | 241 |
| 512 | iso_pu_bacteria | 8024479707 | 8024480363 | 241 |
| 513 | iso_pu_bacteria | 8024486573 | 8024491374 | 241 |
| 514 | iso_pu_bacteria | 8024501048 | 8024503612 | 241 |
| 515 | iso_pu_bacteria | 8046767195 | 8046769924 | 241 |
| 516 | iso_pu_bacteria | 8049293176 | 8049293554 | 241 |
| 517 | iso_pu_bacteria | 8054460903 | 8054461340 | 241 |
| 518 | iso_pu_bacteria | 8054558443 | 8054563414 | 241 |
| 519 | iso_pu_bacteria | 8056375014 | 8056375696 | 241 |
| 520 | iso_pu_bacteria | 8056382006 | 8056386021 | 241 |
| 521 | iso_pu_bacteria | 8056875544 | 8056879196 | 241 |
| 522 | iso_pu_bacteria | 8057575449 | 8057579888 | 241 |
| 523 | iso_pu_bacteria | 8057874678 | 8057880992 | 241 |
| 524 | 3300002704 | JGI25155J39150_1000023 | JGI25155J39150_1000023100 | 245 |
| 525 | 3300002705 | JGI25156J39149_1000094 | JGI25156J39149_100009443 | 245 |
| 526 | 3300002737 | JGI25162J39368_1000177 | JGI25162J39368_100017714 | 245 |
| 527 | 3300002737 | JGI25162J39368_1000803 | JGI25162J39368_10008038 | 245 |
| 528 | 3300002738 | JGI25154J39366_1000213 | JGI25154J39366_100021314 | 245 |
| 529 | 3300002739 | JGI25158J39367_1000091 | JGI25158J39367_100009120 | 245 |
| 530 | 3300002739 | JGI25158J39367_1004200 | JGI25158J39367_10042003 | 245 |
| 531 | 3300002741 | JGI25157J39369_1000043 | JGI25157J39369_100004327 | 245 |
| 532 | 3300002773 | JGI25152J39213_1002205 | JGI25152J39213_10022057 | 245 |
| 533 | 3300002773 | JGI25152J39213_1003952 | JGI25152J39213_10039524 | 245 |
| 534 | 3300002773 | JGI25152J39213_1004109 | JGI25152J39213_10041093 | 245 |
| 535 | 3300002773 | JGI25152J39213_1017526 | JGI25152J39213_10175261 | 245 |
| 536 | 3300002774 | JGI25150J39212_1000378 | JGI25150J39212_100037820 | 245 |
| 537 | 3300002987 | JGI25159J45721_1000016 | JGI25159J45721_1000016115 | 245 |
| 538 | 3300002987 | JGI25159J45721_1000279 | JGI25159J45721_100027922 | 245 |
| 539 | 3300002987 | JGI25159J45721_1003209 | JGI25159J45721_10032094 | 245 |
| 540 | 3300003187 | JGI25151J46595_10000250 | JGI25151J46595_1000025017 | 245 |
| 541 | 3300003187 | JGI25151J46595_10000565 | JGI25151J46595_100005654 | 245 |
| 542 | 3300003187 | JGI25151J46595_10005624 | JGI25151J46595_100056246 | 245 |
| 543 | 3300003187 | JGI25151J46595_10012978 | JGI25151J46595_100129782 | 245 |
| 544 | 3300003187 | JGI25151J46595_10017052 | JGI25151J46595_100170523 | 245 |
| 545 | 3300003214 | JGI25165J46597_1000415 | JGI25165J46597_100041514 | 245 |
| 546 | 3300003214 | JGI25165J46597_1000555 | JGI25165J46597_100055533 | 245 |
| 547 | 3300003215 | JGI25153J46596_10000833 | JGI25153J46596_100008333 | 245 |
| 548 | 3300003215 | JGI25153J46596_10001644 | JGI25153J46596_100016443 | 245 |
| 549 | 3300003215 | JGI25153J46596_10009682 | JGI25153J46596_100096825 | 245 |
| 550 | 3300003320 | rootH2_10027335 | rootH2_100273352 | 245 |
| 551 | 3300003322 | rootL2_10010419 | rootL2_100104193 | 245 |
| 552 | 3300003323 | rootH1_10028824 | rootH1_100288243 | 245 |
| 553 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002420 | 245 |
| 554 | 3300003354 | JGI25160J50197_1000046 | JGI25160J50197_100004659 | 245 |
| 555 | 3300003354 | JGI25160J50197_1009230 | JGI25160J50197_10092304 | 245 |
| 556 | 3300003354 | JGI25160J50197_1016920 | JGI25160J50197_10169202 | 245 |
| 557 | 3300003374 | JGI25161J50226_1000031 | JGI25161J50226_100003159 | 245 |
| 558 | 3300003374 | JGI25161J50226_1000074 | JGI25161J50226_100007468 | 245 |
| 559 | 3300003374 | JGI25161J50226_1000333 | JGI25161J50226_100033320 | 245 |
| 560 | 3300003771 | Ga0055526_1000207 | Ga0055526_100020710 | 245 |
| 561 | 3300003771 | Ga0055526_1004816 | Ga0055526_10048164 | 245 |
| 562 | 3300003771 | Ga0055526_1007043 | Ga0055526_10070434 | 245 |
| 563 | 3300003771 | Ga0055526_1007746 | Ga0055526_10077465 | 245 |
| 564 | 3300003771 | Ga0055526_1022341 | Ga0055526_10223412 | 245 |
| 565 | 3300003775 | Ga0055524_1001148 | Ga0055524_100114810 | 245 |
| 566 | 3300003775 | Ga0055524_1007167 | Ga0055524_10071675 | 245 |
| 567 | 3300003775 | Ga0055524_1008334 | Ga0055524_10083342 | 245 |
| 568 | 3300003775 | Ga0055524_1015372 | Ga0055524_10153722 | 245 |
| 569 | 3300003775 | Ga0055524_1026608 | Ga0055524_10266082 | 245 |
| 570 | 3300003775 | Ga0055524_1030533 | Ga0055524_10305332 | 245 |
| 571 | 3300003781 | Ga0055536_1005508 | Ga0055536_10055085 | 245 |
| 572 | 3300003790 | Ga0055528_1000146 | Ga0055528_100014631 | 245 |
| 573 | 3300003790 | Ga0055528_1000636 | Ga0055528_100063628 | 245 |
| 574 | 3300003790 | Ga0055528_1002292 | Ga0055528_100229211 | 245 |
| 575 | 3300003790 | Ga0055528_1004046 | Ga0055528_10040465 | 245 |
| 576 | 3300003790 | Ga0055528_1006665 | Ga0055528_10066654 | 245 |
| 577 | 3300003790 | Ga0055528_1007009 | Ga0055528_10070091 | 245 |
| 578 | 3300003791 | Ga0055530_10012423 | Ga0055530_100124233 | 245 |
| 579 | 3300003791 | Ga0055530_10018589 | Ga0055530_100185893 | 245 |
| 580 | 3300003792 | Ga0055540_1000111 | Ga0055540_100011163 | 245 |
| 581 | 3300003792 | Ga0055540_1002236 | Ga0055540_10022367 | 245 |
| 582 | 3300003792 | Ga0055540_1016230 | Ga0055540_10162302 | 245 |
| 583 | 3300003794 | Ga0055531_10006091 | Ga0055531_100060912 | 245 |
| 584 | 3300003856 | Ga0058692_1001904 | Ga0058692_10019045 | 245 |
| 585 | 3300003856 | Ga0058692_1001956 | Ga0058692_10019562 | 245 |
| 586 | 3300003856 | Ga0058692_1020979 | Ga0058692_10209792 | 245 |
| 587 | 3300004625 | Ga0055543_1000008 | Ga0055543_1000008190 | 245 |
| 588 | 3300004625 | Ga0055543_1000022 | Ga0055543_1000022128 | 245 |
| 589 | 3300004625 | Ga0055543_1000188 | Ga0055543_100018841 | 245 |
| 590 | 3300004625 | Ga0055543_1000460 | Ga0055543_100046015 | 245 |
| 591 | 3300005262 | Ga0065165_1000058 | Ga0065165_100005846 | 245 |
| 592 | 3300005262 | Ga0065165_1000336 | Ga0065165_100033663 | 245 |
| 593 | 3300005262 | Ga0065165_1024457 | Ga0065165_10244572 | 245 |
| 594 | 3300005331 | Ga0070670_100000173 | Ga0070670_10000017322 | 245 |
| 595 | 3300005347 | Ga0070668_100032636 | Ga0070668_1000326362 | 245 |
| 596 | 3300005353 | Ga0070669_100025581 | Ga0070669_1000255813 | 245 |
| 597 | 3300005355 | Ga0070671_100013462 | Ga0070671_1000134625 | 245 |
| 598 | 3300005455 | Ga0070663_100105530 | Ga0070663_1001055302 | 245 |
| 599 | 3300005548 | Ga0070665_100002331 | Ga0070665_1000023316 | 245 |
| 600 | 3300005548 | Ga0070665_100042307 | Ga0070665_1000423074 | 245 |
| 601 | 3300005548 | Ga0070665_100399122 | Ga0070665_1003991222 | 245 |
| 602 | 3300005614 | Ga0068856_100060399 | Ga0068856_1000603993 | 245 |
| 603 | 3300005614 | Ga0068856_100810448 | Ga0068856_1008104481 | 245 |
| 604 | 3300005616 | Ga0068852_100498891 | Ga0068852_1004988912 | 245 |
| 605 | 3300006038 | Ga0075365_10071101 | Ga0075365_100711012 | 245 |
| 606 | 3300006038 | Ga0075365_10110557 | Ga0075365_101105571 | 245 |
| 607 | 3300006038 | Ga0075365_10392305 | Ga0075365_103923052 | 245 |
| 608 | 3300006048 | Ga0075363_100050337 | Ga0075363_1000503372 | 245 |
| 609 | 3300006051 | Ga0075364_10001442 | Ga0075364_100014422 | 245 |
| 610 | 3300006051 | Ga0075364_10021036 | Ga0075364_100210362 | 245 |
| 611 | 3300006177 | Ga0075362_10009154 | Ga0075362_100091542 | 245 |
| 612 | 3300006178 | Ga0075367_10008199 | Ga0075367_100081996 | 245 |
| 613 | 3300006186 | Ga0075369_10002117 | Ga0075369_100021176 | 245 |
| 614 | 3300006195 | Ga0075366_10018810 | Ga0075366_100188104 | 245 |
| 615 | 3300006195 | Ga0075366_10083027 | Ga0075366_100830272 | 245 |
| 616 | 3300006353 | Ga0075370_10003403 | Ga0075370_100034034 | 245 |
| 617 | 3300006353 | Ga0075370_10010644 | Ga0075370_100106445 | 245 |
| 618 | 3300006948 | Ga0099826_10000542 | Ga0099826_100005429 | 245 |
| 619 | 3300006948 | Ga0099826_10007443 | Ga0099826_100074432 | 245 |
| 620 | 3300009036 | Ga0105244_10032731 | Ga0105244_100327312 | 245 |
| 621 | 3300009036 | Ga0105244_10044968 | Ga0105244_100449683 | 245 |
| 622 | 3300009093 | Ga0105240_10000278 | Ga0105240_1000027876 | 245 |
| 623 | 3300009148 | Ga0105243_10027876 | Ga0105243_100278763 | 245 |
| 624 | 3300009177 | Ga0105248_10054238 | Ga0105248_100542382 | 245 |
| 625 | 3300009545 | Ga0105237_10005254 | Ga0105237_1000525410 | 245 |
| 626 | 3300009766 | Ga0123342_1032774 | Ga0123342_10327742 | 245 |
| 627 | 3300009986 | Ga0105033_102667 | Ga0105033_1026671 | 245 |
| 628 | 3300010375 | Ga0105239_10005703 | Ga0105239_100057034 | 245 |
| 629 | 3300010375 | Ga0105239_10515350 | Ga0105239_105153502 | 245 |
| 630 | 3300011119 | Ga0105246_10227448 | Ga0105246_102274482 | 245 |
| 631 | 3300012502 | Ga0157347_1008248 | Ga0157347_10082482 | 245 |
| 632 | 3300013100 | Ga0157373_10010891 | Ga0157373_100108912 | 245 |
| 633 | 3300013102 | Ga0157371_10000058 | Ga0157371_1000005857 | 245 |
| 634 | 3300013104 | Ga0157370_10001488 | Ga0157370_1000148819 | 245 |
| 635 | 3300013104 | Ga0157370_10003259 | Ga0157370_1000325914 | 245 |
| 636 | 3300013104 | Ga0157370_10031263 | Ga0157370_100312634 | 245 |
| 637 | 3300013105 | Ga0157369_10069570 | Ga0157369_100695704 | 245 |
| 638 | 3300013249 | Ga0171463_1001 | Ga0171463_1001634 | 245 |
| 639 | 3300015265 | Ga0182005_1001660 | Ga0182005_10016602 | 245 |
| 640 | 3300015690 | Ga0183363_1107 | Ga0183363_11077 | 245 |
| 641 | 3300021320 | Ga0214544_1000008 | Ga0214544_1000008297 | 245 |
| 642 | 3300021321 | Ga0214542_1000010 | Ga0214542_1000010254 | 245 |
| 643 | 3300021321 | Ga0214542_1026881 | Ga0214542_10268812 | 245 |
| 644 | 3300021327 | Ga0214543_1000003 | Ga0214543_100000389 | 245 |
| 645 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004276 | 245 |
| 646 | 3300025206 | Ga0209435_100011 | Ga0209435_100011274 | 245 |
| 647 | 3300025208 | Ga0209436_100447 | Ga0209436_10044712 | 245 |
| 648 | 3300025208 | Ga0209436_100516 | Ga0209436_10051613 | 245 |
| 649 | 3300025208 | Ga0209436_119163 | Ga0209436_1191631 | 245 |
| 650 | 3300025233 | Ga0209437_100036 | Ga0209437_10003679 | 245 |
| 651 | 3300025233 | Ga0209437_100086 | Ga0209437_100086171 | 245 |
| 652 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012388 | 245 |
| 653 | 3300025245 | Ga0207425_1000840 | Ga0207425_10008402 | 245 |
| 654 | 3300025245 | Ga0207425_1021458 | Ga0207425_10214582 | 245 |
| 655 | 3300025245 | Ga0207425_1022622 | Ga0207425_10226222 | 245 |
| 656 | 3300025246 | Ga0209646_1000024 | Ga0209646_1000024137 | 245 |
| 657 | 3300025250 | Ga0209026_1000030 | Ga0209026_1000030137 | 245 |
| 658 | 3300025253 | Ga0209677_100267 | Ga0209677_10026729 | 245 |
| 659 | 3300025256 | Ga0209759_1000011 | Ga0209759_1000011274 | 245 |
| 660 | 3300025258 | Ga0209129_1000086 | Ga0209129_1000086153 | 245 |
| 661 | 3300025258 | Ga0209129_1000123 | Ga0209129_1000123101 | 245 |
| 662 | 3300025258 | Ga0209129_1000316 | Ga0209129_100031629 | 245 |
| 663 | 3300025258 | Ga0209129_1001356 | Ga0209129_100135613 | 245 |
| 664 | 3300025258 | Ga0209129_1001470 | Ga0209129_10014705 | 245 |
| 665 | 3300025258 | Ga0209129_1012397 | Ga0209129_10123972 | 245 |
| 666 | 3300025261 | Ga0209233_1000110 | Ga0209233_100011077 | 245 |
| 667 | 3300025261 | Ga0209233_1000166 | Ga0209233_100016679 | 245 |
| 668 | 3300025261 | Ga0209233_1000350 | Ga0209233_100035032 | 245 |
| 669 | 3300025272 | Ga0209455_1017753 | Ga0209455_10177532 | 245 |
| 670 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015314 | 245 |
| 671 | 3300025273 | Ga0209673_1000091 | Ga0209673_1000091178 | 245 |
| 672 | 3300025273 | Ga0209673_1000919 | Ga0209673_100091916 | 245 |
| 673 | 3300025273 | Ga0209673_1002434 | Ga0209673_10024345 | 245 |
| 674 | 3300025273 | Ga0209673_1002489 | Ga0209673_10024899 | 245 |
| 675 | 3300025273 | Ga0209673_1006679 | Ga0209673_10066795 | 245 |
| 676 | 3300025273 | Ga0209673_1010462 | Ga0209673_10104624 | 245 |
| 677 | 3300025273 | Ga0209673_1012741 | Ga0209673_10127412 | 245 |
| 678 | 3300025284 | Ga0209130_1000002 | Ga0209130_100000213 | 245 |
| 679 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008123 | 245 |
| 680 | 3300025284 | Ga0209130_1000088 | Ga0209130_10000885 | 245 |
| 681 | 3300025284 | Ga0209130_1036182 | Ga0209130_10361821 | 245 |
| 682 | 3300025292 | Ga0209676_1006633 | Ga0209676_10066333 | 245 |
| 683 | 3300025292 | Ga0209676_1010742 | Ga0209676_10107423 | 245 |
| 684 | 3300025292 | Ga0209676_1021677 | Ga0209676_10216772 | 245 |
| 685 | 3300025292 | Ga0209676_1034700 | Ga0209676_10347002 | 245 |
| 686 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024388 | 245 |
| 687 | 3300025294 | Ga0209025_1000407 | Ga0209025_100040730 | 245 |
| 688 | 3300025294 | Ga0209025_1000469 | Ga0209025_100046923 | 245 |
| 689 | 3300025294 | Ga0209025_1001129 | Ga0209025_100112940 | 245 |
| 690 | 3300025294 | Ga0209025_1001232 | Ga0209025_100123238 | 245 |
| 691 | 3300025294 | Ga0209025_1001360 | Ga0209025_10013602 | 245 |
| 692 | 3300025294 | Ga0209025_1013476 | Ga0209025_10134762 | 245 |
| 693 | 3300025294 | Ga0209025_1019467 | Ga0209025_10194671 | 245 |
| 694 | 3300025294 | Ga0209025_1020353 | Ga0209025_10203533 | 245 |
| 695 | 3300025294 | Ga0209025_1030915 | Ga0209025_10309152 | 245 |
| 696 | 3300025294 | Ga0209025_1089964 | Ga0209025_10899641 | 245 |
| 697 | 3300025295 | Ga0209564_1000091 | Ga0209564_1000091109 | 245 |
| 698 | 3300025295 | Ga0209564_1000845 | Ga0209564_100084520 | 245 |
| 699 | 3300025295 | Ga0209564_1001820 | Ga0209564_10018207 | 245 |
| 700 | 3300025295 | Ga0209564_1002233 | Ga0209564_10022335 | 245 |
| 701 | 3300025295 | Ga0209564_1003141 | Ga0209564_10031419 | 245 |
| 702 | 3300025295 | Ga0209564_1021873 | Ga0209564_10218732 | 245 |
| 703 | 3300025295 | Ga0209564_1037278 | Ga0209564_10372782 | 245 |
| 704 | 3300025295 | Ga0209564_1051467 | Ga0209564_10514671 | 245 |
| 705 | 3300025297 | Ga0209758_1000046 | Ga0209758_1000046153 | 245 |
| 706 | 3300025297 | Ga0209758_1000336 | Ga0209758_100033658 | 245 |
| 707 | 3300025297 | Ga0209758_1000877 | Ga0209758_100087729 | 245 |
| 708 | 3300025297 | Ga0209758_1003352 | Ga0209758_10033522 | 245 |
| 709 | 3300025297 | Ga0209758_1003629 | Ga0209758_100362913 | 245 |
| 710 | 3300025297 | Ga0209758_1008939 | Ga0209758_10089395 | 245 |
| 711 | 3300025297 | Ga0209758_1015276 | Ga0209758_10152763 | 245 |
| 712 | 3300025297 | Ga0209758_1027117 | Ga0209758_10271171 | 245 |
| 713 | 3300025297 | Ga0209758_1078809 | Ga0209758_10788091 | 245 |
| 714 | 3300025298 | Ga0209050_1002819 | Ga0209050_10028196 | 245 |
| 715 | 3300025298 | Ga0209050_1009815 | Ga0209050_10098155 | 245 |
| 716 | 3300025299 | Ga0209256_1000531 | Ga0209256_100053152 | 245 |
| 717 | 3300025299 | Ga0209256_1001360 | Ga0209256_10013602 | 245 |
| 718 | 3300025299 | Ga0209256_1002033 | Ga0209256_100203310 | 245 |
| 719 | 3300025299 | Ga0209256_1002068 | Ga0209256_100206820 | 245 |
| 720 | 3300025299 | Ga0209256_1002164 | Ga0209256_10021648 | 245 |
| 721 | 3300025299 | Ga0209256_1004435 | Ga0209256_10044359 | 245 |
| 722 | 3300025299 | Ga0209256_1006729 | Ga0209256_10067295 | 245 |
| 723 | 3300025299 | Ga0209256_1010949 | Ga0209256_10109492 | 245 |
| 724 | 3300025302 | Ga0207426_1000012 | Ga0207426_100001260 | 245 |
| 725 | 3300025302 | Ga0207426_1000013 | Ga0207426_100001313 | 245 |
| 726 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016438 | 245 |
| 727 | 3300025302 | Ga0207426_1000063 | Ga0207426_1000063149 | 245 |
| 728 | 3300025302 | Ga0207426_1000172 | Ga0207426_1000172155 | 245 |
| 729 | 3300025302 | Ga0207426_1001284 | Ga0207426_100128424 | 245 |
| 730 | 3300025303 | Ga0209051_1000084 | Ga0209051_100008472 | 245 |
| 731 | 3300025303 | Ga0209051_1001391 | Ga0209051_100139117 | 245 |
| 732 | 3300025303 | Ga0209051_1001972 | Ga0209051_10019725 | 245 |
| 733 | 3300025303 | Ga0209051_1003225 | Ga0209051_10032256 | 245 |
| 734 | 3300025303 | Ga0209051_1015056 | Ga0209051_10150562 | 245 |
| 735 | 3300025303 | Ga0209051_1030733 | Ga0209051_10307332 | 245 |
| 736 | 3300025304 | Ga0209257_1002244 | Ga0209257_100224415 | 245 |
| 737 | 3300025304 | Ga0209257_1009272 | Ga0209257_10092722 | 245 |
| 738 | 3300025304 | Ga0209257_1009288 | Ga0209257_10092882 | 245 |
| 739 | 3300025304 | Ga0209257_1031843 | Ga0209257_10318432 | 245 |
| 740 | 3300025321 | Ga0207656_10050177 | Ga0207656_100501771 | 245 |
| 741 | 3300025913 | Ga0207695_10000376 | Ga0207695_1000037676 | 245 |
| 742 | 3300025914 | Ga0207671_10000732 | Ga0207671_1000073210 | 245 |
| 743 | 3300025925 | Ga0207650_10000899 | Ga0207650_1000089919 | 245 |
| 744 | 3300025931 | Ga0207644_10021705 | Ga0207644_100217055 | 245 |
| 745 | 3300025972 | Ga0207668_10010428 | Ga0207668_100104282 | 245 |
| 746 | 3300026067 | Ga0207678_10209091 | Ga0207678_102090912 | 245 |
| 747 | 3300026078 | Ga0207702_10008346 | Ga0207702_100083467 | 245 |
| 748 | 3300026078 | Ga0207702_10146983 | Ga0207702_101469832 | 245 |
| 749 | 3300026142 | Ga0207698_10473597 | Ga0207698_104735971 | 245 |
| 750 | 3300027111 | Ga0209281_1000192 | Ga0209281_100019232 | 245 |
| 751 | 3300027111 | Ga0209281_1000629 | Ga0209281_100062921 | 245 |
| 752 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009386 | 245 |
| 753 | 3300027312 | Ga0209371_1001137 | Ga0209371_100113713 | 245 |
| 754 | 3300027312 | Ga0209371_1002001 | Ga0209371_10020019 | 245 |
| 755 | 3300027666 | Ga0209282_1000269 | Ga0209282_100026916 | 245 |
| 756 | 3300028379 | Ga0268266_10006718 | Ga0268266_100067185 | 245 |
| 757 | 3300028379 | Ga0268266_10040248 | Ga0268266_100402484 | 245 |
| 758 | 3300028379 | Ga0268266_10069283 | Ga0268266_100692831 | 245 |
| 759 | 3300028379 | Ga0268266_10660563 | Ga0268266_106605631 | 245 |
| 760 | 3300028794 | Ga0307515_10000154 | Ga0307515_1000015430 | 245 |
| 761 | 3300028794 | Ga0307515_10000444 | Ga0307515_1000044412 | 245 |
| 762 | 3300028794 | Ga0307515_10019259 | Ga0307515_100192599 | 245 |
| 763 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010385 | 245 |
| 764 | 3300030500 | Ga0268256_1002423 | Ga0268256_10024238 | 245 |
| 765 | 3300030500 | Ga0268256_1008149 | Ga0268256_10081492 | 245 |
| 766 | 3300031456 | Ga0307513_10003801 | Ga0307513_1000380118 | 245 |
| 767 | 3300031731 | Ga0307405_10009702 | Ga0307405_100097024 | 245 |
| 768 | 3300031901 | Ga0307406_10016226 | Ga0307406_100162264 | 245 |
| 769 | 3300031911 | Ga0307412_10001549 | Ga0307412_100015497 | 245 |
| 770 | 3300031911 | Ga0307412_10061217 | Ga0307412_100612171 | 245 |
| 771 | 3300031995 | Ga0307409_100141672 | Ga0307409_1001416722 | 245 |
| 772 | 3300031995 | Ga0307409_100729702 | Ga0307409_1007297021 | 245 |
| 773 | 3300035692 | Ga0373935_0129042 | Ga0373935_0129042_861_1598 | 245 |
| 774 | 3300035695 | Ga0373927_0000329 | Ga0373927_0000329_4262_4999 | 245 |
| 775 | 3300037068 | Ga0373925_0006529 | Ga0373925_0006529_7356_8093 | 245 |
| 776 | 3300041404 | Ga0439436_0000603 | Ga0439436_0000603_7354_8091 | 245 |
| 777 | 3300041405 | Ga0439438_026976 | Ga0439438_026976_261_998 | 245 |
| 778 | 3300041413 | Ga0439465_0001431 | Ga0439465_0001431_6267_7004 | 245 |
| 779 | 3300041413 | Ga0439465_0005132 | Ga0439465_0005132_3030_3767 | 245 |
| 780 | 3300041492 | Ga0451835_0532266 | Ga0451835_0532266_199_936 | 245 |
| 781 | 3300041494 | Ga0451837_1452220 | Ga0451837_1452220_754_1491 | 245 |
| 782 | 3300041496 | Ga0451839_0469472 | Ga0451839_0469472_16_753 | 245 |
| 783 | 3300041496 | Ga0451839_1624085 | Ga0451839_1624085_103_840 | 245 |
| 784 | 3300041498 | Ga0451841_1381482 | Ga0451841_1381482_192_929 | 245 |
| 785 | 3300041501 | Ga0451845_0636985 | Ga0451845_0636985_27_764 | 245 |
| 786 | 3300041503 | Ga0451847_0235905 | Ga0451847_0235905_1100_1837 | 245 |
| 787 | 3300041512 | Ga0451853_1200660 | Ga0451853_1200660_189_926 | 245 |
| 788 | 3300042004 | Ga0439445_0028025 | Ga0439445_0028025_480_1217 | 245 |
| 789 | 3300042007 | Ga0439449_0032178 | Ga0439449_0032178_491_1228 | 245 |
| 790 | 3300042007 | Ga0439449_0054665 | Ga0439449_0054665_330_1067 | 245 |
| 791 | 3300042007 | Ga0439449_0108782 | Ga0439449_0108782_22_759 | 245 |
| 792 | 3300042007 | Ga0439449_0121161 | Ga0439449_0121161_93_830 | 245 |
| 793 | 3300042015 | Ga0439462_0017703 | Ga0439462_0017703_909_1646 | 245 |
| 794 | 3300042122 | Ga0450920_018160 | Ga0450920_018160_186_923 | 245 |
| 795 | 3300042136 | Ga0450900_007645 | Ga0450900_007645_450_1187 | 245 |
| 796 | 3300042145 | Ga0450906_011583 | Ga0450906_011583_854_1591 | 245 |
| 797 | 3300042435 | Ga0439434_0012815 | Ga0439434_0012815_1134_1871 | 245 |
| 798 | 3300042531 | Ga0450918_010064 | Ga0450918_010064_381_1118 | 245 |
| 799 | 3300044765 | Ga0466970_0028741 | Ga0466970_0028741_1215_1952 | 245 |
| 800 | 3300045976 | Ga0466967_0172131 | Ga0466967_0172131_106_843 | 245 |
| 801 | 3300046457 | Ga0495590_0071343 | Ga0495590_0071343_409_1146 | 245 |
| 802 | 3300046459 | Ga0495629_0031294 | Ga0495629_0031294_765_1502 | 245 |
| 803 | 3300046471 | Ga0495650_0024370 | Ga0495650_0024370_89_826 | 245 |
| 804 | 3300046471 | Ga0495650_0080590 | Ga0495650_0080590_498_1235 | 245 |
| 805 | 3300046474 | Ga0495605_0087296 | Ga0495605_0087296_97_834 | 245 |
| 806 | 3300046476 | Ga0495662_0023435 | Ga0495662_0023435_1721_2458 | 245 |
| 807 | 3300046492 | Ga0495585_0051289 | Ga0495585_0051289_1085_1822 | 245 |
| 808 | 3300046492 | Ga0495585_0068360 | Ga0495585_0068360_198_935 | 245 |
| 809 | 3300046501 | Ga0495607_0042109 | Ga0495607_0042109_428_1165 | 245 |
| 810 | 3300046501 | Ga0495607_0065801 | Ga0495607_0065801_910_1647 | 245 |
| 811 | 3300046506 | Ga0495583_0001834 | Ga0495583_0001834_18093_18830 | 245 |
| 812 | 3300046507 | Ga0495606_0016727 | Ga0495606_0016727_4451_5188 | 245 |
| 813 | 3300046507 | Ga0495606_0051734 | Ga0495606_0051734_882_1619 | 245 |
| 814 | 3300046507 | Ga0495606_0115194 | Ga0495606_0115194_277_1014 | 245 |
| 815 | 3300046507 | Ga0495606_0190950 | Ga0495606_0190950_41_778 | 245 |
| 816 | 3300046512 | Ga0495610_0062537 | Ga0495610_0062537_133_870 | 245 |
| 817 | 3300046512 | Ga0495610_0073621 | Ga0495610_0073621_98_835 | 245 |
| 818 | 3300046515 | Ga0495620_0015977 | Ga0495620_0015977_2941_3678 | 245 |
| 819 | 3300046515 | Ga0495620_0024808 | Ga0495620_0024808_672_1412 | 245 |
| 820 | 3300046515 | Ga0495620_0082314 | Ga0495620_0082314_228_965 | 245 |
| 821 | 3300046518 | Ga0495631_0059477 | Ga0495631_0059477_70_807 | 245 |
| 822 | 3300046519 | Ga0495632_0007410 | Ga0495632_0007410_3399_4136 | 245 |
| 823 | 3300046522 | Ga0495643_0025235 | Ga0495643_0025235_133_870 | 245 |
| 824 | 3300046522 | Ga0495643_0036630 | Ga0495643_0036630_1285_2022 | 245 |
| 825 | 3300046522 | Ga0495643_0068980 | Ga0495643_0068980_715_1452 | 245 |
| 826 | 3300046524 | Ga0495648_0015099 | Ga0495648_0015099_694_1431 | 245 |
| 827 | 3300046524 | Ga0495648_0213108 | Ga0495648_0213108_200_937 | 245 |
| 828 | 3300046530 | Ga0495654_0000530 | Ga0495654_0000530_27071_27808 | 245 |
| 829 | 3300046557 | Ga0495622_0071154 | Ga0495622_0071154_413_1150 | 245 |
| 830 | 3300046557 | Ga0495622_0105665 | Ga0495622_0105665_442_1179 | 245 |
| 831 | 3300046558 | Ga0495633_0044464 | Ga0495633_0044464_47_784 | 245 |
| 832 | 3300046558 | Ga0495633_0062183 | Ga0495633_0062183_975_1712 | 245 |
| 833 | 3300046558 | Ga0495633_0067180 | Ga0495633_0067180_561_1298 | 245 |
| 834 | 3300046558 | Ga0495633_0078879 | Ga0495633_0078879_740_1477 | 245 |
| 835 | 3300046615 | Ga0495656_0045298 | Ga0495656_0045298_1038_1775 | 245 |
| 836 | 3300046616 | Ga0495668_0067076 | Ga0495668_0067076_780_1517 | 245 |
| 837 | 3300046642 | Ga0495634_0180857 | Ga0495634_0180857_304_1041 | 245 |
| 838 | 3300046660 | Ga0495625_0004038 | Ga0495625_0004038_216_953 | 245 |
| 839 | 3300046660 | Ga0495625_0035298 | Ga0495625_0035298_99_836 | 245 |
| 840 | 3300046660 | Ga0495625_0052753 | Ga0495625_0052753_138_875 | 245 |
| 841 | 3300046660 | Ga0495625_0107936 | Ga0495625_0107936_727_1464 | 245 |
| 842 | 3300046663 | Ga0495635_0025784 | Ga0495635_0025784_2653_3390 | 245 |
| 843 | 3300046674 | Ga0495588_0007450 | Ga0495588_0007450_2425_3162 | 245 |
| 844 | 3300046674 | Ga0495588_0124740 | Ga0495588_0124740_350_1087 | 245 |
| 845 | 3300046674 | Ga0495588_0251817 | Ga0495588_0251817_121_858 | 245 |
| 846 | 3300046675 | Ga0495657_0120213 | Ga0495657_0120213_683_1420 | 245 |
| 847 | 3300046683 | Ga0495658_0083866 | Ga0495658_0083866_829_1566 | 245 |
| 848 | 3300046690 | Ga0495624_0327396 | Ga0495624_0327396_124_861 | 245 |
| 849 | 3300046694 | Ga0495649_0030284 | Ga0495649_0030284_433_1170 | 245 |
| 850 | 3300046794 | Ga0495589_0081044 | Ga0495589_0081044_306_1043 | 245 |
| 851 | 3300046809 | Ga0495600_0017187 | Ga0495600_0017187_1443_2180 | 245 |
| 852 | 3300047317 | Ga0495604_0092081 | Ga0495604_0092081_235_972 | 245 |
| 853 | 3300047318 | Ga0495636_0056117 | Ga0495636_0056117_260_997 | 245 |
| 854 | 3300047323 | Ga0495683_0139790 | Ga0495683_0139790_376_1113 | 245 |
| 855 | 3300047469 | Ga0495673_0116321 | Ga0495673_0116321_193_930 | 245 |
| 856 | 3300047470 | Ga0495681_0003498 | Ga0495681_0003498_9519_10256 | 245 |
| 857 | 3300047470 | Ga0495681_0154310 | Ga0495681_0154310_64_801 | 245 |
| 858 | 3300047472 | Ga0495686_0017518 | Ga0495686_0017518_673_1410 | 245 |
| 859 | 3300047472 | Ga0495686_0125448 | Ga0495686_0125448_269_1009 | 245 |
| 860 | 3300048090 | Ga0495615_0034340 | Ga0495615_0034340_145_882 | 245 |
| 861 | 3300048091 | Ga0495626_0088481 | Ga0495626_0088481_233_970 | 245 |
| 862 | 3300048903 | Ga0496100_0026122 | Ga0496100_0026122_1333_2070 | 245 |
| 863 | 3300048904 | Ga0496101_0191705 | Ga0496101_0191705_77_814 | 245 |
| 864 | 3300048904 | Ga0496101_0429729 | Ga0496101_0429729_251_991 | 245 |
| 865 | 3300048905 | Ga0496102_0007354 | Ga0496102_0007354_1652_2389 | 245 |
| 866 | 3300048906 | Ga0496103_0014180 | Ga0496103_0014180_2305_3042 | 245 |
| 867 | 3300048913 | Ga0496110_0068733 | Ga0496110_0068733_1359_2096 | 245 |
| 868 | 3300048914 | Ga0496111_0045488 | Ga0496111_0045488_540_1277 | 245 |
| 869 | 3300048915 | Ga0496112_0546452 | Ga0496112_0546452_32_769 | 245 |
| 870 | 3300048916 | Ga0496113_0128061 | Ga0496113_0128061_399_1136 | 245 |
| 871 | 3300048919 | Ga0496116_0001010 | Ga0496116_0001010_19442_20182 | 245 |
| 872 | 3300048919 | Ga0496116_0015732 | Ga0496116_0015732_4207_4944 | 245 |
| 873 | 3300048919 | Ga0496116_0017253 | Ga0496116_0017253_1063_1800 | 245 |
| 874 | 3300048919 | Ga0496116_0023025 | Ga0496116_0023025_2319_3059 | 245 |
| 875 | 3300048919 | Ga0496116_0051493 | Ga0496116_0051493_1677_2414 | 245 |
| 876 | 3300048919 | Ga0496116_0058736 | Ga0496116_0058736_1657_2397 | 245 |
| 877 | 3300048919 | Ga0496116_0062069 | Ga0496116_0062069_142_882 | 245 |
| 878 | 3300048919 | Ga0496116_0234828 | Ga0496116_0234828_82_822 | 245 |
| 879 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1906844_1907581 | 245 |
| 880 | 3300048920 | Ga0496117_0000732 | Ga0496117_0000732_25057_25794 | 245 |
| 881 | 3300048920 | Ga0496117_0005677 | Ga0496117_0005677_11937_12677 | 245 |
| 882 | 3300048920 | Ga0496117_0005953 | Ga0496117_0005953_10409_11146 | 245 |
| 883 | 3300048920 | Ga0496117_0013837 | Ga0496117_0013837_2261_2998 | 245 |
| 884 | 3300048920 | Ga0496117_0047633 | Ga0496117_0047633_142_882 | 245 |
| 885 | 3300048920 | Ga0496117_0065685 | Ga0496117_0065685_330_1067 | 245 |
| 886 | 3300048921 | Ga0496118_0002815 | Ga0496118_0002815_11504_12241 | 245 |
| 887 | 3300048921 | Ga0496118_0005185 | Ga0496118_0005185_9486_10226 | 245 |
| 888 | 3300048921 | Ga0496118_0010358 | Ga0496118_0010358_3583_4320 | 245 |
| 889 | 3300048921 | Ga0496118_0010897 | Ga0496118_0010897_479_1216 | 245 |
| 890 | 3300048921 | Ga0496118_0015048 | Ga0496118_0015048_2985_3722 | 245 |
| 891 | 3300048921 | Ga0496118_0030250 | Ga0496118_0030250_2112_2852 | 245 |
| 892 | 3300048922 | Ga0496119_0020314 | Ga0496119_0020314_1481_2218 | 245 |
| 893 | 3300048922 | Ga0496119_0025121 | Ga0496119_0025121_2667_3404 | 245 |
| 894 | 3300048922 | Ga0496119_0071376 | Ga0496119_0071376_407_1147 | 245 |
| 895 | 3300048922 | Ga0496119_0091272 | Ga0496119_0091272_101_838 | 245 |
| 896 | 3300048922 | Ga0496119_0291316 | Ga0496119_0291316_27_767 | 245 |
| 897 | 3300048923 | Ga0496120_0000021 | Ga0496120_0000021_158994_159731 | 245 |
| 898 | 3300048923 | Ga0496120_0008278 | Ga0496120_0008278_5124_5861 | 245 |
| 899 | 3300048923 | Ga0496120_0071424 | Ga0496120_0071424_352_1089 | 245 |
| 900 | 3300048923 | Ga0496120_0102165 | Ga0496120_0102165_454_1191 | 245 |
| 901 | 3300048923 | Ga0496120_0165327 | Ga0496120_0165327_40_777 | 245 |
| 902 | 3300048923 | Ga0496120_0216403 | Ga0496120_0216403_40_777 | 245 |
| 903 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_469620_470357 | 245 |
| 904 | 3300048924 | Ga0496121_0000581 | Ga0496121_0000581_49564_50301 | 245 |
| 905 | 3300048924 | Ga0496121_0003240 | Ga0496121_0003240_10530_11267 | 245 |
| 906 | 3300048924 | Ga0496121_0024071 | Ga0496121_0024071_423_1160 | 245 |
| 907 | 3300048924 | Ga0496121_0061551 | Ga0496121_0061551_2198_2938 | 245 |
| 908 | 3300048924 | Ga0496121_0137041 | Ga0496121_0137041_339_1076 | 245 |
| 909 | 3300048924 | Ga0496121_0153968 | Ga0496121_0153968_142_882 | 245 |
| 910 | 3300048924 | Ga0496121_0224742 | Ga0496121_0224742_550_1287 | 245 |
| 911 | 3300048924 | Ga0496121_0272964 | Ga0496121_0272964_310_1047 | 245 |
| 912 | 3300048924 | Ga0496121_0402774 | Ga0496121_0402774_35_772 | 245 |
| 913 | 3300048924 | Ga0496121_0432265 | Ga0496121_0432265_82_819 | 245 |
| 914 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1277634_1278371 | 245 |
| 915 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_460115_460852 | 245 |
| 916 | 3300048925 | Ga0496122_0000247 | Ga0496122_0000247_24631_25368 | 245 |
| 917 | 3300048925 | Ga0496122_0011748 | Ga0496122_0011748_6296_7033 | 245 |
| 918 | 3300048925 | Ga0496122_0018902 | Ga0496122_0018902_816_1553 | 245 |
| 919 | 3300048925 | Ga0496122_0023069 | Ga0496122_0023069_4750_5487 | 245 |
| 920 | 3300048925 | Ga0496122_0029557 | Ga0496122_0029557_2634_3371 | 245 |
| 921 | 3300048925 | Ga0496122_0045343 | Ga0496122_0045343_1738_2475 | 245 |
| 922 | 3300048925 | Ga0496122_0050593 | Ga0496122_0050593_1968_2705 | 245 |
| 923 | 3300048925 | Ga0496122_0052622 | Ga0496122_0052622_2198_2938 | 245 |
| 924 | 3300048925 | Ga0496122_0054734 | Ga0496122_0054734_2240_2980 | 245 |
| 925 | 3300048925 | Ga0496122_0130490 | Ga0496122_0130490_167_907 | 245 |
| 926 | 3300048925 | Ga0496122_0277472 | Ga0496122_0277472_37_777 | 245 |
| 927 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1281365_1282102 | 245 |
| 928 | 3300048926 | Ga0496123_0000020 | Ga0496123_0000020_264673_265410 | 245 |
| 929 | 3300048926 | Ga0496123_0000222 | Ga0496123_0000222_24292_25029 | 245 |
| 930 | 3300048926 | Ga0496123_0005238 | Ga0496123_0005238_1913_2650 | 245 |
| 931 | 3300048926 | Ga0496123_0021560 | Ga0496123_0021560_50_787 | 245 |
| 932 | 3300048926 | Ga0496123_0032979 | Ga0496123_0032979_61_801 | 245 |
| 933 | 3300048926 | Ga0496123_0043345 | Ga0496123_0043345_538_1278 | 245 |
| 934 | 3300048926 | Ga0496123_0091621 | Ga0496123_0091621_291_1028 | 245 |
| 935 | 3300048927 | Ga0496124_0000063 | Ga0496124_0000063_69925_70686 | 245 |
| 936 | 3300048927 | Ga0496124_0005486 | Ga0496124_0005486_654_1391 | 245 |
| 937 | 3300048927 | Ga0496124_0005927 | Ga0496124_0005927_8429_9166 | 245 |
| 938 | 3300048927 | Ga0496124_0006765 | Ga0496124_0006765_9502_10242 | 245 |
| 939 | 3300048927 | Ga0496124_0010229 | Ga0496124_0010229_674_1411 | 245 |
| 940 | 3300048927 | Ga0496124_0013163 | Ga0496124_0013163_5811_6548 | 245 |
| 941 | 3300048927 | Ga0496124_0015770 | Ga0496124_0015770_61_801 | 245 |
| 942 | 3300048927 | Ga0496124_0015862 | Ga0496124_0015862_5619_6356 | 245 |
| 943 | 3300048927 | Ga0496124_0052100 | Ga0496124_0052100_852_1589 | 245 |
| 944 | 3300048927 | Ga0496124_0052416 | Ga0496124_0052416_2254_2991 | 245 |
| 945 | 3300048927 | Ga0496124_0058070 | Ga0496124_0058070_1930_2667 | 245 |
| 946 | 3300048927 | Ga0496124_0129115 | Ga0496124_0129115_1105_1845 | 245 |
| 947 | 3300048927 | Ga0496124_0163083 | Ga0496124_0163083_181_918 | 245 |
| 948 | 3300048927 | Ga0496124_0173617 | Ga0496124_0173617_276_1013 | 245 |
| 949 | 3300048927 | Ga0496124_0301589 | Ga0496124_0301589_72_809 | 245 |
| 950 | 3300048927 | Ga0496124_0364926 | Ga0496124_0364926_113_853 | 245 |
| 951 | 3300048927 | Ga0496124_0450074 | Ga0496124_0450074_25_765 | 245 |
| 952 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_581675_582412 | 245 |
| 953 | 3300048928 | Ga0496125_0001358 | Ga0496125_0001358_25997_26734 | 245 |
| 954 | 3300048928 | Ga0496125_0002192 | Ga0496125_0002192_17356_18096 | 245 |
| 955 | 3300048928 | Ga0496125_0014572 | Ga0496125_0014572_5465_6202 | 245 |
| 956 | 3300048928 | Ga0496125_0041097 | Ga0496125_0041097_2287_3024 | 245 |
| 957 | 3300048929 | Ga0496126_0001362 | Ga0496126_0001362_29551_30288 | 245 |
| 958 | 3300048929 | Ga0496126_0012358 | Ga0496126_0012358_791_1528 | 245 |
| 959 | 3300048929 | Ga0496126_0095875 | Ga0496126_0095875_287_1024 | 245 |
| 960 | 3300048929 | Ga0496126_0143652 | Ga0496126_0143652_661_1398 | 245 |
| 961 | 3300048929 | Ga0496126_0235582 | Ga0496126_0235582_505_1242 | 245 |
| 962 | 3300048929 | Ga0496126_0305505 | Ga0496126_0305505_295_1032 | 245 |
| 963 | 3300049570 | Ga0501033_0083870 | Ga0501033_0083870_699_1436 | 245 |
| 964 | 3300049571 | Ga0501034_0395942 | Ga0501034_0395942_461_1198 | 245 |
| 965 | 3300049571 | Ga0501034_0782889 | Ga0501034_0782889_26_763 | 245 |
| 966 | 3300049571 | Ga0501034_0799597 | Ga0501034_0799597_84_821 | 245 |
| 967 | 3300049572 | Ga0501036_0143387 | Ga0501036_0143387_214_951 | 245 |
| 968 | 3300049573 | Ga0501037_0060722 | Ga0501037_0060722_56_793 | 245 |
| 969 | 3300049574 | Ga0501038_0094553 | Ga0501038_0094553_714_1451 | 245 |
| 970 | 3300049575 | Ga0501039_0161708 | Ga0501039_0161708_873_1610 | 245 |
| 971 | 3300049579 | Ga0501043_0041168 | Ga0501043_0041168_10_747 | 245 |
| 972 | 3300049580 | Ga0501046_0141505 | Ga0501046_0141505_608_1345 | 245 |
| 973 | 3300049581 | Ga0501047_0059074 | Ga0501047_0059074_1329_2066 | 245 |
| 974 | 3300049584 | Ga0501068_0153090 | Ga0501068_0153090_308_1045 | 245 |
| 975 | 3300049589 | Ga0501073_0157608 | Ga0501073_0157608_375_1112 | 245 |
| 976 | 3300049744 | Ga0501083_0054490 | Ga0501083_0054490_1114_1851 | 245 |
| 977 | 3300049776 | Ga0501280_001351 | Ga0501280_001351_479_1216 | 245 |
| 978 | 3300049822 | Ga0501035_0023157 | Ga0501035_0023157_4664_5401 | 245 |
| 979 | 3300050490 | nmdc:mga03n38_8375_c1 | nmdc:mga03n38_8375_c1_1328_2065 | 245 |
| 980 | 3300050491 | nmdc:mga00v17_133_c2 | nmdc:mga00v17_133_c2_17662_18399 | 245 |
| 981 | 3300050491 | nmdc:mga00v17_1528_c2 | nmdc:mga00v17_1528_c2_2889_3626 | 245 |
| 982 | 3300050491 | nmdc:mga00v17_257_c1 | nmdc:mga00v17_257_c1_21351_22088 | 245 |
| 983 | 3300050492 | nmdc:mga0yw44_279_c1 | nmdc:mga0yw44_279_c1_11500_12237 | 245 |
| 984 | 3300050493 | nmdc:mga0k408_77084_c1 | nmdc:mga0k408_77084_c1_190_927 | 245 |
| 985 | 3300050494 | nmdc:mga06z11_17846_c1 | nmdc:mga06z11_17846_c1_581_1318 | 245 |
| 986 | 3300050495 | nmdc:mga04h51_94105_c1 | nmdc:mga04h51_94105_c1_176_913 | 245 |
| 987 | 3300050496 | nmdc:mga07m45_9227_c1 | nmdc:mga07m45_9227_c1_3343_4080 | 245 |
| 988 | 3300050516 | nmdc:mga0sz30_38997_c1 | nmdc:mga0sz30_38997_c1_133_870 | 245 |
| 989 | 3300050516 | nmdc:mga0sz30_395_c1 | nmdc:mga0sz30_395_c1_1879_2616 | 245 |
| 990 | 3300053086 | Ga0500578_0158938 | Ga0500578_0158938_553_1290 | 245 |
| 991 | 3300053086 | Ga0500578_0305076 | Ga0500578_0305076_97_834 | 245 |
| 992 | 3300053107 | Ga0500560_009593 | Ga0500560_009593_913_1650 | 245 |
| 993 | 3300053111 | Ga0500572_001125 | Ga0500572_001125_5588_6325 | 245 |
| 994 | 3300053121 | Ga0500607_201336 | Ga0500607_201336_62_799 | 245 |
| 995 | 3300053125 | Ga0500618_000046 | Ga0500618_000046_78220_79044 | 245 |
| 996 | 3300053125 | Ga0500618_001284 | Ga0500618_001284_7488_8225 | 245 |
| 997 | 3300053125 | Ga0500618_004792 | Ga0500618_004792_2484_3221 | 245 |
| 998 | 3300053125 | Ga0500618_015519 | Ga0500618_015519_616_1356 | 245 |
| 999 | 3300053125 | Ga0500618_026040 | Ga0500618_026040_80_817 | 245 |
| 1000 | 3300053134 | Ga0500658_0017210 | Ga0500658_0017210_352_1089 | 245 |
| 1001 | 3300053134 | Ga0500658_0023874 | Ga0500658_0023874_915_1652 | 245 |
| 1002 | 3300053137 | Ga0500561_0000284 | Ga0500561_0000284_542_1279 | 245 |
| 1003 | 3300053139 | Ga0500568_0002051 | Ga0500568_0002051_8082_8819 | 245 |
| 1004 | 3300053139 | Ga0500568_0003923 | Ga0500568_0003923_847_1584 | 245 |
| 1005 | 3300053140 | Ga0500573_0000491 | Ga0500573_0000491_13067_13804 | 245 |
| 1006 | 3300053140 | Ga0500573_0001555 | Ga0500573_0001555_10198_10935 | 245 |
| 1007 | 3300053148 | Ga0500590_000222 | Ga0500590_000222_596_1333 | 245 |
| 1008 | 3300053151 | Ga0500604_0038410 | Ga0500604_0038410_166_903 | 245 |
| 1009 | 3300053153 | Ga0500616_0001019 | Ga0500616_0001019_6602_7339 | 245 |
| 1010 | 3300053153 | Ga0500616_0001529 | Ga0500616_0001529_8225_8962 | 245 |
| 1011 | 3300053153 | Ga0500616_0108519 | Ga0500616_0108519_77_814 | 245 |
| 1012 | 3300053153 | Ga0500616_0125247 | Ga0500616_0125247_77_814 | 245 |
| 1013 | 3300053155 | Ga0500620_107381 | Ga0500620_107381_27_764 | 245 |
| 1014 | 3300053156 | Ga0500622_0000653 | Ga0500622_0000653_20993_21730 | 245 |
| 1015 | 3300053157 | Ga0500624_002019 | Ga0500624_002019_432_1169 | 245 |
| 1016 | 3300053157 | Ga0500624_013063 | Ga0500624_013063_181_918 | 245 |
| 1017 | 3300053158 | Ga0500627_0116304 | Ga0500627_0116304_151_888 | 245 |
| 1018 | 3300053158 | Ga0500627_0140664 | Ga0500627_0140664_251_988 | 245 |
| 1019 | 3300053161 | Ga0500634_0079540 | Ga0500634_0079540_96_833 | 245 |
| 1020 | 3300053177 | Ga0500636_0000010 | Ga0500636_0000010_68174_68911 | 245 |
| 1021 | 3300053730 | Ga0500645_076790 | Ga0500645_076790_96_833 | 245 |
| 1022 | 3300061719 | Ga0466962_0085602 | Ga0466962_0085602_238_975 | 245 |
| 1023 | iso_pu_bacteria | 650716007 | 650739101 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j3c-assembly1.cif.gz_B | crystal structure of 16s ribosomal rna methyltransferase rsme | 0.9588 | 7 | 245 |
| 4j3c-assembly1.cif.gz_B | crystal structure of 16s ribosomal rna methyltransferase rsme | 0.9549 | 7 | 245 |
| 4j3c-assembly1.cif.gz_A | crystal structure of 16s ribosomal rna methyltransferase rsme | 0.9515 | 7 | 245 |
| 4j3c-assembly1.cif.gz_A | crystal structure of 16s ribosomal rna methyltransferase rsme | 0.9475 | 7 | 245 |
| 4e8b-assembly1.cif.gz_A | crystal structure of 16s rrna methyltransferase rsme from e.coli | 0.8665 | 7 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j3cB02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9635 | 77 | 245 | 3.40.1280.10 |
| 4j3cB02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9577 | 77 | 245 | 3.40.1280.10 |
| 4j3cA01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.8918 | 8 | 76 | 2.40.240.20 |
| 4j3cA01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.8789 | 8 | 76 | 2.40.240.20 |
| 5o95A01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.8732 | 6 | 72 | 2.40.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5P9D625-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9582 | 4 | 245 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A0F2Q1K1-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.954 | 1 | 244 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A0F2Q1K1-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9501 | 1 | 244 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A1M7AHJ3-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9477 | 2 | 245 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A839AGT6-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9453 | 2 | 245 |
GO:0005737
GO:0070042 GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar