F488333

General Info

Members Datasets Scaffolds Average Seq Length
1018 318 2036 239

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0095109|Ga0501080_0095109_1810_2613
Length 267
Sequence MIAVIEDVLGWRAVEAESDSHLLAPPAERALALELRDVTFGYVPGRTVLAGVDFAVRHGEFVAVAGPNGGGKTTLLRLALGLERPGSGRVLLLGDPAERCRRRKEIGYVPQRTRLGGEAPATVREVVAAGRLAQGGLFGPLRRDDRLAVEEALARVGLADRASSPLRTLSGGMQQRAFIARALAGRPSLLVLDEPTTGVDAESQESLAALLDELHRELGVTVLYVSHEFGAVEHFVQRLVLVRGGIVFDGPPSDLPGLWHDPSHAHA

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
211 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
212 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 8.06
Rhizosphere 91.65
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0095109 3300049742 Bacteria 2767
2 rootL2_10099212 3300003322 Bacteria 2180
3 Ga0070658_10004765 3300005327 Bacteria 11035
4 Ga0070658_10086058 3300005327 Bacteria 2585
5 Ga0070676_10026767 3300005328 Bacteria 3265
6 Ga0070676_10167866 3300005328 Bacteria 1417
7 Ga0070676_10179284 3300005328 Bacteria 1376
8 Ga0070676_10293952 3300005328 Bacteria 1099
9 Ga0070683_100005772 3300005329 Bacteria 10347
10 Ga0070683_100012389 3300005329 Bacteria 7410
11 Ga0070683_100065532 3300005329 Bacteria 3382
12 Ga0070683_100103692 3300005329 Bacteria 2680
13 Ga0070683_100135741 3300005329 Bacteria 2330
14 Ga0070670_100031582 3300005331 Bacteria 4561
15 Ga0070670_100084270 3300005331 Bacteria 2731
16 Ga0068869_100010642 3300005334 Bacteria 6005
17 Ga0068869_100031540 3300005334 Bacteria 3728
18 Ga0070680_100005763 3300005336 Bacteria 9398
19 Ga0070680_100008081 3300005336 Bacteria 8032
20 Ga0070680_100010423 3300005336 Bacteria 7166
21 Ga0070680_100297640 3300005336 Bacteria 1368
22 Ga0070682_100002294 3300005337 Bacteria 10577
23 Ga0070682_100049355 3300005337 Bacteria 2623
24 Ga0070682_100510904 3300005337 Bacteria 933
25 Ga0068868_100034864 3300005338 Bacteria 3887
26 Ga0068868_100052010 3300005338 Bacteria 3225
27 Ga0068868_100059253 3300005338 Bacteria 3028
28 Ga0068868_100156836 3300005338 Bacteria 1878
29 Ga0068868_100492841 3300005338 Bacteria 1072
30 Ga0070660_100080234 3300005339 Bacteria 2560
31 Ga0070660_100163102 3300005339 Bacteria 1797
32 Ga0070660_100276745 3300005339 Bacteria 1373
33 Ga0070660_100330238 3300005339 Bacteria 1254
34 Ga0070689_100024563 3300005340 Bacteria 4521
35 Ga0070689_100037506 3300005340 Bacteria 3705
36 Ga0070691_10003581 3300005341 Bacteria 7012
37 Ga0070691_10124598 3300005341 Bacteria 1300
38 Ga0070691_10184418 3300005341 Bacteria 1088
39 Ga0070661_100051472 3300005344 Bacteria 3014
40 Ga0070661_100067152 3300005344 Bacteria 2635
41 Ga0070661_100076790 3300005344 Bacteria 2462
42 Ga0070661_100153149 3300005344 Bacteria 1744
43 Ga0070661_100250106 3300005344 Bacteria 1368
44 Ga0070692_10003307 3300005345 Bacteria 6510
45 Ga0070692_10438106 3300005345 Bacteria 834
46 Ga0070668_100084254 3300005347 Bacteria 2496
47 Ga0070668_100099293 3300005347 Bacteria 2305
48 Ga0070668_100754541 3300005347 Bacteria 862
49 Ga0070669_100189943 3300005353 Bacteria 1611
50 Ga0070675_100036451 3300005354 Bacteria 4002
51 Ga0070675_100036695 3300005354 Bacteria 3990
52 Ga0070675_100373520 3300005354 Bacteria 1268
53 Ga0070671_100402621 3300005355 Bacteria 1171
54 Ga0070671_100466950 3300005355 Bacteria 1084
55 Ga0070674_100002032 3300005356 Bacteria 11092
56 Ga0070674_100008473 3300005356 Bacteria 6122
57 Ga0070674_100126887 3300005356 Bacteria 1897
58 Ga0070674_100405547 3300005356 Bacteria 1115
59 Ga0070674_100462233 3300005356 Bacteria 1050
60 Ga0070674_100666656 3300005356 Bacteria 886
61 Ga0070673_100021200 3300005364 Bacteria 4704
62 Ga0070673_100122262 3300005364 Bacteria 2174
63 Ga0070688_100005633 3300005365 Bacteria 6610
64 Ga0070659_100036838 3300005366 Bacteria 3813
65 Ga0070659_100040918 3300005366 Bacteria 3622
66 Ga0070659_100079498 3300005366 Bacteria 2617
67 Ga0070659_100701771 3300005366 Bacteria 875
68 Ga0070667_100285637 3300005367 Bacteria 1483
69 Ga0070713_100277904 3300005436 Bacteria 1535
70 Ga0070710_10018750 3300005437 Bacteria 3565
71 Ga0070701_10043794 3300005438 Bacteria 2291
72 Ga0070701_10472644 3300005438 Bacteria 809
73 Ga0070711_100636502 3300005439 Bacteria 893
74 Ga0070705_100059374 3300005440 Bacteria 2264
75 Ga0070705_100181595 3300005440 Bacteria 1426
76 Ga0070705_100422257 3300005440 Bacteria 993
77 Ga0070700_100048035 3300005441 Bacteria 2644
78 Ga0070700_100269434 3300005441 Bacteria 1230
79 Ga0070694_100175481 3300005444 Bacteria 1581
80 Ga0070694_100222669 3300005444 Bacteria 1416
81 Ga0070663_100044664 3300005455 Bacteria 3126
82 Ga0070663_100095726 3300005455 Bacteria 2207
83 Ga0070663_100183438 3300005455 Bacteria 1625
84 Ga0070663_100600045 3300005455 Bacteria 926
85 Ga0070678_100005380 3300005456 Bacteria 7387
86 Ga0070678_100067132 3300005456 Bacteria 2668
87 Ga0070678_100228234 3300005456 Bacteria 1551
88 Ga0070662_100044687 3300005457 Bacteria 3174
89 Ga0070662_100117956 3300005457 Bacteria 2030
90 Ga0070662_100128377 3300005457 Bacteria 1952
91 Ga0070662_100159033 3300005457 Bacteria 1766
92 Ga0070662_100249379 3300005457 Bacteria 1426
93 Ga0070681_10001517 3300005458 Bacteria 20575
94 Ga0070681_10004737 3300005458 Bacteria 13027
95 Ga0070681_10125268 3300005458 Bacteria 2502
96 Ga0068867_100107768 3300005459 Bacteria 2136
97 Ga0068867_100370152 3300005459 Bacteria 1201
98 Ga0070685_10015996 3300005466 Bacteria 3990
99 Ga0070685_10336061 3300005466 Bacteria 1028
100 Ga0070706_100021988 3300005467 Bacteria 5874
101 Ga0070706_100034884 3300005467 Bacteria 4645
102 Ga0070706_100403180 3300005467 Bacteria 1273
103 Ga0070707_100030912 3300005468 Bacteria 5100
104 Ga0070707_100310380 3300005468 Bacteria 1533
105 Ga0070707_100563906 3300005468 Bacteria 1101
106 Ga0070707_100776191 3300005468 Unclassified 922
107 Ga0070698_100077888 3300005471 Bacteria 3314
108 Ga0070698_100128764 3300005471 Bacteria 2487
109 Ga0070698_100141121 3300005471 Unclassified 2360
110 Ga0070699_100081291 3300005518 Bacteria 2825
111 Ga0070679_100001190 3300005530 Bacteria 22847
112 Ga0070679_100016991 3300005530 Bacteria 7034
113 Ga0070679_100037940 3300005530 Bacteria 4788
114 Ga0070679_100088815 3300005530 Bacteria 3077
115 Ga0070679_100412752 3300005530 Bacteria 1296
116 Ga0070684_100002475 3300005535 Bacteria 13601
117 Ga0070684_100008837 3300005535 Bacteria 7899
118 Ga0070684_100024169 3300005535 Bacteria 5094
119 Ga0070684_100024713 3300005535 Bacteria 5042
120 Ga0070684_100024877 3300005535 Bacteria 5026
121 Ga0070684_100101946 3300005535 Bacteria 2565
122 Ga0070684_100250235 3300005535 Bacteria 1620
123 Ga0070684_100368760 3300005535 Bacteria 1322
124 Ga0070684_100588799 3300005535 Bacteria 1034
125 Ga0070684_100726344 3300005535 Bacteria 926
126 Ga0070697_100082256 3300005536 Bacteria 2654
127 Ga0068853_100206615 3300005539 Bacteria 1789
128 Ga0068853_100584358 3300005539 Bacteria 1060
129 Ga0070672_100028983 3300005543 Bacteria 4146
130 Ga0070672_100079614 3300005543 Bacteria 2623
131 Ga0070686_100038012 3300005544 Bacteria 2990
132 Ga0070686_100078344 3300005544 Bacteria 2182
133 Ga0070686_100115428 3300005544 Bacteria 1836
134 Ga0070686_100356461 3300005544 Bacteria 1100
135 Ga0070695_100202648 3300005545 Bacteria 1419
136 Ga0070696_100060253 3300005546 Bacteria 2654
137 Ga0070696_100101570 3300005546 Bacteria 2061
138 Ga0070696_100262181 3300005546 Bacteria 1311
139 Ga0070696_100446318 3300005546 Bacteria 1020
140 Ga0070693_100009137 3300005547 Bacteria 4921
141 Ga0070704_100053064 3300005549 Bacteria 2864
142 Ga0070704_100328936 3300005549 Bacteria 1283
143 Ga0068855_100016986 3300005563 Bacteria 8752
144 Ga0068855_100067944 3300005563 Bacteria 4151
145 Ga0068855_100131542 3300005563 Bacteria 2857
146 Ga0068855_100380205 3300005563 Bacteria 1551
147 Ga0070664_100031006 3300005564 Bacteria 4464
148 Ga0070664_100060615 3300005564 Bacteria 3222
149 Ga0070664_100107551 3300005564 Bacteria 2431
150 Ga0070664_100187769 3300005564 Bacteria 1840
151 Ga0070664_100328019 3300005564 Bacteria 1388
152 Ga0068857_100007616 3300005577 Bacteria 9324
153 Ga0068857_100050082 3300005577 Bacteria 3706
154 Ga0068857_100089263 3300005577 Bacteria 2758
155 Ga0068857_100137000 3300005577 Bacteria 2210
156 Ga0068857_100432927 3300005577 Bacteria 1228
157 Ga0068854_100071737 3300005578 Bacteria 2534
158 Ga0068854_100533796 3300005578 Bacteria 993
159 Ga0068854_100539171 3300005578 Bacteria 988
160 Ga0068856_100109460 3300005614 Bacteria 2759
161 Ga0068856_100118802 3300005614 Bacteria 2645
162 Ga0068856_100155924 3300005614 Bacteria 2293
163 Ga0068856_100598200 3300005614 Bacteria 1124
164 Ga0068856_100888157 3300005614 Bacteria 910
165 Ga0070702_100005742 3300005615 Bacteria 5812
166 Ga0070702_100029720 3300005615 Bacteria 2974
167 Ga0070702_100035607 3300005615 Bacteria 2751
168 Ga0070702_100036891 3300005615 Bacteria 2712
169 Ga0070702_100099911 3300005615 Bacteria 1778
170 Ga0070702_100463382 3300005615 Bacteria 922
171 Ga0068852_100071478 3300005616 Bacteria 3047
172 Ga0068852_100099241 3300005616 Bacteria 2624
173 Ga0068852_100406649 3300005616 Bacteria 1340
174 Ga0068859_100097340 3300005617 Bacteria 2996
175 Ga0068864_100103952 3300005618 Bacteria 2522
176 Ga0068864_100877312 3300005618 Bacteria 885
177 Ga0068866_10036430 3300005718 Bacteria 2410
178 Ga0068866_10169333 3300005718 Bacteria 1281
179 Ga0068866_10253886 3300005718 Bacteria 1077
180 Ga0068861_100067564 3300005719 Bacteria 2759
181 Ga0068861_100104809 3300005719 Bacteria 2257
182 Ga0068861_100293037 3300005719 Bacteria 1406
183 Ga0068861_100339847 3300005719 Bacteria 1313
184 Ga0068870_10013168 3300005840 Bacteria 3881
185 Ga0068870_10034050 3300005840 Bacteria 2604
186 Ga0068870_10213439 3300005840 Bacteria 1177
187 Ga0068863_100125580 3300005841 Bacteria 2448
188 Ga0068858_100025329 3300005842 Bacteria 5521
189 Ga0068858_100704322 3300005842 Bacteria 983
190 Ga0068860_100024509 3300005843 Bacteria 5829
191 Ga0068860_100222744 3300005843 Bacteria 1832
192 Ga0068862_100255312 3300005844 Bacteria 1599
193 Ga0068862_100342618 3300005844 Bacteria 1385
194 Ga0081455_10051443 3300005937 Bacteria 3534
195 Ga0081455_10068601 3300005937 Bacteria 2950
196 Ga0081455_10160058 3300005937 Bacteria 1727
197 Ga0081538_10000864 3300005981 Bacteria 32691
198 Ga0081538_10073956 3300005981 Bacteria 1858
199 Ga0081539_10000335 3300005985 Bacteria 104157
200 Ga0081539_10002145 3300005985 Bacteria 29161
201 Ga0075365_10344928 3300006038 Bacteria 1049
202 Ga0070715_10088246 3300006163 Bacteria 1421
203 Ga0070716_100014516 3300006173 Bacteria 4035
204 Ga0070712_100318071 3300006175 Bacteria 1265
205 Ga0097621_100048186 3300006237 Bacteria 3456
206 Ga0097621_100100644 3300006237 Bacteria 2431
207 Ga0068871_100048540 3300006358 Bacteria 3428
208 Ga0068871_100102278 3300006358 Bacteria 2401
209 Ga0068871_100133981 3300006358 Bacteria 2103
210 Ga0068871_100423798 3300006358 Bacteria 1189
211 Ga0068871_100555776 3300006358 Bacteria 1040
212 Ga0075428_100002047 3300006844 Bacteria 21753
213 Ga0075428_100011263 3300006844 Bacteria 9948
214 Ga0075428_100032480 3300006844 Bacteria 5765
215 Ga0075428_100212214 3300006844 Bacteria 2092
216 Ga0075428_100501347 3300006844 Bacteria 1299
217 Ga0075430_100202570 3300006846 Bacteria 1648
218 Ga0075431_100030532 3300006847 Bacteria 5551
219 Ga0075431_100113531 3300006847 Bacteria 2796
220 Ga0075433_10016304 3300006852 Bacteria 6117
221 Ga0075433_10225331 3300006852 Bacteria 1665
222 Ga0075433_10417220 3300006852 Bacteria 1184
223 Ga0075434_100105583 3300006871 Bacteria 2827
224 Ga0075434_100113787 3300006871 Bacteria 2718
225 Ga0075434_100159330 3300006871 Bacteria 2277
226 Ga0075434_100212172 3300006871 Bacteria 1956
227 Ga0075429_100005788 3300006880 Bacteria 10668
228 Ga0075429_100043183 3300006880 Bacteria 3922
229 Ga0068865_100023535 3300006881 Bacteria 4034
230 Ga0068865_100027824 3300006881 Bacteria 3738
231 Ga0068865_100149223 3300006881 Bacteria 1772
232 Ga0068865_100167534 3300006881 Bacteria 1681
233 Ga0068865_100223999 3300006881 Bacteria 1472
234 Ga0068865_100387028 3300006881 Bacteria 1142
235 Ga0075436_100143469 3300006914 Bacteria 1679
236 Ga0097620_100097341 3300006931 Bacteria 2996
237 Ga0075435_100012074 3300007076 Bacteria 6384
238 Ga0075435_100053353 3300007076 Bacteria 3260
239 Ga0105240_10277841 3300009093 Bacteria 1925
240 Ga0111539_10009767 3300009094 Bacteria 12111
241 Ga0111539_10016431 3300009094 Bacteria 9175
242 Ga0111539_10024626 3300009094 Bacteria 7383
243 Ga0111539_10046165 3300009094 Bacteria 5212
244 Ga0111539_10055201 3300009094 Bacteria 4723
245 Ga0111539_10068708 3300009094 Bacteria 4183
246 Ga0111539_10105489 3300009094 Bacteria 3306
247 Ga0111539_10179571 3300009094 Bacteria 2473
248 Ga0111539_10390483 3300009094 Archaea 1621
249 Ga0111539_10499974 3300009094 Archaea 1416
250 Ga0111539_10665866 3300009094 Bacteria 1212
251 Ga0105245_10001062 3300009098 Bacteria 24876
252 Ga0105245_10002157 3300009098 Bacteria 17822
253 Ga0105245_10067307 3300009098 Bacteria 3244
254 Ga0105245_10087090 3300009098 Bacteria 2866
255 Ga0105245_10111003 3300009098 Bacteria 2550
256 Ga0105245_10204327 3300009098 Bacteria 1898
257 Ga0105245_10291126 3300009098 Bacteria 1599
258 Ga0105245_10316254 3300009098 Bacteria 1537
259 Ga0105247_10322562 3300009101 Bacteria 1078
260 Ga0105247_10552332 3300009101 Bacteria 847
261 Ga0114129_10005183 3300009147 Bacteria 18351
262 Ga0114129_10005445 3300009147 Bacteria 17985
263 Ga0114129_10010791 3300009147 Bacteria 13016
264 Ga0114129_10104620 3300009147 Bacteria 3912
265 Ga0114129_10107714 3300009147 Bacteria 3848
266 Ga0114129_10118542 3300009147 Bacteria 3646
267 Ga0114129_10264284 3300009147 Bacteria 2305
268 Ga0105243_10016866 3300009148 Bacteria 5521
269 Ga0105243_10040653 3300009148 Bacteria 3633
270 Ga0105243_10064486 3300009148 Bacteria 2940
271 Ga0105243_10113806 3300009148 Bacteria 2269
272 Ga0105243_10141417 3300009148 Bacteria 2054
273 Ga0105243_10383719 3300009148 Bacteria 1300
274 Ga0105243_10531864 3300009148 Bacteria 1120
275 Ga0105241_10027993 3300009174 Bacteria 4197
276 Ga0105242_10036222 3300009176 Bacteria 3957
277 Ga0105242_10047661 3300009176 Bacteria 3480
278 Ga0105242_10055716 3300009176 Bacteria 3234
279 Ga0105242_10201103 3300009176 Bacteria 1770
280 Ga0105242_10283246 3300009176 Bacteria 1506
281 Ga0105242_10417621 3300009176 Bacteria 1256
282 Ga0105242_10458557 3300009176 Bacteria 1203
283 Ga0105242_11171632 3300009176 Bacteria 786
284 Ga0105248_10058256 3300009177 Bacteria 4337
285 Ga0105248_10148313 3300009177 Bacteria 2646
286 Ga0105237_10636358 3300009545 Bacteria 1073
287 Ga0105237_10805726 3300009545 Bacteria 946
288 Ga0105238_10133139 3300009551 Bacteria 2464
289 Ga0105238_10300461 3300009551 Bacteria 1589
290 Ga0105249_10129018 3300009553 Bacteria 2411
291 Ga0105249_10235068 3300009553 Bacteria 1809
292 Ga0105249_10672819 3300009553 Bacteria 1094
293 Ga0105249_10741675 3300009553 Bacteria 1044
294 Ga0105249_10825122 3300009553 Bacteria 992
295 Ga0105239_10017706 3300010375 Bacteria 7883
296 Ga0105239_10020919 3300010375 Bacteria 7219
297 Ga0105239_10025303 3300010375 Bacteria 6536
298 Ga0105239_10028808 3300010375 Bacteria 6106
299 Ga0105239_10111840 3300010375 Bacteria 3028
300 Ga0105239_10277086 3300010375 Bacteria 1888
301 Ga0105239_11090932 3300010375 Bacteria 919
302 Ga0105246_10009303 3300011119 Bacteria 6051
303 Ga0105246_10042153 3300011119 Bacteria 3090
304 Ga0105246_10050709 3300011119 Bacteria 2847
305 Ga0105246_10057684 3300011119 Bacteria 2687
306 Ga0105246_10123370 3300011119 Bacteria 1923
307 Ga0105246_10255676 3300011119 Bacteria 1393
308 Ga0105246_10873452 3300011119 Bacteria 804
309 Ga0157341_1007043 3300012494 Bacteria 885
310 Ga0157373_10199783 3300013100 Bacteria 1409
311 Ga0157371_10071269 3300013102 Bacteria 2460
312 Ga0157370_10006695 3300013104 Bacteria 12647
313 Ga0157369_10014930 3300013105 Bacteria 8766
314 Ga0157369_10731538 3300013105 Bacteria 1018
315 Ga0157374_10070941 3300013296 Bacteria 3284
316 Ga0157374_10124652 3300013296 Bacteria 2489
317 Ga0163162_10344805 3300013306 Bacteria 1622
318 Ga0163162_10573016 3300013306 Bacteria 1256
319 Ga0157372_10133503 3300013307 Bacteria 2858
320 Ga0157372_10605639 3300013307 Bacteria 1277
321 Ga0157375_10056095 3300013308 Bacteria 3887
322 Ga0157375_10085648 3300013308 Bacteria 3201
323 Ga0157375_10130463 3300013308 Bacteria 2632
324 Ga0157375_10192454 3300013308 Bacteria 2195
325 Ga0157375_10235832 3300013308 Bacteria 1989
326 Ga0157375_10292540 3300013308 Bacteria 1792
327 Ga0157375_10856120 3300013308 Bacteria 1055
328 Ga0163163_10161460 3300014325 Bacteria 2286
329 Ga0163163_10181762 3300014325 Bacteria 2150
330 Ga0163163_10205294 3300014325 Bacteria 2019
331 Ga0163163_10372728 3300014325 Bacteria 1485
332 Ga0163163_10845488 3300014325 Bacteria 979
333 Ga0157380_10021075 3300014326 Bacteria 4883
334 Ga0157380_10081214 3300014326 Bacteria 2651
335 Ga0182008_10078544 3300014497 Bacteria 1624
336 Ga0157377_10001184 3300014745 Bacteria 11091
337 Ga0157377_10035537 3300014745 Bacteria 2734
338 Ga0157377_10038092 3300014745 Unclassified 2652
339 Ga0157377_10200628 3300014745 Bacteria 1266
340 Ga0157379_10265167 3300014968 Bacteria 1561
341 Ga0157379_10267048 3300014968 Bacteria 1555
342 Ga0157376_10033194 3300014969 Bacteria 4152
343 Ga0157376_10088042 3300014969 Bacteria 2681
344 Ga0157376_10403431 3300014969 Bacteria 1322
345 Ga0157376_10542636 3300014969 Bacteria 1149
346 Ga0163161_10051318 3300017792 Bacteria 2987
347 Ga0163161_10154864 3300017792 Bacteria 1744
348 Ga0163161_10203324 3300017792 Bacteria 1527
349 Ga0206356_10519479 3300020070 Bacteria 2725
350 Ga0206354_11677922 3300020081 Bacteria 2214
351 Ga0206354_11697263 3300020081 Bacteria 2909
352 Ga0206353_10850478 3300020082 Bacteria 6381
353 Ga0207653_10020832 3300025885 Bacteria 2078
354 Ga0207688_10001835 3300025901 Bacteria 11333
355 Ga0207688_10004340 3300025901 Bacteria 7730
356 Ga0207688_10033454 3300025901 Bacteria 2844
357 Ga0207688_10039174 3300025901 Bacteria 2633
358 Ga0207645_10054398 3300025907 Bacteria 2556
359 Ga0207645_10111569 3300025907 Bacteria 1771
360 Ga0207645_10184451 3300025907 Bacteria 1369
361 Ga0207645_10223276 3300025907 Bacteria 1242
362 Ga0207643_10006658 3300025908 Bacteria 6195
363 Ga0207705_10008932 3300025909 Bacteria 7297
364 Ga0207705_10039721 3300025909 Bacteria 3373
365 Ga0207705_10341037 3300025909 Bacteria 1153
366 Ga0207684_10079151 3300025910 Bacteria 2796
367 Ga0207654_10019326 3300025911 Bacteria 3595
368 Ga0207707_10009308 3300025912 Bacteria 8517
369 Ga0207707_10094803 3300025912 Bacteria 2608
370 Ga0207693_10013387 3300025915 Bacteria 6613
371 Ga0207693_10050718 3300025915 Bacteria 3258
372 Ga0207693_10135568 3300025915 Bacteria 1936
373 Ga0207663_10124941 3300025916 Bacteria 1768
374 Ga0207660_10051804 3300025917 Bacteria 2920
375 Ga0207660_10080233 3300025917 Bacteria 2395
376 Ga0207660_10549487 3300025917 Bacteria 939
377 Ga0207662_10004444 3300025918 Bacteria 7375
378 Ga0207662_10212834 3300025918 Bacteria 1255
379 Ga0207657_10000331 3300025919 Bacteria 50115
380 Ga0207657_10025168 3300025919 Bacteria 5493
381 Ga0207657_10053881 3300025919 Bacteria 3482
382 Ga0207657_10080926 3300025919 Bacteria 2729
383 Ga0207649_10021808 3300025920 Bacteria 3695
384 Ga0207649_10086001 3300025920 Bacteria 2048
385 Ga0207652_10001925 3300025921 Bacteria 17959
386 Ga0207652_10043109 3300025921 Bacteria 3842
387 Ga0207652_10046367 3300025921 Bacteria 3708
388 Ga0207652_10106640 3300025921 Bacteria 2480
389 Ga0207652_10112775 3300025921 Bacteria 2413
390 Ga0207652_10325010 3300025921 Bacteria 1389
391 Ga0207646_10008016 3300025922 Bacteria 10652
392 Ga0207681_10039033 3300025923 Bacteria 3150
393 Ga0207681_10408711 3300025923 Bacteria 1098
394 Ga0207650_10288980 3300025925 Bacteria 1336
395 Ga0207659_10048085 3300025926 Bacteria 3020
396 Ga0207659_10122809 3300025926 Bacteria 1992
397 Ga0207687_10002663 3300025927 Bacteria 12086
398 Ga0207687_10009887 3300025927 Bacteria 6244
399 Ga0207687_10046460 3300025927 Bacteria 3006
400 Ga0207687_10048563 3300025927 Bacteria 2948
401 Ga0207687_10120306 3300025927 Bacteria 1963
402 Ga0207687_10248966 3300025927 Bacteria 1412
403 Ga0207687_10586456 3300025927 Bacteria 938
404 Ga0207644_10459076 3300025931 Bacteria 1047
405 Ga0207644_10589779 3300025931 Bacteria 922
406 Ga0207690_10019468 3300025932 Bacteria 4181
407 Ga0207690_10191601 3300025932 Bacteria 1547
408 Ga0207690_10586538 3300025932 Bacteria 909
409 Ga0207706_10009833 3300025933 Bacteria 8774
410 Ga0207706_10011879 3300025933 Bacteria 7927
411 Ga0207706_10048847 3300025933 Bacteria 3741
412 Ga0207706_10100741 3300025933 Bacteria 2541
413 Ga0207706_10123423 3300025933 Bacteria 2278
414 Ga0207706_10265005 3300025933 Bacteria 1500
415 Ga0207706_10314272 3300025933 Bacteria 1364
416 Ga0207686_10144898 3300025934 Bacteria 1646
417 Ga0207686_10280393 3300025934 Bacteria 1230
418 Ga0207686_10367634 3300025934 Bacteria 1087
419 Ga0207686_10576513 3300025934 Bacteria 883
420 Ga0207709_10042641 3300025935 Bacteria 2731
421 Ga0207709_10117165 3300025935 Bacteria 1792
422 Ga0207709_10156024 3300025935 Bacteria 1587
423 Ga0207670_10070713 3300025936 Bacteria 2411
424 Ga0207670_10650500 3300025936 Unclassified 869
425 Ga0207669_10002692 3300025937 Bacteria 7602
426 Ga0207669_10094000 3300025937 Bacteria 1961
427 Ga0207669_10250502 3300025937 Bacteria 1318
428 Ga0207669_10372653 3300025937 Bacteria 1110
429 Ga0207669_10406684 3300025937 Bacteria 1068
430 Ga0207704_10123178 3300025938 Bacteria 1779
431 Ga0207704_10186866 3300025938 Bacteria 1503
432 Ga0207665_10002419 3300025939 Bacteria 12632
433 Ga0207691_10048589 3300025940 Bacteria 3889
434 Ga0207691_10073189 3300025940 Bacteria 3090
435 Ga0207691_10076997 3300025940 Bacteria 3006
436 Ga0207689_10070737 3300025942 Bacteria 2866
437 Ga0207689_10130222 3300025942 Bacteria 2070
438 Ga0207689_10378931 3300025942 Bacteria 1178
439 Ga0207661_10000167 3300025944 Bacteria 42604
440 Ga0207661_10006848 3300025944 Bacteria 8078
441 Ga0207661_10007021 3300025944 Bacteria 7988
442 Ga0207661_10043819 3300025944 Bacteria 3533
443 Ga0207661_10052224 3300025944 Bacteria 3265
444 Ga0207661_10137932 3300025944 Bacteria 2096
445 Ga0207679_10080677 3300025945 Bacteria 2485
446 Ga0207679_10204094 3300025945 Bacteria 1653
447 Ga0207679_10217449 3300025945 Bacteria 1606
448 Ga0207679_10371411 3300025945 Bacteria 1252
449 Ga0207667_10109164 3300025949 Bacteria 2854
450 Ga0207667_10228425 3300025949 Bacteria 1906
451 Ga0207667_10327043 3300025949 Bacteria 1565
452 Ga0207667_10558636 3300025949 Bacteria 1157
453 Ga0207651_10004087 3300025960 Bacteria 7278
454 Ga0207651_10131127 3300025960 Bacteria 1919
455 Ga0207651_10506638 3300025960 Bacteria 1044
456 Ga0207712_10104316 3300025961 Bacteria 2114
457 Ga0207712_10127378 3300025961 Bacteria 1935
458 Ga0207668_10024717 3300025972 Bacteria 3881
459 Ga0207668_10130340 3300025972 Bacteria 1919
460 Ga0207668_10271629 3300025972 Bacteria 1386
461 Ga0207668_10440894 3300025972 Bacteria 1109
462 Ga0207640_10446552 3300025981 Bacteria 1065
463 Ga0207640_10452657 3300025981 Bacteria 1058
464 Ga0207677_10011273 3300026023 Bacteria 5089
465 Ga0207677_10112824 3300026023 Bacteria 2028
466 Ga0207677_10183206 3300026023 Bacteria 1649
467 Ga0207677_10207443 3300026023 Bacteria 1562
468 Ga0207677_10393645 3300026023 Bacteria 1173
469 Ga0207703_10036035 3300026035 Bacteria 3934
470 Ga0207639_10036429 3300026041 Bacteria 3646
471 Ga0207639_10052679 3300026041 Bacteria 3102
472 Ga0207639_10098178 3300026041 Bacteria 2360
473 Ga0207639_10235364 3300026041 Bacteria 1590
474 Ga0207678_10019025 3300026067 Bacteria 6032
475 Ga0207678_10789503 3300026067 Bacteria 838
476 Ga0207708_10030896 3300026075 Bacteria 4064
477 Ga0207708_10034080 3300026075 Bacteria 3872
478 Ga0207708_10058848 3300026075 Bacteria 2932
479 Ga0207708_10400814 3300026075 Bacteria 1134
480 Ga0207708_10460591 3300026075 Bacteria 1060
481 Ga0207708_10521711 3300026075 Bacteria 998
482 Ga0207702_10021760 3300026078 Bacteria 5310
483 Ga0207702_10048040 3300026078 Bacteria 3598
484 Ga0207702_10058318 3300026078 Bacteria 3285
485 Ga0207702_10183353 3300026078 Bacteria 1929
486 Ga0207702_11060284 3300026078 Unclassified 804
487 Ga0207641_10282311 3300026088 Bacteria 1562
488 Ga0207648_10060818 3300026089 Bacteria 3294
489 Ga0207648_10111714 3300026089 Bacteria 2399
490 Ga0207648_10242685 3300026089 Bacteria 1604
491 Ga0207648_10400295 3300026089 Bacteria 1244
492 Ga0207648_10457869 3300026089 Bacteria 1162
493 Ga0207676_10253540 3300026095 Bacteria 1585
494 Ga0207674_10003106 3300026116 Bacteria 20505
495 Ga0207674_10018155 3300026116 Bacteria 7654
496 Ga0207674_10055480 3300026116 Bacteria 4028
497 Ga0207674_10104105 3300026116 Bacteria 2817
498 Ga0207674_10151212 3300026116 Bacteria 2279
499 Ga0207674_10470524 3300026116 Bacteria 1215
500 Ga0207674_10701283 3300026116 Bacteria 977
501 Ga0207674_10762011 3300026116 Bacteria 934
502 Ga0207675_100057052 3300026118 Bacteria 3643
503 Ga0207675_100104031 3300026118 Bacteria 2676
504 Ga0207675_100107589 3300026118 Bacteria 2629
505 Ga0207675_100113211 3300026118 Bacteria 2562
506 Ga0207675_100299696 3300026118 Bacteria 1565
507 Ga0207675_100451144 3300026118 Bacteria 1274
508 Ga0207683_10010195 3300026121 Bacteria 8012
509 Ga0207683_10016208 3300026121 Bacteria 6343
510 Ga0207683_10016533 3300026121 Bacteria 6280
511 Ga0207683_10018197 3300026121 Bacteria 5993
512 Ga0207683_10120628 3300026121 Bacteria 2353
513 Ga0207683_10167353 3300026121 Bacteria 1989
514 Ga0207683_10227766 3300026121 Bacteria 1699
515 Ga0207683_10357611 3300026121 Unclassified 1341
516 Ga0207698_10045883 3300026142 Bacteria 3296
517 Ga0207698_10116324 3300026142 Bacteria 2253
518 Ga0207698_10365888 3300026142 Bacteria 1367
519 Ga0207428_10000327 3300027907 Bacteria 61752
520 Ga0207428_10006296 3300027907 Bacteria 10973
521 Ga0207428_10007597 3300027907 Bacteria 9882
522 Ga0207428_10043381 3300027907 Bacteria 3633
523 Ga0268265_10123635 3300028380 Bacteria 2137
524 Ga0268264_10076280 3300028381 Bacteria 2851
525 Ga0268264_10165548 3300028381 Bacteria 1996
526 Ga0265327_10056628 3300031251 Bacteria 2019
527 Ga0265316_10117361 3300031344 Bacteria 2012
528 Ga0265314_10106402 3300031711 Bacteria 1792
529 Ga0307405_10004098 3300031731 Bacteria 6848
530 Ga0307405_10179609 3300031731 Bacteria 1518
531 Ga0307413_10006056 3300031824 Bacteria 5479
532 Ga0307413_10184426 3300031824 Bacteria 1491
533 Ga0307406_10217977 3300031901 Bacteria 1416
534 Ga0307412_10035117 3300031911 Bacteria 3201
535 Ga0307412_10073314 3300031911 Bacteria 2342
536 Ga0307409_100123740 3300031995 Bacteria 2195
537 Ga0307409_100262081 3300031995 Bacteria 1587
538 Ga0307416_100027674 3300032002 Bacteria 4202
539 Ga0307416_100139871 3300032002 Bacteria 2198
540 Ga0307414_10005455 3300032004 Bacteria 7006
541 Ga0307415_100008754 3300032126 Bacteria 5630
542 Ga0373930_0049734 3300034816 Bacteria 913
543 Ga0373950_0035123 3300034818 Bacteria 942
544 Ga0373958_0012215 3300034819 Bacteria 1466
545 Ga0373959_0009968 3300034820 Bacteria 1651
546 Ga0373938_0016075 3300034957 Bacteria 1458
547 Ga0373929_0057596 3300035085 Bacteria 903
548 Ga0373940_0047459 3300035088 Bacteria 1198
549 Ga0373949_0013482 3300035090 Bacteria 1813
550 Ga0373951_0039749 3300035091 Bacteria 1131
551 Ga0373952_0011426 3300035092 Bacteria 1732
552 Ga0373932_0006965 3300035112 Bacteria 2685
553 Ga0373939_0064903 3300035114 Bacteria 1173
554 Ga0373953_0139998 3300035117 Bacteria 1035
555 Ga0373960_0004005 3300035121 Bacteria 3361
556 Ga0373960_0007459 3300035121 Bacteria 2592
557 Ga0373943_0177898 3300035170 Bacteria 1168
558 Ga0373962_0010570 3300035242 Bacteria 2303
559 Ga0373931_0100876 3300035691 Bacteria 1623
560 Ga0373937_0158296 3300036401 Bacteria 2123
561 Ga0395899_0000899 3300037312 Bacteria 28042
562 Ga0395899_0001850 3300037312 Bacteria 17517
563 Ga0395899_0005803 3300037312 Bacteria 9582
564 Ga0395899_0013572 3300037312 Bacteria 6228
565 Ga0395899_0029850 3300037312 Bacteria 4102
566 Ga0395899_0043335 3300037312 Bacteria 3357
567 Ga0395899_0083273 3300037312 Bacteria 2326
568 Ga0395899_0106831 3300037312 Bacteria 2015
569 Ga0395899_0121855 3300037312 Bacteria 1867
570 Ga0395899_0135173 3300037312 Bacteria 1758
571 Ga0395899_0232721 3300037312 Bacteria 1271
572 Ga0395900_0004947 3300037418 Bacteria 14024
573 Ga0395900_0008467 3300037418 Bacteria 10577
574 Ga0395900_0009503 3300037418 Bacteria 9969
575 Ga0395900_0024495 3300037418 Bacteria 6180
576 Ga0395900_0041675 3300037418 Bacteria 4732
577 Ga0395900_0045047 3300037418 Bacteria 4544
578 Ga0395900_0052832 3300037418 Bacteria 4182
579 Ga0395900_0061463 3300037418 Bacteria 3862
580 Ga0395900_0064886 3300037418 Bacteria 3751
581 Ga0395900_0069784 3300037418 Bacteria 3612
582 Ga0395900_0077429 3300037418 Bacteria 3416
583 Ga0395900_0083585 3300037418 Bacteria 3280
584 Ga0395900_0097534 3300037418 Bacteria 3020
585 Ga0395900_0114430 3300037418 Bacteria 2768
586 Ga0395900_0161131 3300037418 Bacteria 2288
587 Ga0395900_0198976 3300037418 Bacteria 2028
588 Ga0395900_0249190 3300037418 Bacteria 1778
589 Ga0395900_0309308 3300037418 Bacteria 1564
590 Ga0395900_0323848 3300037418 Bacteria 1521
591 Ga0395900_0491752 3300037418 Unclassified 1178
592 Ga0395900_0587082 3300037418 Bacteria 1056
593 Ga0395898_0002821 3300037466 Bacteria 19931
594 Ga0395898_0003001 3300037466 Bacteria 19133
595 Ga0395898_0003379 3300037466 Bacteria 17875
596 Ga0395898_0004559 3300037466 Bacteria 15121
597 Ga0395898_0016080 3300037466 Bacteria 7666
598 Ga0395898_0023534 3300037466 Bacteria 6223
599 Ga0395898_0049171 3300037466 Bacteria 4132
600 Ga0395898_0049264 3300037466 Bacteria 4128
601 Ga0395898_0092266 3300037466 Bacteria 2912
602 Ga0395898_0165688 3300037466 Bacteria 2114
603 Ga0395898_0176892 3300037466 Bacteria 2039
604 Ga0395898_0323411 3300037466 Bacteria 1471
605 Ga0395898_0472758 3300037466 Bacteria 1193
606 Ga0395898_0490162 3300037466 Bacteria 1169
607 Ga0395898_0541344 3300037466 Bacteria 1106
608 Ga0395898_0599067 3300037466 Bacteria 1045
609 Ga0395905_0001363 3300037471 Bacteria 29719
610 Ga0395905_0002059 3300037471 Bacteria 22953
611 Ga0395905_0002078 3300037471 Bacteria 22774
612 Ga0395905_0004086 3300037471 Bacteria 15296
613 Ga0395905_0006030 3300037471 Bacteria 12272
614 Ga0395905_0014759 3300037471 Bacteria 7448
615 Ga0395905_0021871 3300037471 Bacteria 6049
616 Ga0395905_0036589 3300037471 Bacteria 4610
617 Ga0395905_0051578 3300037471 Bacteria 3854
618 Ga0395905_0084339 3300037471 Bacteria 2977
619 Ga0395905_0095831 3300037471 Bacteria 2785
620 Ga0395905_0113201 3300037471 Bacteria 2549
621 Ga0395905_0159640 3300037471 Bacteria 2119
622 Ga0395905_0224777 3300037471 Bacteria 1756
623 Ga0395905_0236101 3300037471 Bacteria 1709
624 Ga0395905_0244702 3300037471 Unclassified 1676
625 Ga0395905_0278226 3300037471 Bacteria 1559
626 Ga0395905_0316602 3300037471 Bacteria 1450
627 Ga0395905_0321113 3300037471 Bacteria 1438
628 Ga0395905_0495537 3300037471 Bacteria 1122
629 Ga0395905_0517718 3300037471 Bacteria 1093
630 Ga0395901_0001352 3300038443 Bacteria 25731
631 Ga0395901_0003549 3300038443 Bacteria 15723
632 Ga0395901_0003858 3300038443 Bacteria 15084
633 Ga0395901_0005231 3300038443 Bacteria 13099
634 Ga0395901_0018144 3300038443 Bacteria 7181
635 Ga0395901_0024846 3300038443 Bacteria 6149
636 Ga0395901_0029397 3300038443 Bacteria 5658
637 Ga0395901_0031856 3300038443 Bacteria 5436
638 Ga0395901_0033143 3300038443 Bacteria 5330
639 Ga0395901_0050239 3300038443 Bacteria 4333
640 Ga0395901_0051433 3300038443 Bacteria 4284
641 Ga0395901_0071012 3300038443 Bacteria 3628
642 Ga0395901_0076611 3300038443 Bacteria 3489
643 Ga0395901_0085134 3300038443 Bacteria 3305
644 Ga0395901_0091389 3300038443 Bacteria 3186
645 Ga0395901_0145921 3300038443 Bacteria 2487
646 Ga0395901_0181152 3300038443 Bacteria 2210
647 Ga0395901_0183869 3300038443 Bacteria 2192
648 Ga0395901_0216999 3300038443 Bacteria 2000
649 Ga0395901_0290155 3300038443 Bacteria 1698
650 Ga0395901_0296835 3300038443 Unclassified 1676
651 Ga0395901_0333528 3300038443 Bacteria 1568
652 Ga0395901_0369259 3300038443 Bacteria 1478
653 Ga0395901_0570848 3300038443 Bacteria 1144
654 Ga0395901_0572192 3300038443 Bacteria 1142
655 Ga0395901_0582252 3300038443 Bacteria 1130
656 Ga0395901_0630352 3300038443 Bacteria 1078
657 Ga0451793_0473993 3300041452 Bacteria 1320
658 Ga0451797_0714666 3300041453 Bacteria 1183
659 Ga0451839_0175852 3300041496 Bacteria 5304
660 Ga0450914_000317 3300042118 Bacteria 2077
661 Ga0450920_001292 3300042122 Bacteria 4127
662 Ga0450920_054645 3300042122 Bacteria 803
663 Ga0450907_010198 3300042146 Bacteria 1560
664 Ga0466964_0183950 3300044706 Bacteria 993
665 Ga0451576_0007862 3300045051 Bacteria 12639
666 Ga0495617_126941 3300046452 Bacteria 820
667 Ga0495592_0072171 3300046454 Bacteria 2512
668 Ga0495603_0132194 3300046455 Bacteria 1453
669 Ga0495629_0073549 3300046459 Bacteria 2386
670 Ga0495653_0053747 3300046463 Bacteria 3080
671 Ga0495582_0050345 3300046473 Bacteria 2295
672 Ga0495582_0173952 3300046473 Bacteria 1226
673 Ga0495662_0026544 3300046476 Bacteria 2796
674 Ga0495662_0105814 3300046476 Bacteria 1377
675 Ga0495662_0151225 3300046476 Bacteria 1143
676 Ga0495664_0277333 3300046477 Bacteria 1013
677 Ga0495584_0011195 3300046491 Bacteria 4597
678 Ga0495585_0096043 3300046492 Bacteria 1591
679 Ga0495594_0158358 3300046499 Bacteria 1287
680 Ga0495596_0043730 3300046500 Bacteria 1765
681 Ga0495596_0048859 3300046500 Bacteria 1659
682 Ga0495608_0139098 3300046511 Bacteria 1550
683 Ga0495616_0167154 3300046513 Bacteria 986
684 Ga0495618_0103951 3300046514 Bacteria 1819
685 Ga0495628_0306825 3300046516 Bacteria 1174
686 Ga0495630_0041028 3300046517 Bacteria 3457
687 Ga0495630_0115134 3300046517 Bacteria 2038
688 Ga0495630_0131431 3300046517 Bacteria 1901
689 Ga0495630_0154532 3300046517 Bacteria 1746
690 Ga0495631_0059657 3300046518 Bacteria 1657
691 Ga0495644_0034602 3300046523 Bacteria 1907
692 Ga0495663_0026281 3300046525 Bacteria 1704
693 Ga0495663_0035625 3300046525 Bacteria 1495
694 Ga0495652_0195229 3300046529 Bacteria 1541
695 Ga0495665_0046326 3300046531 Bacteria 2309
696 Ga0495640_0146314 3300046533 Bacteria 1520
697 Ga0495586_0029326 3300046535 Bacteria 2944
698 Ga0495645_0202975 3300046543 Bacteria 1343
699 Ga0495645_0360265 3300046543 Bacteria 935
700 Ga0495656_0143195 3300046615 Bacteria 1148
701 Ga0495634_0186694 3300046642 Bacteria 1295
702 Ga0495635_0216120 3300046663 Bacteria 1298
703 Ga0495657_0044320 3300046675 Bacteria 3026
704 Ga0495599_0087896 3300046678 Bacteria 1940
705 Ga0495599_0503968 3300046678 Bacteria 712
706 Ga0495658_0011093 3300046683 Bacteria 4522
707 Ga0495658_0015987 3300046683 Bacteria 3859
708 Ga0495613_0025954 3300046689 Bacteria 4365
709 Ga0495613_0060240 3300046689 Bacteria 2781
710 Ga0495613_0184611 3300046689 Bacteria 1476
711 Ga0495624_0078805 3300046690 Bacteria 2043
712 Ga0495670_0158444 3300046691 Bacteria 1189
713 Ga0495589_0060625 3300046794 Bacteria 1858
714 Ga0495581_0008682 3300047315 Bacteria 5885
715 Ga0495674_0059241 3300047319 Bacteria 3345
716 Ga0495674_0107422 3300047319 Bacteria 2369
717 Ga0495674_0188296 3300047319 Bacteria 1716
718 Ga0495676_0159803 3300047321 Bacteria 1595
719 Ga0495684_0044097 3300047471 Bacteria 3415
720 Ga0495684_0271452 3300047471 Bacteria 1227
721 Ga0495593_0046156 3300047673 Bacteria 2323
722 Ga0495602_0274571 3300048088 Bacteria 1244
723 Ga0495626_0151912 3300048091 Bacteria 976
724 Ga0496100_0009018 3300048903 Bacteria 5587
725 Ga0496100_0070381 3300048903 Bacteria 2333
726 Ga0496100_0101528 3300048903 Bacteria 1983
727 Ga0496100_0276174 3300048903 Bacteria 1251
728 Ga0496100_0757529 3300048903 Bacteria 759
729 Ga0496101_0028686 3300048904 Bacteria 3888
730 Ga0496101_0052469 3300048904 Bacteria 2940
731 Ga0496101_0371130 3300048904 Bacteria 1125
732 Ga0496102_0103380 3300048905 Bacteria 2649
733 Ga0496102_0142184 3300048905 Bacteria 2250
734 Ga0496102_0158300 3300048905 Bacteria 2130
735 Ga0496102_0174749 3300048905 Bacteria 2022
736 Ga0496102_0219281 3300048905 Bacteria 1793
737 Ga0496103_0016868 3300048906 Bacteria 4361
738 Ga0496103_0028321 3300048906 Bacteria 3399
739 Ga0496104_0001046 3300048907 Bacteria 23659
740 Ga0496104_0027965 3300048907 Bacteria 5222
741 Ga0496104_0162852 3300048907 Bacteria 2139
742 Ga0496104_0166237 3300048907 Bacteria 2116
743 Ga0496104_0215367 3300048907 Bacteria 1832
744 Ga0496104_0494208 3300048907 Bacteria 1135
745 Ga0496105_0012431 3300048908 Bacteria 6740
746 Ga0496105_0031626 3300048908 Bacteria 4338
747 Ga0496105_0045796 3300048908 Bacteria 3609
748 Ga0496105_0071862 3300048908 Bacteria 2860
749 Ga0496106_0013854 3300048909 Bacteria 5958
750 Ga0496106_0350573 3300048909 Bacteria 1186
751 Ga0496106_0446643 3300048909 Bacteria 1039
752 Ga0496107_0034001 3300048910 Bacteria 3649
753 Ga0496107_0057568 3300048910 Bacteria 2810
754 Ga0496107_0104219 3300048910 Bacteria 2081
755 Ga0496108_0013010 3300048911 Bacteria 6779
756 Ga0496108_0049735 3300048911 Bacteria 3506
757 Ga0496108_0062264 3300048911 Bacteria 3142
758 Ga0496108_0119176 3300048911 Bacteria 2263
759 Ga0496108_0150372 3300048911 Bacteria 2009
760 Ga0496108_0457694 3300048911 Bacteria 1115
761 Ga0496108_0502731 3300048911 Bacteria 1059
762 Ga0496109_0030913 3300048912 Bacteria 4801
763 Ga0496109_0039932 3300048912 Bacteria 4249
764 Ga0496109_0079921 3300048912 Bacteria 3013
765 Ga0496109_0093237 3300048912 Bacteria 2786
766 Ga0496109_0102563 3300048912 Bacteria 2655
767 Ga0496109_0291451 3300048912 Bacteria 1539
768 Ga0496109_0479447 3300048912 Bacteria 1174
769 Ga0496109_0708042 3300048912 Bacteria 944
770 Ga0496110_0000295 3300048913 Bacteria 32671
771 Ga0496110_0009155 3300048913 Bacteria 7996
772 Ga0496110_0064274 3300048913 Bacteria 3242
773 Ga0496110_0071705 3300048913 Bacteria 3072
774 Ga0496110_0285341 3300048913 Bacteria 1503
775 Ga0496110_0297720 3300048913 Bacteria 1470
776 Ga0496110_0303370 3300048913 Bacteria 1455
777 Ga0496110_0324260 3300048913 Bacteria 1403
778 Ga0496111_0008226 3300048914 Bacteria 6896
779 Ga0496111_0010581 3300048914 Bacteria 6197
780 Ga0496111_0016923 3300048914 Bacteria 5032
781 Ga0496111_0047835 3300048914 Bacteria 3080
782 Ga0496111_0050516 3300048914 Bacteria 3000
783 Ga0496111_0097233 3300048914 Bacteria 2161
784 Ga0496111_0100446 3300048914 Bacteria 2125
785 Ga0496112_0067131 3300048915 Bacteria 3540
786 Ga0496112_0173382 3300048915 Bacteria 2122
787 Ga0496112_0375088 3300048915 Bacteria 1364
788 Ga0496113_0058694 3300048916 Bacteria 2896
789 Ga0496113_0290941 3300048916 Bacteria 1307
790 Ga0496114_0000404 3300048917 Bacteria 31906
791 Ga0496114_0037983 3300048917 Bacteria 3983
792 Ga0496114_0076712 3300048917 Bacteria 2816
793 Ga0496114_0083966 3300048917 Bacteria 2696
794 Ga0496114_0147956 3300048917 Bacteria 2037
795 Ga0496114_0148309 3300048917 Bacteria 2034
796 Ga0496114_0198348 3300048917 Bacteria 1757
797 Ga0496114_0382074 3300048917 Bacteria 1247
798 Ga0496114_0585698 3300048917 Bacteria 984
799 Ga0496115_0007180 3300048918 Bacteria 8183
800 Ga0496115_0019498 3300048918 Bacteria 5220
801 Ga0496115_0092445 3300048918 Bacteria 2473
802 Ga0496115_0200575 3300048918 Bacteria 1648
803 Ga0496115_0223042 3300048918 Bacteria 1555
804 Ga0501031_0007339 3300049568 Bacteria 7190
805 Ga0501031_0010960 3300049568 Bacteria 5906
806 Ga0501031_0053362 3300049568 Bacteria 2634
807 Ga0501031_0074991 3300049568 Bacteria 2202
808 Ga0501031_0113116 3300049568 Bacteria 1773
809 Ga0501032_0078220 3300049569 Bacteria 2202
810 Ga0501032_0172332 3300049569 Bacteria 1418
811 Ga0501033_0177960 3300049570 Bacteria 1525
812 Ga0501034_0030500 3300049571 Bacteria 5482
813 Ga0501034_0146006 3300049571 Bacteria 2343
814 Ga0501036_0004976 3300049572 Bacteria 10743
815 Ga0501036_0029982 3300049572 Bacteria 4596
816 Ga0501036_0045256 3300049572 Bacteria 3729
817 Ga0501036_0200978 3300049572 Bacteria 1676
818 Ga0501036_0283366 3300049572 Bacteria 1387
819 Ga0501036_0726864 3300049572 Bacteria 820
820 Ga0501037_0004571 3300049573 Bacteria 10057
821 Ga0501037_0081858 3300049573 Bacteria 2340
822 Ga0501037_0324768 3300049573 Bacteria 1065
823 Ga0501037_0507280 3300049573 Bacteria 818
824 Ga0501038_0005846 3300049574 Bacteria 11379
825 Ga0501038_0033028 3300049574 Bacteria 4559
826 Ga0501038_0165163 3300049574 Bacteria 1796
827 Ga0501039_0036393 3300049575 Bacteria 3798
828 Ga0501039_0070083 3300049575 Bacteria 2724
829 Ga0501039_0087594 3300049575 Bacteria 2426
830 Ga0501039_0094779 3300049575 Bacteria 2327
831 Ga0501039_0128274 3300049575 Bacteria 1990
832 Ga0501039_0243505 3300049575 Bacteria 1414
833 Ga0501040_0001063 3300049576 Bacteria 17384
834 Ga0501040_0015008 3300049576 Bacteria 5118
835 Ga0501040_0017064 3300049576 Bacteria 4816
836 Ga0501040_0496349 3300049576 Bacteria 880
837 Ga0501041_0000466 3300049577 Bacteria 20514
838 Ga0501041_0239880 3300049577 Bacteria 1139
839 Ga0501042_0010580 3300049578 Bacteria 6194
840 Ga0501042_0021077 3300049578 Bacteria 4539
841 Ga0501042_0035265 3300049578 Bacteria 3549
842 Ga0501042_0205714 3300049578 Bacteria 1419
843 Ga0501042_0255797 3300049578 Unclassified 1264
844 Ga0501042_0304409 3300049578 Bacteria 1151
845 Ga0501043_0006516 3300049579 Bacteria 9368
846 Ga0501043_0087782 3300049579 Bacteria 2444
847 Ga0501046_0008207 3300049580 Bacteria 9122
848 Ga0501046_0018840 3300049580 Bacteria 5733
849 Ga0501046_0060444 3300049580 Bacteria 2965
850 Ga0501046_0167136 3300049580 Bacteria 1652
851 Ga0501046_0315904 3300049580 Bacteria 1139
852 Ga0501048_0009849 3300049582 Bacteria 7168
853 Ga0501048_0030822 3300049582 Bacteria 3881
854 Ga0501048_0042392 3300049582 Bacteria 3259
855 Ga0501048_0061871 3300049582 Bacteria 2650
856 Ga0501048_0091170 3300049582 Bacteria 2150
857 Ga0501048_0211850 3300049582 Bacteria 1374
858 Ga0501048_0708054 3300049582 Bacteria 723
859 Ga0501067_0005124 3300049583 Bacteria 7279
860 Ga0501067_0006112 3300049583 Bacteria 6676
861 Ga0501067_0009166 3300049583 Bacteria 5480
862 Ga0501067_0011144 3300049583 Bacteria 4973
863 Ga0501067_0024345 3300049583 Bacteria 3358
864 Ga0501067_0082470 3300049583 Bacteria 1783
865 Ga0501067_0193202 3300049583 Bacteria 1134
866 Ga0501068_0007174 3300049584 Bacteria 6173
867 Ga0501068_0008320 3300049584 Bacteria 5767
868 Ga0501068_0008939 3300049584 Bacteria 5591
869 Ga0501068_0047196 3300049584 Bacteria 2598
870 Ga0501068_0072266 3300049584 Bacteria 2107
871 Ga0501068_0088671 3300049584 Bacteria 1906
872 Ga0501068_0251459 3300049584 Bacteria 1126
873 Ga0501068_0275512 3300049584 Bacteria 1075
874 Ga0501069_0002218 3300049585 Bacteria 9794
875 Ga0501069_0002680 3300049585 Bacteria 9092
876 Ga0501069_0003452 3300049585 Bacteria 8129
877 Ga0501069_0049249 3300049585 Bacteria 2341
878 Ga0501069_0083374 3300049585 Bacteria 1802
879 Ga0501069_0128751 3300049585 Bacteria 1449
880 Ga0501069_0205711 3300049585 Bacteria 1141
881 Ga0501070_0005645 3300049586 Bacteria 10670
882 Ga0501070_0010504 3300049586 Bacteria 7828
883 Ga0501070_0034156 3300049586 Bacteria 4254
884 Ga0501071_0004962 3300049587 Bacteria 8496
885 Ga0501071_0029161 3300049587 Bacteria 3893
886 Ga0501071_0081291 3300049587 Bacteria 2371
887 Ga0501071_0106859 3300049587 Bacteria 2066
888 Ga0501071_0129431 3300049587 Unclassified 1874
889 Ga0501071_0136001 3300049587 Bacteria 1829
890 Ga0501071_0151465 3300049587 Bacteria 1730
891 Ga0501071_0221342 3300049587 Bacteria 1424
892 Ga0501072_0006637 3300049588 Bacteria 8804
893 Ga0501072_0009384 3300049588 Bacteria 7442
894 Ga0501072_0025255 3300049588 Bacteria 4628
895 Ga0501072_0043065 3300049588 Bacteria 3548
896 Ga0501072_0071622 3300049588 Bacteria 2739
897 Ga0501072_0127481 3300049588 Bacteria 2028
898 Ga0501072_0482866 3300049588 Bacteria 980
899 Ga0501074_0007089 3300049590 Bacteria 8099
900 Ga0501074_0022238 3300049590 Bacteria 4608
901 Ga0501074_0046332 3300049590 Bacteria 3144
902 Ga0501074_0049142 3300049590 Bacteria 3045
903 Ga0501074_0167593 3300049590 Bacteria 1568
904 Ga0501074_0297922 3300049590 Bacteria 1146
905 Ga0501075_0012643 3300049591 Bacteria 6003
906 Ga0501075_0037516 3300049591 Bacteria 3621
907 Ga0501075_0043085 3300049591 Bacteria 3385
908 Ga0501075_0107501 3300049591 Bacteria 2120
909 Ga0501075_0112269 3300049591 Bacteria 2072
910 Ga0501075_0127824 3300049591 Bacteria 1935
911 Ga0501076_0061176 3300049592 Bacteria 2997
912 Ga0501076_0061234 3300049592 Bacteria 2995
913 Ga0501076_0136053 3300049592 Bacteria 1994
914 Ga0501076_0142405 3300049592 Bacteria 1948
915 Ga0501076_0170815 3300049592 Bacteria 1772
916 Ga0501076_0216276 3300049592 Bacteria 1566
917 Ga0501076_0225651 3300049592 Bacteria 1531
918 Ga0501076_0243173 3300049592 Unclassified 1472
919 Ga0501077_0015950 3300049593 Bacteria 4733
920 Ga0501077_0017722 3300049593 Bacteria 4498
921 Ga0501077_0029539 3300049593 Bacteria 3485
922 Ga0501077_0035552 3300049593 Bacteria 3171
923 Ga0501077_0047453 3300049593 Unclassified 2729
924 Ga0501077_0447151 3300049593 Bacteria 827
925 Ga0501079_0000537 3300049741 Bacteria 24664
926 Ga0501079_0013666 3300049741 Bacteria 6191
927 Ga0501079_0033613 3300049741 Bacteria 3945
928 Ga0501079_0064770 3300049741 Bacteria 2819
929 Ga0501079_0080710 3300049741 Bacteria 2515
930 Ga0501079_0167787 3300049741 Bacteria 1712
931 Ga0501079_0257300 3300049741 Unclassified 1364
932 Ga0501079_0271347 3300049741 Bacteria 1326
933 Ga0501079_0505941 3300049741 Bacteria 950
934 Ga0501080_0002754 3300049742 Bacteria 15436
935 Ga0501080_0003599 3300049742 Bacteria 13644
936 Ga0501080_0015752 3300049742 Bacteria 6973
937 Ga0501080_0068930 3300049742 Bacteria 3290
938 Ga0501080_0128562 3300049742 Bacteria 2345
939 Ga0501080_0231452 3300049742 Bacteria 1689
940 Ga0501080_0291798 3300049742 Bacteria 1481
941 Ga0501080_0450261 3300049742 Bacteria 1154
942 Ga0501081_0006066 3300049743 Bacteria 7831
943 Ga0501081_0027074 3300049743 Bacteria 3870
944 Ga0501081_0045790 3300049743 Bacteria 3004
945 Ga0501081_0126117 3300049743 Bacteria 1826
946 Ga0501083_0000996 3300049744 Bacteria 18826
947 Ga0501083_0018367 3300049744 Bacteria 4873
948 Ga0501083_0058489 3300049744 Bacteria 2579
949 Ga0501083_0072652 3300049744 Bacteria 2286
950 Ga0501083_0325730 3300049744 Bacteria 999
951 Ga0501035_0042730 3300049822 Bacteria 4087
952 Ga0501035_0102468 3300049822 Bacteria 2511
953 Ga0501035_0131905 3300049822 Bacteria 2177
954 Ga0501035_0340987 3300049822 Bacteria 1256
955 Ga0501035_0486808 3300049822 Bacteria 1017
956 Ga0501044_0018412 3300049823 Bacteria 7482
957 Ga0501044_0745019 3300049823 Bacteria 862
958 Ga0501045_0035783 3300049824 Bacteria 3605
959 Ga0501045_0088296 3300049824 Bacteria 2290
960 Ga0501045_0092490 3300049824 Bacteria 2237
961 Ga0501045_0173197 3300049824 Bacteria 1607
962 Ga0501045_0221262 3300049824 Unclassified 1410
963 nmdc:mga05p37_20324_c1 3300050507 Bacteria 8034
964 nmdc:mga05p37_272750_c1 3300050507 Bacteria 2020
965 nmdc:mga05p37_67744_c1 3300050507 Bacteria 4391
966 nmdc:mga09592_128469_c1 3300050508 Bacteria 2180
967 nmdc:mga09592_187596_c1 3300050508 Bacteria 1789
968 nmdc:mga09592_47721_c1 3300050508 Bacteria 3610
969 nmdc:mga0qj67_249226_c1 3300050509 Bacteria 1441
970 nmdc:mga0qj67_3277_c1 3300050509 Bacteria 11661
971 nmdc:mga06r32_225699_c1 3300050510 Bacteria 1862
972 nmdc:mga08y16_21711_c1 3300050511 Bacteria 6776
973 nmdc:mga08y16_24706_c1 3300050511 Bacteria 6341
974 nmdc:mga08y16_302723_c1 3300050511 Bacteria 1648
975 nmdc:mga08y16_33448_c1 3300050511 Archaea 5399
976 nmdc:mga08y16_34597_c1 3300050511 Bacteria 5308
977 nmdc:mga08y16_389339_c1 3300050511 Archaea 1428
978 nmdc:mga08y16_7680_c1 3300050511 Bacteria 11288
979 nmdc:mga08y16_81708_c1 3300050511 Bacteria 3369
980 nmdc:mga08y16_92784_c1 3300050511 Bacteria 3146
981 nmdc:mga0n895_175113_c1 3300050512 Bacteria 2176
982 nmdc:mga0n895_558215_c1 3300050512 Bacteria 1150
983 nmdc:mga0rr50_76102_c1 3300050513 Bacteria 2575
984 nmdc:mga08x19_136287_c1 3300050514 Bacteria 1655
985 nmdc:mga0a205_131572_c1 3300050515 Bacteria 2402
986 nmdc:mga0a205_231606_c1 3300050515 Bacteria 1730
987 nmdc:mga0a205_34826_c1 3300050515 Bacteria 4833
988 nmdc:mga0a205_410977_c1 3300050515 Bacteria 1216
989 Ga0495655_0025093 3300053083 Bacteria 1391
990 Ga0495595_0042401 3300053084 Bacteria 2084
991 Ga0495595_0177396 3300053084 Bacteria 1056
992 Ga0495619_0158867 3300053085 Bacteria 1561
993 Ga0501084_0005644 3300054114 Bacteria 10274
994 Ga0501084_0021851 3300054114 Bacteria 5336
995 Ga0501084_0054182 3300054114 Bacteria 3355
996 Ga0501084_0105831 3300054114 Bacteria 2363
997 Ga0501084_0126030 3300054114 Bacteria 2155
998 Ga0501084_0184469 3300054114 Bacteria 1761
999 Ga0501084_0200803 3300054114 Bacteria 1682
1000 Ga0501082_0084568 3300060353 Bacteria 2736
1001 Ga0501082_0094642 3300060353 Bacteria 2581
1002 Ga0501082_0115336 3300060353 Bacteria 2326
1003 Ga0501082_0116947 3300060353 Bacteria 2309
1004 Ga0501082_0149040 3300060353 Bacteria 2032
1005 Ga0501082_0203609 3300060353 Bacteria 1722
1006 Ga0501082_0395718 3300060353 Bacteria 1205
1007 Ga0530510_0005979 3300061734 Bacteria 8441
1008 Ga0530510_0011844 3300061734 Bacteria 6121
1009 Ga0530510_0018951 3300061734 Bacteria 4880
1010 Ga0530510_0051929 3300061734 Bacteria 2963
1011 Ga0530510_0081235 3300061734 Bacteria 2360
1012 Ga0530510_0096953 3300061734 Bacteria 2155
1013 Ga0530510_0100363 3300061734 Bacteria 2116
1014 Ga0530510_0195102 3300061734 Bacteria 1503
1015 Ga0530510_0212723 3300061734 Bacteria 1436
1016 Ga0530510_0249348 3300061734 Bacteria 1323
1017 Ga0530510_0323110 3300061734 Bacteria 1157
1018 Ga0530510_0454632 3300061734 Bacteria 968
1019 Ga0501080_0095109
1020 rootL2_10099212
1021 Ga0070658_10004765
1022 Ga0070658_10086058
1023 Ga0070676_10026767
1024 Ga0070676_10167866
1025 Ga0070676_10179284
1026 Ga0070676_10293952
1027 Ga0070683_100005772
1028 Ga0070683_100012389
1029 Ga0070683_100065532
1030 Ga0070683_100103692
1031 Ga0070683_100135741
1032 Ga0070670_100031582
1033 Ga0070670_100084270
1034 Ga0068869_100010642
1035 Ga0068869_100031540
1036 Ga0070680_100005763
1037 Ga0070680_100008081
1038 Ga0070680_100010423
1039 Ga0070680_100297640
1040 Ga0070682_100002294
1041 Ga0070682_100049355
1042 Ga0070682_100510904
1043 Ga0068868_100034864
1044 Ga0068868_100052010
1045 Ga0068868_100059253
1046 Ga0068868_100156836
1047 Ga0068868_100492841
1048 Ga0070660_100080234
1049 Ga0070660_100163102
1050 Ga0070660_100276745
1051 Ga0070660_100330238
1052 Ga0070689_100024563
1053 Ga0070689_100037506
1054 Ga0070691_10003581
1055 Ga0070691_10124598
1056 Ga0070691_10184418
1057 Ga0070661_100051472
1058 Ga0070661_100067152
1059 Ga0070661_100076790
1060 Ga0070661_100153149
1061 Ga0070661_100250106
1062 Ga0070692_10003307
1063 Ga0070692_10438106
1064 Ga0070668_100084254
1065 Ga0070668_100099293
1066 Ga0070668_100754541
1067 Ga0070669_100189943
1068 Ga0070675_100036451
1069 Ga0070675_100036695
1070 Ga0070675_100373520
1071 Ga0070671_100402621
1072 Ga0070671_100466950
1073 Ga0070674_100002032
1074 Ga0070674_100008473
1075 Ga0070674_100126887
1076 Ga0070674_100405547
1077 Ga0070674_100462233
1078 Ga0070674_100666656
1079 Ga0070673_100021200
1080 Ga0070673_100122262
1081 Ga0070688_100005633
1082 Ga0070659_100036838
1083 Ga0070659_100040918
1084 Ga0070659_100079498
1085 Ga0070659_100701771
1086 Ga0070667_100285637
1087 Ga0070713_100277904
1088 Ga0070710_10018750
1089 Ga0070701_10043794
1090 Ga0070701_10472644
1091 Ga0070711_100636502
1092 Ga0070705_100059374
1093 Ga0070705_100181595
1094 Ga0070705_100422257
1095 Ga0070700_100048035
1096 Ga0070700_100269434
1097 Ga0070694_100175481
1098 Ga0070694_100222669
1099 Ga0070663_100044664
1100 Ga0070663_100095726
1101 Ga0070663_100183438
1102 Ga0070663_100600045
1103 Ga0070678_100005380
1104 Ga0070678_100067132
1105 Ga0070678_100228234
1106 Ga0070662_100044687
1107 Ga0070662_100117956
1108 Ga0070662_100128377
1109 Ga0070662_100159033
1110 Ga0070662_100249379
1111 Ga0070681_10001517
1112 Ga0070681_10004737
1113 Ga0070681_10125268
1114 Ga0068867_100107768
1115 Ga0068867_100370152
1116 Ga0070685_10015996
1117 Ga0070685_10336061
1118 Ga0070706_100021988
1119 Ga0070706_100034884
1120 Ga0070706_100403180
1121 Ga0070707_100030912
1122 Ga0070707_100310380
1123 Ga0070707_100563906
1124 Ga0070707_100776191
1125 Ga0070698_100077888
1126 Ga0070698_100128764
1127 Ga0070698_100141121
1128 Ga0070699_100081291
1129 Ga0070679_100001190
1130 Ga0070679_100016991
1131 Ga0070679_100037940
1132 Ga0070679_100088815
1133 Ga0070679_100412752
1134 Ga0070684_100002475
1135 Ga0070684_100008837
1136 Ga0070684_100024169
1137 Ga0070684_100024713
1138 Ga0070684_100024877
1139 Ga0070684_100101946
1140 Ga0070684_100250235
1141 Ga0070684_100368760
1142 Ga0070684_100588799
1143 Ga0070684_100726344
1144 Ga0070697_100082256
1145 Ga0068853_100206615
1146 Ga0068853_100584358
1147 Ga0070672_100028983
1148 Ga0070672_100079614
1149 Ga0070686_100038012
1150 Ga0070686_100078344
1151 Ga0070686_100115428
1152 Ga0070686_100356461
1153 Ga0070695_100202648
1154 Ga0070696_100060253
1155 Ga0070696_100101570
1156 Ga0070696_100262181
1157 Ga0070696_100446318
1158 Ga0070693_100009137
1159 Ga0070704_100053064
1160 Ga0070704_100328936
1161 Ga0068855_100016986
1162 Ga0068855_100067944
1163 Ga0068855_100131542
1164 Ga0068855_100380205
1165 Ga0070664_100031006
1166 Ga0070664_100060615
1167 Ga0070664_100107551
1168 Ga0070664_100187769
1169 Ga0070664_100328019
1170 Ga0068857_100007616
1171 Ga0068857_100050082
1172 Ga0068857_100089263
1173 Ga0068857_100137000
1174 Ga0068857_100432927
1175 Ga0068854_100071737
1176 Ga0068854_100533796
1177 Ga0068854_100539171
1178 Ga0068856_100109460
1179 Ga0068856_100118802
1180 Ga0068856_100155924
1181 Ga0068856_100598200
1182 Ga0068856_100888157
1183 Ga0070702_100005742
1184 Ga0070702_100029720
1185 Ga0070702_100035607
1186 Ga0070702_100036891
1187 Ga0070702_100099911
1188 Ga0070702_100463382
1189 Ga0068852_100071478
1190 Ga0068852_100099241
1191 Ga0068852_100406649
1192 Ga0068859_100097340
1193 Ga0068864_100103952
1194 Ga0068864_100877312
1195 Ga0068866_10036430
1196 Ga0068866_10169333
1197 Ga0068866_10253886
1198 Ga0068861_100067564
1199 Ga0068861_100104809
1200 Ga0068861_100293037
1201 Ga0068861_100339847
1202 Ga0068870_10013168
1203 Ga0068870_10034050
1204 Ga0068870_10213439
1205 Ga0068863_100125580
1206 Ga0068858_100025329
1207 Ga0068858_100704322
1208 Ga0068860_100024509
1209 Ga0068860_100222744
1210 Ga0068862_100255312
1211 Ga0068862_100342618
1212 Ga0081455_10051443
1213 Ga0081455_10068601
1214 Ga0081455_10160058
1215 Ga0081538_10000864
1216 Ga0081538_10073956
1217 Ga0081539_10000335
1218 Ga0081539_10002145
1219 Ga0075365_10344928
1220 Ga0070715_10088246
1221 Ga0070716_100014516
1222 Ga0070712_100318071
1223 Ga0097621_100048186
1224 Ga0097621_100100644
1225 Ga0068871_100048540
1226 Ga0068871_100102278
1227 Ga0068871_100133981
1228 Ga0068871_100423798
1229 Ga0068871_100555776
1230 Ga0075428_100002047
1231 Ga0075428_100011263
1232 Ga0075428_100032480
1233 Ga0075428_100212214
1234 Ga0075428_100501347
1235 Ga0075430_100202570
1236 Ga0075431_100030532
1237 Ga0075431_100113531
1238 Ga0075433_10016304
1239 Ga0075433_10225331
1240 Ga0075433_10417220
1241 Ga0075434_100105583
1242 Ga0075434_100113787
1243 Ga0075434_100159330
1244 Ga0075434_100212172
1245 Ga0075429_100005788
1246 Ga0075429_100043183
1247 Ga0068865_100023535
1248 Ga0068865_100027824
1249 Ga0068865_100149223
1250 Ga0068865_100167534
1251 Ga0068865_100223999
1252 Ga0068865_100387028
1253 Ga0075436_100143469
1254 Ga0097620_100097341
1255 Ga0075435_100012074
1256 Ga0075435_100053353
1257 Ga0105240_10277841
1258 Ga0111539_10009767
1259 Ga0111539_10016431
1260 Ga0111539_10024626
1261 Ga0111539_10046165
1262 Ga0111539_10055201
1263 Ga0111539_10068708
1264 Ga0111539_10105489
1265 Ga0111539_10179571
1266 Ga0111539_10390483
1267 Ga0111539_10499974
1268 Ga0111539_10665866
1269 Ga0105245_10001062
1270 Ga0105245_10002157
1271 Ga0105245_10067307
1272 Ga0105245_10087090
1273 Ga0105245_10111003
1274 Ga0105245_10204327
1275 Ga0105245_10291126
1276 Ga0105245_10316254
1277 Ga0105247_10322562
1278 Ga0105247_10552332
1279 Ga0114129_10005183
1280 Ga0114129_10005445
1281 Ga0114129_10010791
1282 Ga0114129_10104620
1283 Ga0114129_10107714
1284 Ga0114129_10118542
1285 Ga0114129_10264284
1286 Ga0105243_10016866
1287 Ga0105243_10040653
1288 Ga0105243_10064486
1289 Ga0105243_10113806
1290 Ga0105243_10141417
1291 Ga0105243_10383719
1292 Ga0105243_10531864
1293 Ga0105241_10027993
1294 Ga0105242_10036222
1295 Ga0105242_10047661
1296 Ga0105242_10055716
1297 Ga0105242_10201103
1298 Ga0105242_10283246
1299 Ga0105242_10417621
1300 Ga0105242_10458557
1301 Ga0105242_11171632
1302 Ga0105248_10058256
1303 Ga0105248_10148313
1304 Ga0105237_10636358
1305 Ga0105237_10805726
1306 Ga0105238_10133139
1307 Ga0105238_10300461
1308 Ga0105249_10129018
1309 Ga0105249_10235068
1310 Ga0105249_10672819
1311 Ga0105249_10741675
1312 Ga0105249_10825122
1313 Ga0105239_10017706
1314 Ga0105239_10020919
1315 Ga0105239_10025303
1316 Ga0105239_10028808
1317 Ga0105239_10111840
1318 Ga0105239_10277086
1319 Ga0105239_11090932
1320 Ga0105246_10009303
1321 Ga0105246_10042153
1322 Ga0105246_10050709
1323 Ga0105246_10057684
1324 Ga0105246_10123370
1325 Ga0105246_10255676
1326 Ga0105246_10873452
1327 Ga0157341_1007043
1328 Ga0157373_10199783
1329 Ga0157371_10071269
1330 Ga0157370_10006695
1331 Ga0157369_10014930
1332 Ga0157369_10731538
1333 Ga0157374_10070941
1334 Ga0157374_10124652
1335 Ga0163162_10344805
1336 Ga0163162_10573016
1337 Ga0157372_10133503
1338 Ga0157372_10605639
1339 Ga0157375_10056095
1340 Ga0157375_10085648
1341 Ga0157375_10130463
1342 Ga0157375_10192454
1343 Ga0157375_10235832
1344 Ga0157375_10292540
1345 Ga0157375_10856120
1346 Ga0163163_10161460
1347 Ga0163163_10181762
1348 Ga0163163_10205294
1349 Ga0163163_10372728
1350 Ga0163163_10845488
1351 Ga0157380_10021075
1352 Ga0157380_10081214
1353 Ga0182008_10078544
1354 Ga0157377_10001184
1355 Ga0157377_10035537
1356 Ga0157377_10038092
1357 Ga0157377_10200628
1358 Ga0157379_10265167
1359 Ga0157379_10267048
1360 Ga0157376_10033194
1361 Ga0157376_10088042
1362 Ga0157376_10403431
1363 Ga0157376_10542636
1364 Ga0163161_10051318
1365 Ga0163161_10154864
1366 Ga0163161_10203324
1367 Ga0206356_10519479
1368 Ga0206354_11677922
1369 Ga0206354_11697263
1370 Ga0206353_10850478
1371 Ga0207653_10020832
1372 Ga0207688_10001835
1373 Ga0207688_10004340
1374 Ga0207688_10033454
1375 Ga0207688_10039174
1376 Ga0207645_10054398
1377 Ga0207645_10111569
1378 Ga0207645_10184451
1379 Ga0207645_10223276
1380 Ga0207643_10006658
1381 Ga0207705_10008932
1382 Ga0207705_10039721
1383 Ga0207705_10341037
1384 Ga0207684_10079151
1385 Ga0207654_10019326
1386 Ga0207707_10009308
1387 Ga0207707_10094803
1388 Ga0207693_10013387
1389 Ga0207693_10050718
1390 Ga0207693_10135568
1391 Ga0207663_10124941
1392 Ga0207660_10051804
1393 Ga0207660_10080233
1394 Ga0207660_10549487
1395 Ga0207662_10004444
1396 Ga0207662_10212834
1397 Ga0207657_10000331
1398 Ga0207657_10025168
1399 Ga0207657_10053881
1400 Ga0207657_10080926
1401 Ga0207649_10021808
1402 Ga0207649_10086001
1403 Ga0207652_10001925
1404 Ga0207652_10043109
1405 Ga0207652_10046367
1406 Ga0207652_10106640
1407 Ga0207652_10112775
1408 Ga0207652_10325010
1409 Ga0207646_10008016
1410 Ga0207681_10039033
1411 Ga0207681_10408711
1412 Ga0207650_10288980
1413 Ga0207659_10048085
1414 Ga0207659_10122809
1415 Ga0207687_10002663
1416 Ga0207687_10009887
1417 Ga0207687_10046460
1418 Ga0207687_10048563
1419 Ga0207687_10120306
1420 Ga0207687_10248966
1421 Ga0207687_10586456
1422 Ga0207644_10459076
1423 Ga0207644_10589779
1424 Ga0207690_10019468
1425 Ga0207690_10191601
1426 Ga0207690_10586538
1427 Ga0207706_10009833
1428 Ga0207706_10011879
1429 Ga0207706_10048847
1430 Ga0207706_10100741
1431 Ga0207706_10123423
1432 Ga0207706_10265005
1433 Ga0207706_10314272
1434 Ga0207686_10144898
1435 Ga0207686_10280393
1436 Ga0207686_10367634
1437 Ga0207686_10576513
1438 Ga0207709_10042641
1439 Ga0207709_10117165
1440 Ga0207709_10156024
1441 Ga0207670_10070713
1442 Ga0207670_10650500
1443 Ga0207669_10002692
1444 Ga0207669_10094000
1445 Ga0207669_10250502
1446 Ga0207669_10372653
1447 Ga0207669_10406684
1448 Ga0207704_10123178
1449 Ga0207704_10186866
1450 Ga0207665_10002419
1451 Ga0207691_10048589
1452 Ga0207691_10073189
1453 Ga0207691_10076997
1454 Ga0207689_10070737
1455 Ga0207689_10130222
1456 Ga0207689_10378931
1457 Ga0207661_10000167
1458 Ga0207661_10006848
1459 Ga0207661_10007021
1460 Ga0207661_10043819
1461 Ga0207661_10052224
1462 Ga0207661_10137932
1463 Ga0207679_10080677
1464 Ga0207679_10204094
1465 Ga0207679_10217449
1466 Ga0207679_10371411
1467 Ga0207667_10109164
1468 Ga0207667_10228425
1469 Ga0207667_10327043
1470 Ga0207667_10558636
1471 Ga0207651_10004087
1472 Ga0207651_10131127
1473 Ga0207651_10506638
1474 Ga0207712_10104316
1475 Ga0207712_10127378
1476 Ga0207668_10024717
1477 Ga0207668_10130340
1478 Ga0207668_10271629
1479 Ga0207668_10440894
1480 Ga0207640_10446552
1481 Ga0207640_10452657
1482 Ga0207677_10011273
1483 Ga0207677_10112824
1484 Ga0207677_10183206
1485 Ga0207677_10207443
1486 Ga0207677_10393645
1487 Ga0207703_10036035
1488 Ga0207639_10036429
1489 Ga0207639_10052679
1490 Ga0207639_10098178
1491 Ga0207639_10235364
1492 Ga0207678_10019025
1493 Ga0207678_10789503
1494 Ga0207708_10030896
1495 Ga0207708_10034080
1496 Ga0207708_10058848
1497 Ga0207708_10400814
1498 Ga0207708_10460591
1499 Ga0207708_10521711
1500 Ga0207702_10021760
1501 Ga0207702_10048040
1502 Ga0207702_10058318
1503 Ga0207702_10183353
1504 Ga0207702_11060284
1505 Ga0207641_10282311
1506 Ga0207648_10060818
1507 Ga0207648_10111714
1508 Ga0207648_10242685
1509 Ga0207648_10400295
1510 Ga0207648_10457869
1511 Ga0207676_10253540
1512 Ga0207674_10003106
1513 Ga0207674_10018155
1514 Ga0207674_10055480
1515 Ga0207674_10104105
1516 Ga0207674_10151212
1517 Ga0207674_10470524
1518 Ga0207674_10701283
1519 Ga0207674_10762011
1520 Ga0207675_100057052
1521 Ga0207675_100104031
1522 Ga0207675_100107589
1523 Ga0207675_100113211
1524 Ga0207675_100299696
1525 Ga0207675_100451144
1526 Ga0207683_10010195
1527 Ga0207683_10016208
1528 Ga0207683_10016533
1529 Ga0207683_10018197
1530 Ga0207683_10120628
1531 Ga0207683_10167353
1532 Ga0207683_10227766
1533 Ga0207683_10357611
1534 Ga0207698_10045883
1535 Ga0207698_10116324
1536 Ga0207698_10365888
1537 Ga0207428_10000327
1538 Ga0207428_10006296
1539 Ga0207428_10007597
1540 Ga0207428_10043381
1541 Ga0268265_10123635
1542 Ga0268264_10076280
1543 Ga0268264_10165548
1544 Ga0265327_10056628
1545 Ga0265316_10117361
1546 Ga0265314_10106402
1547 Ga0307405_10004098
1548 Ga0307405_10179609
1549 Ga0307413_10006056
1550 Ga0307413_10184426
1551 Ga0307406_10217977
1552 Ga0307412_10035117
1553 Ga0307412_10073314
1554 Ga0307409_100123740
1555 Ga0307409_100262081
1556 Ga0307416_100027674
1557 Ga0307416_100139871
1558 Ga0307414_10005455
1559 Ga0307415_100008754
1560 Ga0373930_0049734
1561 Ga0373950_0035123
1562 Ga0373958_0012215
1563 Ga0373959_0009968
1564 Ga0373938_0016075
1565 Ga0373929_0057596
1566 Ga0373940_0047459
1567 Ga0373949_0013482
1568 Ga0373951_0039749
1569 Ga0373952_0011426
1570 Ga0373932_0006965
1571 Ga0373939_0064903
1572 Ga0373953_0139998
1573 Ga0373960_0004005
1574 Ga0373960_0007459
1575 Ga0373943_0177898
1576 Ga0373962_0010570
1577 Ga0373931_0100876
1578 Ga0373937_0158296
1579 Ga0395899_0000899
1580 Ga0395899_0001850
1581 Ga0395899_0005803
1582 Ga0395899_0013572
1583 Ga0395899_0029850
1584 Ga0395899_0043335
1585 Ga0395899_0083273
1586 Ga0395899_0106831
1587 Ga0395899_0121855
1588 Ga0395899_0135173
1589 Ga0395899_0232721
1590 Ga0395900_0004947
1591 Ga0395900_0008467
1592 Ga0395900_0009503
1593 Ga0395900_0024495
1594 Ga0395900_0041675
1595 Ga0395900_0045047
1596 Ga0395900_0052832
1597 Ga0395900_0061463
1598 Ga0395900_0064886
1599 Ga0395900_0069784
1600 Ga0395900_0077429
1601 Ga0395900_0083585
1602 Ga0395900_0097534
1603 Ga0395900_0114430
1604 Ga0395900_0161131
1605 Ga0395900_0198976
1606 Ga0395900_0249190
1607 Ga0395900_0309308
1608 Ga0395900_0323848
1609 Ga0395900_0491752
1610 Ga0395900_0587082
1611 Ga0395898_0002821
1612 Ga0395898_0003001
1613 Ga0395898_0003379
1614 Ga0395898_0004559
1615 Ga0395898_0016080
1616 Ga0395898_0023534
1617 Ga0395898_0049171
1618 Ga0395898_0049264
1619 Ga0395898_0092266
1620 Ga0395898_0165688
1621 Ga0395898_0176892
1622 Ga0395898_0323411
1623 Ga0395898_0472758
1624 Ga0395898_0490162
1625 Ga0395898_0541344
1626 Ga0395898_0599067
1627 Ga0395905_0001363
1628 Ga0395905_0002059
1629 Ga0395905_0002078
1630 Ga0395905_0004086
1631 Ga0395905_0006030
1632 Ga0395905_0014759
1633 Ga0395905_0021871
1634 Ga0395905_0036589
1635 Ga0395905_0051578
1636 Ga0395905_0084339
1637 Ga0395905_0095831
1638 Ga0395905_0113201
1639 Ga0395905_0159640
1640 Ga0395905_0224777
1641 Ga0395905_0236101
1642 Ga0395905_0244702
1643 Ga0395905_0278226
1644 Ga0395905_0316602
1645 Ga0395905_0321113
1646 Ga0395905_0495537
1647 Ga0395905_0517718
1648 Ga0395901_0001352
1649 Ga0395901_0003549
1650 Ga0395901_0003858
1651 Ga0395901_0005231
1652 Ga0395901_0018144
1653 Ga0395901_0024846
1654 Ga0395901_0029397
1655 Ga0395901_0031856
1656 Ga0395901_0033143
1657 Ga0395901_0050239
1658 Ga0395901_0051433
1659 Ga0395901_0071012
1660 Ga0395901_0076611
1661 Ga0395901_0085134
1662 Ga0395901_0091389
1663 Ga0395901_0145921
1664 Ga0395901_0181152
1665 Ga0395901_0183869
1666 Ga0395901_0216999
1667 Ga0395901_0290155
1668 Ga0395901_0296835
1669 Ga0395901_0333528
1670 Ga0395901_0369259
1671 Ga0395901_0570848
1672 Ga0395901_0572192
1673 Ga0395901_0582252
1674 Ga0395901_0630352
1675 Ga0451793_0473993
1676 Ga0451797_0714666
1677 Ga0451839_0175852
1678 Ga0450914_000317
1679 Ga0450920_001292
1680 Ga0450920_054645
1681 Ga0450907_010198
1682 Ga0466964_0183950
1683 Ga0451576_0007862
1684 Ga0495617_126941
1685 Ga0495592_0072171
1686 Ga0495603_0132194
1687 Ga0495629_0073549
1688 Ga0495653_0053747
1689 Ga0495582_0050345
1690 Ga0495582_0173952
1691 Ga0495662_0026544
1692 Ga0495662_0105814
1693 Ga0495662_0151225
1694 Ga0495664_0277333
1695 Ga0495584_0011195
1696 Ga0495585_0096043
1697 Ga0495594_0158358
1698 Ga0495596_0043730
1699 Ga0495596_0048859
1700 Ga0495608_0139098
1701 Ga0495616_0167154
1702 Ga0495618_0103951
1703 Ga0495628_0306825
1704 Ga0495630_0041028
1705 Ga0495630_0115134
1706 Ga0495630_0131431
1707 Ga0495630_0154532
1708 Ga0495631_0059657
1709 Ga0495644_0034602
1710 Ga0495663_0026281
1711 Ga0495663_0035625
1712 Ga0495652_0195229
1713 Ga0495665_0046326
1714 Ga0495640_0146314
1715 Ga0495586_0029326
1716 Ga0495645_0202975
1717 Ga0495645_0360265
1718 Ga0495656_0143195
1719 Ga0495634_0186694
1720 Ga0495635_0216120
1721 Ga0495657_0044320
1722 Ga0495599_0087896
1723 Ga0495599_0503968
1724 Ga0495658_0011093
1725 Ga0495658_0015987
1726 Ga0495613_0025954
1727 Ga0495613_0060240
1728 Ga0495613_0184611
1729 Ga0495624_0078805
1730 Ga0495670_0158444
1731 Ga0495589_0060625
1732 Ga0495581_0008682
1733 Ga0495674_0059241
1734 Ga0495674_0107422
1735 Ga0495674_0188296
1736 Ga0495676_0159803
1737 Ga0495684_0044097
1738 Ga0495684_0271452
1739 Ga0495593_0046156
1740 Ga0495602_0274571
1741 Ga0495626_0151912
1742 Ga0496100_0009018
1743 Ga0496100_0070381
1744 Ga0496100_0101528
1745 Ga0496100_0276174
1746 Ga0496100_0757529
1747 Ga0496101_0028686
1748 Ga0496101_0052469
1749 Ga0496101_0371130
1750 Ga0496102_0103380
1751 Ga0496102_0142184
1752 Ga0496102_0158300
1753 Ga0496102_0174749
1754 Ga0496102_0219281
1755 Ga0496103_0016868
1756 Ga0496103_0028321
1757 Ga0496104_0001046
1758 Ga0496104_0027965
1759 Ga0496104_0162852
1760 Ga0496104_0166237
1761 Ga0496104_0215367
1762 Ga0496104_0494208
1763 Ga0496105_0012431
1764 Ga0496105_0031626
1765 Ga0496105_0045796
1766 Ga0496105_0071862
1767 Ga0496106_0013854
1768 Ga0496106_0350573
1769 Ga0496106_0446643
1770 Ga0496107_0034001
1771 Ga0496107_0057568
1772 Ga0496107_0104219
1773 Ga0496108_0013010
1774 Ga0496108_0049735
1775 Ga0496108_0062264
1776 Ga0496108_0119176
1777 Ga0496108_0150372
1778 Ga0496108_0457694
1779 Ga0496108_0502731
1780 Ga0496109_0030913
1781 Ga0496109_0039932
1782 Ga0496109_0079921
1783 Ga0496109_0093237
1784 Ga0496109_0102563
1785 Ga0496109_0291451
1786 Ga0496109_0479447
1787 Ga0496109_0708042
1788 Ga0496110_0000295
1789 Ga0496110_0009155
1790 Ga0496110_0064274
1791 Ga0496110_0071705
1792 Ga0496110_0285341
1793 Ga0496110_0297720
1794 Ga0496110_0303370
1795 Ga0496110_0324260
1796 Ga0496111_0008226
1797 Ga0496111_0010581
1798 Ga0496111_0016923
1799 Ga0496111_0047835
1800 Ga0496111_0050516
1801 Ga0496111_0097233
1802 Ga0496111_0100446
1803 Ga0496112_0067131
1804 Ga0496112_0173382
1805 Ga0496112_0375088
1806 Ga0496113_0058694
1807 Ga0496113_0290941
1808 Ga0496114_0000404
1809 Ga0496114_0037983
1810 Ga0496114_0076712
1811 Ga0496114_0083966
1812 Ga0496114_0147956
1813 Ga0496114_0148309
1814 Ga0496114_0198348
1815 Ga0496114_0382074
1816 Ga0496114_0585698
1817 Ga0496115_0007180
1818 Ga0496115_0019498
1819 Ga0496115_0092445
1820 Ga0496115_0200575
1821 Ga0496115_0223042
1822 Ga0501031_0007339
1823 Ga0501031_0010960
1824 Ga0501031_0053362
1825 Ga0501031_0074991
1826 Ga0501031_0113116
1827 Ga0501032_0078220
1828 Ga0501032_0172332
1829 Ga0501033_0177960
1830 Ga0501034_0030500
1831 Ga0501034_0146006
1832 Ga0501036_0004976
1833 Ga0501036_0029982
1834 Ga0501036_0045256
1835 Ga0501036_0200978
1836 Ga0501036_0283366
1837 Ga0501036_0726864
1838 Ga0501037_0004571
1839 Ga0501037_0081858
1840 Ga0501037_0324768
1841 Ga0501037_0507280
1842 Ga0501038_0005846
1843 Ga0501038_0033028
1844 Ga0501038_0165163
1845 Ga0501039_0036393
1846 Ga0501039_0070083
1847 Ga0501039_0087594
1848 Ga0501039_0094779
1849 Ga0501039_0128274
1850 Ga0501039_0243505
1851 Ga0501040_0001063
1852 Ga0501040_0015008
1853 Ga0501040_0017064
1854 Ga0501040_0496349
1855 Ga0501041_0000466
1856 Ga0501041_0239880
1857 Ga0501042_0010580
1858 Ga0501042_0021077
1859 Ga0501042_0035265
1860 Ga0501042_0205714
1861 Ga0501042_0255797
1862 Ga0501042_0304409
1863 Ga0501043_0006516
1864 Ga0501043_0087782
1865 Ga0501046_0008207
1866 Ga0501046_0018840
1867 Ga0501046_0060444
1868 Ga0501046_0167136
1869 Ga0501046_0315904
1870 Ga0501048_0009849
1871 Ga0501048_0030822
1872 Ga0501048_0042392
1873 Ga0501048_0061871
1874 Ga0501048_0091170
1875 Ga0501048_0211850
1876 Ga0501048_0708054
1877 Ga0501067_0005124
1878 Ga0501067_0006112
1879 Ga0501067_0009166
1880 Ga0501067_0011144
1881 Ga0501067_0024345
1882 Ga0501067_0082470
1883 Ga0501067_0193202
1884 Ga0501068_0007174
1885 Ga0501068_0008320
1886 Ga0501068_0008939
1887 Ga0501068_0047196
1888 Ga0501068_0072266
1889 Ga0501068_0088671
1890 Ga0501068_0251459
1891 Ga0501068_0275512
1892 Ga0501069_0002218
1893 Ga0501069_0002680
1894 Ga0501069_0003452
1895 Ga0501069_0049249
1896 Ga0501069_0083374
1897 Ga0501069_0128751
1898 Ga0501069_0205711
1899 Ga0501070_0005645
1900 Ga0501070_0010504
1901 Ga0501070_0034156
1902 Ga0501071_0004962
1903 Ga0501071_0029161
1904 Ga0501071_0081291
1905 Ga0501071_0106859
1906 Ga0501071_0129431
1907 Ga0501071_0136001
1908 Ga0501071_0151465
1909 Ga0501071_0221342
1910 Ga0501072_0006637
1911 Ga0501072_0009384
1912 Ga0501072_0025255
1913 Ga0501072_0043065
1914 Ga0501072_0071622
1915 Ga0501072_0127481
1916 Ga0501072_0482866
1917 Ga0501074_0007089
1918 Ga0501074_0022238
1919 Ga0501074_0046332
1920 Ga0501074_0049142
1921 Ga0501074_0167593
1922 Ga0501074_0297922
1923 Ga0501075_0012643
1924 Ga0501075_0037516
1925 Ga0501075_0043085
1926 Ga0501075_0107501
1927 Ga0501075_0112269
1928 Ga0501075_0127824
1929 Ga0501076_0061176
1930 Ga0501076_0061234
1931 Ga0501076_0136053
1932 Ga0501076_0142405
1933 Ga0501076_0170815
1934 Ga0501076_0216276
1935 Ga0501076_0225651
1936 Ga0501076_0243173
1937 Ga0501077_0015950
1938 Ga0501077_0017722
1939 Ga0501077_0029539
1940 Ga0501077_0035552
1941 Ga0501077_0047453
1942 Ga0501077_0447151
1943 Ga0501079_0000537
1944 Ga0501079_0013666
1945 Ga0501079_0033613
1946 Ga0501079_0064770
1947 Ga0501079_0080710
1948 Ga0501079_0167787
1949 Ga0501079_0257300
1950 Ga0501079_0271347
1951 Ga0501079_0505941
1952 Ga0501080_0002754
1953 Ga0501080_0003599
1954 Ga0501080_0015752
1955 Ga0501080_0068930
1956 Ga0501080_0128562
1957 Ga0501080_0231452
1958 Ga0501080_0291798
1959 Ga0501080_0450261
1960 Ga0501081_0006066
1961 Ga0501081_0027074
1962 Ga0501081_0045790
1963 Ga0501081_0126117
1964 Ga0501083_0000996
1965 Ga0501083_0018367
1966 Ga0501083_0058489
1967 Ga0501083_0072652
1968 Ga0501083_0325730
1969 Ga0501035_0042730
1970 Ga0501035_0102468
1971 Ga0501035_0131905
1972 Ga0501035_0340987
1973 Ga0501035_0486808
1974 Ga0501044_0018412
1975 Ga0501044_0745019
1976 Ga0501045_0035783
1977 Ga0501045_0088296
1978 Ga0501045_0092490
1979 Ga0501045_0173197
1980 Ga0501045_0221262
1981 nmdc:mga05p37_20324_c1
1982 nmdc:mga05p37_272750_c1
1983 nmdc:mga05p37_67744_c1
1984 nmdc:mga09592_128469_c1
1985 nmdc:mga09592_187596_c1
1986 nmdc:mga09592_47721_c1
1987 nmdc:mga0qj67_249226_c1
1988 nmdc:mga0qj67_3277_c1
1989 nmdc:mga06r32_225699_c1
1990 nmdc:mga08y16_21711_c1
1991 nmdc:mga08y16_24706_c1
1992 nmdc:mga08y16_302723_c1
1993 nmdc:mga08y16_33448_c1
1994 nmdc:mga08y16_34597_c1
1995 nmdc:mga08y16_389339_c1
1996 nmdc:mga08y16_7680_c1
1997 nmdc:mga08y16_81708_c1
1998 nmdc:mga08y16_92784_c1
1999 nmdc:mga0n895_175113_c1
2000 nmdc:mga0n895_558215_c1
2001 nmdc:mga0rr50_76102_c1
2002 nmdc:mga08x19_136287_c1
2003 nmdc:mga0a205_131572_c1
2004 nmdc:mga0a205_231606_c1
2005 nmdc:mga0a205_34826_c1
2006 nmdc:mga0a205_410977_c1
2007 Ga0495655_0025093
2008 Ga0495595_0042401
2009 Ga0495595_0177396
2010 Ga0495619_0158867
2011 Ga0501084_0005644
2012 Ga0501084_0021851
2013 Ga0501084_0054182
2014 Ga0501084_0105831
2015 Ga0501084_0126030
2016 Ga0501084_0184469
2017 Ga0501084_0200803
2018 Ga0501082_0084568
2019 Ga0501082_0094642
2020 Ga0501082_0115336
2021 Ga0501082_0116947
2022 Ga0501082_0149040
2023 Ga0501082_0203609
2024 Ga0501082_0395718
2025 Ga0530510_0005979
2026 Ga0530510_0011844
2027 Ga0530510_0018951
2028 Ga0530510_0051929
2029 Ga0530510_0081235
2030 Ga0530510_0096953
2031 Ga0530510_0100363
2032 Ga0530510_0195102
2033 Ga0530510_0212723
2034 Ga0530510_0249348
2035 Ga0530510_0323110
2036 Ga0530510_0454632

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

197

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

137

232

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9286 1 226
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9075 4 225
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9013 3 230
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9006 4 226
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9006 1 230
ID Description Score Start End Superfamily
af_P07821_3_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9315 1 226 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9283 6 230 3.40.50.300
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.911 2 231 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9088 4 230 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9079 4 226 3.40.50.300
ID Description Score Start End GO Terms
AF-E1RA61-F1-model_v4 ABC transporter related protein 0.9291 2 230 GO:0005524
GO:0016887
AF-A0A0W8I1A1-F1-model_v4 Metal ABC transporter ATP-binding protein 0.9233 1 226 GO:0005524
GO:0016887
AF-A0A7Y6YTT6-F1-model_v4 ABC transporter ATP-binding protein 0.9204 3 226 GO:0005524
GO:0016887
AF-A0A1I2PYD5-F1-model_v4 Iron complex transport system ATP-binding protein 0.9195 5 226 GO:0005524
GO:0016887
AF-A0A0S7WSC9-F1-model_v4 ABC transporter domain-containing protein 0.9193 1 227 GO:0005524
GO:0016887

Map