F488333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 318 | 2036 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0095109|Ga0501080_0095109_1810_2613 |
| Length | 267 |
| Sequence | MIAVIEDVLGWRAVEAESDSHLLAPPAERALALELRDVTFGYVPGRTVLAGVDFAVRHGEFVAVAGPNGGGKTTLLRLALGLERPGSGRVLLLGDPAERCRRRKEIGYVPQRTRLGGEAPATVREVVAAGRLAQGGLFGPLRRDDRLAVEEALARVGLADRASSPLRTLSGGMQQRAFIARALAGRPSLLVLDEPTTGVDAESQESLAALLDELHRELGVTVLYVSHEFGAVEHFVQRLVLVRGGIVFDGPPSDLPGLWHDPSHAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 187 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 188 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 211 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 212 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 213 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 8.06 |
| Rhizosphere | 91.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501080_0095109 | 3300049742 | Bacteria | 2767 |
| 2 | rootL2_10099212 | 3300003322 | Bacteria | 2180 |
| 3 | Ga0070658_10004765 | 3300005327 | Bacteria | 11035 |
| 4 | Ga0070658_10086058 | 3300005327 | Bacteria | 2585 |
| 5 | Ga0070676_10026767 | 3300005328 | Bacteria | 3265 |
| 6 | Ga0070676_10167866 | 3300005328 | Bacteria | 1417 |
| 7 | Ga0070676_10179284 | 3300005328 | Bacteria | 1376 |
| 8 | Ga0070676_10293952 | 3300005328 | Bacteria | 1099 |
| 9 | Ga0070683_100005772 | 3300005329 | Bacteria | 10347 |
| 10 | Ga0070683_100012389 | 3300005329 | Bacteria | 7410 |
| 11 | Ga0070683_100065532 | 3300005329 | Bacteria | 3382 |
| 12 | Ga0070683_100103692 | 3300005329 | Bacteria | 2680 |
| 13 | Ga0070683_100135741 | 3300005329 | Bacteria | 2330 |
| 14 | Ga0070670_100031582 | 3300005331 | Bacteria | 4561 |
| 15 | Ga0070670_100084270 | 3300005331 | Bacteria | 2731 |
| 16 | Ga0068869_100010642 | 3300005334 | Bacteria | 6005 |
| 17 | Ga0068869_100031540 | 3300005334 | Bacteria | 3728 |
| 18 | Ga0070680_100005763 | 3300005336 | Bacteria | 9398 |
| 19 | Ga0070680_100008081 | 3300005336 | Bacteria | 8032 |
| 20 | Ga0070680_100010423 | 3300005336 | Bacteria | 7166 |
| 21 | Ga0070680_100297640 | 3300005336 | Bacteria | 1368 |
| 22 | Ga0070682_100002294 | 3300005337 | Bacteria | 10577 |
| 23 | Ga0070682_100049355 | 3300005337 | Bacteria | 2623 |
| 24 | Ga0070682_100510904 | 3300005337 | Bacteria | 933 |
| 25 | Ga0068868_100034864 | 3300005338 | Bacteria | 3887 |
| 26 | Ga0068868_100052010 | 3300005338 | Bacteria | 3225 |
| 27 | Ga0068868_100059253 | 3300005338 | Bacteria | 3028 |
| 28 | Ga0068868_100156836 | 3300005338 | Bacteria | 1878 |
| 29 | Ga0068868_100492841 | 3300005338 | Bacteria | 1072 |
| 30 | Ga0070660_100080234 | 3300005339 | Bacteria | 2560 |
| 31 | Ga0070660_100163102 | 3300005339 | Bacteria | 1797 |
| 32 | Ga0070660_100276745 | 3300005339 | Bacteria | 1373 |
| 33 | Ga0070660_100330238 | 3300005339 | Bacteria | 1254 |
| 34 | Ga0070689_100024563 | 3300005340 | Bacteria | 4521 |
| 35 | Ga0070689_100037506 | 3300005340 | Bacteria | 3705 |
| 36 | Ga0070691_10003581 | 3300005341 | Bacteria | 7012 |
| 37 | Ga0070691_10124598 | 3300005341 | Bacteria | 1300 |
| 38 | Ga0070691_10184418 | 3300005341 | Bacteria | 1088 |
| 39 | Ga0070661_100051472 | 3300005344 | Bacteria | 3014 |
| 40 | Ga0070661_100067152 | 3300005344 | Bacteria | 2635 |
| 41 | Ga0070661_100076790 | 3300005344 | Bacteria | 2462 |
| 42 | Ga0070661_100153149 | 3300005344 | Bacteria | 1744 |
| 43 | Ga0070661_100250106 | 3300005344 | Bacteria | 1368 |
| 44 | Ga0070692_10003307 | 3300005345 | Bacteria | 6510 |
| 45 | Ga0070692_10438106 | 3300005345 | Bacteria | 834 |
| 46 | Ga0070668_100084254 | 3300005347 | Bacteria | 2496 |
| 47 | Ga0070668_100099293 | 3300005347 | Bacteria | 2305 |
| 48 | Ga0070668_100754541 | 3300005347 | Bacteria | 862 |
| 49 | Ga0070669_100189943 | 3300005353 | Bacteria | 1611 |
| 50 | Ga0070675_100036451 | 3300005354 | Bacteria | 4002 |
| 51 | Ga0070675_100036695 | 3300005354 | Bacteria | 3990 |
| 52 | Ga0070675_100373520 | 3300005354 | Bacteria | 1268 |
| 53 | Ga0070671_100402621 | 3300005355 | Bacteria | 1171 |
| 54 | Ga0070671_100466950 | 3300005355 | Bacteria | 1084 |
| 55 | Ga0070674_100002032 | 3300005356 | Bacteria | 11092 |
| 56 | Ga0070674_100008473 | 3300005356 | Bacteria | 6122 |
| 57 | Ga0070674_100126887 | 3300005356 | Bacteria | 1897 |
| 58 | Ga0070674_100405547 | 3300005356 | Bacteria | 1115 |
| 59 | Ga0070674_100462233 | 3300005356 | Bacteria | 1050 |
| 60 | Ga0070674_100666656 | 3300005356 | Bacteria | 886 |
| 61 | Ga0070673_100021200 | 3300005364 | Bacteria | 4704 |
| 62 | Ga0070673_100122262 | 3300005364 | Bacteria | 2174 |
| 63 | Ga0070688_100005633 | 3300005365 | Bacteria | 6610 |
| 64 | Ga0070659_100036838 | 3300005366 | Bacteria | 3813 |
| 65 | Ga0070659_100040918 | 3300005366 | Bacteria | 3622 |
| 66 | Ga0070659_100079498 | 3300005366 | Bacteria | 2617 |
| 67 | Ga0070659_100701771 | 3300005366 | Bacteria | 875 |
| 68 | Ga0070667_100285637 | 3300005367 | Bacteria | 1483 |
| 69 | Ga0070713_100277904 | 3300005436 | Bacteria | 1535 |
| 70 | Ga0070710_10018750 | 3300005437 | Bacteria | 3565 |
| 71 | Ga0070701_10043794 | 3300005438 | Bacteria | 2291 |
| 72 | Ga0070701_10472644 | 3300005438 | Bacteria | 809 |
| 73 | Ga0070711_100636502 | 3300005439 | Bacteria | 893 |
| 74 | Ga0070705_100059374 | 3300005440 | Bacteria | 2264 |
| 75 | Ga0070705_100181595 | 3300005440 | Bacteria | 1426 |
| 76 | Ga0070705_100422257 | 3300005440 | Bacteria | 993 |
| 77 | Ga0070700_100048035 | 3300005441 | Bacteria | 2644 |
| 78 | Ga0070700_100269434 | 3300005441 | Bacteria | 1230 |
| 79 | Ga0070694_100175481 | 3300005444 | Bacteria | 1581 |
| 80 | Ga0070694_100222669 | 3300005444 | Bacteria | 1416 |
| 81 | Ga0070663_100044664 | 3300005455 | Bacteria | 3126 |
| 82 | Ga0070663_100095726 | 3300005455 | Bacteria | 2207 |
| 83 | Ga0070663_100183438 | 3300005455 | Bacteria | 1625 |
| 84 | Ga0070663_100600045 | 3300005455 | Bacteria | 926 |
| 85 | Ga0070678_100005380 | 3300005456 | Bacteria | 7387 |
| 86 | Ga0070678_100067132 | 3300005456 | Bacteria | 2668 |
| 87 | Ga0070678_100228234 | 3300005456 | Bacteria | 1551 |
| 88 | Ga0070662_100044687 | 3300005457 | Bacteria | 3174 |
| 89 | Ga0070662_100117956 | 3300005457 | Bacteria | 2030 |
| 90 | Ga0070662_100128377 | 3300005457 | Bacteria | 1952 |
| 91 | Ga0070662_100159033 | 3300005457 | Bacteria | 1766 |
| 92 | Ga0070662_100249379 | 3300005457 | Bacteria | 1426 |
| 93 | Ga0070681_10001517 | 3300005458 | Bacteria | 20575 |
| 94 | Ga0070681_10004737 | 3300005458 | Bacteria | 13027 |
| 95 | Ga0070681_10125268 | 3300005458 | Bacteria | 2502 |
| 96 | Ga0068867_100107768 | 3300005459 | Bacteria | 2136 |
| 97 | Ga0068867_100370152 | 3300005459 | Bacteria | 1201 |
| 98 | Ga0070685_10015996 | 3300005466 | Bacteria | 3990 |
| 99 | Ga0070685_10336061 | 3300005466 | Bacteria | 1028 |
| 100 | Ga0070706_100021988 | 3300005467 | Bacteria | 5874 |
| 101 | Ga0070706_100034884 | 3300005467 | Bacteria | 4645 |
| 102 | Ga0070706_100403180 | 3300005467 | Bacteria | 1273 |
| 103 | Ga0070707_100030912 | 3300005468 | Bacteria | 5100 |
| 104 | Ga0070707_100310380 | 3300005468 | Bacteria | 1533 |
| 105 | Ga0070707_100563906 | 3300005468 | Bacteria | 1101 |
| 106 | Ga0070707_100776191 | 3300005468 | Unclassified | 922 |
| 107 | Ga0070698_100077888 | 3300005471 | Bacteria | 3314 |
| 108 | Ga0070698_100128764 | 3300005471 | Bacteria | 2487 |
| 109 | Ga0070698_100141121 | 3300005471 | Unclassified | 2360 |
| 110 | Ga0070699_100081291 | 3300005518 | Bacteria | 2825 |
| 111 | Ga0070679_100001190 | 3300005530 | Bacteria | 22847 |
| 112 | Ga0070679_100016991 | 3300005530 | Bacteria | 7034 |
| 113 | Ga0070679_100037940 | 3300005530 | Bacteria | 4788 |
| 114 | Ga0070679_100088815 | 3300005530 | Bacteria | 3077 |
| 115 | Ga0070679_100412752 | 3300005530 | Bacteria | 1296 |
| 116 | Ga0070684_100002475 | 3300005535 | Bacteria | 13601 |
| 117 | Ga0070684_100008837 | 3300005535 | Bacteria | 7899 |
| 118 | Ga0070684_100024169 | 3300005535 | Bacteria | 5094 |
| 119 | Ga0070684_100024713 | 3300005535 | Bacteria | 5042 |
| 120 | Ga0070684_100024877 | 3300005535 | Bacteria | 5026 |
| 121 | Ga0070684_100101946 | 3300005535 | Bacteria | 2565 |
| 122 | Ga0070684_100250235 | 3300005535 | Bacteria | 1620 |
| 123 | Ga0070684_100368760 | 3300005535 | Bacteria | 1322 |
| 124 | Ga0070684_100588799 | 3300005535 | Bacteria | 1034 |
| 125 | Ga0070684_100726344 | 3300005535 | Bacteria | 926 |
| 126 | Ga0070697_100082256 | 3300005536 | Bacteria | 2654 |
| 127 | Ga0068853_100206615 | 3300005539 | Bacteria | 1789 |
| 128 | Ga0068853_100584358 | 3300005539 | Bacteria | 1060 |
| 129 | Ga0070672_100028983 | 3300005543 | Bacteria | 4146 |
| 130 | Ga0070672_100079614 | 3300005543 | Bacteria | 2623 |
| 131 | Ga0070686_100038012 | 3300005544 | Bacteria | 2990 |
| 132 | Ga0070686_100078344 | 3300005544 | Bacteria | 2182 |
| 133 | Ga0070686_100115428 | 3300005544 | Bacteria | 1836 |
| 134 | Ga0070686_100356461 | 3300005544 | Bacteria | 1100 |
| 135 | Ga0070695_100202648 | 3300005545 | Bacteria | 1419 |
| 136 | Ga0070696_100060253 | 3300005546 | Bacteria | 2654 |
| 137 | Ga0070696_100101570 | 3300005546 | Bacteria | 2061 |
| 138 | Ga0070696_100262181 | 3300005546 | Bacteria | 1311 |
| 139 | Ga0070696_100446318 | 3300005546 | Bacteria | 1020 |
| 140 | Ga0070693_100009137 | 3300005547 | Bacteria | 4921 |
| 141 | Ga0070704_100053064 | 3300005549 | Bacteria | 2864 |
| 142 | Ga0070704_100328936 | 3300005549 | Bacteria | 1283 |
| 143 | Ga0068855_100016986 | 3300005563 | Bacteria | 8752 |
| 144 | Ga0068855_100067944 | 3300005563 | Bacteria | 4151 |
| 145 | Ga0068855_100131542 | 3300005563 | Bacteria | 2857 |
| 146 | Ga0068855_100380205 | 3300005563 | Bacteria | 1551 |
| 147 | Ga0070664_100031006 | 3300005564 | Bacteria | 4464 |
| 148 | Ga0070664_100060615 | 3300005564 | Bacteria | 3222 |
| 149 | Ga0070664_100107551 | 3300005564 | Bacteria | 2431 |
| 150 | Ga0070664_100187769 | 3300005564 | Bacteria | 1840 |
| 151 | Ga0070664_100328019 | 3300005564 | Bacteria | 1388 |
| 152 | Ga0068857_100007616 | 3300005577 | Bacteria | 9324 |
| 153 | Ga0068857_100050082 | 3300005577 | Bacteria | 3706 |
| 154 | Ga0068857_100089263 | 3300005577 | Bacteria | 2758 |
| 155 | Ga0068857_100137000 | 3300005577 | Bacteria | 2210 |
| 156 | Ga0068857_100432927 | 3300005577 | Bacteria | 1228 |
| 157 | Ga0068854_100071737 | 3300005578 | Bacteria | 2534 |
| 158 | Ga0068854_100533796 | 3300005578 | Bacteria | 993 |
| 159 | Ga0068854_100539171 | 3300005578 | Bacteria | 988 |
| 160 | Ga0068856_100109460 | 3300005614 | Bacteria | 2759 |
| 161 | Ga0068856_100118802 | 3300005614 | Bacteria | 2645 |
| 162 | Ga0068856_100155924 | 3300005614 | Bacteria | 2293 |
| 163 | Ga0068856_100598200 | 3300005614 | Bacteria | 1124 |
| 164 | Ga0068856_100888157 | 3300005614 | Bacteria | 910 |
| 165 | Ga0070702_100005742 | 3300005615 | Bacteria | 5812 |
| 166 | Ga0070702_100029720 | 3300005615 | Bacteria | 2974 |
| 167 | Ga0070702_100035607 | 3300005615 | Bacteria | 2751 |
| 168 | Ga0070702_100036891 | 3300005615 | Bacteria | 2712 |
| 169 | Ga0070702_100099911 | 3300005615 | Bacteria | 1778 |
| 170 | Ga0070702_100463382 | 3300005615 | Bacteria | 922 |
| 171 | Ga0068852_100071478 | 3300005616 | Bacteria | 3047 |
| 172 | Ga0068852_100099241 | 3300005616 | Bacteria | 2624 |
| 173 | Ga0068852_100406649 | 3300005616 | Bacteria | 1340 |
| 174 | Ga0068859_100097340 | 3300005617 | Bacteria | 2996 |
| 175 | Ga0068864_100103952 | 3300005618 | Bacteria | 2522 |
| 176 | Ga0068864_100877312 | 3300005618 | Bacteria | 885 |
| 177 | Ga0068866_10036430 | 3300005718 | Bacteria | 2410 |
| 178 | Ga0068866_10169333 | 3300005718 | Bacteria | 1281 |
| 179 | Ga0068866_10253886 | 3300005718 | Bacteria | 1077 |
| 180 | Ga0068861_100067564 | 3300005719 | Bacteria | 2759 |
| 181 | Ga0068861_100104809 | 3300005719 | Bacteria | 2257 |
| 182 | Ga0068861_100293037 | 3300005719 | Bacteria | 1406 |
| 183 | Ga0068861_100339847 | 3300005719 | Bacteria | 1313 |
| 184 | Ga0068870_10013168 | 3300005840 | Bacteria | 3881 |
| 185 | Ga0068870_10034050 | 3300005840 | Bacteria | 2604 |
| 186 | Ga0068870_10213439 | 3300005840 | Bacteria | 1177 |
| 187 | Ga0068863_100125580 | 3300005841 | Bacteria | 2448 |
| 188 | Ga0068858_100025329 | 3300005842 | Bacteria | 5521 |
| 189 | Ga0068858_100704322 | 3300005842 | Bacteria | 983 |
| 190 | Ga0068860_100024509 | 3300005843 | Bacteria | 5829 |
| 191 | Ga0068860_100222744 | 3300005843 | Bacteria | 1832 |
| 192 | Ga0068862_100255312 | 3300005844 | Bacteria | 1599 |
| 193 | Ga0068862_100342618 | 3300005844 | Bacteria | 1385 |
| 194 | Ga0081455_10051443 | 3300005937 | Bacteria | 3534 |
| 195 | Ga0081455_10068601 | 3300005937 | Bacteria | 2950 |
| 196 | Ga0081455_10160058 | 3300005937 | Bacteria | 1727 |
| 197 | Ga0081538_10000864 | 3300005981 | Bacteria | 32691 |
| 198 | Ga0081538_10073956 | 3300005981 | Bacteria | 1858 |
| 199 | Ga0081539_10000335 | 3300005985 | Bacteria | 104157 |
| 200 | Ga0081539_10002145 | 3300005985 | Bacteria | 29161 |
| 201 | Ga0075365_10344928 | 3300006038 | Bacteria | 1049 |
| 202 | Ga0070715_10088246 | 3300006163 | Bacteria | 1421 |
| 203 | Ga0070716_100014516 | 3300006173 | Bacteria | 4035 |
| 204 | Ga0070712_100318071 | 3300006175 | Bacteria | 1265 |
| 205 | Ga0097621_100048186 | 3300006237 | Bacteria | 3456 |
| 206 | Ga0097621_100100644 | 3300006237 | Bacteria | 2431 |
| 207 | Ga0068871_100048540 | 3300006358 | Bacteria | 3428 |
| 208 | Ga0068871_100102278 | 3300006358 | Bacteria | 2401 |
| 209 | Ga0068871_100133981 | 3300006358 | Bacteria | 2103 |
| 210 | Ga0068871_100423798 | 3300006358 | Bacteria | 1189 |
| 211 | Ga0068871_100555776 | 3300006358 | Bacteria | 1040 |
| 212 | Ga0075428_100002047 | 3300006844 | Bacteria | 21753 |
| 213 | Ga0075428_100011263 | 3300006844 | Bacteria | 9948 |
| 214 | Ga0075428_100032480 | 3300006844 | Bacteria | 5765 |
| 215 | Ga0075428_100212214 | 3300006844 | Bacteria | 2092 |
| 216 | Ga0075428_100501347 | 3300006844 | Bacteria | 1299 |
| 217 | Ga0075430_100202570 | 3300006846 | Bacteria | 1648 |
| 218 | Ga0075431_100030532 | 3300006847 | Bacteria | 5551 |
| 219 | Ga0075431_100113531 | 3300006847 | Bacteria | 2796 |
| 220 | Ga0075433_10016304 | 3300006852 | Bacteria | 6117 |
| 221 | Ga0075433_10225331 | 3300006852 | Bacteria | 1665 |
| 222 | Ga0075433_10417220 | 3300006852 | Bacteria | 1184 |
| 223 | Ga0075434_100105583 | 3300006871 | Bacteria | 2827 |
| 224 | Ga0075434_100113787 | 3300006871 | Bacteria | 2718 |
| 225 | Ga0075434_100159330 | 3300006871 | Bacteria | 2277 |
| 226 | Ga0075434_100212172 | 3300006871 | Bacteria | 1956 |
| 227 | Ga0075429_100005788 | 3300006880 | Bacteria | 10668 |
| 228 | Ga0075429_100043183 | 3300006880 | Bacteria | 3922 |
| 229 | Ga0068865_100023535 | 3300006881 | Bacteria | 4034 |
| 230 | Ga0068865_100027824 | 3300006881 | Bacteria | 3738 |
| 231 | Ga0068865_100149223 | 3300006881 | Bacteria | 1772 |
| 232 | Ga0068865_100167534 | 3300006881 | Bacteria | 1681 |
| 233 | Ga0068865_100223999 | 3300006881 | Bacteria | 1472 |
| 234 | Ga0068865_100387028 | 3300006881 | Bacteria | 1142 |
| 235 | Ga0075436_100143469 | 3300006914 | Bacteria | 1679 |
| 236 | Ga0097620_100097341 | 3300006931 | Bacteria | 2996 |
| 237 | Ga0075435_100012074 | 3300007076 | Bacteria | 6384 |
| 238 | Ga0075435_100053353 | 3300007076 | Bacteria | 3260 |
| 239 | Ga0105240_10277841 | 3300009093 | Bacteria | 1925 |
| 240 | Ga0111539_10009767 | 3300009094 | Bacteria | 12111 |
| 241 | Ga0111539_10016431 | 3300009094 | Bacteria | 9175 |
| 242 | Ga0111539_10024626 | 3300009094 | Bacteria | 7383 |
| 243 | Ga0111539_10046165 | 3300009094 | Bacteria | 5212 |
| 244 | Ga0111539_10055201 | 3300009094 | Bacteria | 4723 |
| 245 | Ga0111539_10068708 | 3300009094 | Bacteria | 4183 |
| 246 | Ga0111539_10105489 | 3300009094 | Bacteria | 3306 |
| 247 | Ga0111539_10179571 | 3300009094 | Bacteria | 2473 |
| 248 | Ga0111539_10390483 | 3300009094 | Archaea | 1621 |
| 249 | Ga0111539_10499974 | 3300009094 | Archaea | 1416 |
| 250 | Ga0111539_10665866 | 3300009094 | Bacteria | 1212 |
| 251 | Ga0105245_10001062 | 3300009098 | Bacteria | 24876 |
| 252 | Ga0105245_10002157 | 3300009098 | Bacteria | 17822 |
| 253 | Ga0105245_10067307 | 3300009098 | Bacteria | 3244 |
| 254 | Ga0105245_10087090 | 3300009098 | Bacteria | 2866 |
| 255 | Ga0105245_10111003 | 3300009098 | Bacteria | 2550 |
| 256 | Ga0105245_10204327 | 3300009098 | Bacteria | 1898 |
| 257 | Ga0105245_10291126 | 3300009098 | Bacteria | 1599 |
| 258 | Ga0105245_10316254 | 3300009098 | Bacteria | 1537 |
| 259 | Ga0105247_10322562 | 3300009101 | Bacteria | 1078 |
| 260 | Ga0105247_10552332 | 3300009101 | Bacteria | 847 |
| 261 | Ga0114129_10005183 | 3300009147 | Bacteria | 18351 |
| 262 | Ga0114129_10005445 | 3300009147 | Bacteria | 17985 |
| 263 | Ga0114129_10010791 | 3300009147 | Bacteria | 13016 |
| 264 | Ga0114129_10104620 | 3300009147 | Bacteria | 3912 |
| 265 | Ga0114129_10107714 | 3300009147 | Bacteria | 3848 |
| 266 | Ga0114129_10118542 | 3300009147 | Bacteria | 3646 |
| 267 | Ga0114129_10264284 | 3300009147 | Bacteria | 2305 |
| 268 | Ga0105243_10016866 | 3300009148 | Bacteria | 5521 |
| 269 | Ga0105243_10040653 | 3300009148 | Bacteria | 3633 |
| 270 | Ga0105243_10064486 | 3300009148 | Bacteria | 2940 |
| 271 | Ga0105243_10113806 | 3300009148 | Bacteria | 2269 |
| 272 | Ga0105243_10141417 | 3300009148 | Bacteria | 2054 |
| 273 | Ga0105243_10383719 | 3300009148 | Bacteria | 1300 |
| 274 | Ga0105243_10531864 | 3300009148 | Bacteria | 1120 |
| 275 | Ga0105241_10027993 | 3300009174 | Bacteria | 4197 |
| 276 | Ga0105242_10036222 | 3300009176 | Bacteria | 3957 |
| 277 | Ga0105242_10047661 | 3300009176 | Bacteria | 3480 |
| 278 | Ga0105242_10055716 | 3300009176 | Bacteria | 3234 |
| 279 | Ga0105242_10201103 | 3300009176 | Bacteria | 1770 |
| 280 | Ga0105242_10283246 | 3300009176 | Bacteria | 1506 |
| 281 | Ga0105242_10417621 | 3300009176 | Bacteria | 1256 |
| 282 | Ga0105242_10458557 | 3300009176 | Bacteria | 1203 |
| 283 | Ga0105242_11171632 | 3300009176 | Bacteria | 786 |
| 284 | Ga0105248_10058256 | 3300009177 | Bacteria | 4337 |
| 285 | Ga0105248_10148313 | 3300009177 | Bacteria | 2646 |
| 286 | Ga0105237_10636358 | 3300009545 | Bacteria | 1073 |
| 287 | Ga0105237_10805726 | 3300009545 | Bacteria | 946 |
| 288 | Ga0105238_10133139 | 3300009551 | Bacteria | 2464 |
| 289 | Ga0105238_10300461 | 3300009551 | Bacteria | 1589 |
| 290 | Ga0105249_10129018 | 3300009553 | Bacteria | 2411 |
| 291 | Ga0105249_10235068 | 3300009553 | Bacteria | 1809 |
| 292 | Ga0105249_10672819 | 3300009553 | Bacteria | 1094 |
| 293 | Ga0105249_10741675 | 3300009553 | Bacteria | 1044 |
| 294 | Ga0105249_10825122 | 3300009553 | Bacteria | 992 |
| 295 | Ga0105239_10017706 | 3300010375 | Bacteria | 7883 |
| 296 | Ga0105239_10020919 | 3300010375 | Bacteria | 7219 |
| 297 | Ga0105239_10025303 | 3300010375 | Bacteria | 6536 |
| 298 | Ga0105239_10028808 | 3300010375 | Bacteria | 6106 |
| 299 | Ga0105239_10111840 | 3300010375 | Bacteria | 3028 |
| 300 | Ga0105239_10277086 | 3300010375 | Bacteria | 1888 |
| 301 | Ga0105239_11090932 | 3300010375 | Bacteria | 919 |
| 302 | Ga0105246_10009303 | 3300011119 | Bacteria | 6051 |
| 303 | Ga0105246_10042153 | 3300011119 | Bacteria | 3090 |
| 304 | Ga0105246_10050709 | 3300011119 | Bacteria | 2847 |
| 305 | Ga0105246_10057684 | 3300011119 | Bacteria | 2687 |
| 306 | Ga0105246_10123370 | 3300011119 | Bacteria | 1923 |
| 307 | Ga0105246_10255676 | 3300011119 | Bacteria | 1393 |
| 308 | Ga0105246_10873452 | 3300011119 | Bacteria | 804 |
| 309 | Ga0157341_1007043 | 3300012494 | Bacteria | 885 |
| 310 | Ga0157373_10199783 | 3300013100 | Bacteria | 1409 |
| 311 | Ga0157371_10071269 | 3300013102 | Bacteria | 2460 |
| 312 | Ga0157370_10006695 | 3300013104 | Bacteria | 12647 |
| 313 | Ga0157369_10014930 | 3300013105 | Bacteria | 8766 |
| 314 | Ga0157369_10731538 | 3300013105 | Bacteria | 1018 |
| 315 | Ga0157374_10070941 | 3300013296 | Bacteria | 3284 |
| 316 | Ga0157374_10124652 | 3300013296 | Bacteria | 2489 |
| 317 | Ga0163162_10344805 | 3300013306 | Bacteria | 1622 |
| 318 | Ga0163162_10573016 | 3300013306 | Bacteria | 1256 |
| 319 | Ga0157372_10133503 | 3300013307 | Bacteria | 2858 |
| 320 | Ga0157372_10605639 | 3300013307 | Bacteria | 1277 |
| 321 | Ga0157375_10056095 | 3300013308 | Bacteria | 3887 |
| 322 | Ga0157375_10085648 | 3300013308 | Bacteria | 3201 |
| 323 | Ga0157375_10130463 | 3300013308 | Bacteria | 2632 |
| 324 | Ga0157375_10192454 | 3300013308 | Bacteria | 2195 |
| 325 | Ga0157375_10235832 | 3300013308 | Bacteria | 1989 |
| 326 | Ga0157375_10292540 | 3300013308 | Bacteria | 1792 |
| 327 | Ga0157375_10856120 | 3300013308 | Bacteria | 1055 |
| 328 | Ga0163163_10161460 | 3300014325 | Bacteria | 2286 |
| 329 | Ga0163163_10181762 | 3300014325 | Bacteria | 2150 |
| 330 | Ga0163163_10205294 | 3300014325 | Bacteria | 2019 |
| 331 | Ga0163163_10372728 | 3300014325 | Bacteria | 1485 |
| 332 | Ga0163163_10845488 | 3300014325 | Bacteria | 979 |
| 333 | Ga0157380_10021075 | 3300014326 | Bacteria | 4883 |
| 334 | Ga0157380_10081214 | 3300014326 | Bacteria | 2651 |
| 335 | Ga0182008_10078544 | 3300014497 | Bacteria | 1624 |
| 336 | Ga0157377_10001184 | 3300014745 | Bacteria | 11091 |
| 337 | Ga0157377_10035537 | 3300014745 | Bacteria | 2734 |
| 338 | Ga0157377_10038092 | 3300014745 | Unclassified | 2652 |
| 339 | Ga0157377_10200628 | 3300014745 | Bacteria | 1266 |
| 340 | Ga0157379_10265167 | 3300014968 | Bacteria | 1561 |
| 341 | Ga0157379_10267048 | 3300014968 | Bacteria | 1555 |
| 342 | Ga0157376_10033194 | 3300014969 | Bacteria | 4152 |
| 343 | Ga0157376_10088042 | 3300014969 | Bacteria | 2681 |
| 344 | Ga0157376_10403431 | 3300014969 | Bacteria | 1322 |
| 345 | Ga0157376_10542636 | 3300014969 | Bacteria | 1149 |
| 346 | Ga0163161_10051318 | 3300017792 | Bacteria | 2987 |
| 347 | Ga0163161_10154864 | 3300017792 | Bacteria | 1744 |
| 348 | Ga0163161_10203324 | 3300017792 | Bacteria | 1527 |
| 349 | Ga0206356_10519479 | 3300020070 | Bacteria | 2725 |
| 350 | Ga0206354_11677922 | 3300020081 | Bacteria | 2214 |
| 351 | Ga0206354_11697263 | 3300020081 | Bacteria | 2909 |
| 352 | Ga0206353_10850478 | 3300020082 | Bacteria | 6381 |
| 353 | Ga0207653_10020832 | 3300025885 | Bacteria | 2078 |
| 354 | Ga0207688_10001835 | 3300025901 | Bacteria | 11333 |
| 355 | Ga0207688_10004340 | 3300025901 | Bacteria | 7730 |
| 356 | Ga0207688_10033454 | 3300025901 | Bacteria | 2844 |
| 357 | Ga0207688_10039174 | 3300025901 | Bacteria | 2633 |
| 358 | Ga0207645_10054398 | 3300025907 | Bacteria | 2556 |
| 359 | Ga0207645_10111569 | 3300025907 | Bacteria | 1771 |
| 360 | Ga0207645_10184451 | 3300025907 | Bacteria | 1369 |
| 361 | Ga0207645_10223276 | 3300025907 | Bacteria | 1242 |
| 362 | Ga0207643_10006658 | 3300025908 | Bacteria | 6195 |
| 363 | Ga0207705_10008932 | 3300025909 | Bacteria | 7297 |
| 364 | Ga0207705_10039721 | 3300025909 | Bacteria | 3373 |
| 365 | Ga0207705_10341037 | 3300025909 | Bacteria | 1153 |
| 366 | Ga0207684_10079151 | 3300025910 | Bacteria | 2796 |
| 367 | Ga0207654_10019326 | 3300025911 | Bacteria | 3595 |
| 368 | Ga0207707_10009308 | 3300025912 | Bacteria | 8517 |
| 369 | Ga0207707_10094803 | 3300025912 | Bacteria | 2608 |
| 370 | Ga0207693_10013387 | 3300025915 | Bacteria | 6613 |
| 371 | Ga0207693_10050718 | 3300025915 | Bacteria | 3258 |
| 372 | Ga0207693_10135568 | 3300025915 | Bacteria | 1936 |
| 373 | Ga0207663_10124941 | 3300025916 | Bacteria | 1768 |
| 374 | Ga0207660_10051804 | 3300025917 | Bacteria | 2920 |
| 375 | Ga0207660_10080233 | 3300025917 | Bacteria | 2395 |
| 376 | Ga0207660_10549487 | 3300025917 | Bacteria | 939 |
| 377 | Ga0207662_10004444 | 3300025918 | Bacteria | 7375 |
| 378 | Ga0207662_10212834 | 3300025918 | Bacteria | 1255 |
| 379 | Ga0207657_10000331 | 3300025919 | Bacteria | 50115 |
| 380 | Ga0207657_10025168 | 3300025919 | Bacteria | 5493 |
| 381 | Ga0207657_10053881 | 3300025919 | Bacteria | 3482 |
| 382 | Ga0207657_10080926 | 3300025919 | Bacteria | 2729 |
| 383 | Ga0207649_10021808 | 3300025920 | Bacteria | 3695 |
| 384 | Ga0207649_10086001 | 3300025920 | Bacteria | 2048 |
| 385 | Ga0207652_10001925 | 3300025921 | Bacteria | 17959 |
| 386 | Ga0207652_10043109 | 3300025921 | Bacteria | 3842 |
| 387 | Ga0207652_10046367 | 3300025921 | Bacteria | 3708 |
| 388 | Ga0207652_10106640 | 3300025921 | Bacteria | 2480 |
| 389 | Ga0207652_10112775 | 3300025921 | Bacteria | 2413 |
| 390 | Ga0207652_10325010 | 3300025921 | Bacteria | 1389 |
| 391 | Ga0207646_10008016 | 3300025922 | Bacteria | 10652 |
| 392 | Ga0207681_10039033 | 3300025923 | Bacteria | 3150 |
| 393 | Ga0207681_10408711 | 3300025923 | Bacteria | 1098 |
| 394 | Ga0207650_10288980 | 3300025925 | Bacteria | 1336 |
| 395 | Ga0207659_10048085 | 3300025926 | Bacteria | 3020 |
| 396 | Ga0207659_10122809 | 3300025926 | Bacteria | 1992 |
| 397 | Ga0207687_10002663 | 3300025927 | Bacteria | 12086 |
| 398 | Ga0207687_10009887 | 3300025927 | Bacteria | 6244 |
| 399 | Ga0207687_10046460 | 3300025927 | Bacteria | 3006 |
| 400 | Ga0207687_10048563 | 3300025927 | Bacteria | 2948 |
| 401 | Ga0207687_10120306 | 3300025927 | Bacteria | 1963 |
| 402 | Ga0207687_10248966 | 3300025927 | Bacteria | 1412 |
| 403 | Ga0207687_10586456 | 3300025927 | Bacteria | 938 |
| 404 | Ga0207644_10459076 | 3300025931 | Bacteria | 1047 |
| 405 | Ga0207644_10589779 | 3300025931 | Bacteria | 922 |
| 406 | Ga0207690_10019468 | 3300025932 | Bacteria | 4181 |
| 407 | Ga0207690_10191601 | 3300025932 | Bacteria | 1547 |
| 408 | Ga0207690_10586538 | 3300025932 | Bacteria | 909 |
| 409 | Ga0207706_10009833 | 3300025933 | Bacteria | 8774 |
| 410 | Ga0207706_10011879 | 3300025933 | Bacteria | 7927 |
| 411 | Ga0207706_10048847 | 3300025933 | Bacteria | 3741 |
| 412 | Ga0207706_10100741 | 3300025933 | Bacteria | 2541 |
| 413 | Ga0207706_10123423 | 3300025933 | Bacteria | 2278 |
| 414 | Ga0207706_10265005 | 3300025933 | Bacteria | 1500 |
| 415 | Ga0207706_10314272 | 3300025933 | Bacteria | 1364 |
| 416 | Ga0207686_10144898 | 3300025934 | Bacteria | 1646 |
| 417 | Ga0207686_10280393 | 3300025934 | Bacteria | 1230 |
| 418 | Ga0207686_10367634 | 3300025934 | Bacteria | 1087 |
| 419 | Ga0207686_10576513 | 3300025934 | Bacteria | 883 |
| 420 | Ga0207709_10042641 | 3300025935 | Bacteria | 2731 |
| 421 | Ga0207709_10117165 | 3300025935 | Bacteria | 1792 |
| 422 | Ga0207709_10156024 | 3300025935 | Bacteria | 1587 |
| 423 | Ga0207670_10070713 | 3300025936 | Bacteria | 2411 |
| 424 | Ga0207670_10650500 | 3300025936 | Unclassified | 869 |
| 425 | Ga0207669_10002692 | 3300025937 | Bacteria | 7602 |
| 426 | Ga0207669_10094000 | 3300025937 | Bacteria | 1961 |
| 427 | Ga0207669_10250502 | 3300025937 | Bacteria | 1318 |
| 428 | Ga0207669_10372653 | 3300025937 | Bacteria | 1110 |
| 429 | Ga0207669_10406684 | 3300025937 | Bacteria | 1068 |
| 430 | Ga0207704_10123178 | 3300025938 | Bacteria | 1779 |
| 431 | Ga0207704_10186866 | 3300025938 | Bacteria | 1503 |
| 432 | Ga0207665_10002419 | 3300025939 | Bacteria | 12632 |
| 433 | Ga0207691_10048589 | 3300025940 | Bacteria | 3889 |
| 434 | Ga0207691_10073189 | 3300025940 | Bacteria | 3090 |
| 435 | Ga0207691_10076997 | 3300025940 | Bacteria | 3006 |
| 436 | Ga0207689_10070737 | 3300025942 | Bacteria | 2866 |
| 437 | Ga0207689_10130222 | 3300025942 | Bacteria | 2070 |
| 438 | Ga0207689_10378931 | 3300025942 | Bacteria | 1178 |
| 439 | Ga0207661_10000167 | 3300025944 | Bacteria | 42604 |
| 440 | Ga0207661_10006848 | 3300025944 | Bacteria | 8078 |
| 441 | Ga0207661_10007021 | 3300025944 | Bacteria | 7988 |
| 442 | Ga0207661_10043819 | 3300025944 | Bacteria | 3533 |
| 443 | Ga0207661_10052224 | 3300025944 | Bacteria | 3265 |
| 444 | Ga0207661_10137932 | 3300025944 | Bacteria | 2096 |
| 445 | Ga0207679_10080677 | 3300025945 | Bacteria | 2485 |
| 446 | Ga0207679_10204094 | 3300025945 | Bacteria | 1653 |
| 447 | Ga0207679_10217449 | 3300025945 | Bacteria | 1606 |
| 448 | Ga0207679_10371411 | 3300025945 | Bacteria | 1252 |
| 449 | Ga0207667_10109164 | 3300025949 | Bacteria | 2854 |
| 450 | Ga0207667_10228425 | 3300025949 | Bacteria | 1906 |
| 451 | Ga0207667_10327043 | 3300025949 | Bacteria | 1565 |
| 452 | Ga0207667_10558636 | 3300025949 | Bacteria | 1157 |
| 453 | Ga0207651_10004087 | 3300025960 | Bacteria | 7278 |
| 454 | Ga0207651_10131127 | 3300025960 | Bacteria | 1919 |
| 455 | Ga0207651_10506638 | 3300025960 | Bacteria | 1044 |
| 456 | Ga0207712_10104316 | 3300025961 | Bacteria | 2114 |
| 457 | Ga0207712_10127378 | 3300025961 | Bacteria | 1935 |
| 458 | Ga0207668_10024717 | 3300025972 | Bacteria | 3881 |
| 459 | Ga0207668_10130340 | 3300025972 | Bacteria | 1919 |
| 460 | Ga0207668_10271629 | 3300025972 | Bacteria | 1386 |
| 461 | Ga0207668_10440894 | 3300025972 | Bacteria | 1109 |
| 462 | Ga0207640_10446552 | 3300025981 | Bacteria | 1065 |
| 463 | Ga0207640_10452657 | 3300025981 | Bacteria | 1058 |
| 464 | Ga0207677_10011273 | 3300026023 | Bacteria | 5089 |
| 465 | Ga0207677_10112824 | 3300026023 | Bacteria | 2028 |
| 466 | Ga0207677_10183206 | 3300026023 | Bacteria | 1649 |
| 467 | Ga0207677_10207443 | 3300026023 | Bacteria | 1562 |
| 468 | Ga0207677_10393645 | 3300026023 | Bacteria | 1173 |
| 469 | Ga0207703_10036035 | 3300026035 | Bacteria | 3934 |
| 470 | Ga0207639_10036429 | 3300026041 | Bacteria | 3646 |
| 471 | Ga0207639_10052679 | 3300026041 | Bacteria | 3102 |
| 472 | Ga0207639_10098178 | 3300026041 | Bacteria | 2360 |
| 473 | Ga0207639_10235364 | 3300026041 | Bacteria | 1590 |
| 474 | Ga0207678_10019025 | 3300026067 | Bacteria | 6032 |
| 475 | Ga0207678_10789503 | 3300026067 | Bacteria | 838 |
| 476 | Ga0207708_10030896 | 3300026075 | Bacteria | 4064 |
| 477 | Ga0207708_10034080 | 3300026075 | Bacteria | 3872 |
| 478 | Ga0207708_10058848 | 3300026075 | Bacteria | 2932 |
| 479 | Ga0207708_10400814 | 3300026075 | Bacteria | 1134 |
| 480 | Ga0207708_10460591 | 3300026075 | Bacteria | 1060 |
| 481 | Ga0207708_10521711 | 3300026075 | Bacteria | 998 |
| 482 | Ga0207702_10021760 | 3300026078 | Bacteria | 5310 |
| 483 | Ga0207702_10048040 | 3300026078 | Bacteria | 3598 |
| 484 | Ga0207702_10058318 | 3300026078 | Bacteria | 3285 |
| 485 | Ga0207702_10183353 | 3300026078 | Bacteria | 1929 |
| 486 | Ga0207702_11060284 | 3300026078 | Unclassified | 804 |
| 487 | Ga0207641_10282311 | 3300026088 | Bacteria | 1562 |
| 488 | Ga0207648_10060818 | 3300026089 | Bacteria | 3294 |
| 489 | Ga0207648_10111714 | 3300026089 | Bacteria | 2399 |
| 490 | Ga0207648_10242685 | 3300026089 | Bacteria | 1604 |
| 491 | Ga0207648_10400295 | 3300026089 | Bacteria | 1244 |
| 492 | Ga0207648_10457869 | 3300026089 | Bacteria | 1162 |
| 493 | Ga0207676_10253540 | 3300026095 | Bacteria | 1585 |
| 494 | Ga0207674_10003106 | 3300026116 | Bacteria | 20505 |
| 495 | Ga0207674_10018155 | 3300026116 | Bacteria | 7654 |
| 496 | Ga0207674_10055480 | 3300026116 | Bacteria | 4028 |
| 497 | Ga0207674_10104105 | 3300026116 | Bacteria | 2817 |
| 498 | Ga0207674_10151212 | 3300026116 | Bacteria | 2279 |
| 499 | Ga0207674_10470524 | 3300026116 | Bacteria | 1215 |
| 500 | Ga0207674_10701283 | 3300026116 | Bacteria | 977 |
| 501 | Ga0207674_10762011 | 3300026116 | Bacteria | 934 |
| 502 | Ga0207675_100057052 | 3300026118 | Bacteria | 3643 |
| 503 | Ga0207675_100104031 | 3300026118 | Bacteria | 2676 |
| 504 | Ga0207675_100107589 | 3300026118 | Bacteria | 2629 |
| 505 | Ga0207675_100113211 | 3300026118 | Bacteria | 2562 |
| 506 | Ga0207675_100299696 | 3300026118 | Bacteria | 1565 |
| 507 | Ga0207675_100451144 | 3300026118 | Bacteria | 1274 |
| 508 | Ga0207683_10010195 | 3300026121 | Bacteria | 8012 |
| 509 | Ga0207683_10016208 | 3300026121 | Bacteria | 6343 |
| 510 | Ga0207683_10016533 | 3300026121 | Bacteria | 6280 |
| 511 | Ga0207683_10018197 | 3300026121 | Bacteria | 5993 |
| 512 | Ga0207683_10120628 | 3300026121 | Bacteria | 2353 |
| 513 | Ga0207683_10167353 | 3300026121 | Bacteria | 1989 |
| 514 | Ga0207683_10227766 | 3300026121 | Bacteria | 1699 |
| 515 | Ga0207683_10357611 | 3300026121 | Unclassified | 1341 |
| 516 | Ga0207698_10045883 | 3300026142 | Bacteria | 3296 |
| 517 | Ga0207698_10116324 | 3300026142 | Bacteria | 2253 |
| 518 | Ga0207698_10365888 | 3300026142 | Bacteria | 1367 |
| 519 | Ga0207428_10000327 | 3300027907 | Bacteria | 61752 |
| 520 | Ga0207428_10006296 | 3300027907 | Bacteria | 10973 |
| 521 | Ga0207428_10007597 | 3300027907 | Bacteria | 9882 |
| 522 | Ga0207428_10043381 | 3300027907 | Bacteria | 3633 |
| 523 | Ga0268265_10123635 | 3300028380 | Bacteria | 2137 |
| 524 | Ga0268264_10076280 | 3300028381 | Bacteria | 2851 |
| 525 | Ga0268264_10165548 | 3300028381 | Bacteria | 1996 |
| 526 | Ga0265327_10056628 | 3300031251 | Bacteria | 2019 |
| 527 | Ga0265316_10117361 | 3300031344 | Bacteria | 2012 |
| 528 | Ga0265314_10106402 | 3300031711 | Bacteria | 1792 |
| 529 | Ga0307405_10004098 | 3300031731 | Bacteria | 6848 |
| 530 | Ga0307405_10179609 | 3300031731 | Bacteria | 1518 |
| 531 | Ga0307413_10006056 | 3300031824 | Bacteria | 5479 |
| 532 | Ga0307413_10184426 | 3300031824 | Bacteria | 1491 |
| 533 | Ga0307406_10217977 | 3300031901 | Bacteria | 1416 |
| 534 | Ga0307412_10035117 | 3300031911 | Bacteria | 3201 |
| 535 | Ga0307412_10073314 | 3300031911 | Bacteria | 2342 |
| 536 | Ga0307409_100123740 | 3300031995 | Bacteria | 2195 |
| 537 | Ga0307409_100262081 | 3300031995 | Bacteria | 1587 |
| 538 | Ga0307416_100027674 | 3300032002 | Bacteria | 4202 |
| 539 | Ga0307416_100139871 | 3300032002 | Bacteria | 2198 |
| 540 | Ga0307414_10005455 | 3300032004 | Bacteria | 7006 |
| 541 | Ga0307415_100008754 | 3300032126 | Bacteria | 5630 |
| 542 | Ga0373930_0049734 | 3300034816 | Bacteria | 913 |
| 543 | Ga0373950_0035123 | 3300034818 | Bacteria | 942 |
| 544 | Ga0373958_0012215 | 3300034819 | Bacteria | 1466 |
| 545 | Ga0373959_0009968 | 3300034820 | Bacteria | 1651 |
| 546 | Ga0373938_0016075 | 3300034957 | Bacteria | 1458 |
| 547 | Ga0373929_0057596 | 3300035085 | Bacteria | 903 |
| 548 | Ga0373940_0047459 | 3300035088 | Bacteria | 1198 |
| 549 | Ga0373949_0013482 | 3300035090 | Bacteria | 1813 |
| 550 | Ga0373951_0039749 | 3300035091 | Bacteria | 1131 |
| 551 | Ga0373952_0011426 | 3300035092 | Bacteria | 1732 |
| 552 | Ga0373932_0006965 | 3300035112 | Bacteria | 2685 |
| 553 | Ga0373939_0064903 | 3300035114 | Bacteria | 1173 |
| 554 | Ga0373953_0139998 | 3300035117 | Bacteria | 1035 |
| 555 | Ga0373960_0004005 | 3300035121 | Bacteria | 3361 |
| 556 | Ga0373960_0007459 | 3300035121 | Bacteria | 2592 |
| 557 | Ga0373943_0177898 | 3300035170 | Bacteria | 1168 |
| 558 | Ga0373962_0010570 | 3300035242 | Bacteria | 2303 |
| 559 | Ga0373931_0100876 | 3300035691 | Bacteria | 1623 |
| 560 | Ga0373937_0158296 | 3300036401 | Bacteria | 2123 |
| 561 | Ga0395899_0000899 | 3300037312 | Bacteria | 28042 |
| 562 | Ga0395899_0001850 | 3300037312 | Bacteria | 17517 |
| 563 | Ga0395899_0005803 | 3300037312 | Bacteria | 9582 |
| 564 | Ga0395899_0013572 | 3300037312 | Bacteria | 6228 |
| 565 | Ga0395899_0029850 | 3300037312 | Bacteria | 4102 |
| 566 | Ga0395899_0043335 | 3300037312 | Bacteria | 3357 |
| 567 | Ga0395899_0083273 | 3300037312 | Bacteria | 2326 |
| 568 | Ga0395899_0106831 | 3300037312 | Bacteria | 2015 |
| 569 | Ga0395899_0121855 | 3300037312 | Bacteria | 1867 |
| 570 | Ga0395899_0135173 | 3300037312 | Bacteria | 1758 |
| 571 | Ga0395899_0232721 | 3300037312 | Bacteria | 1271 |
| 572 | Ga0395900_0004947 | 3300037418 | Bacteria | 14024 |
| 573 | Ga0395900_0008467 | 3300037418 | Bacteria | 10577 |
| 574 | Ga0395900_0009503 | 3300037418 | Bacteria | 9969 |
| 575 | Ga0395900_0024495 | 3300037418 | Bacteria | 6180 |
| 576 | Ga0395900_0041675 | 3300037418 | Bacteria | 4732 |
| 577 | Ga0395900_0045047 | 3300037418 | Bacteria | 4544 |
| 578 | Ga0395900_0052832 | 3300037418 | Bacteria | 4182 |
| 579 | Ga0395900_0061463 | 3300037418 | Bacteria | 3862 |
| 580 | Ga0395900_0064886 | 3300037418 | Bacteria | 3751 |
| 581 | Ga0395900_0069784 | 3300037418 | Bacteria | 3612 |
| 582 | Ga0395900_0077429 | 3300037418 | Bacteria | 3416 |
| 583 | Ga0395900_0083585 | 3300037418 | Bacteria | 3280 |
| 584 | Ga0395900_0097534 | 3300037418 | Bacteria | 3020 |
| 585 | Ga0395900_0114430 | 3300037418 | Bacteria | 2768 |
| 586 | Ga0395900_0161131 | 3300037418 | Bacteria | 2288 |
| 587 | Ga0395900_0198976 | 3300037418 | Bacteria | 2028 |
| 588 | Ga0395900_0249190 | 3300037418 | Bacteria | 1778 |
| 589 | Ga0395900_0309308 | 3300037418 | Bacteria | 1564 |
| 590 | Ga0395900_0323848 | 3300037418 | Bacteria | 1521 |
| 591 | Ga0395900_0491752 | 3300037418 | Unclassified | 1178 |
| 592 | Ga0395900_0587082 | 3300037418 | Bacteria | 1056 |
| 593 | Ga0395898_0002821 | 3300037466 | Bacteria | 19931 |
| 594 | Ga0395898_0003001 | 3300037466 | Bacteria | 19133 |
| 595 | Ga0395898_0003379 | 3300037466 | Bacteria | 17875 |
| 596 | Ga0395898_0004559 | 3300037466 | Bacteria | 15121 |
| 597 | Ga0395898_0016080 | 3300037466 | Bacteria | 7666 |
| 598 | Ga0395898_0023534 | 3300037466 | Bacteria | 6223 |
| 599 | Ga0395898_0049171 | 3300037466 | Bacteria | 4132 |
| 600 | Ga0395898_0049264 | 3300037466 | Bacteria | 4128 |
| 601 | Ga0395898_0092266 | 3300037466 | Bacteria | 2912 |
| 602 | Ga0395898_0165688 | 3300037466 | Bacteria | 2114 |
| 603 | Ga0395898_0176892 | 3300037466 | Bacteria | 2039 |
| 604 | Ga0395898_0323411 | 3300037466 | Bacteria | 1471 |
| 605 | Ga0395898_0472758 | 3300037466 | Bacteria | 1193 |
| 606 | Ga0395898_0490162 | 3300037466 | Bacteria | 1169 |
| 607 | Ga0395898_0541344 | 3300037466 | Bacteria | 1106 |
| 608 | Ga0395898_0599067 | 3300037466 | Bacteria | 1045 |
| 609 | Ga0395905_0001363 | 3300037471 | Bacteria | 29719 |
| 610 | Ga0395905_0002059 | 3300037471 | Bacteria | 22953 |
| 611 | Ga0395905_0002078 | 3300037471 | Bacteria | 22774 |
| 612 | Ga0395905_0004086 | 3300037471 | Bacteria | 15296 |
| 613 | Ga0395905_0006030 | 3300037471 | Bacteria | 12272 |
| 614 | Ga0395905_0014759 | 3300037471 | Bacteria | 7448 |
| 615 | Ga0395905_0021871 | 3300037471 | Bacteria | 6049 |
| 616 | Ga0395905_0036589 | 3300037471 | Bacteria | 4610 |
| 617 | Ga0395905_0051578 | 3300037471 | Bacteria | 3854 |
| 618 | Ga0395905_0084339 | 3300037471 | Bacteria | 2977 |
| 619 | Ga0395905_0095831 | 3300037471 | Bacteria | 2785 |
| 620 | Ga0395905_0113201 | 3300037471 | Bacteria | 2549 |
| 621 | Ga0395905_0159640 | 3300037471 | Bacteria | 2119 |
| 622 | Ga0395905_0224777 | 3300037471 | Bacteria | 1756 |
| 623 | Ga0395905_0236101 | 3300037471 | Bacteria | 1709 |
| 624 | Ga0395905_0244702 | 3300037471 | Unclassified | 1676 |
| 625 | Ga0395905_0278226 | 3300037471 | Bacteria | 1559 |
| 626 | Ga0395905_0316602 | 3300037471 | Bacteria | 1450 |
| 627 | Ga0395905_0321113 | 3300037471 | Bacteria | 1438 |
| 628 | Ga0395905_0495537 | 3300037471 | Bacteria | 1122 |
| 629 | Ga0395905_0517718 | 3300037471 | Bacteria | 1093 |
| 630 | Ga0395901_0001352 | 3300038443 | Bacteria | 25731 |
| 631 | Ga0395901_0003549 | 3300038443 | Bacteria | 15723 |
| 632 | Ga0395901_0003858 | 3300038443 | Bacteria | 15084 |
| 633 | Ga0395901_0005231 | 3300038443 | Bacteria | 13099 |
| 634 | Ga0395901_0018144 | 3300038443 | Bacteria | 7181 |
| 635 | Ga0395901_0024846 | 3300038443 | Bacteria | 6149 |
| 636 | Ga0395901_0029397 | 3300038443 | Bacteria | 5658 |
| 637 | Ga0395901_0031856 | 3300038443 | Bacteria | 5436 |
| 638 | Ga0395901_0033143 | 3300038443 | Bacteria | 5330 |
| 639 | Ga0395901_0050239 | 3300038443 | Bacteria | 4333 |
| 640 | Ga0395901_0051433 | 3300038443 | Bacteria | 4284 |
| 641 | Ga0395901_0071012 | 3300038443 | Bacteria | 3628 |
| 642 | Ga0395901_0076611 | 3300038443 | Bacteria | 3489 |
| 643 | Ga0395901_0085134 | 3300038443 | Bacteria | 3305 |
| 644 | Ga0395901_0091389 | 3300038443 | Bacteria | 3186 |
| 645 | Ga0395901_0145921 | 3300038443 | Bacteria | 2487 |
| 646 | Ga0395901_0181152 | 3300038443 | Bacteria | 2210 |
| 647 | Ga0395901_0183869 | 3300038443 | Bacteria | 2192 |
| 648 | Ga0395901_0216999 | 3300038443 | Bacteria | 2000 |
| 649 | Ga0395901_0290155 | 3300038443 | Bacteria | 1698 |
| 650 | Ga0395901_0296835 | 3300038443 | Unclassified | 1676 |
| 651 | Ga0395901_0333528 | 3300038443 | Bacteria | 1568 |
| 652 | Ga0395901_0369259 | 3300038443 | Bacteria | 1478 |
| 653 | Ga0395901_0570848 | 3300038443 | Bacteria | 1144 |
| 654 | Ga0395901_0572192 | 3300038443 | Bacteria | 1142 |
| 655 | Ga0395901_0582252 | 3300038443 | Bacteria | 1130 |
| 656 | Ga0395901_0630352 | 3300038443 | Bacteria | 1078 |
| 657 | Ga0451793_0473993 | 3300041452 | Bacteria | 1320 |
| 658 | Ga0451797_0714666 | 3300041453 | Bacteria | 1183 |
| 659 | Ga0451839_0175852 | 3300041496 | Bacteria | 5304 |
| 660 | Ga0450914_000317 | 3300042118 | Bacteria | 2077 |
| 661 | Ga0450920_001292 | 3300042122 | Bacteria | 4127 |
| 662 | Ga0450920_054645 | 3300042122 | Bacteria | 803 |
| 663 | Ga0450907_010198 | 3300042146 | Bacteria | 1560 |
| 664 | Ga0466964_0183950 | 3300044706 | Bacteria | 993 |
| 665 | Ga0451576_0007862 | 3300045051 | Bacteria | 12639 |
| 666 | Ga0495617_126941 | 3300046452 | Bacteria | 820 |
| 667 | Ga0495592_0072171 | 3300046454 | Bacteria | 2512 |
| 668 | Ga0495603_0132194 | 3300046455 | Bacteria | 1453 |
| 669 | Ga0495629_0073549 | 3300046459 | Bacteria | 2386 |
| 670 | Ga0495653_0053747 | 3300046463 | Bacteria | 3080 |
| 671 | Ga0495582_0050345 | 3300046473 | Bacteria | 2295 |
| 672 | Ga0495582_0173952 | 3300046473 | Bacteria | 1226 |
| 673 | Ga0495662_0026544 | 3300046476 | Bacteria | 2796 |
| 674 | Ga0495662_0105814 | 3300046476 | Bacteria | 1377 |
| 675 | Ga0495662_0151225 | 3300046476 | Bacteria | 1143 |
| 676 | Ga0495664_0277333 | 3300046477 | Bacteria | 1013 |
| 677 | Ga0495584_0011195 | 3300046491 | Bacteria | 4597 |
| 678 | Ga0495585_0096043 | 3300046492 | Bacteria | 1591 |
| 679 | Ga0495594_0158358 | 3300046499 | Bacteria | 1287 |
| 680 | Ga0495596_0043730 | 3300046500 | Bacteria | 1765 |
| 681 | Ga0495596_0048859 | 3300046500 | Bacteria | 1659 |
| 682 | Ga0495608_0139098 | 3300046511 | Bacteria | 1550 |
| 683 | Ga0495616_0167154 | 3300046513 | Bacteria | 986 |
| 684 | Ga0495618_0103951 | 3300046514 | Bacteria | 1819 |
| 685 | Ga0495628_0306825 | 3300046516 | Bacteria | 1174 |
| 686 | Ga0495630_0041028 | 3300046517 | Bacteria | 3457 |
| 687 | Ga0495630_0115134 | 3300046517 | Bacteria | 2038 |
| 688 | Ga0495630_0131431 | 3300046517 | Bacteria | 1901 |
| 689 | Ga0495630_0154532 | 3300046517 | Bacteria | 1746 |
| 690 | Ga0495631_0059657 | 3300046518 | Bacteria | 1657 |
| 691 | Ga0495644_0034602 | 3300046523 | Bacteria | 1907 |
| 692 | Ga0495663_0026281 | 3300046525 | Bacteria | 1704 |
| 693 | Ga0495663_0035625 | 3300046525 | Bacteria | 1495 |
| 694 | Ga0495652_0195229 | 3300046529 | Bacteria | 1541 |
| 695 | Ga0495665_0046326 | 3300046531 | Bacteria | 2309 |
| 696 | Ga0495640_0146314 | 3300046533 | Bacteria | 1520 |
| 697 | Ga0495586_0029326 | 3300046535 | Bacteria | 2944 |
| 698 | Ga0495645_0202975 | 3300046543 | Bacteria | 1343 |
| 699 | Ga0495645_0360265 | 3300046543 | Bacteria | 935 |
| 700 | Ga0495656_0143195 | 3300046615 | Bacteria | 1148 |
| 701 | Ga0495634_0186694 | 3300046642 | Bacteria | 1295 |
| 702 | Ga0495635_0216120 | 3300046663 | Bacteria | 1298 |
| 703 | Ga0495657_0044320 | 3300046675 | Bacteria | 3026 |
| 704 | Ga0495599_0087896 | 3300046678 | Bacteria | 1940 |
| 705 | Ga0495599_0503968 | 3300046678 | Bacteria | 712 |
| 706 | Ga0495658_0011093 | 3300046683 | Bacteria | 4522 |
| 707 | Ga0495658_0015987 | 3300046683 | Bacteria | 3859 |
| 708 | Ga0495613_0025954 | 3300046689 | Bacteria | 4365 |
| 709 | Ga0495613_0060240 | 3300046689 | Bacteria | 2781 |
| 710 | Ga0495613_0184611 | 3300046689 | Bacteria | 1476 |
| 711 | Ga0495624_0078805 | 3300046690 | Bacteria | 2043 |
| 712 | Ga0495670_0158444 | 3300046691 | Bacteria | 1189 |
| 713 | Ga0495589_0060625 | 3300046794 | Bacteria | 1858 |
| 714 | Ga0495581_0008682 | 3300047315 | Bacteria | 5885 |
| 715 | Ga0495674_0059241 | 3300047319 | Bacteria | 3345 |
| 716 | Ga0495674_0107422 | 3300047319 | Bacteria | 2369 |
| 717 | Ga0495674_0188296 | 3300047319 | Bacteria | 1716 |
| 718 | Ga0495676_0159803 | 3300047321 | Bacteria | 1595 |
| 719 | Ga0495684_0044097 | 3300047471 | Bacteria | 3415 |
| 720 | Ga0495684_0271452 | 3300047471 | Bacteria | 1227 |
| 721 | Ga0495593_0046156 | 3300047673 | Bacteria | 2323 |
| 722 | Ga0495602_0274571 | 3300048088 | Bacteria | 1244 |
| 723 | Ga0495626_0151912 | 3300048091 | Bacteria | 976 |
| 724 | Ga0496100_0009018 | 3300048903 | Bacteria | 5587 |
| 725 | Ga0496100_0070381 | 3300048903 | Bacteria | 2333 |
| 726 | Ga0496100_0101528 | 3300048903 | Bacteria | 1983 |
| 727 | Ga0496100_0276174 | 3300048903 | Bacteria | 1251 |
| 728 | Ga0496100_0757529 | 3300048903 | Bacteria | 759 |
| 729 | Ga0496101_0028686 | 3300048904 | Bacteria | 3888 |
| 730 | Ga0496101_0052469 | 3300048904 | Bacteria | 2940 |
| 731 | Ga0496101_0371130 | 3300048904 | Bacteria | 1125 |
| 732 | Ga0496102_0103380 | 3300048905 | Bacteria | 2649 |
| 733 | Ga0496102_0142184 | 3300048905 | Bacteria | 2250 |
| 734 | Ga0496102_0158300 | 3300048905 | Bacteria | 2130 |
| 735 | Ga0496102_0174749 | 3300048905 | Bacteria | 2022 |
| 736 | Ga0496102_0219281 | 3300048905 | Bacteria | 1793 |
| 737 | Ga0496103_0016868 | 3300048906 | Bacteria | 4361 |
| 738 | Ga0496103_0028321 | 3300048906 | Bacteria | 3399 |
| 739 | Ga0496104_0001046 | 3300048907 | Bacteria | 23659 |
| 740 | Ga0496104_0027965 | 3300048907 | Bacteria | 5222 |
| 741 | Ga0496104_0162852 | 3300048907 | Bacteria | 2139 |
| 742 | Ga0496104_0166237 | 3300048907 | Bacteria | 2116 |
| 743 | Ga0496104_0215367 | 3300048907 | Bacteria | 1832 |
| 744 | Ga0496104_0494208 | 3300048907 | Bacteria | 1135 |
| 745 | Ga0496105_0012431 | 3300048908 | Bacteria | 6740 |
| 746 | Ga0496105_0031626 | 3300048908 | Bacteria | 4338 |
| 747 | Ga0496105_0045796 | 3300048908 | Bacteria | 3609 |
| 748 | Ga0496105_0071862 | 3300048908 | Bacteria | 2860 |
| 749 | Ga0496106_0013854 | 3300048909 | Bacteria | 5958 |
| 750 | Ga0496106_0350573 | 3300048909 | Bacteria | 1186 |
| 751 | Ga0496106_0446643 | 3300048909 | Bacteria | 1039 |
| 752 | Ga0496107_0034001 | 3300048910 | Bacteria | 3649 |
| 753 | Ga0496107_0057568 | 3300048910 | Bacteria | 2810 |
| 754 | Ga0496107_0104219 | 3300048910 | Bacteria | 2081 |
| 755 | Ga0496108_0013010 | 3300048911 | Bacteria | 6779 |
| 756 | Ga0496108_0049735 | 3300048911 | Bacteria | 3506 |
| 757 | Ga0496108_0062264 | 3300048911 | Bacteria | 3142 |
| 758 | Ga0496108_0119176 | 3300048911 | Bacteria | 2263 |
| 759 | Ga0496108_0150372 | 3300048911 | Bacteria | 2009 |
| 760 | Ga0496108_0457694 | 3300048911 | Bacteria | 1115 |
| 761 | Ga0496108_0502731 | 3300048911 | Bacteria | 1059 |
| 762 | Ga0496109_0030913 | 3300048912 | Bacteria | 4801 |
| 763 | Ga0496109_0039932 | 3300048912 | Bacteria | 4249 |
| 764 | Ga0496109_0079921 | 3300048912 | Bacteria | 3013 |
| 765 | Ga0496109_0093237 | 3300048912 | Bacteria | 2786 |
| 766 | Ga0496109_0102563 | 3300048912 | Bacteria | 2655 |
| 767 | Ga0496109_0291451 | 3300048912 | Bacteria | 1539 |
| 768 | Ga0496109_0479447 | 3300048912 | Bacteria | 1174 |
| 769 | Ga0496109_0708042 | 3300048912 | Bacteria | 944 |
| 770 | Ga0496110_0000295 | 3300048913 | Bacteria | 32671 |
| 771 | Ga0496110_0009155 | 3300048913 | Bacteria | 7996 |
| 772 | Ga0496110_0064274 | 3300048913 | Bacteria | 3242 |
| 773 | Ga0496110_0071705 | 3300048913 | Bacteria | 3072 |
| 774 | Ga0496110_0285341 | 3300048913 | Bacteria | 1503 |
| 775 | Ga0496110_0297720 | 3300048913 | Bacteria | 1470 |
| 776 | Ga0496110_0303370 | 3300048913 | Bacteria | 1455 |
| 777 | Ga0496110_0324260 | 3300048913 | Bacteria | 1403 |
| 778 | Ga0496111_0008226 | 3300048914 | Bacteria | 6896 |
| 779 | Ga0496111_0010581 | 3300048914 | Bacteria | 6197 |
| 780 | Ga0496111_0016923 | 3300048914 | Bacteria | 5032 |
| 781 | Ga0496111_0047835 | 3300048914 | Bacteria | 3080 |
| 782 | Ga0496111_0050516 | 3300048914 | Bacteria | 3000 |
| 783 | Ga0496111_0097233 | 3300048914 | Bacteria | 2161 |
| 784 | Ga0496111_0100446 | 3300048914 | Bacteria | 2125 |
| 785 | Ga0496112_0067131 | 3300048915 | Bacteria | 3540 |
| 786 | Ga0496112_0173382 | 3300048915 | Bacteria | 2122 |
| 787 | Ga0496112_0375088 | 3300048915 | Bacteria | 1364 |
| 788 | Ga0496113_0058694 | 3300048916 | Bacteria | 2896 |
| 789 | Ga0496113_0290941 | 3300048916 | Bacteria | 1307 |
| 790 | Ga0496114_0000404 | 3300048917 | Bacteria | 31906 |
| 791 | Ga0496114_0037983 | 3300048917 | Bacteria | 3983 |
| 792 | Ga0496114_0076712 | 3300048917 | Bacteria | 2816 |
| 793 | Ga0496114_0083966 | 3300048917 | Bacteria | 2696 |
| 794 | Ga0496114_0147956 | 3300048917 | Bacteria | 2037 |
| 795 | Ga0496114_0148309 | 3300048917 | Bacteria | 2034 |
| 796 | Ga0496114_0198348 | 3300048917 | Bacteria | 1757 |
| 797 | Ga0496114_0382074 | 3300048917 | Bacteria | 1247 |
| 798 | Ga0496114_0585698 | 3300048917 | Bacteria | 984 |
| 799 | Ga0496115_0007180 | 3300048918 | Bacteria | 8183 |
| 800 | Ga0496115_0019498 | 3300048918 | Bacteria | 5220 |
| 801 | Ga0496115_0092445 | 3300048918 | Bacteria | 2473 |
| 802 | Ga0496115_0200575 | 3300048918 | Bacteria | 1648 |
| 803 | Ga0496115_0223042 | 3300048918 | Bacteria | 1555 |
| 804 | Ga0501031_0007339 | 3300049568 | Bacteria | 7190 |
| 805 | Ga0501031_0010960 | 3300049568 | Bacteria | 5906 |
| 806 | Ga0501031_0053362 | 3300049568 | Bacteria | 2634 |
| 807 | Ga0501031_0074991 | 3300049568 | Bacteria | 2202 |
| 808 | Ga0501031_0113116 | 3300049568 | Bacteria | 1773 |
| 809 | Ga0501032_0078220 | 3300049569 | Bacteria | 2202 |
| 810 | Ga0501032_0172332 | 3300049569 | Bacteria | 1418 |
| 811 | Ga0501033_0177960 | 3300049570 | Bacteria | 1525 |
| 812 | Ga0501034_0030500 | 3300049571 | Bacteria | 5482 |
| 813 | Ga0501034_0146006 | 3300049571 | Bacteria | 2343 |
| 814 | Ga0501036_0004976 | 3300049572 | Bacteria | 10743 |
| 815 | Ga0501036_0029982 | 3300049572 | Bacteria | 4596 |
| 816 | Ga0501036_0045256 | 3300049572 | Bacteria | 3729 |
| 817 | Ga0501036_0200978 | 3300049572 | Bacteria | 1676 |
| 818 | Ga0501036_0283366 | 3300049572 | Bacteria | 1387 |
| 819 | Ga0501036_0726864 | 3300049572 | Bacteria | 820 |
| 820 | Ga0501037_0004571 | 3300049573 | Bacteria | 10057 |
| 821 | Ga0501037_0081858 | 3300049573 | Bacteria | 2340 |
| 822 | Ga0501037_0324768 | 3300049573 | Bacteria | 1065 |
| 823 | Ga0501037_0507280 | 3300049573 | Bacteria | 818 |
| 824 | Ga0501038_0005846 | 3300049574 | Bacteria | 11379 |
| 825 | Ga0501038_0033028 | 3300049574 | Bacteria | 4559 |
| 826 | Ga0501038_0165163 | 3300049574 | Bacteria | 1796 |
| 827 | Ga0501039_0036393 | 3300049575 | Bacteria | 3798 |
| 828 | Ga0501039_0070083 | 3300049575 | Bacteria | 2724 |
| 829 | Ga0501039_0087594 | 3300049575 | Bacteria | 2426 |
| 830 | Ga0501039_0094779 | 3300049575 | Bacteria | 2327 |
| 831 | Ga0501039_0128274 | 3300049575 | Bacteria | 1990 |
| 832 | Ga0501039_0243505 | 3300049575 | Bacteria | 1414 |
| 833 | Ga0501040_0001063 | 3300049576 | Bacteria | 17384 |
| 834 | Ga0501040_0015008 | 3300049576 | Bacteria | 5118 |
| 835 | Ga0501040_0017064 | 3300049576 | Bacteria | 4816 |
| 836 | Ga0501040_0496349 | 3300049576 | Bacteria | 880 |
| 837 | Ga0501041_0000466 | 3300049577 | Bacteria | 20514 |
| 838 | Ga0501041_0239880 | 3300049577 | Bacteria | 1139 |
| 839 | Ga0501042_0010580 | 3300049578 | Bacteria | 6194 |
| 840 | Ga0501042_0021077 | 3300049578 | Bacteria | 4539 |
| 841 | Ga0501042_0035265 | 3300049578 | Bacteria | 3549 |
| 842 | Ga0501042_0205714 | 3300049578 | Bacteria | 1419 |
| 843 | Ga0501042_0255797 | 3300049578 | Unclassified | 1264 |
| 844 | Ga0501042_0304409 | 3300049578 | Bacteria | 1151 |
| 845 | Ga0501043_0006516 | 3300049579 | Bacteria | 9368 |
| 846 | Ga0501043_0087782 | 3300049579 | Bacteria | 2444 |
| 847 | Ga0501046_0008207 | 3300049580 | Bacteria | 9122 |
| 848 | Ga0501046_0018840 | 3300049580 | Bacteria | 5733 |
| 849 | Ga0501046_0060444 | 3300049580 | Bacteria | 2965 |
| 850 | Ga0501046_0167136 | 3300049580 | Bacteria | 1652 |
| 851 | Ga0501046_0315904 | 3300049580 | Bacteria | 1139 |
| 852 | Ga0501048_0009849 | 3300049582 | Bacteria | 7168 |
| 853 | Ga0501048_0030822 | 3300049582 | Bacteria | 3881 |
| 854 | Ga0501048_0042392 | 3300049582 | Bacteria | 3259 |
| 855 | Ga0501048_0061871 | 3300049582 | Bacteria | 2650 |
| 856 | Ga0501048_0091170 | 3300049582 | Bacteria | 2150 |
| 857 | Ga0501048_0211850 | 3300049582 | Bacteria | 1374 |
| 858 | Ga0501048_0708054 | 3300049582 | Bacteria | 723 |
| 859 | Ga0501067_0005124 | 3300049583 | Bacteria | 7279 |
| 860 | Ga0501067_0006112 | 3300049583 | Bacteria | 6676 |
| 861 | Ga0501067_0009166 | 3300049583 | Bacteria | 5480 |
| 862 | Ga0501067_0011144 | 3300049583 | Bacteria | 4973 |
| 863 | Ga0501067_0024345 | 3300049583 | Bacteria | 3358 |
| 864 | Ga0501067_0082470 | 3300049583 | Bacteria | 1783 |
| 865 | Ga0501067_0193202 | 3300049583 | Bacteria | 1134 |
| 866 | Ga0501068_0007174 | 3300049584 | Bacteria | 6173 |
| 867 | Ga0501068_0008320 | 3300049584 | Bacteria | 5767 |
| 868 | Ga0501068_0008939 | 3300049584 | Bacteria | 5591 |
| 869 | Ga0501068_0047196 | 3300049584 | Bacteria | 2598 |
| 870 | Ga0501068_0072266 | 3300049584 | Bacteria | 2107 |
| 871 | Ga0501068_0088671 | 3300049584 | Bacteria | 1906 |
| 872 | Ga0501068_0251459 | 3300049584 | Bacteria | 1126 |
| 873 | Ga0501068_0275512 | 3300049584 | Bacteria | 1075 |
| 874 | Ga0501069_0002218 | 3300049585 | Bacteria | 9794 |
| 875 | Ga0501069_0002680 | 3300049585 | Bacteria | 9092 |
| 876 | Ga0501069_0003452 | 3300049585 | Bacteria | 8129 |
| 877 | Ga0501069_0049249 | 3300049585 | Bacteria | 2341 |
| 878 | Ga0501069_0083374 | 3300049585 | Bacteria | 1802 |
| 879 | Ga0501069_0128751 | 3300049585 | Bacteria | 1449 |
| 880 | Ga0501069_0205711 | 3300049585 | Bacteria | 1141 |
| 881 | Ga0501070_0005645 | 3300049586 | Bacteria | 10670 |
| 882 | Ga0501070_0010504 | 3300049586 | Bacteria | 7828 |
| 883 | Ga0501070_0034156 | 3300049586 | Bacteria | 4254 |
| 884 | Ga0501071_0004962 | 3300049587 | Bacteria | 8496 |
| 885 | Ga0501071_0029161 | 3300049587 | Bacteria | 3893 |
| 886 | Ga0501071_0081291 | 3300049587 | Bacteria | 2371 |
| 887 | Ga0501071_0106859 | 3300049587 | Bacteria | 2066 |
| 888 | Ga0501071_0129431 | 3300049587 | Unclassified | 1874 |
| 889 | Ga0501071_0136001 | 3300049587 | Bacteria | 1829 |
| 890 | Ga0501071_0151465 | 3300049587 | Bacteria | 1730 |
| 891 | Ga0501071_0221342 | 3300049587 | Bacteria | 1424 |
| 892 | Ga0501072_0006637 | 3300049588 | Bacteria | 8804 |
| 893 | Ga0501072_0009384 | 3300049588 | Bacteria | 7442 |
| 894 | Ga0501072_0025255 | 3300049588 | Bacteria | 4628 |
| 895 | Ga0501072_0043065 | 3300049588 | Bacteria | 3548 |
| 896 | Ga0501072_0071622 | 3300049588 | Bacteria | 2739 |
| 897 | Ga0501072_0127481 | 3300049588 | Bacteria | 2028 |
| 898 | Ga0501072_0482866 | 3300049588 | Bacteria | 980 |
| 899 | Ga0501074_0007089 | 3300049590 | Bacteria | 8099 |
| 900 | Ga0501074_0022238 | 3300049590 | Bacteria | 4608 |
| 901 | Ga0501074_0046332 | 3300049590 | Bacteria | 3144 |
| 902 | Ga0501074_0049142 | 3300049590 | Bacteria | 3045 |
| 903 | Ga0501074_0167593 | 3300049590 | Bacteria | 1568 |
| 904 | Ga0501074_0297922 | 3300049590 | Bacteria | 1146 |
| 905 | Ga0501075_0012643 | 3300049591 | Bacteria | 6003 |
| 906 | Ga0501075_0037516 | 3300049591 | Bacteria | 3621 |
| 907 | Ga0501075_0043085 | 3300049591 | Bacteria | 3385 |
| 908 | Ga0501075_0107501 | 3300049591 | Bacteria | 2120 |
| 909 | Ga0501075_0112269 | 3300049591 | Bacteria | 2072 |
| 910 | Ga0501075_0127824 | 3300049591 | Bacteria | 1935 |
| 911 | Ga0501076_0061176 | 3300049592 | Bacteria | 2997 |
| 912 | Ga0501076_0061234 | 3300049592 | Bacteria | 2995 |
| 913 | Ga0501076_0136053 | 3300049592 | Bacteria | 1994 |
| 914 | Ga0501076_0142405 | 3300049592 | Bacteria | 1948 |
| 915 | Ga0501076_0170815 | 3300049592 | Bacteria | 1772 |
| 916 | Ga0501076_0216276 | 3300049592 | Bacteria | 1566 |
| 917 | Ga0501076_0225651 | 3300049592 | Bacteria | 1531 |
| 918 | Ga0501076_0243173 | 3300049592 | Unclassified | 1472 |
| 919 | Ga0501077_0015950 | 3300049593 | Bacteria | 4733 |
| 920 | Ga0501077_0017722 | 3300049593 | Bacteria | 4498 |
| 921 | Ga0501077_0029539 | 3300049593 | Bacteria | 3485 |
| 922 | Ga0501077_0035552 | 3300049593 | Bacteria | 3171 |
| 923 | Ga0501077_0047453 | 3300049593 | Unclassified | 2729 |
| 924 | Ga0501077_0447151 | 3300049593 | Bacteria | 827 |
| 925 | Ga0501079_0000537 | 3300049741 | Bacteria | 24664 |
| 926 | Ga0501079_0013666 | 3300049741 | Bacteria | 6191 |
| 927 | Ga0501079_0033613 | 3300049741 | Bacteria | 3945 |
| 928 | Ga0501079_0064770 | 3300049741 | Bacteria | 2819 |
| 929 | Ga0501079_0080710 | 3300049741 | Bacteria | 2515 |
| 930 | Ga0501079_0167787 | 3300049741 | Bacteria | 1712 |
| 931 | Ga0501079_0257300 | 3300049741 | Unclassified | 1364 |
| 932 | Ga0501079_0271347 | 3300049741 | Bacteria | 1326 |
| 933 | Ga0501079_0505941 | 3300049741 | Bacteria | 950 |
| 934 | Ga0501080_0002754 | 3300049742 | Bacteria | 15436 |
| 935 | Ga0501080_0003599 | 3300049742 | Bacteria | 13644 |
| 936 | Ga0501080_0015752 | 3300049742 | Bacteria | 6973 |
| 937 | Ga0501080_0068930 | 3300049742 | Bacteria | 3290 |
| 938 | Ga0501080_0128562 | 3300049742 | Bacteria | 2345 |
| 939 | Ga0501080_0231452 | 3300049742 | Bacteria | 1689 |
| 940 | Ga0501080_0291798 | 3300049742 | Bacteria | 1481 |
| 941 | Ga0501080_0450261 | 3300049742 | Bacteria | 1154 |
| 942 | Ga0501081_0006066 | 3300049743 | Bacteria | 7831 |
| 943 | Ga0501081_0027074 | 3300049743 | Bacteria | 3870 |
| 944 | Ga0501081_0045790 | 3300049743 | Bacteria | 3004 |
| 945 | Ga0501081_0126117 | 3300049743 | Bacteria | 1826 |
| 946 | Ga0501083_0000996 | 3300049744 | Bacteria | 18826 |
| 947 | Ga0501083_0018367 | 3300049744 | Bacteria | 4873 |
| 948 | Ga0501083_0058489 | 3300049744 | Bacteria | 2579 |
| 949 | Ga0501083_0072652 | 3300049744 | Bacteria | 2286 |
| 950 | Ga0501083_0325730 | 3300049744 | Bacteria | 999 |
| 951 | Ga0501035_0042730 | 3300049822 | Bacteria | 4087 |
| 952 | Ga0501035_0102468 | 3300049822 | Bacteria | 2511 |
| 953 | Ga0501035_0131905 | 3300049822 | Bacteria | 2177 |
| 954 | Ga0501035_0340987 | 3300049822 | Bacteria | 1256 |
| 955 | Ga0501035_0486808 | 3300049822 | Bacteria | 1017 |
| 956 | Ga0501044_0018412 | 3300049823 | Bacteria | 7482 |
| 957 | Ga0501044_0745019 | 3300049823 | Bacteria | 862 |
| 958 | Ga0501045_0035783 | 3300049824 | Bacteria | 3605 |
| 959 | Ga0501045_0088296 | 3300049824 | Bacteria | 2290 |
| 960 | Ga0501045_0092490 | 3300049824 | Bacteria | 2237 |
| 961 | Ga0501045_0173197 | 3300049824 | Bacteria | 1607 |
| 962 | Ga0501045_0221262 | 3300049824 | Unclassified | 1410 |
| 963 | nmdc:mga05p37_20324_c1 | 3300050507 | Bacteria | 8034 |
| 964 | nmdc:mga05p37_272750_c1 | 3300050507 | Bacteria | 2020 |
| 965 | nmdc:mga05p37_67744_c1 | 3300050507 | Bacteria | 4391 |
| 966 | nmdc:mga09592_128469_c1 | 3300050508 | Bacteria | 2180 |
| 967 | nmdc:mga09592_187596_c1 | 3300050508 | Bacteria | 1789 |
| 968 | nmdc:mga09592_47721_c1 | 3300050508 | Bacteria | 3610 |
| 969 | nmdc:mga0qj67_249226_c1 | 3300050509 | Bacteria | 1441 |
| 970 | nmdc:mga0qj67_3277_c1 | 3300050509 | Bacteria | 11661 |
| 971 | nmdc:mga06r32_225699_c1 | 3300050510 | Bacteria | 1862 |
| 972 | nmdc:mga08y16_21711_c1 | 3300050511 | Bacteria | 6776 |
| 973 | nmdc:mga08y16_24706_c1 | 3300050511 | Bacteria | 6341 |
| 974 | nmdc:mga08y16_302723_c1 | 3300050511 | Bacteria | 1648 |
| 975 | nmdc:mga08y16_33448_c1 | 3300050511 | Archaea | 5399 |
| 976 | nmdc:mga08y16_34597_c1 | 3300050511 | Bacteria | 5308 |
| 977 | nmdc:mga08y16_389339_c1 | 3300050511 | Archaea | 1428 |
| 978 | nmdc:mga08y16_7680_c1 | 3300050511 | Bacteria | 11288 |
| 979 | nmdc:mga08y16_81708_c1 | 3300050511 | Bacteria | 3369 |
| 980 | nmdc:mga08y16_92784_c1 | 3300050511 | Bacteria | 3146 |
| 981 | nmdc:mga0n895_175113_c1 | 3300050512 | Bacteria | 2176 |
| 982 | nmdc:mga0n895_558215_c1 | 3300050512 | Bacteria | 1150 |
| 983 | nmdc:mga0rr50_76102_c1 | 3300050513 | Bacteria | 2575 |
| 984 | nmdc:mga08x19_136287_c1 | 3300050514 | Bacteria | 1655 |
| 985 | nmdc:mga0a205_131572_c1 | 3300050515 | Bacteria | 2402 |
| 986 | nmdc:mga0a205_231606_c1 | 3300050515 | Bacteria | 1730 |
| 987 | nmdc:mga0a205_34826_c1 | 3300050515 | Bacteria | 4833 |
| 988 | nmdc:mga0a205_410977_c1 | 3300050515 | Bacteria | 1216 |
| 989 | Ga0495655_0025093 | 3300053083 | Bacteria | 1391 |
| 990 | Ga0495595_0042401 | 3300053084 | Bacteria | 2084 |
| 991 | Ga0495595_0177396 | 3300053084 | Bacteria | 1056 |
| 992 | Ga0495619_0158867 | 3300053085 | Bacteria | 1561 |
| 993 | Ga0501084_0005644 | 3300054114 | Bacteria | 10274 |
| 994 | Ga0501084_0021851 | 3300054114 | Bacteria | 5336 |
| 995 | Ga0501084_0054182 | 3300054114 | Bacteria | 3355 |
| 996 | Ga0501084_0105831 | 3300054114 | Bacteria | 2363 |
| 997 | Ga0501084_0126030 | 3300054114 | Bacteria | 2155 |
| 998 | Ga0501084_0184469 | 3300054114 | Bacteria | 1761 |
| 999 | Ga0501084_0200803 | 3300054114 | Bacteria | 1682 |
| 1000 | Ga0501082_0084568 | 3300060353 | Bacteria | 2736 |
| 1001 | Ga0501082_0094642 | 3300060353 | Bacteria | 2581 |
| 1002 | Ga0501082_0115336 | 3300060353 | Bacteria | 2326 |
| 1003 | Ga0501082_0116947 | 3300060353 | Bacteria | 2309 |
| 1004 | Ga0501082_0149040 | 3300060353 | Bacteria | 2032 |
| 1005 | Ga0501082_0203609 | 3300060353 | Bacteria | 1722 |
| 1006 | Ga0501082_0395718 | 3300060353 | Bacteria | 1205 |
| 1007 | Ga0530510_0005979 | 3300061734 | Bacteria | 8441 |
| 1008 | Ga0530510_0011844 | 3300061734 | Bacteria | 6121 |
| 1009 | Ga0530510_0018951 | 3300061734 | Bacteria | 4880 |
| 1010 | Ga0530510_0051929 | 3300061734 | Bacteria | 2963 |
| 1011 | Ga0530510_0081235 | 3300061734 | Bacteria | 2360 |
| 1012 | Ga0530510_0096953 | 3300061734 | Bacteria | 2155 |
| 1013 | Ga0530510_0100363 | 3300061734 | Bacteria | 2116 |
| 1014 | Ga0530510_0195102 | 3300061734 | Bacteria | 1503 |
| 1015 | Ga0530510_0212723 | 3300061734 | Bacteria | 1436 |
| 1016 | Ga0530510_0249348 | 3300061734 | Bacteria | 1323 |
| 1017 | Ga0530510_0323110 | 3300061734 | Bacteria | 1157 |
| 1018 | Ga0530510_0454632 | 3300061734 | Bacteria | 968 |
| 1019 | Ga0501080_0095109 | |||
| 1020 | rootL2_10099212 | |||
| 1021 | Ga0070658_10004765 | |||
| 1022 | Ga0070658_10086058 | |||
| 1023 | Ga0070676_10026767 | |||
| 1024 | Ga0070676_10167866 | |||
| 1025 | Ga0070676_10179284 | |||
| 1026 | Ga0070676_10293952 | |||
| 1027 | Ga0070683_100005772 | |||
| 1028 | Ga0070683_100012389 | |||
| 1029 | Ga0070683_100065532 | |||
| 1030 | Ga0070683_100103692 | |||
| 1031 | Ga0070683_100135741 | |||
| 1032 | Ga0070670_100031582 | |||
| 1033 | Ga0070670_100084270 | |||
| 1034 | Ga0068869_100010642 | |||
| 1035 | Ga0068869_100031540 | |||
| 1036 | Ga0070680_100005763 | |||
| 1037 | Ga0070680_100008081 | |||
| 1038 | Ga0070680_100010423 | |||
| 1039 | Ga0070680_100297640 | |||
| 1040 | Ga0070682_100002294 | |||
| 1041 | Ga0070682_100049355 | |||
| 1042 | Ga0070682_100510904 | |||
| 1043 | Ga0068868_100034864 | |||
| 1044 | Ga0068868_100052010 | |||
| 1045 | Ga0068868_100059253 | |||
| 1046 | Ga0068868_100156836 | |||
| 1047 | Ga0068868_100492841 | |||
| 1048 | Ga0070660_100080234 | |||
| 1049 | Ga0070660_100163102 | |||
| 1050 | Ga0070660_100276745 | |||
| 1051 | Ga0070660_100330238 | |||
| 1052 | Ga0070689_100024563 | |||
| 1053 | Ga0070689_100037506 | |||
| 1054 | Ga0070691_10003581 | |||
| 1055 | Ga0070691_10124598 | |||
| 1056 | Ga0070691_10184418 | |||
| 1057 | Ga0070661_100051472 | |||
| 1058 | Ga0070661_100067152 | |||
| 1059 | Ga0070661_100076790 | |||
| 1060 | Ga0070661_100153149 | |||
| 1061 | Ga0070661_100250106 | |||
| 1062 | Ga0070692_10003307 | |||
| 1063 | Ga0070692_10438106 | |||
| 1064 | Ga0070668_100084254 | |||
| 1065 | Ga0070668_100099293 | |||
| 1066 | Ga0070668_100754541 | |||
| 1067 | Ga0070669_100189943 | |||
| 1068 | Ga0070675_100036451 | |||
| 1069 | Ga0070675_100036695 | |||
| 1070 | Ga0070675_100373520 | |||
| 1071 | Ga0070671_100402621 | |||
| 1072 | Ga0070671_100466950 | |||
| 1073 | Ga0070674_100002032 | |||
| 1074 | Ga0070674_100008473 | |||
| 1075 | Ga0070674_100126887 | |||
| 1076 | Ga0070674_100405547 | |||
| 1077 | Ga0070674_100462233 | |||
| 1078 | Ga0070674_100666656 | |||
| 1079 | Ga0070673_100021200 | |||
| 1080 | Ga0070673_100122262 | |||
| 1081 | Ga0070688_100005633 | |||
| 1082 | Ga0070659_100036838 | |||
| 1083 | Ga0070659_100040918 | |||
| 1084 | Ga0070659_100079498 | |||
| 1085 | Ga0070659_100701771 | |||
| 1086 | Ga0070667_100285637 | |||
| 1087 | Ga0070713_100277904 | |||
| 1088 | Ga0070710_10018750 | |||
| 1089 | Ga0070701_10043794 | |||
| 1090 | Ga0070701_10472644 | |||
| 1091 | Ga0070711_100636502 | |||
| 1092 | Ga0070705_100059374 | |||
| 1093 | Ga0070705_100181595 | |||
| 1094 | Ga0070705_100422257 | |||
| 1095 | Ga0070700_100048035 | |||
| 1096 | Ga0070700_100269434 | |||
| 1097 | Ga0070694_100175481 | |||
| 1098 | Ga0070694_100222669 | |||
| 1099 | Ga0070663_100044664 | |||
| 1100 | Ga0070663_100095726 | |||
| 1101 | Ga0070663_100183438 | |||
| 1102 | Ga0070663_100600045 | |||
| 1103 | Ga0070678_100005380 | |||
| 1104 | Ga0070678_100067132 | |||
| 1105 | Ga0070678_100228234 | |||
| 1106 | Ga0070662_100044687 | |||
| 1107 | Ga0070662_100117956 | |||
| 1108 | Ga0070662_100128377 | |||
| 1109 | Ga0070662_100159033 | |||
| 1110 | Ga0070662_100249379 | |||
| 1111 | Ga0070681_10001517 | |||
| 1112 | Ga0070681_10004737 | |||
| 1113 | Ga0070681_10125268 | |||
| 1114 | Ga0068867_100107768 | |||
| 1115 | Ga0068867_100370152 | |||
| 1116 | Ga0070685_10015996 | |||
| 1117 | Ga0070685_10336061 | |||
| 1118 | Ga0070706_100021988 | |||
| 1119 | Ga0070706_100034884 | |||
| 1120 | Ga0070706_100403180 | |||
| 1121 | Ga0070707_100030912 | |||
| 1122 | Ga0070707_100310380 | |||
| 1123 | Ga0070707_100563906 | |||
| 1124 | Ga0070707_100776191 | |||
| 1125 | Ga0070698_100077888 | |||
| 1126 | Ga0070698_100128764 | |||
| 1127 | Ga0070698_100141121 | |||
| 1128 | Ga0070699_100081291 | |||
| 1129 | Ga0070679_100001190 | |||
| 1130 | Ga0070679_100016991 | |||
| 1131 | Ga0070679_100037940 | |||
| 1132 | Ga0070679_100088815 | |||
| 1133 | Ga0070679_100412752 | |||
| 1134 | Ga0070684_100002475 | |||
| 1135 | Ga0070684_100008837 | |||
| 1136 | Ga0070684_100024169 | |||
| 1137 | Ga0070684_100024713 | |||
| 1138 | Ga0070684_100024877 | |||
| 1139 | Ga0070684_100101946 | |||
| 1140 | Ga0070684_100250235 | |||
| 1141 | Ga0070684_100368760 | |||
| 1142 | Ga0070684_100588799 | |||
| 1143 | Ga0070684_100726344 | |||
| 1144 | Ga0070697_100082256 | |||
| 1145 | Ga0068853_100206615 | |||
| 1146 | Ga0068853_100584358 | |||
| 1147 | Ga0070672_100028983 | |||
| 1148 | Ga0070672_100079614 | |||
| 1149 | Ga0070686_100038012 | |||
| 1150 | Ga0070686_100078344 | |||
| 1151 | Ga0070686_100115428 | |||
| 1152 | Ga0070686_100356461 | |||
| 1153 | Ga0070695_100202648 | |||
| 1154 | Ga0070696_100060253 | |||
| 1155 | Ga0070696_100101570 | |||
| 1156 | Ga0070696_100262181 | |||
| 1157 | Ga0070696_100446318 | |||
| 1158 | Ga0070693_100009137 | |||
| 1159 | Ga0070704_100053064 | |||
| 1160 | Ga0070704_100328936 | |||
| 1161 | Ga0068855_100016986 | |||
| 1162 | Ga0068855_100067944 | |||
| 1163 | Ga0068855_100131542 | |||
| 1164 | Ga0068855_100380205 | |||
| 1165 | Ga0070664_100031006 | |||
| 1166 | Ga0070664_100060615 | |||
| 1167 | Ga0070664_100107551 | |||
| 1168 | Ga0070664_100187769 | |||
| 1169 | Ga0070664_100328019 | |||
| 1170 | Ga0068857_100007616 | |||
| 1171 | Ga0068857_100050082 | |||
| 1172 | Ga0068857_100089263 | |||
| 1173 | Ga0068857_100137000 | |||
| 1174 | Ga0068857_100432927 | |||
| 1175 | Ga0068854_100071737 | |||
| 1176 | Ga0068854_100533796 | |||
| 1177 | Ga0068854_100539171 | |||
| 1178 | Ga0068856_100109460 | |||
| 1179 | Ga0068856_100118802 | |||
| 1180 | Ga0068856_100155924 | |||
| 1181 | Ga0068856_100598200 | |||
| 1182 | Ga0068856_100888157 | |||
| 1183 | Ga0070702_100005742 | |||
| 1184 | Ga0070702_100029720 | |||
| 1185 | Ga0070702_100035607 | |||
| 1186 | Ga0070702_100036891 | |||
| 1187 | Ga0070702_100099911 | |||
| 1188 | Ga0070702_100463382 | |||
| 1189 | Ga0068852_100071478 | |||
| 1190 | Ga0068852_100099241 | |||
| 1191 | Ga0068852_100406649 | |||
| 1192 | Ga0068859_100097340 | |||
| 1193 | Ga0068864_100103952 | |||
| 1194 | Ga0068864_100877312 | |||
| 1195 | Ga0068866_10036430 | |||
| 1196 | Ga0068866_10169333 | |||
| 1197 | Ga0068866_10253886 | |||
| 1198 | Ga0068861_100067564 | |||
| 1199 | Ga0068861_100104809 | |||
| 1200 | Ga0068861_100293037 | |||
| 1201 | Ga0068861_100339847 | |||
| 1202 | Ga0068870_10013168 | |||
| 1203 | Ga0068870_10034050 | |||
| 1204 | Ga0068870_10213439 | |||
| 1205 | Ga0068863_100125580 | |||
| 1206 | Ga0068858_100025329 | |||
| 1207 | Ga0068858_100704322 | |||
| 1208 | Ga0068860_100024509 | |||
| 1209 | Ga0068860_100222744 | |||
| 1210 | Ga0068862_100255312 | |||
| 1211 | Ga0068862_100342618 | |||
| 1212 | Ga0081455_10051443 | |||
| 1213 | Ga0081455_10068601 | |||
| 1214 | Ga0081455_10160058 | |||
| 1215 | Ga0081538_10000864 | |||
| 1216 | Ga0081538_10073956 | |||
| 1217 | Ga0081539_10000335 | |||
| 1218 | Ga0081539_10002145 | |||
| 1219 | Ga0075365_10344928 | |||
| 1220 | Ga0070715_10088246 | |||
| 1221 | Ga0070716_100014516 | |||
| 1222 | Ga0070712_100318071 | |||
| 1223 | Ga0097621_100048186 | |||
| 1224 | Ga0097621_100100644 | |||
| 1225 | Ga0068871_100048540 | |||
| 1226 | Ga0068871_100102278 | |||
| 1227 | Ga0068871_100133981 | |||
| 1228 | Ga0068871_100423798 | |||
| 1229 | Ga0068871_100555776 | |||
| 1230 | Ga0075428_100002047 | |||
| 1231 | Ga0075428_100011263 | |||
| 1232 | Ga0075428_100032480 | |||
| 1233 | Ga0075428_100212214 | |||
| 1234 | Ga0075428_100501347 | |||
| 1235 | Ga0075430_100202570 | |||
| 1236 | Ga0075431_100030532 | |||
| 1237 | Ga0075431_100113531 | |||
| 1238 | Ga0075433_10016304 | |||
| 1239 | Ga0075433_10225331 | |||
| 1240 | Ga0075433_10417220 | |||
| 1241 | Ga0075434_100105583 | |||
| 1242 | Ga0075434_100113787 | |||
| 1243 | Ga0075434_100159330 | |||
| 1244 | Ga0075434_100212172 | |||
| 1245 | Ga0075429_100005788 | |||
| 1246 | Ga0075429_100043183 | |||
| 1247 | Ga0068865_100023535 | |||
| 1248 | Ga0068865_100027824 | |||
| 1249 | Ga0068865_100149223 | |||
| 1250 | Ga0068865_100167534 | |||
| 1251 | Ga0068865_100223999 | |||
| 1252 | Ga0068865_100387028 | |||
| 1253 | Ga0075436_100143469 | |||
| 1254 | Ga0097620_100097341 | |||
| 1255 | Ga0075435_100012074 | |||
| 1256 | Ga0075435_100053353 | |||
| 1257 | Ga0105240_10277841 | |||
| 1258 | Ga0111539_10009767 | |||
| 1259 | Ga0111539_10016431 | |||
| 1260 | Ga0111539_10024626 | |||
| 1261 | Ga0111539_10046165 | |||
| 1262 | Ga0111539_10055201 | |||
| 1263 | Ga0111539_10068708 | |||
| 1264 | Ga0111539_10105489 | |||
| 1265 | Ga0111539_10179571 | |||
| 1266 | Ga0111539_10390483 | |||
| 1267 | Ga0111539_10499974 | |||
| 1268 | Ga0111539_10665866 | |||
| 1269 | Ga0105245_10001062 | |||
| 1270 | Ga0105245_10002157 | |||
| 1271 | Ga0105245_10067307 | |||
| 1272 | Ga0105245_10087090 | |||
| 1273 | Ga0105245_10111003 | |||
| 1274 | Ga0105245_10204327 | |||
| 1275 | Ga0105245_10291126 | |||
| 1276 | Ga0105245_10316254 | |||
| 1277 | Ga0105247_10322562 | |||
| 1278 | Ga0105247_10552332 | |||
| 1279 | Ga0114129_10005183 | |||
| 1280 | Ga0114129_10005445 | |||
| 1281 | Ga0114129_10010791 | |||
| 1282 | Ga0114129_10104620 | |||
| 1283 | Ga0114129_10107714 | |||
| 1284 | Ga0114129_10118542 | |||
| 1285 | Ga0114129_10264284 | |||
| 1286 | Ga0105243_10016866 | |||
| 1287 | Ga0105243_10040653 | |||
| 1288 | Ga0105243_10064486 | |||
| 1289 | Ga0105243_10113806 | |||
| 1290 | Ga0105243_10141417 | |||
| 1291 | Ga0105243_10383719 | |||
| 1292 | Ga0105243_10531864 | |||
| 1293 | Ga0105241_10027993 | |||
| 1294 | Ga0105242_10036222 | |||
| 1295 | Ga0105242_10047661 | |||
| 1296 | Ga0105242_10055716 | |||
| 1297 | Ga0105242_10201103 | |||
| 1298 | Ga0105242_10283246 | |||
| 1299 | Ga0105242_10417621 | |||
| 1300 | Ga0105242_10458557 | |||
| 1301 | Ga0105242_11171632 | |||
| 1302 | Ga0105248_10058256 | |||
| 1303 | Ga0105248_10148313 | |||
| 1304 | Ga0105237_10636358 | |||
| 1305 | Ga0105237_10805726 | |||
| 1306 | Ga0105238_10133139 | |||
| 1307 | Ga0105238_10300461 | |||
| 1308 | Ga0105249_10129018 | |||
| 1309 | Ga0105249_10235068 | |||
| 1310 | Ga0105249_10672819 | |||
| 1311 | Ga0105249_10741675 | |||
| 1312 | Ga0105249_10825122 | |||
| 1313 | Ga0105239_10017706 | |||
| 1314 | Ga0105239_10020919 | |||
| 1315 | Ga0105239_10025303 | |||
| 1316 | Ga0105239_10028808 | |||
| 1317 | Ga0105239_10111840 | |||
| 1318 | Ga0105239_10277086 | |||
| 1319 | Ga0105239_11090932 | |||
| 1320 | Ga0105246_10009303 | |||
| 1321 | Ga0105246_10042153 | |||
| 1322 | Ga0105246_10050709 | |||
| 1323 | Ga0105246_10057684 | |||
| 1324 | Ga0105246_10123370 | |||
| 1325 | Ga0105246_10255676 | |||
| 1326 | Ga0105246_10873452 | |||
| 1327 | Ga0157341_1007043 | |||
| 1328 | Ga0157373_10199783 | |||
| 1329 | Ga0157371_10071269 | |||
| 1330 | Ga0157370_10006695 | |||
| 1331 | Ga0157369_10014930 | |||
| 1332 | Ga0157369_10731538 | |||
| 1333 | Ga0157374_10070941 | |||
| 1334 | Ga0157374_10124652 | |||
| 1335 | Ga0163162_10344805 | |||
| 1336 | Ga0163162_10573016 | |||
| 1337 | Ga0157372_10133503 | |||
| 1338 | Ga0157372_10605639 | |||
| 1339 | Ga0157375_10056095 | |||
| 1340 | Ga0157375_10085648 | |||
| 1341 | Ga0157375_10130463 | |||
| 1342 | Ga0157375_10192454 | |||
| 1343 | Ga0157375_10235832 | |||
| 1344 | Ga0157375_10292540 | |||
| 1345 | Ga0157375_10856120 | |||
| 1346 | Ga0163163_10161460 | |||
| 1347 | Ga0163163_10181762 | |||
| 1348 | Ga0163163_10205294 | |||
| 1349 | Ga0163163_10372728 | |||
| 1350 | Ga0163163_10845488 | |||
| 1351 | Ga0157380_10021075 | |||
| 1352 | Ga0157380_10081214 | |||
| 1353 | Ga0182008_10078544 | |||
| 1354 | Ga0157377_10001184 | |||
| 1355 | Ga0157377_10035537 | |||
| 1356 | Ga0157377_10038092 | |||
| 1357 | Ga0157377_10200628 | |||
| 1358 | Ga0157379_10265167 | |||
| 1359 | Ga0157379_10267048 | |||
| 1360 | Ga0157376_10033194 | |||
| 1361 | Ga0157376_10088042 | |||
| 1362 | Ga0157376_10403431 | |||
| 1363 | Ga0157376_10542636 | |||
| 1364 | Ga0163161_10051318 | |||
| 1365 | Ga0163161_10154864 | |||
| 1366 | Ga0163161_10203324 | |||
| 1367 | Ga0206356_10519479 | |||
| 1368 | Ga0206354_11677922 | |||
| 1369 | Ga0206354_11697263 | |||
| 1370 | Ga0206353_10850478 | |||
| 1371 | Ga0207653_10020832 | |||
| 1372 | Ga0207688_10001835 | |||
| 1373 | Ga0207688_10004340 | |||
| 1374 | Ga0207688_10033454 | |||
| 1375 | Ga0207688_10039174 | |||
| 1376 | Ga0207645_10054398 | |||
| 1377 | Ga0207645_10111569 | |||
| 1378 | Ga0207645_10184451 | |||
| 1379 | Ga0207645_10223276 | |||
| 1380 | Ga0207643_10006658 | |||
| 1381 | Ga0207705_10008932 | |||
| 1382 | Ga0207705_10039721 | |||
| 1383 | Ga0207705_10341037 | |||
| 1384 | Ga0207684_10079151 | |||
| 1385 | Ga0207654_10019326 | |||
| 1386 | Ga0207707_10009308 | |||
| 1387 | Ga0207707_10094803 | |||
| 1388 | Ga0207693_10013387 | |||
| 1389 | Ga0207693_10050718 | |||
| 1390 | Ga0207693_10135568 | |||
| 1391 | Ga0207663_10124941 | |||
| 1392 | Ga0207660_10051804 | |||
| 1393 | Ga0207660_10080233 | |||
| 1394 | Ga0207660_10549487 | |||
| 1395 | Ga0207662_10004444 | |||
| 1396 | Ga0207662_10212834 | |||
| 1397 | Ga0207657_10000331 | |||
| 1398 | Ga0207657_10025168 | |||
| 1399 | Ga0207657_10053881 | |||
| 1400 | Ga0207657_10080926 | |||
| 1401 | Ga0207649_10021808 | |||
| 1402 | Ga0207649_10086001 | |||
| 1403 | Ga0207652_10001925 | |||
| 1404 | Ga0207652_10043109 | |||
| 1405 | Ga0207652_10046367 | |||
| 1406 | Ga0207652_10106640 | |||
| 1407 | Ga0207652_10112775 | |||
| 1408 | Ga0207652_10325010 | |||
| 1409 | Ga0207646_10008016 | |||
| 1410 | Ga0207681_10039033 | |||
| 1411 | Ga0207681_10408711 | |||
| 1412 | Ga0207650_10288980 | |||
| 1413 | Ga0207659_10048085 | |||
| 1414 | Ga0207659_10122809 | |||
| 1415 | Ga0207687_10002663 | |||
| 1416 | Ga0207687_10009887 | |||
| 1417 | Ga0207687_10046460 | |||
| 1418 | Ga0207687_10048563 | |||
| 1419 | Ga0207687_10120306 | |||
| 1420 | Ga0207687_10248966 | |||
| 1421 | Ga0207687_10586456 | |||
| 1422 | Ga0207644_10459076 | |||
| 1423 | Ga0207644_10589779 | |||
| 1424 | Ga0207690_10019468 | |||
| 1425 | Ga0207690_10191601 | |||
| 1426 | Ga0207690_10586538 | |||
| 1427 | Ga0207706_10009833 | |||
| 1428 | Ga0207706_10011879 | |||
| 1429 | Ga0207706_10048847 | |||
| 1430 | Ga0207706_10100741 | |||
| 1431 | Ga0207706_10123423 | |||
| 1432 | Ga0207706_10265005 | |||
| 1433 | Ga0207706_10314272 | |||
| 1434 | Ga0207686_10144898 | |||
| 1435 | Ga0207686_10280393 | |||
| 1436 | Ga0207686_10367634 | |||
| 1437 | Ga0207686_10576513 | |||
| 1438 | Ga0207709_10042641 | |||
| 1439 | Ga0207709_10117165 | |||
| 1440 | Ga0207709_10156024 | |||
| 1441 | Ga0207670_10070713 | |||
| 1442 | Ga0207670_10650500 | |||
| 1443 | Ga0207669_10002692 | |||
| 1444 | Ga0207669_10094000 | |||
| 1445 | Ga0207669_10250502 | |||
| 1446 | Ga0207669_10372653 | |||
| 1447 | Ga0207669_10406684 | |||
| 1448 | Ga0207704_10123178 | |||
| 1449 | Ga0207704_10186866 | |||
| 1450 | Ga0207665_10002419 | |||
| 1451 | Ga0207691_10048589 | |||
| 1452 | Ga0207691_10073189 | |||
| 1453 | Ga0207691_10076997 | |||
| 1454 | Ga0207689_10070737 | |||
| 1455 | Ga0207689_10130222 | |||
| 1456 | Ga0207689_10378931 | |||
| 1457 | Ga0207661_10000167 | |||
| 1458 | Ga0207661_10006848 | |||
| 1459 | Ga0207661_10007021 | |||
| 1460 | Ga0207661_10043819 | |||
| 1461 | Ga0207661_10052224 | |||
| 1462 | Ga0207661_10137932 | |||
| 1463 | Ga0207679_10080677 | |||
| 1464 | Ga0207679_10204094 | |||
| 1465 | Ga0207679_10217449 | |||
| 1466 | Ga0207679_10371411 | |||
| 1467 | Ga0207667_10109164 | |||
| 1468 | Ga0207667_10228425 | |||
| 1469 | Ga0207667_10327043 | |||
| 1470 | Ga0207667_10558636 | |||
| 1471 | Ga0207651_10004087 | |||
| 1472 | Ga0207651_10131127 | |||
| 1473 | Ga0207651_10506638 | |||
| 1474 | Ga0207712_10104316 | |||
| 1475 | Ga0207712_10127378 | |||
| 1476 | Ga0207668_10024717 | |||
| 1477 | Ga0207668_10130340 | |||
| 1478 | Ga0207668_10271629 | |||
| 1479 | Ga0207668_10440894 | |||
| 1480 | Ga0207640_10446552 | |||
| 1481 | Ga0207640_10452657 | |||
| 1482 | Ga0207677_10011273 | |||
| 1483 | Ga0207677_10112824 | |||
| 1484 | Ga0207677_10183206 | |||
| 1485 | Ga0207677_10207443 | |||
| 1486 | Ga0207677_10393645 | |||
| 1487 | Ga0207703_10036035 | |||
| 1488 | Ga0207639_10036429 | |||
| 1489 | Ga0207639_10052679 | |||
| 1490 | Ga0207639_10098178 | |||
| 1491 | Ga0207639_10235364 | |||
| 1492 | Ga0207678_10019025 | |||
| 1493 | Ga0207678_10789503 | |||
| 1494 | Ga0207708_10030896 | |||
| 1495 | Ga0207708_10034080 | |||
| 1496 | Ga0207708_10058848 | |||
| 1497 | Ga0207708_10400814 | |||
| 1498 | Ga0207708_10460591 | |||
| 1499 | Ga0207708_10521711 | |||
| 1500 | Ga0207702_10021760 | |||
| 1501 | Ga0207702_10048040 | |||
| 1502 | Ga0207702_10058318 | |||
| 1503 | Ga0207702_10183353 | |||
| 1504 | Ga0207702_11060284 | |||
| 1505 | Ga0207641_10282311 | |||
| 1506 | Ga0207648_10060818 | |||
| 1507 | Ga0207648_10111714 | |||
| 1508 | Ga0207648_10242685 | |||
| 1509 | Ga0207648_10400295 | |||
| 1510 | Ga0207648_10457869 | |||
| 1511 | Ga0207676_10253540 | |||
| 1512 | Ga0207674_10003106 | |||
| 1513 | Ga0207674_10018155 | |||
| 1514 | Ga0207674_10055480 | |||
| 1515 | Ga0207674_10104105 | |||
| 1516 | Ga0207674_10151212 | |||
| 1517 | Ga0207674_10470524 | |||
| 1518 | Ga0207674_10701283 | |||
| 1519 | Ga0207674_10762011 | |||
| 1520 | Ga0207675_100057052 | |||
| 1521 | Ga0207675_100104031 | |||
| 1522 | Ga0207675_100107589 | |||
| 1523 | Ga0207675_100113211 | |||
| 1524 | Ga0207675_100299696 | |||
| 1525 | Ga0207675_100451144 | |||
| 1526 | Ga0207683_10010195 | |||
| 1527 | Ga0207683_10016208 | |||
| 1528 | Ga0207683_10016533 | |||
| 1529 | Ga0207683_10018197 | |||
| 1530 | Ga0207683_10120628 | |||
| 1531 | Ga0207683_10167353 | |||
| 1532 | Ga0207683_10227766 | |||
| 1533 | Ga0207683_10357611 | |||
| 1534 | Ga0207698_10045883 | |||
| 1535 | Ga0207698_10116324 | |||
| 1536 | Ga0207698_10365888 | |||
| 1537 | Ga0207428_10000327 | |||
| 1538 | Ga0207428_10006296 | |||
| 1539 | Ga0207428_10007597 | |||
| 1540 | Ga0207428_10043381 | |||
| 1541 | Ga0268265_10123635 | |||
| 1542 | Ga0268264_10076280 | |||
| 1543 | Ga0268264_10165548 | |||
| 1544 | Ga0265327_10056628 | |||
| 1545 | Ga0265316_10117361 | |||
| 1546 | Ga0265314_10106402 | |||
| 1547 | Ga0307405_10004098 | |||
| 1548 | Ga0307405_10179609 | |||
| 1549 | Ga0307413_10006056 | |||
| 1550 | Ga0307413_10184426 | |||
| 1551 | Ga0307406_10217977 | |||
| 1552 | Ga0307412_10035117 | |||
| 1553 | Ga0307412_10073314 | |||
| 1554 | Ga0307409_100123740 | |||
| 1555 | Ga0307409_100262081 | |||
| 1556 | Ga0307416_100027674 | |||
| 1557 | Ga0307416_100139871 | |||
| 1558 | Ga0307414_10005455 | |||
| 1559 | Ga0307415_100008754 | |||
| 1560 | Ga0373930_0049734 | |||
| 1561 | Ga0373950_0035123 | |||
| 1562 | Ga0373958_0012215 | |||
| 1563 | Ga0373959_0009968 | |||
| 1564 | Ga0373938_0016075 | |||
| 1565 | Ga0373929_0057596 | |||
| 1566 | Ga0373940_0047459 | |||
| 1567 | Ga0373949_0013482 | |||
| 1568 | Ga0373951_0039749 | |||
| 1569 | Ga0373952_0011426 | |||
| 1570 | Ga0373932_0006965 | |||
| 1571 | Ga0373939_0064903 | |||
| 1572 | Ga0373953_0139998 | |||
| 1573 | Ga0373960_0004005 | |||
| 1574 | Ga0373960_0007459 | |||
| 1575 | Ga0373943_0177898 | |||
| 1576 | Ga0373962_0010570 | |||
| 1577 | Ga0373931_0100876 | |||
| 1578 | Ga0373937_0158296 | |||
| 1579 | Ga0395899_0000899 | |||
| 1580 | Ga0395899_0001850 | |||
| 1581 | Ga0395899_0005803 | |||
| 1582 | Ga0395899_0013572 | |||
| 1583 | Ga0395899_0029850 | |||
| 1584 | Ga0395899_0043335 | |||
| 1585 | Ga0395899_0083273 | |||
| 1586 | Ga0395899_0106831 | |||
| 1587 | Ga0395899_0121855 | |||
| 1588 | Ga0395899_0135173 | |||
| 1589 | Ga0395899_0232721 | |||
| 1590 | Ga0395900_0004947 | |||
| 1591 | Ga0395900_0008467 | |||
| 1592 | Ga0395900_0009503 | |||
| 1593 | Ga0395900_0024495 | |||
| 1594 | Ga0395900_0041675 | |||
| 1595 | Ga0395900_0045047 | |||
| 1596 | Ga0395900_0052832 | |||
| 1597 | Ga0395900_0061463 | |||
| 1598 | Ga0395900_0064886 | |||
| 1599 | Ga0395900_0069784 | |||
| 1600 | Ga0395900_0077429 | |||
| 1601 | Ga0395900_0083585 | |||
| 1602 | Ga0395900_0097534 | |||
| 1603 | Ga0395900_0114430 | |||
| 1604 | Ga0395900_0161131 | |||
| 1605 | Ga0395900_0198976 | |||
| 1606 | Ga0395900_0249190 | |||
| 1607 | Ga0395900_0309308 | |||
| 1608 | Ga0395900_0323848 | |||
| 1609 | Ga0395900_0491752 | |||
| 1610 | Ga0395900_0587082 | |||
| 1611 | Ga0395898_0002821 | |||
| 1612 | Ga0395898_0003001 | |||
| 1613 | Ga0395898_0003379 | |||
| 1614 | Ga0395898_0004559 | |||
| 1615 | Ga0395898_0016080 | |||
| 1616 | Ga0395898_0023534 | |||
| 1617 | Ga0395898_0049171 | |||
| 1618 | Ga0395898_0049264 | |||
| 1619 | Ga0395898_0092266 | |||
| 1620 | Ga0395898_0165688 | |||
| 1621 | Ga0395898_0176892 | |||
| 1622 | Ga0395898_0323411 | |||
| 1623 | Ga0395898_0472758 | |||
| 1624 | Ga0395898_0490162 | |||
| 1625 | Ga0395898_0541344 | |||
| 1626 | Ga0395898_0599067 | |||
| 1627 | Ga0395905_0001363 | |||
| 1628 | Ga0395905_0002059 | |||
| 1629 | Ga0395905_0002078 | |||
| 1630 | Ga0395905_0004086 | |||
| 1631 | Ga0395905_0006030 | |||
| 1632 | Ga0395905_0014759 | |||
| 1633 | Ga0395905_0021871 | |||
| 1634 | Ga0395905_0036589 | |||
| 1635 | Ga0395905_0051578 | |||
| 1636 | Ga0395905_0084339 | |||
| 1637 | Ga0395905_0095831 | |||
| 1638 | Ga0395905_0113201 | |||
| 1639 | Ga0395905_0159640 | |||
| 1640 | Ga0395905_0224777 | |||
| 1641 | Ga0395905_0236101 | |||
| 1642 | Ga0395905_0244702 | |||
| 1643 | Ga0395905_0278226 | |||
| 1644 | Ga0395905_0316602 | |||
| 1645 | Ga0395905_0321113 | |||
| 1646 | Ga0395905_0495537 | |||
| 1647 | Ga0395905_0517718 | |||
| 1648 | Ga0395901_0001352 | |||
| 1649 | Ga0395901_0003549 | |||
| 1650 | Ga0395901_0003858 | |||
| 1651 | Ga0395901_0005231 | |||
| 1652 | Ga0395901_0018144 | |||
| 1653 | Ga0395901_0024846 | |||
| 1654 | Ga0395901_0029397 | |||
| 1655 | Ga0395901_0031856 | |||
| 1656 | Ga0395901_0033143 | |||
| 1657 | Ga0395901_0050239 | |||
| 1658 | Ga0395901_0051433 | |||
| 1659 | Ga0395901_0071012 | |||
| 1660 | Ga0395901_0076611 | |||
| 1661 | Ga0395901_0085134 | |||
| 1662 | Ga0395901_0091389 | |||
| 1663 | Ga0395901_0145921 | |||
| 1664 | Ga0395901_0181152 | |||
| 1665 | Ga0395901_0183869 | |||
| 1666 | Ga0395901_0216999 | |||
| 1667 | Ga0395901_0290155 | |||
| 1668 | Ga0395901_0296835 | |||
| 1669 | Ga0395901_0333528 | |||
| 1670 | Ga0395901_0369259 | |||
| 1671 | Ga0395901_0570848 | |||
| 1672 | Ga0395901_0572192 | |||
| 1673 | Ga0395901_0582252 | |||
| 1674 | Ga0395901_0630352 | |||
| 1675 | Ga0451793_0473993 | |||
| 1676 | Ga0451797_0714666 | |||
| 1677 | Ga0451839_0175852 | |||
| 1678 | Ga0450914_000317 | |||
| 1679 | Ga0450920_001292 | |||
| 1680 | Ga0450920_054645 | |||
| 1681 | Ga0450907_010198 | |||
| 1682 | Ga0466964_0183950 | |||
| 1683 | Ga0451576_0007862 | |||
| 1684 | Ga0495617_126941 | |||
| 1685 | Ga0495592_0072171 | |||
| 1686 | Ga0495603_0132194 | |||
| 1687 | Ga0495629_0073549 | |||
| 1688 | Ga0495653_0053747 | |||
| 1689 | Ga0495582_0050345 | |||
| 1690 | Ga0495582_0173952 | |||
| 1691 | Ga0495662_0026544 | |||
| 1692 | Ga0495662_0105814 | |||
| 1693 | Ga0495662_0151225 | |||
| 1694 | Ga0495664_0277333 | |||
| 1695 | Ga0495584_0011195 | |||
| 1696 | Ga0495585_0096043 | |||
| 1697 | Ga0495594_0158358 | |||
| 1698 | Ga0495596_0043730 | |||
| 1699 | Ga0495596_0048859 | |||
| 1700 | Ga0495608_0139098 | |||
| 1701 | Ga0495616_0167154 | |||
| 1702 | Ga0495618_0103951 | |||
| 1703 | Ga0495628_0306825 | |||
| 1704 | Ga0495630_0041028 | |||
| 1705 | Ga0495630_0115134 | |||
| 1706 | Ga0495630_0131431 | |||
| 1707 | Ga0495630_0154532 | |||
| 1708 | Ga0495631_0059657 | |||
| 1709 | Ga0495644_0034602 | |||
| 1710 | Ga0495663_0026281 | |||
| 1711 | Ga0495663_0035625 | |||
| 1712 | Ga0495652_0195229 | |||
| 1713 | Ga0495665_0046326 | |||
| 1714 | Ga0495640_0146314 | |||
| 1715 | Ga0495586_0029326 | |||
| 1716 | Ga0495645_0202975 | |||
| 1717 | Ga0495645_0360265 | |||
| 1718 | Ga0495656_0143195 | |||
| 1719 | Ga0495634_0186694 | |||
| 1720 | Ga0495635_0216120 | |||
| 1721 | Ga0495657_0044320 | |||
| 1722 | Ga0495599_0087896 | |||
| 1723 | Ga0495599_0503968 | |||
| 1724 | Ga0495658_0011093 | |||
| 1725 | Ga0495658_0015987 | |||
| 1726 | Ga0495613_0025954 | |||
| 1727 | Ga0495613_0060240 | |||
| 1728 | Ga0495613_0184611 | |||
| 1729 | Ga0495624_0078805 | |||
| 1730 | Ga0495670_0158444 | |||
| 1731 | Ga0495589_0060625 | |||
| 1732 | Ga0495581_0008682 | |||
| 1733 | Ga0495674_0059241 | |||
| 1734 | Ga0495674_0107422 | |||
| 1735 | Ga0495674_0188296 | |||
| 1736 | Ga0495676_0159803 | |||
| 1737 | Ga0495684_0044097 | |||
| 1738 | Ga0495684_0271452 | |||
| 1739 | Ga0495593_0046156 | |||
| 1740 | Ga0495602_0274571 | |||
| 1741 | Ga0495626_0151912 | |||
| 1742 | Ga0496100_0009018 | |||
| 1743 | Ga0496100_0070381 | |||
| 1744 | Ga0496100_0101528 | |||
| 1745 | Ga0496100_0276174 | |||
| 1746 | Ga0496100_0757529 | |||
| 1747 | Ga0496101_0028686 | |||
| 1748 | Ga0496101_0052469 | |||
| 1749 | Ga0496101_0371130 | |||
| 1750 | Ga0496102_0103380 | |||
| 1751 | Ga0496102_0142184 | |||
| 1752 | Ga0496102_0158300 | |||
| 1753 | Ga0496102_0174749 | |||
| 1754 | Ga0496102_0219281 | |||
| 1755 | Ga0496103_0016868 | |||
| 1756 | Ga0496103_0028321 | |||
| 1757 | Ga0496104_0001046 | |||
| 1758 | Ga0496104_0027965 | |||
| 1759 | Ga0496104_0162852 | |||
| 1760 | Ga0496104_0166237 | |||
| 1761 | Ga0496104_0215367 | |||
| 1762 | Ga0496104_0494208 | |||
| 1763 | Ga0496105_0012431 | |||
| 1764 | Ga0496105_0031626 | |||
| 1765 | Ga0496105_0045796 | |||
| 1766 | Ga0496105_0071862 | |||
| 1767 | Ga0496106_0013854 | |||
| 1768 | Ga0496106_0350573 | |||
| 1769 | Ga0496106_0446643 | |||
| 1770 | Ga0496107_0034001 | |||
| 1771 | Ga0496107_0057568 | |||
| 1772 | Ga0496107_0104219 | |||
| 1773 | Ga0496108_0013010 | |||
| 1774 | Ga0496108_0049735 | |||
| 1775 | Ga0496108_0062264 | |||
| 1776 | Ga0496108_0119176 | |||
| 1777 | Ga0496108_0150372 | |||
| 1778 | Ga0496108_0457694 | |||
| 1779 | Ga0496108_0502731 | |||
| 1780 | Ga0496109_0030913 | |||
| 1781 | Ga0496109_0039932 | |||
| 1782 | Ga0496109_0079921 | |||
| 1783 | Ga0496109_0093237 | |||
| 1784 | Ga0496109_0102563 | |||
| 1785 | Ga0496109_0291451 | |||
| 1786 | Ga0496109_0479447 | |||
| 1787 | Ga0496109_0708042 | |||
| 1788 | Ga0496110_0000295 | |||
| 1789 | Ga0496110_0009155 | |||
| 1790 | Ga0496110_0064274 | |||
| 1791 | Ga0496110_0071705 | |||
| 1792 | Ga0496110_0285341 | |||
| 1793 | Ga0496110_0297720 | |||
| 1794 | Ga0496110_0303370 | |||
| 1795 | Ga0496110_0324260 | |||
| 1796 | Ga0496111_0008226 | |||
| 1797 | Ga0496111_0010581 | |||
| 1798 | Ga0496111_0016923 | |||
| 1799 | Ga0496111_0047835 | |||
| 1800 | Ga0496111_0050516 | |||
| 1801 | Ga0496111_0097233 | |||
| 1802 | Ga0496111_0100446 | |||
| 1803 | Ga0496112_0067131 | |||
| 1804 | Ga0496112_0173382 | |||
| 1805 | Ga0496112_0375088 | |||
| 1806 | Ga0496113_0058694 | |||
| 1807 | Ga0496113_0290941 | |||
| 1808 | Ga0496114_0000404 | |||
| 1809 | Ga0496114_0037983 | |||
| 1810 | Ga0496114_0076712 | |||
| 1811 | Ga0496114_0083966 | |||
| 1812 | Ga0496114_0147956 | |||
| 1813 | Ga0496114_0148309 | |||
| 1814 | Ga0496114_0198348 | |||
| 1815 | Ga0496114_0382074 | |||
| 1816 | Ga0496114_0585698 | |||
| 1817 | Ga0496115_0007180 | |||
| 1818 | Ga0496115_0019498 | |||
| 1819 | Ga0496115_0092445 | |||
| 1820 | Ga0496115_0200575 | |||
| 1821 | Ga0496115_0223042 | |||
| 1822 | Ga0501031_0007339 | |||
| 1823 | Ga0501031_0010960 | |||
| 1824 | Ga0501031_0053362 | |||
| 1825 | Ga0501031_0074991 | |||
| 1826 | Ga0501031_0113116 | |||
| 1827 | Ga0501032_0078220 | |||
| 1828 | Ga0501032_0172332 | |||
| 1829 | Ga0501033_0177960 | |||
| 1830 | Ga0501034_0030500 | |||
| 1831 | Ga0501034_0146006 | |||
| 1832 | Ga0501036_0004976 | |||
| 1833 | Ga0501036_0029982 | |||
| 1834 | Ga0501036_0045256 | |||
| 1835 | Ga0501036_0200978 | |||
| 1836 | Ga0501036_0283366 | |||
| 1837 | Ga0501036_0726864 | |||
| 1838 | Ga0501037_0004571 | |||
| 1839 | Ga0501037_0081858 | |||
| 1840 | Ga0501037_0324768 | |||
| 1841 | Ga0501037_0507280 | |||
| 1842 | Ga0501038_0005846 | |||
| 1843 | Ga0501038_0033028 | |||
| 1844 | Ga0501038_0165163 | |||
| 1845 | Ga0501039_0036393 | |||
| 1846 | Ga0501039_0070083 | |||
| 1847 | Ga0501039_0087594 | |||
| 1848 | Ga0501039_0094779 | |||
| 1849 | Ga0501039_0128274 | |||
| 1850 | Ga0501039_0243505 | |||
| 1851 | Ga0501040_0001063 | |||
| 1852 | Ga0501040_0015008 | |||
| 1853 | Ga0501040_0017064 | |||
| 1854 | Ga0501040_0496349 | |||
| 1855 | Ga0501041_0000466 | |||
| 1856 | Ga0501041_0239880 | |||
| 1857 | Ga0501042_0010580 | |||
| 1858 | Ga0501042_0021077 | |||
| 1859 | Ga0501042_0035265 | |||
| 1860 | Ga0501042_0205714 | |||
| 1861 | Ga0501042_0255797 | |||
| 1862 | Ga0501042_0304409 | |||
| 1863 | Ga0501043_0006516 | |||
| 1864 | Ga0501043_0087782 | |||
| 1865 | Ga0501046_0008207 | |||
| 1866 | Ga0501046_0018840 | |||
| 1867 | Ga0501046_0060444 | |||
| 1868 | Ga0501046_0167136 | |||
| 1869 | Ga0501046_0315904 | |||
| 1870 | Ga0501048_0009849 | |||
| 1871 | Ga0501048_0030822 | |||
| 1872 | Ga0501048_0042392 | |||
| 1873 | Ga0501048_0061871 | |||
| 1874 | Ga0501048_0091170 | |||
| 1875 | Ga0501048_0211850 | |||
| 1876 | Ga0501048_0708054 | |||
| 1877 | Ga0501067_0005124 | |||
| 1878 | Ga0501067_0006112 | |||
| 1879 | Ga0501067_0009166 | |||
| 1880 | Ga0501067_0011144 | |||
| 1881 | Ga0501067_0024345 | |||
| 1882 | Ga0501067_0082470 | |||
| 1883 | Ga0501067_0193202 | |||
| 1884 | Ga0501068_0007174 | |||
| 1885 | Ga0501068_0008320 | |||
| 1886 | Ga0501068_0008939 | |||
| 1887 | Ga0501068_0047196 | |||
| 1888 | Ga0501068_0072266 | |||
| 1889 | Ga0501068_0088671 | |||
| 1890 | Ga0501068_0251459 | |||
| 1891 | Ga0501068_0275512 | |||
| 1892 | Ga0501069_0002218 | |||
| 1893 | Ga0501069_0002680 | |||
| 1894 | Ga0501069_0003452 | |||
| 1895 | Ga0501069_0049249 | |||
| 1896 | Ga0501069_0083374 | |||
| 1897 | Ga0501069_0128751 | |||
| 1898 | Ga0501069_0205711 | |||
| 1899 | Ga0501070_0005645 | |||
| 1900 | Ga0501070_0010504 | |||
| 1901 | Ga0501070_0034156 | |||
| 1902 | Ga0501071_0004962 | |||
| 1903 | Ga0501071_0029161 | |||
| 1904 | Ga0501071_0081291 | |||
| 1905 | Ga0501071_0106859 | |||
| 1906 | Ga0501071_0129431 | |||
| 1907 | Ga0501071_0136001 | |||
| 1908 | Ga0501071_0151465 | |||
| 1909 | Ga0501071_0221342 | |||
| 1910 | Ga0501072_0006637 | |||
| 1911 | Ga0501072_0009384 | |||
| 1912 | Ga0501072_0025255 | |||
| 1913 | Ga0501072_0043065 | |||
| 1914 | Ga0501072_0071622 | |||
| 1915 | Ga0501072_0127481 | |||
| 1916 | Ga0501072_0482866 | |||
| 1917 | Ga0501074_0007089 | |||
| 1918 | Ga0501074_0022238 | |||
| 1919 | Ga0501074_0046332 | |||
| 1920 | Ga0501074_0049142 | |||
| 1921 | Ga0501074_0167593 | |||
| 1922 | Ga0501074_0297922 | |||
| 1923 | Ga0501075_0012643 | |||
| 1924 | Ga0501075_0037516 | |||
| 1925 | Ga0501075_0043085 | |||
| 1926 | Ga0501075_0107501 | |||
| 1927 | Ga0501075_0112269 | |||
| 1928 | Ga0501075_0127824 | |||
| 1929 | Ga0501076_0061176 | |||
| 1930 | Ga0501076_0061234 | |||
| 1931 | Ga0501076_0136053 | |||
| 1932 | Ga0501076_0142405 | |||
| 1933 | Ga0501076_0170815 | |||
| 1934 | Ga0501076_0216276 | |||
| 1935 | Ga0501076_0225651 | |||
| 1936 | Ga0501076_0243173 | |||
| 1937 | Ga0501077_0015950 | |||
| 1938 | Ga0501077_0017722 | |||
| 1939 | Ga0501077_0029539 | |||
| 1940 | Ga0501077_0035552 | |||
| 1941 | Ga0501077_0047453 | |||
| 1942 | Ga0501077_0447151 | |||
| 1943 | Ga0501079_0000537 | |||
| 1944 | Ga0501079_0013666 | |||
| 1945 | Ga0501079_0033613 | |||
| 1946 | Ga0501079_0064770 | |||
| 1947 | Ga0501079_0080710 | |||
| 1948 | Ga0501079_0167787 | |||
| 1949 | Ga0501079_0257300 | |||
| 1950 | Ga0501079_0271347 | |||
| 1951 | Ga0501079_0505941 | |||
| 1952 | Ga0501080_0002754 | |||
| 1953 | Ga0501080_0003599 | |||
| 1954 | Ga0501080_0015752 | |||
| 1955 | Ga0501080_0068930 | |||
| 1956 | Ga0501080_0128562 | |||
| 1957 | Ga0501080_0231452 | |||
| 1958 | Ga0501080_0291798 | |||
| 1959 | Ga0501080_0450261 | |||
| 1960 | Ga0501081_0006066 | |||
| 1961 | Ga0501081_0027074 | |||
| 1962 | Ga0501081_0045790 | |||
| 1963 | Ga0501081_0126117 | |||
| 1964 | Ga0501083_0000996 | |||
| 1965 | Ga0501083_0018367 | |||
| 1966 | Ga0501083_0058489 | |||
| 1967 | Ga0501083_0072652 | |||
| 1968 | Ga0501083_0325730 | |||
| 1969 | Ga0501035_0042730 | |||
| 1970 | Ga0501035_0102468 | |||
| 1971 | Ga0501035_0131905 | |||
| 1972 | Ga0501035_0340987 | |||
| 1973 | Ga0501035_0486808 | |||
| 1974 | Ga0501044_0018412 | |||
| 1975 | Ga0501044_0745019 | |||
| 1976 | Ga0501045_0035783 | |||
| 1977 | Ga0501045_0088296 | |||
| 1978 | Ga0501045_0092490 | |||
| 1979 | Ga0501045_0173197 | |||
| 1980 | Ga0501045_0221262 | |||
| 1981 | nmdc:mga05p37_20324_c1 | |||
| 1982 | nmdc:mga05p37_272750_c1 | |||
| 1983 | nmdc:mga05p37_67744_c1 | |||
| 1984 | nmdc:mga09592_128469_c1 | |||
| 1985 | nmdc:mga09592_187596_c1 | |||
| 1986 | nmdc:mga09592_47721_c1 | |||
| 1987 | nmdc:mga0qj67_249226_c1 | |||
| 1988 | nmdc:mga0qj67_3277_c1 | |||
| 1989 | nmdc:mga06r32_225699_c1 | |||
| 1990 | nmdc:mga08y16_21711_c1 | |||
| 1991 | nmdc:mga08y16_24706_c1 | |||
| 1992 | nmdc:mga08y16_302723_c1 | |||
| 1993 | nmdc:mga08y16_33448_c1 | |||
| 1994 | nmdc:mga08y16_34597_c1 | |||
| 1995 | nmdc:mga08y16_389339_c1 | |||
| 1996 | nmdc:mga08y16_7680_c1 | |||
| 1997 | nmdc:mga08y16_81708_c1 | |||
| 1998 | nmdc:mga08y16_92784_c1 | |||
| 1999 | nmdc:mga0n895_175113_c1 | |||
| 2000 | nmdc:mga0n895_558215_c1 | |||
| 2001 | nmdc:mga0rr50_76102_c1 | |||
| 2002 | nmdc:mga08x19_136287_c1 | |||
| 2003 | nmdc:mga0a205_131572_c1 | |||
| 2004 | nmdc:mga0a205_231606_c1 | |||
| 2005 | nmdc:mga0a205_34826_c1 | |||
| 2006 | nmdc:mga0a205_410977_c1 | |||
| 2007 | Ga0495655_0025093 | |||
| 2008 | Ga0495595_0042401 | |||
| 2009 | Ga0495595_0177396 | |||
| 2010 | Ga0495619_0158867 | |||
| 2011 | Ga0501084_0005644 | |||
| 2012 | Ga0501084_0021851 | |||
| 2013 | Ga0501084_0054182 | |||
| 2014 | Ga0501084_0105831 | |||
| 2015 | Ga0501084_0126030 | |||
| 2016 | Ga0501084_0184469 | |||
| 2017 | Ga0501084_0200803 | |||
| 2018 | Ga0501082_0084568 | |||
| 2019 | Ga0501082_0094642 | |||
| 2020 | Ga0501082_0115336 | |||
| 2021 | Ga0501082_0116947 | |||
| 2022 | Ga0501082_0149040 | |||
| 2023 | Ga0501082_0203609 | |||
| 2024 | Ga0501082_0395718 | |||
| 2025 | Ga0530510_0005979 | |||
| 2026 | Ga0530510_0011844 | |||
| 2027 | Ga0530510_0018951 | |||
| 2028 | Ga0530510_0051929 | |||
| 2029 | Ga0530510_0081235 | |||
| 2030 | Ga0530510_0096953 | |||
| 2031 | Ga0530510_0100363 | |||
| 2032 | Ga0530510_0195102 | |||
| 2033 | Ga0530510_0212723 | |||
| 2034 | Ga0530510_0249348 | |||
| 2035 | Ga0530510_0323110 | |||
| 2036 | Ga0530510_0454632 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ihy-assembly1.cif.gz_B | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.9286 | 1 | 226 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9075 | 4 | 225 |
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.9013 | 3 | 230 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9006 | 4 | 226 |
| 2nq2-assembly1.cif.gz_D | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.9006 | 1 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07821_3_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9315 | 1 | 226 | 3.40.50.300 |
| af_P23878_8_259_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9283 | 6 | 230 | 3.40.50.300 |
| af_I6YF11_12_276_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.911 | 2 | 231 | 3.40.50.300 |
| af_Q57554_4_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9088 | 4 | 230 | 3.40.50.300 |
| af_Q2FWA1_1_260_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9079 | 4 | 226 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E1RA61-F1-model_v4 | ABC transporter related protein | 0.9291 | 2 | 230 |
GO:0005524
GO:0016887 |
| AF-A0A0W8I1A1-F1-model_v4 | Metal ABC transporter ATP-binding protein | 0.9233 | 1 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A7Y6YTT6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9204 | 3 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A1I2PYD5-F1-model_v4 | Iron complex transport system ATP-binding protein | 0.9195 | 5 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A0S7WSC9-F1-model_v4 | ABC transporter domain-containing protein | 0.9193 | 1 | 227 |
GO:0005524
GO:0016887 |