F488453

General Info

Members Datasets Scaffolds Average Seq Length
1023 283 2046 199

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0061284|Ga0501034_0061284_3101_3691
Length 196
Sequence LEYLIKQYPLQQGALEIQYIEEFFLDFPRKKTAAEVIQRLSERDHQILMAEAPLPDDPGTIVPVSFKVAHELRRDESDPKLADLVAQLEEHVDFGRRVLYQWIGGTRSDWRGQGHFRALTEEQEAWAIANGFDEVLVKTKNKFYEMRAALAQLNFNVIRFVPHPVDEAESKVFLRKRLGQHVLDAHRSRRMVTRFD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.14
Stem 0
Stem Tuber 0
Unclassified 15.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0061284 3300049571 Bacteria 3778
2 SwRhRL2b_contig_665754 2162886007 Unclassified 887
3 JGI24747J21853_1016190 3300001978 Bacteria 787
4 JGI24033J26618_1025026 3300002155 Bacteria 782
5 JGI25406J46586_10000294 3300003203 Bacteria 22402
6 JGI25406J46586_10000986 3300003203 Bacteria 13371
7 Ga0065714_10247501 3300005288 Bacteria 782
8 Ga0065704_10114904 3300005289 Bacteria 1882
9 Ga0065704_10281613 3300005289 Bacteria 921
10 Ga0065712_10018091 3300005290 Bacteria 1757
11 Ga0065712_10123258 3300005290 Bacteria 1625
12 Ga0065712_10151892 3300005290 Bacteria 1363
13 Ga0065712_10333823 3300005290 Bacteria 810
14 Ga0065715_10031998 3300005293 Bacteria 1463
15 Ga0065715_10107556 3300005293 Bacteria 2766
16 Ga0065715_10113799 3300005293 Bacteria 2475
17 Ga0065715_10209470 3300005293 Bacteria 1320
18 Ga0065715_10217979 3300005293 Bacteria 1284
19 Ga0065715_10279035 3300005293 Bacteria 1091
20 Ga0065715_10396681 3300005293 Unclassified 887
21 Ga0065715_10420523 3300005293 Unclassified 858
22 Ga0065707_10010865 3300005295 Bacteria 2426
23 Ga0065707_10088138 3300005295 Bacteria 4760
24 Ga0065707_10120748 3300005295 Bacteria 2126
25 Ga0065707_10157504 3300005295 Unclassified 1594
26 Ga0065707_10167893 3300005295 Bacteria 1507
27 Ga0065707_10273109 3300005295 Bacteria 1066
28 Ga0070658_10114194 3300005327 Bacteria 2239
29 Ga0070658_10368557 3300005327 Bacteria 1231
30 Ga0070676_10006091 3300005328 Bacteria 6439
31 Ga0070676_10026824 3300005328 Bacteria 3262
32 Ga0070676_10183246 3300005328 Bacteria 1363
33 Ga0070676_10289423 3300005328 Bacteria 1106
34 Ga0070676_10543392 3300005328 Unclassified 831
35 Ga0070676_10838475 3300005328 Unclassified 681
36 Ga0070683_100003901 3300005329 Bacteria 12187
37 Ga0070690_100001694 3300005330 Bacteria 11617
38 Ga0070690_100003813 3300005330 Bacteria 8303
39 Ga0070690_100051668 3300005330 Bacteria 2625
40 Ga0070690_100086429 3300005330 Bacteria 2059
41 Ga0070690_100140443 3300005330 Bacteria 1639
42 Ga0070670_100000644 3300005331 Bacteria 27141
43 Ga0070670_100001817 3300005331 Bacteria 17382
44 Ga0070670_100014370 3300005331 Bacteria 6794
45 Ga0070670_100044828 3300005331 Bacteria 3802
46 Ga0070670_100053236 3300005331 Bacteria 3475
47 Ga0070670_100059351 3300005331 Bacteria 3284
48 Ga0070670_100093296 3300005331 Bacteria 2589
49 Ga0070670_100173064 3300005331 Bacteria 1873
50 Ga0070670_100404859 3300005331 Bacteria 1205
51 Ga0070670_100462216 3300005331 Bacteria 1126
52 Ga0070670_100738051 3300005331 Unclassified 887
53 Ga0070677_10072655 3300005333 Bacteria 1451
54 Ga0068869_100006400 3300005334 Bacteria 7467
55 Ga0068869_100008797 3300005334 Bacteria 6531
56 Ga0068869_100307645 3300005334 Bacteria 1282
57 Ga0070666_10012227 3300005335 Bacteria 5409
58 Ga0070680_100048144 3300005336 Bacteria 3474
59 Ga0070680_100240054 3300005336 Bacteria 1531
60 Ga0068868_100005247 3300005338 Bacteria 9095
61 Ga0068868_100811449 3300005338 Bacteria 845
62 Ga0070660_100308979 3300005339 Bacteria 1297
63 Ga0070689_100008841 3300005340 Bacteria 7115
64 Ga0070689_100015730 3300005340 Bacteria 5524
65 Ga0070689_100036010 3300005340 Bacteria 3784
66 Ga0070689_100085044 3300005340 Bacteria 2487
67 Ga0070689_100158001 3300005340 Bacteria 1831
68 Ga0070691_10012980 3300005341 Bacteria 3815
69 Ga0070691_10105579 3300005341 Bacteria 1404
70 Ga0070691_10276720 3300005341 Bacteria 909
71 Ga0070687_100012617 3300005343 Bacteria 3738
72 Ga0070687_100085812 3300005343 Bacteria 1729
73 Ga0070687_100106122 3300005343 Bacteria 1582
74 Ga0070661_100021506 3300005344 Bacteria 4609
75 Ga0070661_100148673 3300005344 Unclassified 1770
76 Ga0070692_10047054 3300005345 Unclassified 2231
77 Ga0070692_10055105 3300005345 Bacteria 2078
78 Ga0070668_100101595 3300005347 Bacteria 2279
79 Ga0070668_100190584 3300005347 Bacteria 1679
80 Ga0070668_100356081 3300005347 Unclassified 1240
81 Ga0070669_100000352 3300005353 Bacteria 35915
82 Ga0070669_100002995 3300005353 Bacteria 12171
83 Ga0070669_100003511 3300005353 Bacteria 11306
84 Ga0070669_100007795 3300005353 Bacteria 7649
85 Ga0070669_100135596 3300005353 Bacteria 1893
86 Ga0070675_100000344 3300005354 Bacteria 31386
87 Ga0070675_100001225 3300005354 Bacteria 18657
88 Ga0070675_100015999 3300005354 Bacteria 5944
89 Ga0070675_100040449 3300005354 Bacteria 3806
90 Ga0070675_100046420 3300005354 Bacteria 3556
91 Ga0070675_100051999 3300005354 Bacteria 3367
92 Ga0070675_100078904 3300005354 Bacteria 2743
93 Ga0070675_100096752 3300005354 Bacteria 2480
94 Ga0070675_100107257 3300005354 Bacteria 2358
95 Ga0070675_100147648 3300005354 Unclassified 2014
96 Ga0070675_100198542 3300005354 Bacteria 1740
97 Ga0070675_100279820 3300005354 Unclassified 1466
98 Ga0070675_100288051 3300005354 Bacteria 1445
99 Ga0070675_100559351 3300005354 Bacteria 1035
100 Ga0070675_100583415 3300005354 Bacteria 1013
101 Ga0070671_100005852 3300005355 Bacteria 9796
102 Ga0070671_100025327 3300005355 Bacteria 4867
103 Ga0070671_100132333 3300005355 Bacteria 2101
104 Ga0070671_100206255 3300005355 Bacteria 1667
105 Ga0070671_100245625 3300005355 Unclassified 1520
106 Ga0070671_100264834 3300005355 Bacteria 1461
107 Ga0070671_101225267 3300005355 Unclassified 661
108 Ga0070674_100000032 3300005356 Bacteria 64311
109 Ga0070674_100065943 3300005356 Bacteria 2543
110 Ga0070674_100094474 3300005356 Bacteria 2166
111 Ga0070674_100344898 3300005356 Bacteria 1201
112 Ga0070674_100767156 3300005356 Bacteria 830
113 Ga0070673_100005865 3300005364 Bacteria 7918
114 Ga0070673_100018607 3300005364 Bacteria 4967
115 Ga0070673_100038899 3300005364 Bacteria 3636
116 Ga0070673_100044900 3300005364 Bacteria 3424
117 Ga0070673_100074580 3300005364 Bacteria 2734
118 Ga0070673_100121723 3300005364 Bacteria 2178
119 Ga0070673_100122768 3300005364 Unclassified 2169
120 Ga0070673_100126263 3300005364 Unclassified 2141
121 Ga0070673_100340711 3300005364 Unclassified 1328
122 Ga0070673_100570169 3300005364 Bacteria 1030
123 Ga0070673_100630666 3300005364 Bacteria 980
124 Ga0070688_100004122 3300005365 Bacteria 7543
125 Ga0070688_100010066 3300005365 Bacteria 5197
126 Ga0070688_100026806 3300005365 Bacteria 3427
127 Ga0070688_100067688 3300005365 Bacteria 2275
128 Ga0070688_100203701 3300005365 Bacteria 1386
129 Ga0070688_100575593 3300005365 Bacteria 859
130 Ga0070659_100071938 3300005366 Bacteria 2751
131 Ga0070659_100202365 3300005366 Bacteria 1635
132 Ga0070659_100400919 3300005366 Bacteria 1158
133 Ga0070659_101165032 3300005366 Bacteria 681
134 Ga0070667_100004553 3300005367 Bacteria 11668
135 Ga0070667_100181154 3300005367 Bacteria 1863
136 Ga0070667_100230039 3300005367 Bacteria 1653
137 Ga0070701_10016046 3300005438 Bacteria 3473
138 Ga0070701_10028224 3300005438 Bacteria 2757
139 Ga0070701_10044835 3300005438 Bacteria 2267
140 Ga0070701_10091089 3300005438 Bacteria 1671
141 Ga0070701_10365800 3300005438 Bacteria 905
142 Ga0070701_10401311 3300005438 Bacteria 869
143 Ga0070705_100045277 3300005440 Bacteria 2531
144 Ga0070700_100011308 3300005441 Bacteria 4940
145 Ga0070700_100015815 3300005441 Bacteria 4287
146 Ga0070700_100172282 3300005441 Bacteria 1499
147 Ga0070700_100255079 3300005441 Bacteria 1260
148 Ga0070700_100461372 3300005441 Bacteria 969
149 Ga0070700_100518919 3300005441 Bacteria 920
150 Ga0070700_100585954 3300005441 Unclassified 872
151 Ga0070694_100005351 3300005444 Bacteria 7760
152 Ga0070694_100019818 3300005444 Bacteria 4281
153 Ga0070694_100161786 3300005444 Unclassified 1643
154 Ga0070694_100315946 3300005444 Bacteria 1201
155 Ga0070694_100505890 3300005444 Unclassified 962
156 Ga0070708_100033179 3300005445 Bacteria 4485
157 Ga0070708_100440545 3300005445 Bacteria 1229
158 Ga0070663_100630033 3300005455 Bacteria 905
159 Ga0070678_100010447 3300005456 Bacteria 5674
160 Ga0070678_100075817 3300005456 Bacteria 2531
161 Ga0070678_100127762 3300005456 Bacteria 2015
162 Ga0070678_100201860 3300005456 Bacteria 1642
163 Ga0070678_100349821 3300005456 Unclassified 1270
164 Ga0070678_100355662 3300005456 Bacteria 1260
165 Ga0070678_100422538 3300005456 Bacteria 1162
166 Ga0070678_100704582 3300005456 Unclassified 910
167 Ga0070662_100025031 3300005457 Bacteria 4119
168 Ga0070662_100083347 3300005457 Bacteria 2386
169 Ga0070681_10013937 3300005458 Bacteria 7999
170 Ga0070681_10422631 3300005458 Bacteria 1245
171 Ga0068867_100000578 3300005459 Bacteria 24270
172 Ga0068867_100003034 3300005459 Bacteria 11842
173 Ga0068867_100306192 3300005459 Bacteria 1312
174 Ga0068867_100492198 3300005459 Bacteria 1052
175 Ga0070685_10008790 3300005466 Bacteria 5202
176 Ga0070685_10071359 3300005466 Bacteria 2059
177 Ga0070685_10129722 3300005466 Bacteria 1575
178 Ga0070685_10184773 3300005466 Bacteria 1344
179 Ga0070707_100393877 3300005468 Unclassified 1345
180 Ga0070707_100492910 3300005468 Unclassified 1187
181 Ga0070698_100001133 3300005471 Bacteria 29490
182 Ga0070698_100028550 3300005471 Bacteria 5794
183 Ga0070698_100123513 3300005471 Bacteria 2547
184 Ga0070699_100000125 3300005518 Bacteria 70893
185 Ga0070699_100003725 3300005518 Bacteria 13465
186 Ga0070699_100009237 3300005518 Bacteria 8544
187 Ga0070699_100197148 3300005518 Bacteria 1790
188 Ga0070699_100237143 3300005518 Bacteria 1627
189 Ga0070679_100117892 3300005530 Bacteria 2639
190 Ga0070679_100556185 3300005530 Bacteria 1091
191 Ga0070684_100003179 3300005535 Bacteria 12280
192 Ga0070684_100285614 3300005535 Bacteria 1512
193 Ga0070697_100132162 3300005536 Bacteria 2094
194 Ga0070672_100011456 3300005543 Bacteria 6185
195 Ga0070672_100015090 3300005543 Bacteria 5491
196 Ga0070672_100041580 3300005543 Bacteria 3534
197 Ga0070672_100074302 3300005543 Bacteria 2711
198 Ga0070672_100122884 3300005543 Bacteria 2127
199 Ga0070672_100147177 3300005543 Bacteria 1946
200 Ga0070672_100265361 3300005543 Unclassified 1449
201 Ga0070672_100503702 3300005543 Unclassified 1048
202 Ga0070686_100019164 3300005544 Bacteria 4027
203 Ga0070686_100026404 3300005544 Bacteria 3506
204 Ga0070695_100000040 3300005545 Bacteria 49538
205 Ga0070696_100003923 3300005546 Bacteria 9932
206 Ga0070696_100021687 3300005546 Bacteria 4356
207 Ga0070696_100097530 3300005546 Bacteria 2102
208 Ga0070696_100151636 3300005546 Unclassified 1702
209 Ga0070665_100080658 3300005548 Bacteria 3260
210 Ga0070665_100249408 3300005548 Unclassified 1776
211 Ga0070665_100922721 3300005548 Unclassified 886
212 Ga0070704_100001122 3300005549 Bacteria 13939
213 Ga0070704_100009716 3300005549 Bacteria 5831
214 Ga0070704_100053324 3300005549 Bacteria 2857
215 Ga0070704_100272105 3300005549 Bacteria 1400
216 Ga0070704_100366880 3300005549 Bacteria 1220
217 Ga0070704_100895486 3300005549 Unclassified 798
218 Ga0070664_100000148 3300005564 Bacteria 48402
219 Ga0070664_100005128 3300005564 Bacteria 10517
220 Ga0070664_100007452 3300005564 Bacteria 8835
221 Ga0070664_100018814 3300005564 Bacteria 5679
222 Ga0070664_100043757 3300005564 Bacteria 3779
223 Ga0070664_100052925 3300005564 Unclassified 3440
224 Ga0070664_100273188 3300005564 Bacteria 1523
225 Ga0068857_100044893 3300005577 Bacteria 3920
226 Ga0068857_100126514 3300005577 Bacteria 2303
227 Ga0068857_100197516 3300005577 Bacteria 1833
228 Ga0070702_100061053 3300005615 Bacteria 2194
229 Ga0068852_100073870 3300005616 Bacteria 3001
230 Ga0068852_100150952 3300005616 Bacteria 2160
231 Ga0068859_100038979 3300005617 Unclassified 4766
232 Ga0068859_100045507 3300005617 Bacteria 4409
233 Ga0068859_100137809 3300005617 Bacteria 2514
234 Ga0068859_100443376 3300005617 Bacteria 1394
235 Ga0068859_100557033 3300005617 Bacteria 1241
236 Ga0068864_100011950 3300005618 Bacteria 7167
237 Ga0068864_100051851 3300005618 Bacteria 3535
238 Ga0068864_100054976 3300005618 Bacteria 3436
239 Ga0068864_100162577 3300005618 Bacteria 2030
240 Ga0068864_100184566 3300005618 Unclassified 1909
241 Ga0068864_100186387 3300005618 Unclassified 1900
242 Ga0068864_100208716 3300005618 Bacteria 1798
243 Ga0068861_100001827 3300005719 Bacteria 13693
244 Ga0068861_100019586 3300005719 Bacteria 4834
245 Ga0068861_100058079 3300005719 Bacteria 2957
246 Ga0068861_100172744 3300005719 Bacteria 1792
247 Ga0068861_101393185 3300005719 Unclassified 685
248 Ga0068851_10008626 3300005834 Bacteria 4718
249 Ga0068870_10002627 3300005840 Bacteria 7522
250 Ga0068870_10014812 3300005840 Bacteria 3690
251 Ga0068870_10038443 3300005840 Bacteria 2471
252 Ga0068870_10044385 3300005840 Bacteria 2322
253 Ga0068870_10046467 3300005840 Bacteria 2277
254 Ga0068870_10057744 3300005840 Bacteria 2076
255 Ga0068870_10066603 3300005840 Unclassified 1951
256 Ga0068870_10169917 3300005840 Bacteria 1300
257 Ga0068870_10194188 3300005840 Bacteria 1227
258 Ga0068870_10243202 3300005840 Unclassified 1112
259 Ga0068863_100006263 3300005841 Bacteria 11688
260 Ga0068863_100033097 3300005841 Bacteria 4924
261 Ga0068863_101093613 3300005841 Unclassified 802
262 Ga0068858_100122126 3300005842 Bacteria 2436
263 Ga0068860_100010069 3300005843 Bacteria 9366
264 Ga0068860_100072348 3300005843 Bacteria 3277
265 Ga0068860_100795668 3300005843 Bacteria 959
266 Ga0068860_100808236 3300005843 Unclassified 951
267 Ga0068862_100001109 3300005844 Bacteria 25557
268 Ga0068862_100003727 3300005844 Bacteria 13004
269 Ga0068862_100268326 3300005844 Bacteria 1560
270 Ga0081538_10064933 3300005981 Unclassified 2060
271 Ga0081539_10000013 3300005985 Bacteria 432395
272 Ga0081539_10000164 3300005985 Bacteria 154639
273 Ga0081539_10000750 3300005985 Bacteria 64517
274 Ga0081539_10146462 3300005985 Bacteria 1141
275 Ga0070712_100542470 3300006175 Bacteria 979
276 Ga0075367_10240853 3300006178 Bacteria 1134
277 Ga0075366_10043226 3300006195 Bacteria 2669
278 Ga0097621_100365689 3300006237 Unclassified 1286
279 Ga0097621_100673514 3300006237 Bacteria 951
280 Ga0068871_100391705 3300006358 Bacteria 1236
281 Ga0075428_100000166 3300006844 Bacteria 60871
282 Ga0075428_100001819 3300006844 Bacteria 22833
283 Ga0075428_100024456 3300006844 Bacteria 6684
284 Ga0075428_100027623 3300006844 Bacteria 6278
285 Ga0075428_100037413 3300006844 Bacteria 5342
286 Ga0075428_100043905 3300006844 Bacteria 4913
287 Ga0075428_100189984 3300006844 Bacteria 2221
288 Ga0075430_100000691 3300006846 Bacteria 25696
289 Ga0075430_100002729 3300006846 Bacteria 14734
290 Ga0075430_100003225 3300006846 Bacteria 13669
291 Ga0075430_100012246 3300006846 Bacteria 7298
292 Ga0075430_100024978 3300006846 Bacteria 5083
293 Ga0075430_100042806 3300006846 Unclassified 3829
294 Ga0075430_100069874 3300006846 Bacteria 2945
295 Ga0075430_100150894 3300006846 Bacteria 1935
296 Ga0075431_100001885 3300006847 Bacteria 19887
297 Ga0075431_100003049 3300006847 Bacteria 16210
298 Ga0075431_100024090 3300006847 Bacteria 6233
299 Ga0075431_100050956 3300006847 Bacteria 4269
300 Ga0075431_100099856 3300006847 Bacteria 2995
301 Ga0075431_100100747 3300006847 Bacteria 2980
302 Ga0075431_100109384 3300006847 Bacteria 2853
303 Ga0075431_100193645 3300006847 Bacteria 2082
304 Ga0075431_100201330 3300006847 Bacteria 2037
305 Ga0075433_10000037 3300006852 Bacteria 53492
306 Ga0075433_10003070 3300006852 Bacteria 12830
307 Ga0075433_10004340 3300006852 Bacteria 11017
308 Ga0075433_10023808 3300006852 Bacteria 5158
309 Ga0075433_10089514 3300006852 Bacteria 2720
310 Ga0075433_10127240 3300006852 Bacteria 2262
311 Ga0075433_10131648 3300006852 Unclassified 2222
312 Ga0075433_10143129 3300006852 Bacteria 2125
313 Ga0075433_11088439 3300006852 Unclassified 695
314 Ga0075434_100000596 3300006871 Bacteria 27926
315 Ga0075434_100008215 3300006871 Bacteria 9686
316 Ga0075434_100008506 3300006871 Bacteria 9544
317 Ga0075434_100050899 3300006871 Bacteria 4115
318 Ga0075434_100069126 3300006871 Unclassified 3520
319 Ga0075434_100087618 3300006871 Bacteria 3114
320 Ga0075434_100099792 3300006871 Bacteria 2909
321 Ga0075434_100177461 3300006871 Bacteria 2150
322 Ga0075434_100649634 3300006871 Bacteria 1073
323 Ga0075429_100007109 3300006880 Bacteria 9720
324 Ga0075429_100008984 3300006880 Bacteria 8680
325 Ga0075429_100013970 3300006880 Bacteria 6960
326 Ga0075429_100015410 3300006880 Bacteria 6623
327 Ga0075429_100017078 3300006880 Bacteria 6275
328 Ga0075429_100036691 3300006880 Bacteria 4265
329 Ga0075429_100045136 3300006880 Bacteria 3834
330 Ga0075429_100110464 3300006880 Bacteria 2403
331 Ga0075429_100334755 3300006880 Bacteria 1325
332 Ga0068865_100121774 3300006881 Bacteria 1941
333 Ga0068865_100336926 3300006881 Unclassified 1218
334 Ga0068865_100382069 3300006881 Unclassified 1149
335 Ga0097620_100038978 3300006931 Unclassified 4766
336 Ga0097620_100045507 3300006931 Bacteria 4409
337 Ga0097620_100137816 3300006931 Bacteria 2514
338 Ga0097620_100443381 3300006931 Bacteria 1394
339 Ga0097620_100557043 3300006931 Bacteria 1241
340 Ga0075435_100008907 3300007076 Bacteria 7231
341 Ga0075435_100040076 3300007076 Bacteria 3740
342 Ga0075435_100059310 3300007076 Bacteria 3102
343 Ga0075435_100076598 3300007076 Bacteria 2741
344 Ga0075435_100156436 3300007076 Bacteria 1918
345 Ga0111539_10000417 3300009094 Bacteria 53293
346 Ga0111539_10001302 3300009094 Bacteria 33331
347 Ga0111539_10002820 3300009094 Bacteria 23099
348 Ga0111539_10004794 3300009094 Bacteria 17647
349 Ga0111539_10009006 3300009094 Bacteria 12631
350 Ga0111539_10024939 3300009094 Bacteria 7330
351 Ga0111539_10030202 3300009094 Bacteria 6590
352 Ga0111539_10030843 3300009094 Bacteria 6517
353 Ga0111539_10038640 3300009094 Bacteria 5759
354 Ga0111539_10052383 3300009094 Bacteria 4858
355 Ga0111539_10067881 3300009094 Bacteria 4210
356 Ga0111539_10124907 3300009094 Bacteria 3016
357 Ga0111539_10180891 3300009094 Bacteria 2462
358 Ga0111539_10196209 3300009094 Bacteria 2354
359 Ga0111539_10197680 3300009094 Bacteria 2345
360 Ga0111539_10298677 3300009094 Bacteria 1874
361 Ga0111539_10484475 3300009094 Bacteria 1441
362 Ga0111539_11227306 3300009094 Unclassified 871
363 Ga0105245_11006823 3300009098 Bacteria 878
364 Ga0105247_10305987 3300009101 Bacteria 1104
365 Ga0114129_10002975 3300009147 Bacteria 23734
366 Ga0114129_10009556 3300009147 Bacteria 13830
367 Ga0114129_10014604 3300009147 Bacteria 11189
368 Ga0114129_10016193 3300009147 Bacteria 10610
369 Ga0114129_10017991 3300009147 Bacteria 10063
370 Ga0114129_10034099 3300009147 Bacteria 7191
371 Ga0114129_10051085 3300009147 Bacteria 5805
372 Ga0114129_10087982 3300009147 Bacteria 4307
373 Ga0114129_10126859 3300009147 Bacteria 3508
374 Ga0114129_10221915 3300009147 Bacteria 2549
375 Ga0114129_10253111 3300009147 Bacteria 2363
376 Ga0114129_10336628 3300009147 Unclassified 2003
377 Ga0114129_10419849 3300009147 Bacteria 1759
378 Ga0114129_10519672 3300009147 Bacteria 1552
379 Ga0114129_10761375 3300009147 Unclassified 1239
380 Ga0114129_10772112 3300009147 Bacteria 1228
381 Ga0114129_10955340 3300009147 Unclassified 1082
382 Ga0105243_10428257 3300009148 Unclassified 1236
383 Ga0105243_10566958 3300009148 Bacteria 1088
384 Ga0105241_10593998 3300009174 Bacteria 999
385 Ga0105242_10034278 3300009176 Bacteria 4070
386 Ga0105248_10007336 3300009177 Bacteria 12101
387 Ga0105248_10072756 3300009177 Bacteria 3863
388 Ga0105248_10267833 3300009177 Bacteria 1923
389 Ga0105248_10696084 3300009177 Bacteria 1147
390 Ga0105248_10976953 3300009177 Bacteria 956
391 Ga0105237_10681195 3300009545 Bacteria 1035
392 Ga0105238_10082062 3300009551 Bacteria 3214
393 Ga0105238_10094814 3300009551 Bacteria 2972
394 Ga0105249_10000496 3300009553 Bacteria 36369
395 Ga0105249_10017545 3300009553 Bacteria 6356
396 Ga0105249_10020989 3300009553 Bacteria 5844
397 Ga0105249_10592014 3300009553 Bacteria 1163
398 Ga0105249_11756793 3300009553 Unclassified 693
399 Ga0105239_10941252 3300010375 Unclassified 992
400 Ga0105246_10044988 3300011119 Bacteria 3004
401 Ga0105246_10304387 3300011119 Unclassified 1288
402 Ga0105246_10526460 3300011119 Unclassified 1008
403 Ga0157369_10801470 3300013105 Bacteria 968
404 Ga0157374_10031858 3300013296 Bacteria 4796
405 Ga0163162_10017321 3300013306 Bacteria 7049
406 Ga0163162_10265323 3300013306 Bacteria 1849
407 Ga0163162_11491075 3300013306 Bacteria 770
408 Ga0163162_11559233 3300013306 Bacteria 753
409 Ga0157372_10370636 3300013307 Bacteria 1668
410 Ga0157375_10019096 3300013308 Bacteria 6226
411 Ga0157375_10043578 3300013308 Bacteria 4353
412 Ga0157375_10066024 3300013308 Bacteria 3610
413 Ga0157375_10194814 3300013308 Bacteria 2181
414 Ga0157375_10252731 3300013308 Bacteria 1923
415 Ga0157375_10259872 3300013308 Bacteria 1898
416 Ga0157375_10272919 3300013308 Bacteria 1853
417 Ga0157375_10549733 3300013308 Bacteria 1316
418 Ga0163163_10011152 3300014325 Bacteria 8137
419 Ga0163163_10029067 3300014325 Bacteria 5315
420 Ga0163163_10162135 3300014325 Bacteria 2281
421 Ga0163163_10213548 3300014325 Bacteria 1978
422 Ga0163163_10245687 3300014325 Bacteria 1840
423 Ga0163163_10292812 3300014325 Bacteria 1680
424 Ga0163163_10698946 3300014325 Bacteria 1078
425 Ga0157380_10003180 3300014326 Bacteria 11209
426 Ga0157380_10015256 3300014326 Bacteria 5643
427 Ga0157380_10016604 3300014326 Bacteria 5433
428 Ga0157380_10022211 3300014326 Bacteria 4772
429 Ga0157380_10079271 3300014326 Unclassified 2682
430 Ga0157380_10413414 3300014326 Unclassified 1284
431 Ga0157380_10549522 3300014326 Unclassified 1133
432 Ga0157380_11070202 3300014326 Bacteria 844
433 Ga0157377_10006987 3300014745 Bacteria 5423
434 Ga0157377_10041577 3300014745 Bacteria 2551
435 Ga0157377_10110576 3300014745 Bacteria 1651
436 Ga0157377_10145029 3300014745 Unclassified 1462
437 Ga0157377_10149526 3300014745 Bacteria 1443
438 Ga0157377_10296308 3300014745 Bacteria 1066
439 Ga0157377_10371781 3300014745 Bacteria 965
440 Ga0157379_10079801 3300014968 Bacteria 2931
441 Ga0157379_10213250 3300014968 Bacteria 1748
442 Ga0157376_10212523 3300014969 Bacteria 1787
443 Ga0157376_10701899 3300014969 Bacteria 1017
444 Ga0157376_10912589 3300014969 Bacteria 897
445 Ga0163161_10011768 3300017792 Bacteria 6067
446 Ga0163161_10321554 3300017792 Bacteria 1223
447 Ga0207697_10002286 3300025315 Bacteria 10011
448 Ga0207697_10215211 3300025315 Bacteria 847
449 Ga0207656_10027013 3300025321 Bacteria 2345
450 Ga0207653_10059348 3300025885 Bacteria 1287
451 Ga0207682_10016527 3300025893 Unclassified 2879
452 Ga0207682_10028422 3300025893 Bacteria 2232
453 Ga0207682_10091143 3300025893 Bacteria 1321
454 Ga0207682_10102323 3300025893 Bacteria 1253
455 Ga0207682_10133875 3300025893 Bacteria 1108
456 Ga0207642_10079247 3300025899 Bacteria 1590
457 Ga0207688_10001096 3300025901 Bacteria 13891
458 Ga0207688_10108235 3300025901 Bacteria 1611
459 Ga0207688_10129870 3300025901 Bacteria 1476
460 Ga0207688_10368634 3300025901 Bacteria 887
461 Ga0207680_10070281 3300025903 Bacteria 2166
462 Ga0207645_10015770 3300025907 Bacteria 5011
463 Ga0207645_10016759 3300025907 Bacteria 4845
464 Ga0207645_10021862 3300025907 Bacteria 4167
465 Ga0207645_10099872 3300025907 Bacteria 1872
466 Ga0207645_10627436 3300025907 Unclassified 730
467 Ga0207643_10000068 3300025908 Bacteria 69282
468 Ga0207643_10001752 3300025908 Bacteria 12121
469 Ga0207643_10022482 3300025908 Bacteria 3472
470 Ga0207643_10041294 3300025908 Bacteria 2599
471 Ga0207643_10047583 3300025908 Bacteria 2427
472 Ga0207643_10060452 3300025908 Bacteria 2163
473 Ga0207643_10150709 3300025908 Bacteria 1394
474 Ga0207643_10200442 3300025908 Unclassified 1215
475 Ga0207643_10242028 3300025908 Bacteria 1109
476 Ga0207707_10035368 3300025912 Bacteria 4368
477 Ga0207660_10105737 3300025917 Bacteria 2110
478 Ga0207660_10134957 3300025917 Bacteria 1882
479 Ga0207660_10394855 3300025917 Unclassified 1113
480 Ga0207660_10765252 3300025917 Unclassified 788
481 Ga0207662_10025819 3300025918 Bacteria 3385
482 Ga0207662_10034280 3300025918 Bacteria 2962
483 Ga0207662_10108606 3300025918 Bacteria 1727
484 Ga0207662_10112090 3300025918 Bacteria 1702
485 Ga0207657_10324807 3300025919 Bacteria 1216
486 Ga0207649_10034702 3300025920 Bacteria 3025
487 Ga0207649_10114936 3300025920 Unclassified 1804
488 Ga0207646_10104242 3300025922 Bacteria 2544
489 Ga0207646_10529475 3300025922 Bacteria 1061
490 Ga0207646_10706812 3300025922 Unclassified 901
491 Ga0207681_10002615 3300025923 Bacteria 11406
492 Ga0207681_10019010 3300025923 Bacteria 4336
493 Ga0207681_10026977 3300025923 Bacteria 3710
494 Ga0207681_10028232 3300025923 Bacteria 3634
495 Ga0207681_10137821 3300025923 Bacteria 1813
496 Ga0207681_10169098 3300025923 Bacteria 1656
497 Ga0207681_10341324 3300025923 Bacteria 1196
498 Ga0207681_10389739 3300025923 Bacteria 1123
499 Ga0207650_10021293 3300025925 Bacteria 4582
500 Ga0207650_10052489 3300025925 Bacteria 3020
501 Ga0207650_10053705 3300025925 Unclassified 2987
502 Ga0207650_10213391 3300025925 Bacteria 1551
503 Ga0207650_10402003 3300025925 Bacteria 1134
504 Ga0207650_10520715 3300025925 Bacteria 995
505 Ga0207650_10546151 3300025925 Bacteria 971
506 Ga0207650_10734295 3300025925 Bacteria 835
507 Ga0207659_10000110 3300025926 Bacteria 48302
508 Ga0207659_10005807 3300025926 Bacteria 7522
509 Ga0207659_10023192 3300025926 Bacteria 4139
510 Ga0207659_10026708 3300025926 Unclassified 3899
511 Ga0207659_10042416 3300025926 Unclassified 3190
512 Ga0207659_10082161 3300025926 Bacteria 2385
513 Ga0207659_10085597 3300025926 Bacteria 2342
514 Ga0207659_10086904 3300025926 Bacteria 2326
515 Ga0207659_10089349 3300025926 Bacteria 2297
516 Ga0207659_10113839 3300025926 Bacteria 2061
517 Ga0207659_10127384 3300025926 Bacteria 1960
518 Ga0207659_10335653 3300025926 Bacteria 1251
519 Ga0207659_10677510 3300025926 Bacteria 882
520 Ga0207687_10310809 3300025927 Bacteria 1272
521 Ga0207644_10004633 3300025931 Bacteria 8947
522 Ga0207644_10019278 3300025931 Bacteria 4625
523 Ga0207644_10192590 3300025931 Bacteria 1604
524 Ga0207644_10420181 3300025931 Bacteria 1095
525 Ga0207644_10537453 3300025931 Bacteria 967
526 Ga0207690_10321108 3300025932 Bacteria 1217
527 Ga0207690_10691547 3300025932 Bacteria 838
528 Ga0207690_10878034 3300025932 Bacteria 743
529 Ga0207706_10016248 3300025933 Bacteria 6723
530 Ga0207706_10046751 3300025933 Bacteria 3831
531 Ga0207706_10048140 3300025933 Bacteria 3771
532 Ga0207706_10098856 3300025933 Bacteria 2567
533 Ga0207706_10147846 3300025933 Bacteria 2067
534 Ga0207706_10584608 3300025933 Bacteria 960
535 Ga0207706_10833404 3300025933 Bacteria 782
536 Ga0207686_10114249 3300025934 Unclassified 1827
537 Ga0207709_10169376 3300025935 Bacteria 1531
538 Ga0207670_10011792 3300025936 Bacteria 5087
539 Ga0207670_10018839 3300025936 Bacteria 4205
540 Ga0207670_10083112 3300025936 Bacteria 2245
541 Ga0207670_10097115 3300025936 Unclassified 2097
542 Ga0207670_10306541 3300025936 Unclassified 1245
543 Ga0207669_10001301 3300025937 Bacteria 10600
544 Ga0207669_10071687 3300025937 Bacteria 2178
545 Ga0207669_10099513 3300025937 Bacteria 1918
546 Ga0207669_10237112 3300025937 Bacteria 1350
547 Ga0207669_10475630 3300025937 Bacteria 995
548 Ga0207669_10655154 3300025937 Bacteria 859
549 Ga0207704_10012641 3300025938 Bacteria 4195
550 Ga0207704_10202139 3300025938 Unclassified 1455
551 Ga0207691_10007798 3300025940 Bacteria 10307
552 Ga0207691_10017127 3300025940 Bacteria 6874
553 Ga0207691_10017705 3300025940 Bacteria 6754
554 Ga0207691_10045785 3300025940 Bacteria 4021
555 Ga0207691_10046220 3300025940 Bacteria 4002
556 Ga0207691_10069784 3300025940 Bacteria 3174
557 Ga0207691_10132536 3300025940 Bacteria 2200
558 Ga0207691_10412078 3300025940 Bacteria 1152
559 Ga0207711_10244546 3300025941 Bacteria 1646
560 Ga0207689_10002433 3300025942 Bacteria 17334
561 Ga0207689_10115367 3300025942 Bacteria 2208
562 Ga0207689_10127586 3300025942 Bacteria 2092
563 Ga0207689_10198399 3300025942 Bacteria 1656
564 Ga0207689_10239102 3300025942 Bacteria 1501
565 Ga0207689_10455305 3300025942 Bacteria 1070
566 Ga0207661_10016888 3300025944 Bacteria 5391
567 Ga0207679_10014223 3300025945 Bacteria 5226
568 Ga0207679_10086139 3300025945 Bacteria 2415
569 Ga0207679_10285694 3300025945 Bacteria 1416
570 Ga0207679_10375687 3300025945 Bacteria 1245
571 Ga0207679_10427760 3300025945 Unclassified 1170
572 Ga0207679_10538086 3300025945 Bacteria 1047
573 Ga0207667_10200058 3300025949 Bacteria 2050
574 Ga0207651_10008346 3300025960 Bacteria 5589
575 Ga0207651_10186860 3300025960 Bacteria 1649
576 Ga0207651_10305958 3300025960 Unclassified 1323
577 Ga0207651_10435204 3300025960 Bacteria 1122
578 Ga0207651_10676011 3300025960 Bacteria 908
579 Ga0207651_10684402 3300025960 Bacteria 902
580 Ga0207712_10025490 3300025961 Bacteria 3929
581 Ga0207712_10039875 3300025961 Bacteria 3220
582 Ga0207712_10055246 3300025961 Bacteria 2792
583 Ga0207668_10105509 3300025972 Bacteria 2103
584 Ga0207668_10119512 3300025972 Bacteria 1993
585 Ga0207668_10320938 3300025972 Unclassified 1285
586 Ga0207668_10522926 3300025972 Unclassified 1024
587 Ga0207658_10058312 3300025986 Bacteria 2872
588 Ga0207658_10502681 3300025986 Bacteria 1080
589 Ga0207658_10645992 3300025986 Bacteria 953
590 Ga0207677_10046533 3300026023 Bacteria 2906
591 Ga0207677_10303187 3300026023 Unclassified 1320
592 Ga0207703_10021444 3300026035 Bacteria 5057
593 Ga0207703_10058689 3300026035 Bacteria 3141
594 Ga0207678_10055838 3300026067 Bacteria 3401
595 Ga0207678_10340084 3300026067 Bacteria 1293
596 Ga0207708_10004225 3300026075 Bacteria 10574
597 Ga0207708_10057295 3300026075 Bacteria 2973
598 Ga0207708_10107834 3300026075 Bacteria 2160
599 Ga0207708_10124297 3300026075 Bacteria 2012
600 Ga0207708_10137155 3300026075 Bacteria 1917
601 Ga0207708_10232409 3300026075 Unclassified 1481
602 Ga0207708_10579767 3300026075 Bacteria 948
603 Ga0207708_10611706 3300026075 Unclassified 924
604 Ga0207641_10132212 3300026088 Bacteria 2242
605 Ga0207641_10391215 3300026088 Bacteria 1333
606 Ga0207641_10847180 3300026088 Unclassified 906
607 Ga0207641_11274443 3300026088 Bacteria 735
608 Ga0207648_10000819 3300026089 Bacteria 35169
609 Ga0207648_10001252 3300026089 Bacteria 28387
610 Ga0207648_10022354 3300026089 Bacteria 5682
611 Ga0207648_10071091 3300026089 Bacteria 3033
612 Ga0207648_10291346 3300026089 Bacteria 1462
613 Ga0207648_10378775 3300026089 Unclassified 1279
614 Ga0207676_10007332 3300026095 Bacteria 7822
615 Ga0207676_10062815 3300026095 Bacteria 2947
616 Ga0207676_10077581 3300026095 Bacteria 2688
617 Ga0207676_10114216 3300026095 Bacteria 2265
618 Ga0207676_10188865 3300026095 Bacteria 1811
619 Ga0207676_10191663 3300026095 Bacteria 1799
620 Ga0207676_10321376 3300026095 Unclassified 1421
621 Ga0207676_10404630 3300026095 Bacteria 1276
622 Ga0207676_10471932 3300026095 Bacteria 1187
623 Ga0207676_10804405 3300026095 Bacteria 917
624 Ga0207674_10017892 3300026116 Bacteria 7725
625 Ga0207674_10024953 3300026116 Bacteria 6380
626 Ga0207674_10032779 3300026116 Bacteria 5446
627 Ga0207674_10108560 3300026116 Unclassified 2751
628 Ga0207675_100004144 3300026118 Bacteria 14034
629 Ga0207675_100016115 3300026118 Bacteria 6982
630 Ga0207675_100018571 3300026118 Bacteria 6487
631 Ga0207675_100069758 3300026118 Bacteria 3285
632 Ga0207675_100110317 3300026118 Bacteria 2596
633 Ga0207675_100170783 3300026118 Bacteria 2078
634 Ga0207675_100213871 3300026118 Bacteria 1855
635 Ga0207675_100256035 3300026118 Bacteria 1695
636 Ga0207675_100570392 3300026118 Bacteria 1132
637 Ga0207683_10025432 3300026121 Bacteria 5108
638 Ga0207683_10044173 3300026121 Bacteria 3895
639 Ga0207683_10068234 3300026121 Bacteria 3138
640 Ga0207683_10071905 3300026121 Bacteria 3059
641 Ga0207683_10177511 3300026121 Unclassified 1931
642 Ga0207683_10225896 3300026121 Bacteria 1707
643 Ga0207683_10340210 3300026121 Bacteria 1376
644 Ga0207683_10352610 3300026121 Bacteria 1351
645 Ga0207683_10476279 3300026121 Bacteria 1152
646 Ga0207698_10083322 3300026142 Bacteria 2588
647 Ga0207698_10112568 3300026142 Bacteria 2285
648 Ga0207698_10264793 3300026142 Bacteria 1581
649 Ga0209971_1058086 3300027682 Bacteria 936
650 Ga0209998_10072928 3300027717 Unclassified 823
651 Ga0207428_10000444 3300027907 Bacteria 50619
652 Ga0207428_10000579 3300027907 Bacteria 43267
653 Ga0207428_10001202 3300027907 Bacteria 27748
654 Ga0207428_10009371 3300027907 Bacteria 8782
655 Ga0207428_10009973 3300027907 Bacteria 8503
656 Ga0207428_10010085 3300027907 Bacteria 8454
657 Ga0207428_10013310 3300027907 Bacteria 7193
658 Ga0207428_10163848 3300027907 Bacteria 1687
659 Ga0207428_10571661 3300027907 Bacteria 816
660 Ga0268266_10234565 3300028379 Unclassified 1691
661 Ga0268265_10009133 3300028380 Bacteria 6699
662 Ga0268265_10009470 3300028380 Bacteria 6579
663 Ga0268265_10077218 3300028380 Bacteria 2615
664 Ga0268265_10114577 3300028380 Bacteria 2208
665 Ga0268265_10257985 3300028380 Bacteria 1548
666 Ga0268265_10444707 3300028380 Bacteria 1209
667 Ga0268265_10530377 3300028380 Bacteria 1114
668 Ga0268264_10175933 3300028381 Bacteria 1939
669 Ga0268264_10496856 3300028381 Bacteria 1189
670 Ga0268264_10832976 3300028381 Bacteria 923
671 Ga0268264_10942761 3300028381 Unclassified 868
672 Ga0307408_100033443 3300031548 Bacteria 3592
673 Ga0307408_100041164 3300031548 Bacteria 3275
674 Ga0307408_100100399 3300031548 Bacteria 2204
675 Ga0307408_100133473 3300031548 Bacteria 1939
676 Ga0307408_100249243 3300031548 Bacteria 1464
677 Ga0307408_100691489 3300031548 Unclassified 916
678 Ga0307408_100982483 3300031548 Bacteria 777
679 Ga0307405_10004150 3300031731 Bacteria 6814
680 Ga0307405_10009507 3300031731 Bacteria 4989
681 Ga0307405_10023443 3300031731 Bacteria 3507
682 Ga0307405_10300797 3300031731 Unclassified 1217
683 Ga0307413_10054896 3300031824 Bacteria 2420
684 Ga0307413_10145030 3300031824 Bacteria 1646
685 Ga0307413_10176393 3300031824 Bacteria 1519
686 Ga0307410_10029791 3300031852 Bacteria 3480
687 Ga0307410_10034128 3300031852 Bacteria 3291
688 Ga0307410_10105343 3300031852 Bacteria 2030
689 Ga0307410_10193621 3300031852 Bacteria 1548
690 Ga0307406_10214292 3300031901 Bacteria 1427
691 Ga0307406_10235134 3300031901 Unclassified 1371
692 Ga0307406_10517310 3300031901 Bacteria 970
693 Ga0307406_10791688 3300031901 Unclassified 799
694 Ga0307407_10016077 3300031903 Bacteria 3717
695 Ga0307407_10033768 3300031903 Bacteria 2794
696 Ga0307407_10050719 3300031903 Bacteria 2375
697 Ga0307407_10116043 3300031903 Bacteria 1689
698 Ga0307407_10256541 3300031903 Bacteria 1201
699 Ga0307412_10017157 3300031911 Bacteria 4330
700 Ga0307412_10205313 3300031911 Bacteria 1499
701 Ga0307412_10225940 3300031911 Unclassified 1438
702 Ga0307412_10315409 3300031911 Bacteria 1242
703 Ga0307409_100009500 3300031995 Bacteria 5978
704 Ga0307409_100044458 3300031995 Bacteria 3345
705 Ga0307409_100089661 3300031995 Bacteria 2514
706 Ga0307409_100179226 3300031995 Bacteria 1874
707 Ga0307409_100450497 3300031995 Bacteria 1242
708 Ga0307409_100496372 3300031995 Bacteria 1187
709 Ga0307409_100718258 3300031995 Bacteria 1000
710 Ga0307416_100004049 3300032002 Bacteria 8759
711 Ga0307416_100058498 3300032002 Bacteria 3125
712 Ga0307416_100113240 3300032002 Bacteria 2397
713 Ga0307416_100173601 3300032002 Bacteria 2010
714 Ga0307416_100271118 3300032002 Bacteria 1666
715 Ga0307416_100634114 3300032002 Bacteria 1152
716 Ga0307416_100995095 3300032002 Unclassified 941
717 Ga0307416_101136280 3300032002 Unclassified 886
718 Ga0307414_10047970 3300032004 Bacteria 2943
719 Ga0307414_10198742 3300032004 Bacteria 1629
720 Ga0307414_10433969 3300032004 Bacteria 1148
721 Ga0307411_10004853 3300032005 Bacteria 6525
722 Ga0307411_10074597 3300032005 Bacteria 2312
723 Ga0307411_10157571 3300032005 Unclassified 1695
724 Ga0307411_10490039 3300032005 Bacteria 1037
725 Ga0307411_10492145 3300032005 Bacteria 1035
726 Ga0307411_10600396 3300032005 Unclassified 946
727 Ga0307411_10716201 3300032005 Bacteria 873
728 Ga0307415_100001761 3300032126 Bacteria 10574
729 Ga0307415_100046867 3300032126 Bacteria 2906
730 Ga0307415_100121042 3300032126 Bacteria 1962
731 Ga0307415_100152219 3300032126 Bacteria 1782
732 Ga0373958_0044029 3300034819 Bacteria 922
733 Ga0373926_0097374 3300035083 Bacteria 1098
734 Ga0373952_0154904 3300035092 Bacteria 645
735 Ga0373939_0034593 3300035114 Unclassified 1484
736 Ga0373956_0240059 3300035119 Bacteria 861
737 Ga0373946_0060895 3300035171 Unclassified 1606
738 Ga0373935_0102913 3300035692 Bacteria 1885
739 Ga0373947_0014643 3300035725 Bacteria 4497
740 Ga0451804_0124480 3300041463 Bacteria 846
741 Ga0439431_0024900 3300041997 Unclassified 1459
742 Ga0439445_0024004 3300042004 Unclassified 1547
743 Ga0439450_052463 3300042008 Unclassified 972
744 Ga0439457_011164 3300042014 Bacteria 2050
745 Ga0439446_0010681 3300042156 Unclassified 2479
746 Ga0439446_0013029 3300042156 Bacteria 2277
747 Ga0450908_013869 3300042184 Bacteria 1453
748 Ga0439434_0017808 3300042435 Bacteria 2126
749 Ga0439434_0058163 3300042435 Bacteria 1206
750 Ga0439434_0113264 3300042435 Bacteria 880
751 Ga0439435_0002693 3300042436 Bacteria 3575
752 Ga0439444_0030150 3300042437 Bacteria 1014
753 Ga0439464_0054302 3300042439 Unclassified 1164
754 Ga0439460_0102776 3300042461 Archaea 920
755 Ga0450916_041881 3300042530 Unclassified 699
756 Ga0451577_0144334 3300042876 Unclassified 2140
757 Ga0439440_0028921 3300042993 Bacteria 1296
758 Ga0453683_0068182 3300044673 Unclassified 2224
759 Ga0453683_0233505 3300044673 Bacteria 1171
760 Ga0451576_0029314 3300045051 Bacteria 5889
761 Ga0451576_0052136 3300045051 Bacteria 4287
762 Ga0451576_0293720 3300045051 Bacteria 1699
763 Ga0466967_0905132 3300045976 Bacteria 877
764 Ga0495603_0007270 3300046455 Bacteria 6653
765 Ga0495603_0015606 3300046455 Bacteria 4598
766 Ga0495603_0152687 3300046455 Bacteria 1341
767 Ga0495629_0005621 3300046459 Bacteria 9365
768 Ga0495641_0066192 3300046461 Unclassified 1626
769 Ga0495580_0193844 3300046472 Bacteria 1401
770 Ga0495584_0014186 3300046491 Bacteria 4061
771 Ga0495584_0136411 3300046491 Bacteria 1246
772 Ga0495585_0313212 3300046492 Bacteria 769
773 Ga0495594_0107756 3300046499 Unclassified 1570
774 Ga0495594_0111329 3300046499 Unclassified 1544
775 Ga0495594_0350148 3300046499 Bacteria 841
776 Ga0495637_0094252 3300046520 Unclassified 1177
777 Ga0495643_0003465 3300046522 Bacteria 11522
778 Ga0495644_0111529 3300046523 Bacteria 1038
779 Ga0495663_0013360 3300046525 Bacteria 2295
780 Ga0495642_0021843 3300046528 Bacteria 2519
781 Ga0495642_0064419 3300046528 Bacteria 1525
782 Ga0495609_0031275 3300046538 Bacteria 2420
783 Ga0495621_0000608 3300046539 Bacteria 8970
784 Ga0495621_0031934 3300046539 Bacteria 1809
785 Ga0495621_0032773 3300046539 Bacteria 1788
786 Ga0495621_0086482 3300046539 Unclassified 1176
787 Ga0495621_0142607 3300046539 Bacteria 938
788 Ga0495659_0011115 3300046664 Bacteria 2900
789 Ga0495659_0035519 3300046664 Bacteria 1757
790 Ga0495659_0047098 3300046664 Bacteria 1558
791 Ga0495659_0158244 3300046664 Bacteria 913
792 Ga0495658_0066310 3300046683 Bacteria 2085
793 Ga0495669_0115922 3300046684 Bacteria 1253
794 Ga0495669_0239868 3300046684 Bacteria 870
795 Ga0495670_0023357 3300046691 Unclassified 3052
796 Ga0495670_0119539 3300046691 Bacteria 1368
797 Ga0495636_0003219 3300047318 Bacteria 6332
798 Ga0495636_0005085 3300047318 Bacteria 5168
799 Ga0495674_0620824 3300047319 Bacteria 855
800 Ga0495672_0042760 3300047320 Bacteria 2730
801 Ga0495685_026454 3300047447 Bacteria 1996
802 Ga0495685_214527 3300047447 Unclassified 615
803 Ga0495614_0089166 3300048089 Bacteria 1341
804 Ga0496100_0176978 3300048903 Bacteria 1541
805 Ga0496104_0017354 3300048907 Bacteria 6552
806 Ga0496108_0412058 3300048911 Unclassified 1180
807 Ga0496109_0018241 3300048912 Bacteria 6164
808 Ga0496109_0018746 3300048912 Bacteria 6085
809 Ga0496109_0222060 3300048912 Bacteria 1777
810 Ga0496110_0020105 3300048913 Bacteria 5632
811 Ga0496110_0398363 3300048913 Bacteria 1255
812 Ga0496110_0694963 3300048913 Bacteria 918
813 Ga0496112_0326479 3300048915 Bacteria 1478
814 Ga0496113_0379738 3300048916 Unclassified 1134
815 Ga0496114_0545140 3300048917 Bacteria 1025
816 Ga0501036_0118509 3300049572 Unclassified 2236
817 Ga0501036_0438856 3300049572 Bacteria 1088
818 Ga0501036_0487047 3300049572 Bacteria 1027
819 Ga0501036_0676029 3300049572 Bacteria 854
820 Ga0501036_0830757 3300049572 Unclassified 760
821 Ga0501037_0181290 3300049573 Bacteria 1494
822 Ga0501037_0675873 3300049573 Unclassified 689
823 Ga0501038_0151164 3300049574 Bacteria 1893
824 Ga0501038_0329496 3300049574 Bacteria 1193
825 Ga0501038_0379238 3300049574 Bacteria 1097
826 Ga0501038_0703653 3300049574 Unclassified 757
827 Ga0501039_0071792 3300049575 Bacteria 2690
828 Ga0501039_0090112 3300049575 Bacteria 2390
829 Ga0501039_0103976 3300049575 Bacteria 2217
830 Ga0501040_0022412 3300049576 Unclassified 4226
831 Ga0501040_0184923 3300049576 Bacteria 1478
832 Ga0501040_0362316 3300049576 Bacteria 1039
833 Ga0501040_0435674 3300049576 Unclassified 943
834 Ga0501041_0027084 3300049577 Bacteria 3453
835 Ga0501041_0029568 3300049577 Unclassified 3305
836 Ga0501041_0126538 3300049577 Bacteria 1591
837 Ga0501041_0303462 3300049577 Bacteria 1006
838 Ga0501042_0024016 3300049578 Bacteria 4272
839 Ga0501042_0078486 3300049578 Bacteria 2365
840 Ga0501042_0163503 3300049578 Bacteria 1606
841 Ga0501042_0733290 3300049578 Unclassified 719
842 Ga0501043_0157226 3300049579 Bacteria 1778
843 Ga0501046_0187057 3300049580 Bacteria 1546
844 Ga0501046_0306238 3300049580 Bacteria 1159
845 Ga0501046_0358421 3300049580 Unclassified 1058
846 Ga0501047_0087950 3300049581 Bacteria 2984
847 Ga0501048_0087483 3300049582 Unclassified 2198
848 Ga0501048_0130865 3300049582 Bacteria 1774
849 Ga0501068_0052526 3300049584 Bacteria 2466
850 Ga0501071_0007692 3300049587 Bacteria 7100
851 Ga0501071_0067072 3300049587 Bacteria 2609
852 Ga0501071_0157819 3300049587 Unclassified 1694
853 Ga0501071_0395578 3300049587 Bacteria 1055
854 Ga0501071_0420538 3300049587 Bacteria 1021
855 Ga0501072_0012409 3300049588 Bacteria 6511
856 Ga0501072_0024066 3300049588 Bacteria 4735
857 Ga0501072_0024609 3300049588 Bacteria 4686
858 Ga0501073_0502168 3300049589 Bacteria 839
859 Ga0501074_0295121 3300049590 Bacteria 1152
860 Ga0501074_0349253 3300049590 Bacteria 1050
861 Ga0501074_0546598 3300049590 Unclassified 820
862 Ga0501075_0008801 3300049591 Bacteria 7036
863 Ga0501075_0026831 3300049591 Bacteria 4243
864 Ga0501075_0030556 3300049591 Bacteria 3991
865 Ga0501075_0365572 3300049591 Unclassified 1100
866 Ga0501075_0651907 3300049591 Bacteria 803
867 Ga0501076_0008466 3300049592 Bacteria 7539
868 Ga0501076_0049079 3300049592 Bacteria 3337
869 Ga0501076_0056579 3300049592 Bacteria 3113
870 Ga0501076_0060176 3300049592 Bacteria 3021
871 Ga0501076_0146625 3300049592 Unclassified 1919
872 Ga0501076_0900523 3300049592 Bacteria 729
873 Ga0501077_0060531 3300049593 Bacteria 2403
874 Ga0501077_0081607 3300049593 Bacteria 2049
875 Ga0501077_0095471 3300049593 Bacteria 1885
876 Ga0501077_0112247 3300049593 Bacteria 1728
877 Ga0501077_0151523 3300049593 Bacteria 1471
878 Ga0501077_0209030 3300049593 Bacteria 1240
879 Ga0501077_0303976 3300049593 Unclassified 1016
880 Ga0501217_052058 3300049661 Bacteria 1073
881 Ga0501233_114167 3300049668 Bacteria 725
882 Ga0501235_050633 3300049669 Bacteria 962
883 Ga0501249_062406 3300049679 Bacteria 864
884 Ga0501079_0083910 3300049741 Bacteria 2465
885 Ga0501079_0089319 3300049741 Unclassified 2386
886 Ga0501079_0134050 3300049741 Bacteria 1928
887 Ga0501079_0223881 3300049741 Bacteria 1470
888 Ga0501079_0918925 3300049741 Bacteria 689
889 Ga0501080_0264871 3300049742 Unclassified 1565
890 Ga0501080_0416853 3300049742 Unclassified 1207
891 Ga0501080_0623670 3300049742 Unclassified 956
892 Ga0501081_0034164 3300049743 Bacteria 3458
893 Ga0501081_0146534 3300049743 Bacteria 1694
894 Ga0501081_0164793 3300049743 Bacteria 1598
895 Ga0501081_0218588 3300049743 Bacteria 1385
896 Ga0501081_0356049 3300049743 Bacteria 1079
897 Ga0501283_003238 3300049779 Bacteria 2145
898 Ga0501045_0011917 3300049824 Bacteria 6112
899 Ga0501045_0016597 3300049824 Bacteria 5232
900 Ga0501045_0059542 3300049824 Bacteria 2798
901 Ga0501045_0105904 3300049824 Bacteria 2084
902 Ga0501045_0459566 3300049824 Unclassified 946
903 Ga0501045_0568929 3300049824 Unclassified 840
904 Ga0501045_0658475 3300049824 Bacteria 774
905 nmdc:mga0k408_237677_c1 3300050493 Bacteria 1088
906 nmdc:mga04h51_83255_c1 3300050495 Unclassified 1139
907 nmdc:mga05p37_100228_c1 3300050507 Bacteria 3567
908 nmdc:mga05p37_1249134_c1 3300050507 Unclassified 762
909 nmdc:mga05p37_148785_c1 3300050507 Unclassified 2866
910 nmdc:mga05p37_177116_c1 3300050507 Bacteria 2597
911 nmdc:mga05p37_288326_c1 3300050507 Bacteria 1955
912 nmdc:mga05p37_316913_c1 3300050507 Bacteria 1847
913 nmdc:mga05p37_324428_c1 3300050507 Bacteria 1821
914 nmdc:mga05p37_35152_c1 3300050507 Bacteria 6143
915 nmdc:mga05p37_43177_c1 3300050507 Bacteria 5544
916 nmdc:mga05p37_479417_c1 3300050507 Bacteria 1433
917 nmdc:mga05p37_56964_c1 3300050507 Bacteria 4813
918 nmdc:mga05p37_95962_c1 3300050507 Bacteria 3653
919 nmdc:mga09592_15439_c1 3300050508 Bacteria 6240
920 nmdc:mga09592_168275_c1 3300050508 Bacteria 1895
921 nmdc:mga09592_3831_c2 3300050508 Bacteria 1556
922 nmdc:mga09592_407036_c1 3300050508 Unclassified 1176
923 nmdc:mga09592_434338_c1 3300050508 Bacteria 1133
924 nmdc:mga09592_590721_c1 3300050508 Unclassified 952
925 nmdc:mga09592_62980_c2 3300050508 Bacteria 2358
926 nmdc:mga09592_9292_c1 3300050508 Bacteria 7993
927 nmdc:mga09592_96537_c1 3300050508 Bacteria 2528
928 nmdc:mga0qj67_108237_c1 3300050509 Bacteria 2242
929 nmdc:mga0qj67_143990_c1 3300050509 Bacteria 1933
930 nmdc:mga0qj67_194532_c1 3300050509 Bacteria 1648
931 nmdc:mga0qj67_29223_c1 3300050509 Bacteria 4281
932 nmdc:mga0qj67_36211_c1 3300050509 Unclassified 3860
933 nmdc:mga0qj67_3819_c1 3300050509 Bacteria 10882
934 nmdc:mga0qj67_38924_c1 3300050509 Bacteria 3732
935 nmdc:mga0qj67_41808_c1 3300050509 Bacteria 3607
936 nmdc:mga0qj67_485026_c1 3300050509 Bacteria 994
937 nmdc:mga0qj67_560048_c1 3300050509 Unclassified 916
938 nmdc:mga0qj67_74646_c1 3300050509 Bacteria 2710
939 nmdc:mga0qj67_7911_c1 3300050509 Bacteria 7857
940 nmdc:mga06r32_109719_c1 3300050510 Bacteria 2714
941 nmdc:mga06r32_11429_c1 3300050510 Bacteria 7996
942 nmdc:mga06r32_131_c1 3300050510 Bacteria 54857
943 nmdc:mga06r32_146201_c1 3300050510 Bacteria 2341
944 nmdc:mga06r32_14691_c1 3300050510 Bacteria 7106
945 nmdc:mga06r32_15843_c1 3300050510 Bacteria 6856
946 nmdc:mga06r32_176409_c1 3300050510 Bacteria 2122
947 nmdc:mga06r32_301717_c1 3300050510 Bacteria 1588
948 nmdc:mga06r32_47936_c1 3300050510 Bacteria 4083
949 nmdc:mga06r32_485389_c1 3300050510 Unclassified 1213
950 nmdc:mga06r32_71981_c1 3300050510 Bacteria 3347
951 nmdc:mga08y16_104311_c1 3300050511 Unclassified 2951
952 nmdc:mga08y16_13114_c1 3300050511 Bacteria 8719
953 nmdc:mga08y16_145655_c1 3300050511 Bacteria 2462
954 nmdc:mga08y16_179343_c1 3300050511 Bacteria 2199
955 nmdc:mga08y16_1905_c1 3300050511 Bacteria 21266
956 nmdc:mga08y16_192796_c1 3300050511 Bacteria 2113
957 nmdc:mga08y16_251815_c1 3300050511 Bacteria 1825
958 nmdc:mga08y16_326339_c1 3300050511 Bacteria 1579
959 nmdc:mga08y16_38524_c1 3300050511 Bacteria 5020
960 nmdc:mga08y16_3907_c1 3300050511 Bacteria 15523
961 nmdc:mga08y16_392030_c1 3300050511 Bacteria 1422
962 nmdc:mga08y16_4224_c1 3300050511 Bacteria 14984
963 nmdc:mga08y16_584136_c1 3300050511 Unclassified 1128
964 nmdc:mga08y16_70825_c1 3300050511 Bacteria 3634
965 nmdc:mga08y16_754908_c1 3300050511 Unclassified 969
966 nmdc:mga08y16_870_c1 3300050511 Bacteria 29078
967 nmdc:mga08y16_87742_c1 3300050511 Bacteria 3241
968 nmdc:mga0n895_14363_c1 3300050512 Bacteria 7189
969 nmdc:mga0n895_17667_c1 3300050512 Bacteria 6581
970 nmdc:mga0n895_242253_c1 3300050512 Bacteria 1830
971 nmdc:mga0n895_617510_c1 3300050512 Bacteria 1085
972 nmdc:mga0n895_706414_c1 3300050512 Bacteria 1004
973 nmdc:mga0n895_81891_c1 3300050512 Bacteria 3217
974 nmdc:mga0n895_853_c1 3300050512 Bacteria 21925
975 nmdc:mga0n895_893862_c1 3300050512 Unclassified 874
976 nmdc:mga0rr50_14010_c1 3300050513 Bacteria 5242
977 nmdc:mga0rr50_442457_c1 3300050513 Unclassified 1101
978 nmdc:mga0rr50_708_c1 3300050513 Bacteria 17916
979 nmdc:mga08x19_474657_c1 3300050514 Bacteria 881
980 nmdc:mga08x19_532939_c1 3300050514 Bacteria 830
981 nmdc:mga0a205_28284_c1 3300050515 Bacteria 5359
982 nmdc:mga0a205_3251_c1 3300050515 Bacteria 14453
983 nmdc:mga0a205_364_c1 3300050515 Bacteria 34166
984 nmdc:mga0a205_371220_c1 3300050515 Bacteria 1297
985 nmdc:mga0a205_442450_c1 3300050515 Bacteria 1160
986 nmdc:mga0a205_452111_c1 3300050515 Bacteria 1144
987 nmdc:mga0a205_716_c1 3300050515 Bacteria 26671
988 nmdc:mga0a205_7877_c1 3300050515 Bacteria 9675
989 nmdc:mga0a205_82172_c1 3300050515 Bacteria 3112
990 nmdc:mga0a205_853044_c1 3300050515 Unclassified 758
991 nmdc:mga0a205_85783_c1 3300050515 Bacteria 3041
992 Ga0495619_0051296 3300053085 Bacteria 2726
993 Ga0500628_018612 3300053129 Bacteria 1372
994 Ga0500568_0007886 3300053139 Bacteria 5185
995 Ga0501084_0016687 3300054114 Bacteria 6098
996 Ga0501084_0044158 3300054114 Bacteria 3730
997 Ga0501084_0048485 3300054114 Unclassified 3556
998 Ga0501084_0108099 3300054114 Bacteria 2337
999 Ga0501084_0147352 3300054114 Bacteria 1983
1000 Ga0501084_0341850 3300054114 Bacteria 1264
1001 Ga0590071_003406 3300059421 Bacteria 3907
1002 Ga0590071_021699 3300059421 Bacteria 1514
1003 Ga0590071_036894 3300059421 Unclassified 1172
1004 Ga0590074_004818 3300059423 Unclassified 2227
1005 Ga0590075_001538 3300059424 Bacteria 5735
1006 Ga0590075_002346 3300059424 Bacteria 4543
1007 Ga0590075_024933 3300059424 Bacteria 1502
1008 Ga0590075_094507 3300059424 Unclassified 777
1009 Ga0590077_002809 3300059426 Bacteria 3664
1010 Ga0590077_003334 3300059426 Unclassified 3338
1011 Ga0590077_003484 3300059426 Unclassified 3255
1012 Ga0590077_019168 3300059426 Unclassified 1448
1013 Ga0590077_106390 3300059426 Bacteria 658
1014 Ga0501082_0044544 3300060353 Bacteria 3827
1015 Ga0501082_0092448 3300060353 Bacteria 2613
1016 Ga0501082_0095163 3300060353 Unclassified 2574
1017 Ga0501082_0161393 3300060353 Bacteria 1948
1018 Ga0501082_0351314 3300060353 Unclassified 1285
1019 Ga0501082_0408592 3300060353 Bacteria 1185
1020 Ga0530510_0004166 3300061734 Bacteria 9982
1021 Ga0530510_0010767 3300061734 Bacteria 6418
1022 Ga0530510_0234866 3300061734 Bacteria 1364
1023 Ga0530510_0504751 3300061734 Unclassified 917
1024 Ga0501034_0061284
1025 SwRhRL2b_contig_665754
1026 JGI24747J21853_1016190
1027 JGI24033J26618_1025026
1028 JGI25406J46586_10000294
1029 JGI25406J46586_10000986
1030 Ga0065714_10247501
1031 Ga0065704_10114904
1032 Ga0065704_10281613
1033 Ga0065712_10018091
1034 Ga0065712_10123258
1035 Ga0065712_10151892
1036 Ga0065712_10333823
1037 Ga0065715_10031998
1038 Ga0065715_10107556
1039 Ga0065715_10113799
1040 Ga0065715_10209470
1041 Ga0065715_10217979
1042 Ga0065715_10279035
1043 Ga0065715_10396681
1044 Ga0065715_10420523
1045 Ga0065707_10010865
1046 Ga0065707_10088138
1047 Ga0065707_10120748
1048 Ga0065707_10157504
1049 Ga0065707_10167893
1050 Ga0065707_10273109
1051 Ga0070658_10114194
1052 Ga0070658_10368557
1053 Ga0070676_10006091
1054 Ga0070676_10026824
1055 Ga0070676_10183246
1056 Ga0070676_10289423
1057 Ga0070676_10543392
1058 Ga0070676_10838475
1059 Ga0070683_100003901
1060 Ga0070690_100001694
1061 Ga0070690_100003813
1062 Ga0070690_100051668
1063 Ga0070690_100086429
1064 Ga0070690_100140443
1065 Ga0070670_100000644
1066 Ga0070670_100001817
1067 Ga0070670_100014370
1068 Ga0070670_100044828
1069 Ga0070670_100053236
1070 Ga0070670_100059351
1071 Ga0070670_100093296
1072 Ga0070670_100173064
1073 Ga0070670_100404859
1074 Ga0070670_100462216
1075 Ga0070670_100738051
1076 Ga0070677_10072655
1077 Ga0068869_100006400
1078 Ga0068869_100008797
1079 Ga0068869_100307645
1080 Ga0070666_10012227
1081 Ga0070680_100048144
1082 Ga0070680_100240054
1083 Ga0068868_100005247
1084 Ga0068868_100811449
1085 Ga0070660_100308979
1086 Ga0070689_100008841
1087 Ga0070689_100015730
1088 Ga0070689_100036010
1089 Ga0070689_100085044
1090 Ga0070689_100158001
1091 Ga0070691_10012980
1092 Ga0070691_10105579
1093 Ga0070691_10276720
1094 Ga0070687_100012617
1095 Ga0070687_100085812
1096 Ga0070687_100106122
1097 Ga0070661_100021506
1098 Ga0070661_100148673
1099 Ga0070692_10047054
1100 Ga0070692_10055105
1101 Ga0070668_100101595
1102 Ga0070668_100190584
1103 Ga0070668_100356081
1104 Ga0070669_100000352
1105 Ga0070669_100002995
1106 Ga0070669_100003511
1107 Ga0070669_100007795
1108 Ga0070669_100135596
1109 Ga0070675_100000344
1110 Ga0070675_100001225
1111 Ga0070675_100015999
1112 Ga0070675_100040449
1113 Ga0070675_100046420
1114 Ga0070675_100051999
1115 Ga0070675_100078904
1116 Ga0070675_100096752
1117 Ga0070675_100107257
1118 Ga0070675_100147648
1119 Ga0070675_100198542
1120 Ga0070675_100279820
1121 Ga0070675_100288051
1122 Ga0070675_100559351
1123 Ga0070675_100583415
1124 Ga0070671_100005852
1125 Ga0070671_100025327
1126 Ga0070671_100132333
1127 Ga0070671_100206255
1128 Ga0070671_100245625
1129 Ga0070671_100264834
1130 Ga0070671_101225267
1131 Ga0070674_100000032
1132 Ga0070674_100065943
1133 Ga0070674_100094474
1134 Ga0070674_100344898
1135 Ga0070674_100767156
1136 Ga0070673_100005865
1137 Ga0070673_100018607
1138 Ga0070673_100038899
1139 Ga0070673_100044900
1140 Ga0070673_100074580
1141 Ga0070673_100121723
1142 Ga0070673_100122768
1143 Ga0070673_100126263
1144 Ga0070673_100340711
1145 Ga0070673_100570169
1146 Ga0070673_100630666
1147 Ga0070688_100004122
1148 Ga0070688_100010066
1149 Ga0070688_100026806
1150 Ga0070688_100067688
1151 Ga0070688_100203701
1152 Ga0070688_100575593
1153 Ga0070659_100071938
1154 Ga0070659_100202365
1155 Ga0070659_100400919
1156 Ga0070659_101165032
1157 Ga0070667_100004553
1158 Ga0070667_100181154
1159 Ga0070667_100230039
1160 Ga0070701_10016046
1161 Ga0070701_10028224
1162 Ga0070701_10044835
1163 Ga0070701_10091089
1164 Ga0070701_10365800
1165 Ga0070701_10401311
1166 Ga0070705_100045277
1167 Ga0070700_100011308
1168 Ga0070700_100015815
1169 Ga0070700_100172282
1170 Ga0070700_100255079
1171 Ga0070700_100461372
1172 Ga0070700_100518919
1173 Ga0070700_100585954
1174 Ga0070694_100005351
1175 Ga0070694_100019818
1176 Ga0070694_100161786
1177 Ga0070694_100315946
1178 Ga0070694_100505890
1179 Ga0070708_100033179
1180 Ga0070708_100440545
1181 Ga0070663_100630033
1182 Ga0070678_100010447
1183 Ga0070678_100075817
1184 Ga0070678_100127762
1185 Ga0070678_100201860
1186 Ga0070678_100349821
1187 Ga0070678_100355662
1188 Ga0070678_100422538
1189 Ga0070678_100704582
1190 Ga0070662_100025031
1191 Ga0070662_100083347
1192 Ga0070681_10013937
1193 Ga0070681_10422631
1194 Ga0068867_100000578
1195 Ga0068867_100003034
1196 Ga0068867_100306192
1197 Ga0068867_100492198
1198 Ga0070685_10008790
1199 Ga0070685_10071359
1200 Ga0070685_10129722
1201 Ga0070685_10184773
1202 Ga0070707_100393877
1203 Ga0070707_100492910
1204 Ga0070698_100001133
1205 Ga0070698_100028550
1206 Ga0070698_100123513
1207 Ga0070699_100000125
1208 Ga0070699_100003725
1209 Ga0070699_100009237
1210 Ga0070699_100197148
1211 Ga0070699_100237143
1212 Ga0070679_100117892
1213 Ga0070679_100556185
1214 Ga0070684_100003179
1215 Ga0070684_100285614
1216 Ga0070697_100132162
1217 Ga0070672_100011456
1218 Ga0070672_100015090
1219 Ga0070672_100041580
1220 Ga0070672_100074302
1221 Ga0070672_100122884
1222 Ga0070672_100147177
1223 Ga0070672_100265361
1224 Ga0070672_100503702
1225 Ga0070686_100019164
1226 Ga0070686_100026404
1227 Ga0070695_100000040
1228 Ga0070696_100003923
1229 Ga0070696_100021687
1230 Ga0070696_100097530
1231 Ga0070696_100151636
1232 Ga0070665_100080658
1233 Ga0070665_100249408
1234 Ga0070665_100922721
1235 Ga0070704_100001122
1236 Ga0070704_100009716
1237 Ga0070704_100053324
1238 Ga0070704_100272105
1239 Ga0070704_100366880
1240 Ga0070704_100895486
1241 Ga0070664_100000148
1242 Ga0070664_100005128
1243 Ga0070664_100007452
1244 Ga0070664_100018814
1245 Ga0070664_100043757
1246 Ga0070664_100052925
1247 Ga0070664_100273188
1248 Ga0068857_100044893
1249 Ga0068857_100126514
1250 Ga0068857_100197516
1251 Ga0070702_100061053
1252 Ga0068852_100073870
1253 Ga0068852_100150952
1254 Ga0068859_100038979
1255 Ga0068859_100045507
1256 Ga0068859_100137809
1257 Ga0068859_100443376
1258 Ga0068859_100557033
1259 Ga0068864_100011950
1260 Ga0068864_100051851
1261 Ga0068864_100054976
1262 Ga0068864_100162577
1263 Ga0068864_100184566
1264 Ga0068864_100186387
1265 Ga0068864_100208716
1266 Ga0068861_100001827
1267 Ga0068861_100019586
1268 Ga0068861_100058079
1269 Ga0068861_100172744
1270 Ga0068861_101393185
1271 Ga0068851_10008626
1272 Ga0068870_10002627
1273 Ga0068870_10014812
1274 Ga0068870_10038443
1275 Ga0068870_10044385
1276 Ga0068870_10046467
1277 Ga0068870_10057744
1278 Ga0068870_10066603
1279 Ga0068870_10169917
1280 Ga0068870_10194188
1281 Ga0068870_10243202
1282 Ga0068863_100006263
1283 Ga0068863_100033097
1284 Ga0068863_101093613
1285 Ga0068858_100122126
1286 Ga0068860_100010069
1287 Ga0068860_100072348
1288 Ga0068860_100795668
1289 Ga0068860_100808236
1290 Ga0068862_100001109
1291 Ga0068862_100003727
1292 Ga0068862_100268326
1293 Ga0081538_10064933
1294 Ga0081539_10000013
1295 Ga0081539_10000164
1296 Ga0081539_10000750
1297 Ga0081539_10146462
1298 Ga0070712_100542470
1299 Ga0075367_10240853
1300 Ga0075366_10043226
1301 Ga0097621_100365689
1302 Ga0097621_100673514
1303 Ga0068871_100391705
1304 Ga0075428_100000166
1305 Ga0075428_100001819
1306 Ga0075428_100024456
1307 Ga0075428_100027623
1308 Ga0075428_100037413
1309 Ga0075428_100043905
1310 Ga0075428_100189984
1311 Ga0075430_100000691
1312 Ga0075430_100002729
1313 Ga0075430_100003225
1314 Ga0075430_100012246
1315 Ga0075430_100024978
1316 Ga0075430_100042806
1317 Ga0075430_100069874
1318 Ga0075430_100150894
1319 Ga0075431_100001885
1320 Ga0075431_100003049
1321 Ga0075431_100024090
1322 Ga0075431_100050956
1323 Ga0075431_100099856
1324 Ga0075431_100100747
1325 Ga0075431_100109384
1326 Ga0075431_100193645
1327 Ga0075431_100201330
1328 Ga0075433_10000037
1329 Ga0075433_10003070
1330 Ga0075433_10004340
1331 Ga0075433_10023808
1332 Ga0075433_10089514
1333 Ga0075433_10127240
1334 Ga0075433_10131648
1335 Ga0075433_10143129
1336 Ga0075433_11088439
1337 Ga0075434_100000596
1338 Ga0075434_100008215
1339 Ga0075434_100008506
1340 Ga0075434_100050899
1341 Ga0075434_100069126
1342 Ga0075434_100087618
1343 Ga0075434_100099792
1344 Ga0075434_100177461
1345 Ga0075434_100649634
1346 Ga0075429_100007109
1347 Ga0075429_100008984
1348 Ga0075429_100013970
1349 Ga0075429_100015410
1350 Ga0075429_100017078
1351 Ga0075429_100036691
1352 Ga0075429_100045136
1353 Ga0075429_100110464
1354 Ga0075429_100334755
1355 Ga0068865_100121774
1356 Ga0068865_100336926
1357 Ga0068865_100382069
1358 Ga0097620_100038978
1359 Ga0097620_100045507
1360 Ga0097620_100137816
1361 Ga0097620_100443381
1362 Ga0097620_100557043
1363 Ga0075435_100008907
1364 Ga0075435_100040076
1365 Ga0075435_100059310
1366 Ga0075435_100076598
1367 Ga0075435_100156436
1368 Ga0111539_10000417
1369 Ga0111539_10001302
1370 Ga0111539_10002820
1371 Ga0111539_10004794
1372 Ga0111539_10009006
1373 Ga0111539_10024939
1374 Ga0111539_10030202
1375 Ga0111539_10030843
1376 Ga0111539_10038640
1377 Ga0111539_10052383
1378 Ga0111539_10067881
1379 Ga0111539_10124907
1380 Ga0111539_10180891
1381 Ga0111539_10196209
1382 Ga0111539_10197680
1383 Ga0111539_10298677
1384 Ga0111539_10484475
1385 Ga0111539_11227306
1386 Ga0105245_11006823
1387 Ga0105247_10305987
1388 Ga0114129_10002975
1389 Ga0114129_10009556
1390 Ga0114129_10014604
1391 Ga0114129_10016193
1392 Ga0114129_10017991
1393 Ga0114129_10034099
1394 Ga0114129_10051085
1395 Ga0114129_10087982
1396 Ga0114129_10126859
1397 Ga0114129_10221915
1398 Ga0114129_10253111
1399 Ga0114129_10336628
1400 Ga0114129_10419849
1401 Ga0114129_10519672
1402 Ga0114129_10761375
1403 Ga0114129_10772112
1404 Ga0114129_10955340
1405 Ga0105243_10428257
1406 Ga0105243_10566958
1407 Ga0105241_10593998
1408 Ga0105242_10034278
1409 Ga0105248_10007336
1410 Ga0105248_10072756
1411 Ga0105248_10267833
1412 Ga0105248_10696084
1413 Ga0105248_10976953
1414 Ga0105237_10681195
1415 Ga0105238_10082062
1416 Ga0105238_10094814
1417 Ga0105249_10000496
1418 Ga0105249_10017545
1419 Ga0105249_10020989
1420 Ga0105249_10592014
1421 Ga0105249_11756793
1422 Ga0105239_10941252
1423 Ga0105246_10044988
1424 Ga0105246_10304387
1425 Ga0105246_10526460
1426 Ga0157369_10801470
1427 Ga0157374_10031858
1428 Ga0163162_10017321
1429 Ga0163162_10265323
1430 Ga0163162_11491075
1431 Ga0163162_11559233
1432 Ga0157372_10370636
1433 Ga0157375_10019096
1434 Ga0157375_10043578
1435 Ga0157375_10066024
1436 Ga0157375_10194814
1437 Ga0157375_10252731
1438 Ga0157375_10259872
1439 Ga0157375_10272919
1440 Ga0157375_10549733
1441 Ga0163163_10011152
1442 Ga0163163_10029067
1443 Ga0163163_10162135
1444 Ga0163163_10213548
1445 Ga0163163_10245687
1446 Ga0163163_10292812
1447 Ga0163163_10698946
1448 Ga0157380_10003180
1449 Ga0157380_10015256
1450 Ga0157380_10016604
1451 Ga0157380_10022211
1452 Ga0157380_10079271
1453 Ga0157380_10413414
1454 Ga0157380_10549522
1455 Ga0157380_11070202
1456 Ga0157377_10006987
1457 Ga0157377_10041577
1458 Ga0157377_10110576
1459 Ga0157377_10145029
1460 Ga0157377_10149526
1461 Ga0157377_10296308
1462 Ga0157377_10371781
1463 Ga0157379_10079801
1464 Ga0157379_10213250
1465 Ga0157376_10212523
1466 Ga0157376_10701899
1467 Ga0157376_10912589
1468 Ga0163161_10011768
1469 Ga0163161_10321554
1470 Ga0207697_10002286
1471 Ga0207697_10215211
1472 Ga0207656_10027013
1473 Ga0207653_10059348
1474 Ga0207682_10016527
1475 Ga0207682_10028422
1476 Ga0207682_10091143
1477 Ga0207682_10102323
1478 Ga0207682_10133875
1479 Ga0207642_10079247
1480 Ga0207688_10001096
1481 Ga0207688_10108235
1482 Ga0207688_10129870
1483 Ga0207688_10368634
1484 Ga0207680_10070281
1485 Ga0207645_10015770
1486 Ga0207645_10016759
1487 Ga0207645_10021862
1488 Ga0207645_10099872
1489 Ga0207645_10627436
1490 Ga0207643_10000068
1491 Ga0207643_10001752
1492 Ga0207643_10022482
1493 Ga0207643_10041294
1494 Ga0207643_10047583
1495 Ga0207643_10060452
1496 Ga0207643_10150709
1497 Ga0207643_10200442
1498 Ga0207643_10242028
1499 Ga0207707_10035368
1500 Ga0207660_10105737
1501 Ga0207660_10134957
1502 Ga0207660_10394855
1503 Ga0207660_10765252
1504 Ga0207662_10025819
1505 Ga0207662_10034280
1506 Ga0207662_10108606
1507 Ga0207662_10112090
1508 Ga0207657_10324807
1509 Ga0207649_10034702
1510 Ga0207649_10114936
1511 Ga0207646_10104242
1512 Ga0207646_10529475
1513 Ga0207646_10706812
1514 Ga0207681_10002615
1515 Ga0207681_10019010
1516 Ga0207681_10026977
1517 Ga0207681_10028232
1518 Ga0207681_10137821
1519 Ga0207681_10169098
1520 Ga0207681_10341324
1521 Ga0207681_10389739
1522 Ga0207650_10021293
1523 Ga0207650_10052489
1524 Ga0207650_10053705
1525 Ga0207650_10213391
1526 Ga0207650_10402003
1527 Ga0207650_10520715
1528 Ga0207650_10546151
1529 Ga0207650_10734295
1530 Ga0207659_10000110
1531 Ga0207659_10005807
1532 Ga0207659_10023192
1533 Ga0207659_10026708
1534 Ga0207659_10042416
1535 Ga0207659_10082161
1536 Ga0207659_10085597
1537 Ga0207659_10086904
1538 Ga0207659_10089349
1539 Ga0207659_10113839
1540 Ga0207659_10127384
1541 Ga0207659_10335653
1542 Ga0207659_10677510
1543 Ga0207687_10310809
1544 Ga0207644_10004633
1545 Ga0207644_10019278
1546 Ga0207644_10192590
1547 Ga0207644_10420181
1548 Ga0207644_10537453
1549 Ga0207690_10321108
1550 Ga0207690_10691547
1551 Ga0207690_10878034
1552 Ga0207706_10016248
1553 Ga0207706_10046751
1554 Ga0207706_10048140
1555 Ga0207706_10098856
1556 Ga0207706_10147846
1557 Ga0207706_10584608
1558 Ga0207706_10833404
1559 Ga0207686_10114249
1560 Ga0207709_10169376
1561 Ga0207670_10011792
1562 Ga0207670_10018839
1563 Ga0207670_10083112
1564 Ga0207670_10097115
1565 Ga0207670_10306541
1566 Ga0207669_10001301
1567 Ga0207669_10071687
1568 Ga0207669_10099513
1569 Ga0207669_10237112
1570 Ga0207669_10475630
1571 Ga0207669_10655154
1572 Ga0207704_10012641
1573 Ga0207704_10202139
1574 Ga0207691_10007798
1575 Ga0207691_10017127
1576 Ga0207691_10017705
1577 Ga0207691_10045785
1578 Ga0207691_10046220
1579 Ga0207691_10069784
1580 Ga0207691_10132536
1581 Ga0207691_10412078
1582 Ga0207711_10244546
1583 Ga0207689_10002433
1584 Ga0207689_10115367
1585 Ga0207689_10127586
1586 Ga0207689_10198399
1587 Ga0207689_10239102
1588 Ga0207689_10455305
1589 Ga0207661_10016888
1590 Ga0207679_10014223
1591 Ga0207679_10086139
1592 Ga0207679_10285694
1593 Ga0207679_10375687
1594 Ga0207679_10427760
1595 Ga0207679_10538086
1596 Ga0207667_10200058
1597 Ga0207651_10008346
1598 Ga0207651_10186860
1599 Ga0207651_10305958
1600 Ga0207651_10435204
1601 Ga0207651_10676011
1602 Ga0207651_10684402
1603 Ga0207712_10025490
1604 Ga0207712_10039875
1605 Ga0207712_10055246
1606 Ga0207668_10105509
1607 Ga0207668_10119512
1608 Ga0207668_10320938
1609 Ga0207668_10522926
1610 Ga0207658_10058312
1611 Ga0207658_10502681
1612 Ga0207658_10645992
1613 Ga0207677_10046533
1614 Ga0207677_10303187
1615 Ga0207703_10021444
1616 Ga0207703_10058689
1617 Ga0207678_10055838
1618 Ga0207678_10340084
1619 Ga0207708_10004225
1620 Ga0207708_10057295
1621 Ga0207708_10107834
1622 Ga0207708_10124297
1623 Ga0207708_10137155
1624 Ga0207708_10232409
1625 Ga0207708_10579767
1626 Ga0207708_10611706
1627 Ga0207641_10132212
1628 Ga0207641_10391215
1629 Ga0207641_10847180
1630 Ga0207641_11274443
1631 Ga0207648_10000819
1632 Ga0207648_10001252
1633 Ga0207648_10022354
1634 Ga0207648_10071091
1635 Ga0207648_10291346
1636 Ga0207648_10378775
1637 Ga0207676_10007332
1638 Ga0207676_10062815
1639 Ga0207676_10077581
1640 Ga0207676_10114216
1641 Ga0207676_10188865
1642 Ga0207676_10191663
1643 Ga0207676_10321376
1644 Ga0207676_10404630
1645 Ga0207676_10471932
1646 Ga0207676_10804405
1647 Ga0207674_10017892
1648 Ga0207674_10024953
1649 Ga0207674_10032779
1650 Ga0207674_10108560
1651 Ga0207675_100004144
1652 Ga0207675_100016115
1653 Ga0207675_100018571
1654 Ga0207675_100069758
1655 Ga0207675_100110317
1656 Ga0207675_100170783
1657 Ga0207675_100213871
1658 Ga0207675_100256035
1659 Ga0207675_100570392
1660 Ga0207683_10025432
1661 Ga0207683_10044173
1662 Ga0207683_10068234
1663 Ga0207683_10071905
1664 Ga0207683_10177511
1665 Ga0207683_10225896
1666 Ga0207683_10340210
1667 Ga0207683_10352610
1668 Ga0207683_10476279
1669 Ga0207698_10083322
1670 Ga0207698_10112568
1671 Ga0207698_10264793
1672 Ga0209971_1058086
1673 Ga0209998_10072928
1674 Ga0207428_10000444
1675 Ga0207428_10000579
1676 Ga0207428_10001202
1677 Ga0207428_10009371
1678 Ga0207428_10009973
1679 Ga0207428_10010085
1680 Ga0207428_10013310
1681 Ga0207428_10163848
1682 Ga0207428_10571661
1683 Ga0268266_10234565
1684 Ga0268265_10009133
1685 Ga0268265_10009470
1686 Ga0268265_10077218
1687 Ga0268265_10114577
1688 Ga0268265_10257985
1689 Ga0268265_10444707
1690 Ga0268265_10530377
1691 Ga0268264_10175933
1692 Ga0268264_10496856
1693 Ga0268264_10832976
1694 Ga0268264_10942761
1695 Ga0307408_100033443
1696 Ga0307408_100041164
1697 Ga0307408_100100399
1698 Ga0307408_100133473
1699 Ga0307408_100249243
1700 Ga0307408_100691489
1701 Ga0307408_100982483
1702 Ga0307405_10004150
1703 Ga0307405_10009507
1704 Ga0307405_10023443
1705 Ga0307405_10300797
1706 Ga0307413_10054896
1707 Ga0307413_10145030
1708 Ga0307413_10176393
1709 Ga0307410_10029791
1710 Ga0307410_10034128
1711 Ga0307410_10105343
1712 Ga0307410_10193621
1713 Ga0307406_10214292
1714 Ga0307406_10235134
1715 Ga0307406_10517310
1716 Ga0307406_10791688
1717 Ga0307407_10016077
1718 Ga0307407_10033768
1719 Ga0307407_10050719
1720 Ga0307407_10116043
1721 Ga0307407_10256541
1722 Ga0307412_10017157
1723 Ga0307412_10205313
1724 Ga0307412_10225940
1725 Ga0307412_10315409
1726 Ga0307409_100009500
1727 Ga0307409_100044458
1728 Ga0307409_100089661
1729 Ga0307409_100179226
1730 Ga0307409_100450497
1731 Ga0307409_100496372
1732 Ga0307409_100718258
1733 Ga0307416_100004049
1734 Ga0307416_100058498
1735 Ga0307416_100113240
1736 Ga0307416_100173601
1737 Ga0307416_100271118
1738 Ga0307416_100634114
1739 Ga0307416_100995095
1740 Ga0307416_101136280
1741 Ga0307414_10047970
1742 Ga0307414_10198742
1743 Ga0307414_10433969
1744 Ga0307411_10004853
1745 Ga0307411_10074597
1746 Ga0307411_10157571
1747 Ga0307411_10490039
1748 Ga0307411_10492145
1749 Ga0307411_10600396
1750 Ga0307411_10716201
1751 Ga0307415_100001761
1752 Ga0307415_100046867
1753 Ga0307415_100121042
1754 Ga0307415_100152219
1755 Ga0373958_0044029
1756 Ga0373926_0097374
1757 Ga0373952_0154904
1758 Ga0373939_0034593
1759 Ga0373956_0240059
1760 Ga0373946_0060895
1761 Ga0373935_0102913
1762 Ga0373947_0014643
1763 Ga0451804_0124480
1764 Ga0439431_0024900
1765 Ga0439445_0024004
1766 Ga0439450_052463
1767 Ga0439457_011164
1768 Ga0439446_0010681
1769 Ga0439446_0013029
1770 Ga0450908_013869
1771 Ga0439434_0017808
1772 Ga0439434_0058163
1773 Ga0439434_0113264
1774 Ga0439435_0002693
1775 Ga0439444_0030150
1776 Ga0439464_0054302
1777 Ga0439460_0102776
1778 Ga0450916_041881
1779 Ga0451577_0144334
1780 Ga0439440_0028921
1781 Ga0453683_0068182
1782 Ga0453683_0233505
1783 Ga0451576_0029314
1784 Ga0451576_0052136
1785 Ga0451576_0293720
1786 Ga0466967_0905132
1787 Ga0495603_0007270
1788 Ga0495603_0015606
1789 Ga0495603_0152687
1790 Ga0495629_0005621
1791 Ga0495641_0066192
1792 Ga0495580_0193844
1793 Ga0495584_0014186
1794 Ga0495584_0136411
1795 Ga0495585_0313212
1796 Ga0495594_0107756
1797 Ga0495594_0111329
1798 Ga0495594_0350148
1799 Ga0495637_0094252
1800 Ga0495643_0003465
1801 Ga0495644_0111529
1802 Ga0495663_0013360
1803 Ga0495642_0021843
1804 Ga0495642_0064419
1805 Ga0495609_0031275
1806 Ga0495621_0000608
1807 Ga0495621_0031934
1808 Ga0495621_0032773
1809 Ga0495621_0086482
1810 Ga0495621_0142607
1811 Ga0495659_0011115
1812 Ga0495659_0035519
1813 Ga0495659_0047098
1814 Ga0495659_0158244
1815 Ga0495658_0066310
1816 Ga0495669_0115922
1817 Ga0495669_0239868
1818 Ga0495670_0023357
1819 Ga0495670_0119539
1820 Ga0495636_0003219
1821 Ga0495636_0005085
1822 Ga0495674_0620824
1823 Ga0495672_0042760
1824 Ga0495685_026454
1825 Ga0495685_214527
1826 Ga0495614_0089166
1827 Ga0496100_0176978
1828 Ga0496104_0017354
1829 Ga0496108_0412058
1830 Ga0496109_0018241
1831 Ga0496109_0018746
1832 Ga0496109_0222060
1833 Ga0496110_0020105
1834 Ga0496110_0398363
1835 Ga0496110_0694963
1836 Ga0496112_0326479
1837 Ga0496113_0379738
1838 Ga0496114_0545140
1839 Ga0501036_0118509
1840 Ga0501036_0438856
1841 Ga0501036_0487047
1842 Ga0501036_0676029
1843 Ga0501036_0830757
1844 Ga0501037_0181290
1845 Ga0501037_0675873
1846 Ga0501038_0151164
1847 Ga0501038_0329496
1848 Ga0501038_0379238
1849 Ga0501038_0703653
1850 Ga0501039_0071792
1851 Ga0501039_0090112
1852 Ga0501039_0103976
1853 Ga0501040_0022412
1854 Ga0501040_0184923
1855 Ga0501040_0362316
1856 Ga0501040_0435674
1857 Ga0501041_0027084
1858 Ga0501041_0029568
1859 Ga0501041_0126538
1860 Ga0501041_0303462
1861 Ga0501042_0024016
1862 Ga0501042_0078486
1863 Ga0501042_0163503
1864 Ga0501042_0733290
1865 Ga0501043_0157226
1866 Ga0501046_0187057
1867 Ga0501046_0306238
1868 Ga0501046_0358421
1869 Ga0501047_0087950
1870 Ga0501048_0087483
1871 Ga0501048_0130865
1872 Ga0501068_0052526
1873 Ga0501071_0007692
1874 Ga0501071_0067072
1875 Ga0501071_0157819
1876 Ga0501071_0395578
1877 Ga0501071_0420538
1878 Ga0501072_0012409
1879 Ga0501072_0024066
1880 Ga0501072_0024609
1881 Ga0501073_0502168
1882 Ga0501074_0295121
1883 Ga0501074_0349253
1884 Ga0501074_0546598
1885 Ga0501075_0008801
1886 Ga0501075_0026831
1887 Ga0501075_0030556
1888 Ga0501075_0365572
1889 Ga0501075_0651907
1890 Ga0501076_0008466
1891 Ga0501076_0049079
1892 Ga0501076_0056579
1893 Ga0501076_0060176
1894 Ga0501076_0146625
1895 Ga0501076_0900523
1896 Ga0501077_0060531
1897 Ga0501077_0081607
1898 Ga0501077_0095471
1899 Ga0501077_0112247
1900 Ga0501077_0151523
1901 Ga0501077_0209030
1902 Ga0501077_0303976
1903 Ga0501217_052058
1904 Ga0501233_114167
1905 Ga0501235_050633
1906 Ga0501249_062406
1907 Ga0501079_0083910
1908 Ga0501079_0089319
1909 Ga0501079_0134050
1910 Ga0501079_0223881
1911 Ga0501079_0918925
1912 Ga0501080_0264871
1913 Ga0501080_0416853
1914 Ga0501080_0623670
1915 Ga0501081_0034164
1916 Ga0501081_0146534
1917 Ga0501081_0164793
1918 Ga0501081_0218588
1919 Ga0501081_0356049
1920 Ga0501283_003238
1921 Ga0501045_0011917
1922 Ga0501045_0016597
1923 Ga0501045_0059542
1924 Ga0501045_0105904
1925 Ga0501045_0459566
1926 Ga0501045_0568929
1927 Ga0501045_0658475
1928 nmdc:mga0k408_237677_c1
1929 nmdc:mga04h51_83255_c1
1930 nmdc:mga05p37_100228_c1
1931 nmdc:mga05p37_1249134_c1
1932 nmdc:mga05p37_148785_c1
1933 nmdc:mga05p37_177116_c1
1934 nmdc:mga05p37_288326_c1
1935 nmdc:mga05p37_316913_c1
1936 nmdc:mga05p37_324428_c1
1937 nmdc:mga05p37_35152_c1
1938 nmdc:mga05p37_43177_c1
1939 nmdc:mga05p37_479417_c1
1940 nmdc:mga05p37_56964_c1
1941 nmdc:mga05p37_95962_c1
1942 nmdc:mga09592_15439_c1
1943 nmdc:mga09592_168275_c1
1944 nmdc:mga09592_3831_c2
1945 nmdc:mga09592_407036_c1
1946 nmdc:mga09592_434338_c1
1947 nmdc:mga09592_590721_c1
1948 nmdc:mga09592_62980_c2
1949 nmdc:mga09592_9292_c1
1950 nmdc:mga09592_96537_c1
1951 nmdc:mga0qj67_108237_c1
1952 nmdc:mga0qj67_143990_c1
1953 nmdc:mga0qj67_194532_c1
1954 nmdc:mga0qj67_29223_c1
1955 nmdc:mga0qj67_36211_c1
1956 nmdc:mga0qj67_3819_c1
1957 nmdc:mga0qj67_38924_c1
1958 nmdc:mga0qj67_41808_c1
1959 nmdc:mga0qj67_485026_c1
1960 nmdc:mga0qj67_560048_c1
1961 nmdc:mga0qj67_74646_c1
1962 nmdc:mga0qj67_7911_c1
1963 nmdc:mga06r32_109719_c1
1964 nmdc:mga06r32_11429_c1
1965 nmdc:mga06r32_131_c1
1966 nmdc:mga06r32_146201_c1
1967 nmdc:mga06r32_14691_c1
1968 nmdc:mga06r32_15843_c1
1969 nmdc:mga06r32_176409_c1
1970 nmdc:mga06r32_301717_c1
1971 nmdc:mga06r32_47936_c1
1972 nmdc:mga06r32_485389_c1
1973 nmdc:mga06r32_71981_c1
1974 nmdc:mga08y16_104311_c1
1975 nmdc:mga08y16_13114_c1
1976 nmdc:mga08y16_145655_c1
1977 nmdc:mga08y16_179343_c1
1978 nmdc:mga08y16_1905_c1
1979 nmdc:mga08y16_192796_c1
1980 nmdc:mga08y16_251815_c1
1981 nmdc:mga08y16_326339_c1
1982 nmdc:mga08y16_38524_c1
1983 nmdc:mga08y16_3907_c1
1984 nmdc:mga08y16_392030_c1
1985 nmdc:mga08y16_4224_c1
1986 nmdc:mga08y16_584136_c1
1987 nmdc:mga08y16_70825_c1
1988 nmdc:mga08y16_754908_c1
1989 nmdc:mga08y16_870_c1
1990 nmdc:mga08y16_87742_c1
1991 nmdc:mga0n895_14363_c1
1992 nmdc:mga0n895_17667_c1
1993 nmdc:mga0n895_242253_c1
1994 nmdc:mga0n895_617510_c1
1995 nmdc:mga0n895_706414_c1
1996 nmdc:mga0n895_81891_c1
1997 nmdc:mga0n895_853_c1
1998 nmdc:mga0n895_893862_c1
1999 nmdc:mga0rr50_14010_c1
2000 nmdc:mga0rr50_442457_c1
2001 nmdc:mga0rr50_708_c1
2002 nmdc:mga08x19_474657_c1
2003 nmdc:mga08x19_532939_c1
2004 nmdc:mga0a205_28284_c1
2005 nmdc:mga0a205_3251_c1
2006 nmdc:mga0a205_364_c1
2007 nmdc:mga0a205_371220_c1
2008 nmdc:mga0a205_442450_c1
2009 nmdc:mga0a205_452111_c1
2010 nmdc:mga0a205_716_c1
2011 nmdc:mga0a205_7877_c1
2012 nmdc:mga0a205_82172_c1
2013 nmdc:mga0a205_853044_c1
2014 nmdc:mga0a205_85783_c1
2015 Ga0495619_0051296
2016 Ga0500628_018612
2017 Ga0500568_0007886
2018 Ga0501084_0016687
2019 Ga0501084_0044158
2020 Ga0501084_0048485
2021 Ga0501084_0108099
2022 Ga0501084_0147352
2023 Ga0501084_0341850
2024 Ga0590071_003406
2025 Ga0590071_021699
2026 Ga0590071_036894
2027 Ga0590074_004818
2028 Ga0590075_001538
2029 Ga0590075_002346
2030 Ga0590075_024933
2031 Ga0590075_094507
2032 Ga0590077_002809
2033 Ga0590077_003334
2034 Ga0590077_003484
2035 Ga0590077_019168
2036 Ga0590077_106390
2037 Ga0501082_0044544
2038 Ga0501082_0092448
2039 Ga0501082_0095163
2040 Ga0501082_0161393
2041 Ga0501082_0351314
2042 Ga0501082_0408592
2043 Ga0530510_0004166
2044 Ga0530510_0010767
2045 Ga0530510_0234866
2046 Ga0530510_0504751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.8638 135 177
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.84 99 181
4zbp-assembly1.cif.gz_A crystal structure of the ampcpr-bound atnudt7 0.83 99 181
4zb3-assembly1.cif.gz_A-2 crystal structure of the apo atnudt7 0.796 99 181
4zbp-assembly2.cif.gz_C-2 crystal structure of the ampcpr-bound atnudt7 0.7856 95 181
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8777 117 180 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8638 135 177 3.30.572.10
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8262 134 179 3.40.630.30
af_Q7XUY6_156_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8074 100 181 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7972 97 179 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V8B8I8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9604 1 197
AF-A0A2V8B8I8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9557 1 197
AF-A0A2V8N1H8-F1-model_v4 GNAT family N-acetyltransferase 0.9395 1 197
AF-A0A2V8E1R3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9354 2 161
AF-A0A2V8N1H8-F1-model_v4 GNAT family N-acetyltransferase 0.9349 1 197

Map