F488253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1016 | 327 | 1013 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10516524|Ga0070717_105165242 |
| Length | 271 |
| Sequence | VPHPSFALLRKRVGNLTFCKPAASTLFPRDFSTFPHCCYHSCATRMAIDWQTFRLTLELAFTVSVMLLALGLPIAYWIAFSRWRWRFLVEAFVALPIVLPPTVLGFYVLVALGPRSPLGRWWISLTGHTLAFTFTGLVVGSILYSLPFAVQPFASAFLAVDRKLIAASATLGASPFRTFRTVTVPLSVSGIVTGIALSFAHTMGEFGVVLMVGGNIPGITRTVSIDIYDRVQSSDYAGANQTALILLFICFALLALVYGLNRRAALMDAWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 3 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 133 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 134 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 135 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 225 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 249 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 1.08 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 93.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_201130 | 2162886012 | Bacteria | 5475 |
| 2 | MBSR1b_contig_3160416 | 2162886012 | Bacteria | 6945 |
| 3 | LJNas_1000129 | 3300000546 | Bacteria | 11792 |
| 4 | JGI24752J21851_1006373 | 3300001976 | Unclassified | 1542 |
| 5 | JGI24740J21852_10097993 | 3300001979 | Unclassified | 749 |
| 6 | JGI24737J22298_10034298 | 3300001990 | Unclassified | 1573 |
| 7 | JGI24743J22301_10007079 | 3300001991 | Bacteria | 1935 |
| 8 | JGI24034J26672_10000570 | 3300002239 | Bacteria | 4702 |
| 9 | JGI24742J22300_10036682 | 3300002244 | Unclassified | 866 |
| 10 | JGI24751J29686_10023255 | 3300002459 | Unclassified | 1285 |
| 11 | rootH1_10066128 | 3300003323 | Bacteria | 5407 |
| 12 | Ga0065712_10082264 | 3300005290 | Unclassified | 2931 |
| 13 | Ga0065715_10004441 | 3300005293 | Bacteria | 7976 |
| 14 | Ga0065715_10203251 | 3300005293 | Bacteria | 1350 |
| 15 | Ga0065707_10164984 | 3300005295 | Unclassified | 1530 |
| 16 | Ga0070658_10012517 | 3300005327 | Bacteria | 6806 |
| 17 | Ga0070658_10172599 | 3300005327 | Bacteria | 1817 |
| 18 | Ga0070676_10032029 | 3300005328 | Bacteria | 3009 |
| 19 | Ga0070676_10092810 | 3300005328 | Bacteria | 1852 |
| 20 | Ga0070683_100000180 | 3300005329 | Bacteria | 41854 |
| 21 | Ga0070683_100184739 | 3300005329 | Bacteria | 1979 |
| 22 | Ga0070683_100567660 | 3300005329 | Bacteria | 1085 |
| 23 | Ga0070690_100198034 | 3300005330 | Bacteria | 1396 |
| 24 | Ga0070670_100001706 | 3300005331 | Bacteria | 17892 |
| 25 | Ga0070670_100155017 | 3300005331 | Bacteria | 1983 |
| 26 | Ga0070670_100391214 | 3300005331 | Bacteria | 1226 |
| 27 | Ga0068869_100002390 | 3300005334 | Bacteria | 11306 |
| 28 | Ga0068869_100014353 | 3300005334 | Bacteria | 5289 |
| 29 | Ga0070666_10040208 | 3300005335 | Bacteria | 3120 |
| 30 | Ga0070666_10087335 | 3300005335 | Bacteria | 2137 |
| 31 | Ga0070680_100163322 | 3300005336 | Bacteria | 1872 |
| 32 | Ga0070680_100201821 | 3300005336 | Bacteria | 1677 |
| 33 | Ga0070680_100240366 | 3300005336 | Bacteria | 1531 |
| 34 | Ga0070682_100047195 | 3300005337 | Bacteria | 2677 |
| 35 | Ga0070682_100108040 | 3300005337 | Unclassified | 1849 |
| 36 | Ga0068868_100002943 | 3300005338 | Bacteria | 11818 |
| 37 | Ga0068868_100006066 | 3300005338 | Bacteria | 8533 |
| 38 | Ga0068868_100019802 | 3300005338 | Bacteria | 5048 |
| 39 | Ga0068868_100051856 | 3300005338 | Bacteria | 3229 |
| 40 | Ga0068868_100261589 | 3300005338 | Bacteria | 1459 |
| 41 | Ga0070660_100016682 | 3300005339 | Bacteria | 5338 |
| 42 | Ga0070660_100240181 | 3300005339 | Unclassified | 1475 |
| 43 | Ga0070660_100522864 | 3300005339 | Bacteria | 988 |
| 44 | Ga0070689_100016928 | 3300005340 | Bacteria | 5344 |
| 45 | Ga0070689_100170285 | 3300005340 | Bacteria | 1764 |
| 46 | Ga0070687_100023249 | 3300005343 | Bacteria | 2944 |
| 47 | Ga0070661_100000886 | 3300005344 | Bacteria | 21512 |
| 48 | Ga0070661_100226734 | 3300005344 | Bacteria | 1435 |
| 49 | Ga0070692_10463847 | 3300005345 | Unclassified | 813 |
| 50 | Ga0070668_100013446 | 3300005347 | Bacteria | 6110 |
| 51 | Ga0070669_100016274 | 3300005353 | Bacteria | 5305 |
| 52 | Ga0070669_100095707 | 3300005353 | Bacteria | 2233 |
| 53 | Ga0070675_100003414 | 3300005354 | Bacteria | 12028 |
| 54 | Ga0070675_100507415 | 3300005354 | Bacteria | 1087 |
| 55 | Ga0070671_100024798 | 3300005355 | Bacteria | 4913 |
| 56 | Ga0070671_100032659 | 3300005355 | Bacteria | 4301 |
| 57 | Ga0070671_100224112 | 3300005355 | Unclassified | 1595 |
| 58 | Ga0070674_100008141 | 3300005356 | Bacteria | 6219 |
| 59 | Ga0070674_100129520 | 3300005356 | Bacteria | 1879 |
| 60 | Ga0070673_100106371 | 3300005364 | Bacteria | 2319 |
| 61 | Ga0070673_100128982 | 3300005364 | Bacteria | 2119 |
| 62 | Ga0070688_100001337 | 3300005365 | Bacteria | 12230 |
| 63 | Ga0070659_100055418 | 3300005366 | Bacteria | 3124 |
| 64 | Ga0070659_100083237 | 3300005366 | Bacteria | 2557 |
| 65 | Ga0070659_100233724 | 3300005366 | Bacteria | 1519 |
| 66 | Ga0070667_100009483 | 3300005367 | Bacteria | 8075 |
| 67 | Ga0070667_100093961 | 3300005367 | Bacteria | 2583 |
| 68 | Ga0070709_10015131 | 3300005434 | Bacteria | 4383 |
| 69 | Ga0070709_10038441 | 3300005434 | Bacteria | 2930 |
| 70 | Ga0070709_10057013 | 3300005434 | Bacteria | 2473 |
| 71 | Ga0070709_10084591 | 3300005434 | Bacteria | 2078 |
| 72 | Ga0070709_10147207 | 3300005434 | Bacteria | 1624 |
| 73 | Ga0070709_10170516 | 3300005434 | Bacteria | 1520 |
| 74 | Ga0070709_10170725 | 3300005434 | Bacteria | 1519 |
| 75 | Ga0070709_10257488 | 3300005434 | Bacteria | 1259 |
| 76 | Ga0070709_10667144 | 3300005434 | Bacteria | 806 |
| 77 | Ga0070714_100001114 | 3300005435 | Bacteria | 19295 |
| 78 | Ga0070714_100016666 | 3300005435 | Bacteria | 5939 |
| 79 | Ga0070714_100224122 | 3300005435 | Bacteria | 1729 |
| 80 | Ga0070713_100000543 | 3300005436 | Bacteria | 23927 |
| 81 | Ga0070713_100002121 | 3300005436 | Bacteria | 12836 |
| 82 | Ga0070713_100029017 | 3300005436 | Bacteria | 4375 |
| 83 | Ga0070713_100037336 | 3300005436 | Bacteria | 3927 |
| 84 | Ga0070713_100040170 | 3300005436 | Unclassified | 3803 |
| 85 | Ga0070713_100084638 | 3300005436 | Bacteria | 2714 |
| 86 | Ga0070713_100148407 | 3300005436 | Bacteria | 2083 |
| 87 | Ga0070713_100204515 | 3300005436 | Bacteria | 1785 |
| 88 | Ga0070713_100277423 | 3300005436 | Bacteria | 1537 |
| 89 | Ga0070713_100309252 | 3300005436 | Bacteria | 1457 |
| 90 | Ga0070713_100365107 | 3300005436 | Bacteria | 1342 |
| 91 | Ga0070713_100505909 | 3300005436 | Unclassified | 1140 |
| 92 | Ga0070710_10002568 | 3300005437 | Bacteria | 8621 |
| 93 | Ga0070710_10220647 | 3300005437 | Bacteria | 1206 |
| 94 | Ga0070701_10017180 | 3300005438 | Unclassified | 3378 |
| 95 | Ga0070711_100000478 | 3300005439 | Bacteria | 20826 |
| 96 | Ga0070711_100015078 | 3300005439 | Bacteria | 4884 |
| 97 | Ga0070711_100176790 | 3300005439 | Bacteria | 1631 |
| 98 | Ga0070711_100188148 | 3300005439 | Bacteria | 1585 |
| 99 | Ga0070711_100279643 | 3300005439 | Bacteria | 1320 |
| 100 | Ga0070711_100569782 | 3300005439 | Bacteria | 941 |
| 101 | Ga0070711_100590184 | 3300005439 | Bacteria | 926 |
| 102 | Ga0070711_100742228 | 3300005439 | Bacteria | 829 |
| 103 | Ga0070705_100062843 | 3300005440 | Bacteria | 2212 |
| 104 | Ga0070700_100312578 | 3300005441 | Unclassified | 1151 |
| 105 | Ga0070694_100041259 | 3300005444 | Bacteria | 3078 |
| 106 | Ga0070708_100000527 | 3300005445 | Bacteria | 28842 |
| 107 | Ga0070708_100001078 | 3300005445 | Bacteria | 20858 |
| 108 | Ga0070708_100003900 | 3300005445 | Bacteria | 11706 |
| 109 | Ga0070708_100013160 | 3300005445 | Bacteria | 6769 |
| 110 | Ga0070708_100035100 | 3300005445 | Unclassified | 4367 |
| 111 | Ga0070708_100055104 | 3300005445 | Bacteria | 3535 |
| 112 | Ga0070708_100066072 | 3300005445 | Bacteria | 3245 |
| 113 | Ga0070708_100114938 | 3300005445 | Bacteria | 2477 |
| 114 | Ga0070708_100206787 | 3300005445 | Bacteria | 1839 |
| 115 | Ga0070708_100357972 | 3300005445 | Bacteria | 1375 |
| 116 | Ga0070663_100032756 | 3300005455 | Unclassified | 3585 |
| 117 | Ga0070663_100589773 | 3300005455 | Unclassified | 933 |
| 118 | Ga0070678_100355225 | 3300005456 | Bacteria | 1261 |
| 119 | Ga0070662_100005079 | 3300005457 | Bacteria | 8381 |
| 120 | Ga0070662_100225056 | 3300005457 | Unclassified | 1498 |
| 121 | Ga0070681_10000513 | 3300005458 | Bacteria | 31715 |
| 122 | Ga0070681_10001443 | 3300005458 | Bacteria | 20931 |
| 123 | Ga0070681_10047505 | 3300005458 | Bacteria | 4291 |
| 124 | Ga0070681_10071265 | 3300005458 | Bacteria | 3440 |
| 125 | Ga0070681_10231014 | 3300005458 | Bacteria | 1764 |
| 126 | Ga0068867_100016708 | 3300005459 | Bacteria | 5214 |
| 127 | Ga0068867_100053195 | 3300005459 | Bacteria | 2990 |
| 128 | Ga0068867_100428822 | 3300005459 | Bacteria | 1122 |
| 129 | Ga0070685_10001585 | 3300005466 | Bacteria | 12002 |
| 130 | Ga0070685_10238101 | 3300005466 | Bacteria | 1200 |
| 131 | Ga0070706_100000257 | 3300005467 | Bacteria | 64534 |
| 132 | Ga0070706_100000991 | 3300005467 | Bacteria | 30868 |
| 133 | Ga0070706_100094200 | 3300005467 | Bacteria | 2779 |
| 134 | Ga0070706_100113003 | 3300005467 | Bacteria | 2529 |
| 135 | Ga0070706_100204128 | 3300005467 | Bacteria | 1846 |
| 136 | Ga0070707_100001774 | 3300005468 | Bacteria | 20733 |
| 137 | Ga0070707_100062473 | 3300005468 | Bacteria | 3573 |
| 138 | Ga0070707_100072935 | 3300005468 | Bacteria | 3310 |
| 139 | Ga0070707_100535678 | 3300005468 | Bacteria | 1133 |
| 140 | Ga0070707_100569754 | 3300005468 | Bacteria | 1095 |
| 141 | Ga0070698_100000182 | 3300005471 | Bacteria | 59279 |
| 142 | Ga0070698_100012583 | 3300005471 | Bacteria | 8959 |
| 143 | Ga0070698_100389727 | 3300005471 | Bacteria | 1326 |
| 144 | Ga0070698_100791264 | 3300005471 | Bacteria | 892 |
| 145 | Ga0070699_100088406 | 3300005518 | Bacteria | 2706 |
| 146 | Ga0070699_100209163 | 3300005518 | Bacteria | 1736 |
| 147 | Ga0070699_100290372 | 3300005518 | Bacteria | 1466 |
| 148 | Ga0070679_100008087 | 3300005530 | Bacteria | 9887 |
| 149 | Ga0070679_100054487 | 3300005530 | Bacteria | 3982 |
| 150 | Ga0070679_100151665 | 3300005530 | Bacteria | 2294 |
| 151 | Ga0070679_100301683 | 3300005530 | Bacteria | 1552 |
| 152 | Ga0070684_100007581 | 3300005535 | Bacteria | 8452 |
| 153 | Ga0070684_100017780 | 3300005535 | Bacteria | 5842 |
| 154 | Ga0070684_100034929 | 3300005535 | Unclassified | 4301 |
| 155 | Ga0070684_100089161 | 3300005535 | Bacteria | 2741 |
| 156 | Ga0070684_100100259 | 3300005535 | Bacteria | 2586 |
| 157 | Ga0070684_100338931 | 3300005535 | Unclassified | 1382 |
| 158 | Ga0070697_100001487 | 3300005536 | Bacteria | 17834 |
| 159 | Ga0070697_100004056 | 3300005536 | Bacteria | 11237 |
| 160 | Ga0070697_100008463 | 3300005536 | Bacteria | 8027 |
| 161 | Ga0070697_100085791 | 3300005536 | Bacteria | 2597 |
| 162 | Ga0070697_100131291 | 3300005536 | Unclassified | 2101 |
| 163 | Ga0070697_100238772 | 3300005536 | Bacteria | 1551 |
| 164 | Ga0070697_100506852 | 3300005536 | Bacteria | 1055 |
| 165 | Ga0068853_100005004 | 3300005539 | Bacteria | 10328 |
| 166 | Ga0068853_100065061 | 3300005539 | Bacteria | 3163 |
| 167 | Ga0068853_100083675 | 3300005539 | Bacteria | 2796 |
| 168 | Ga0068853_100111845 | 3300005539 | Bacteria | 2427 |
| 169 | Ga0068853_100254637 | 3300005539 | Bacteria | 1612 |
| 170 | Ga0070672_100133123 | 3300005543 | Unclassified | 2045 |
| 171 | Ga0070672_100381838 | 3300005543 | Bacteria | 1205 |
| 172 | Ga0070686_100011657 | 3300005544 | Bacteria | 4993 |
| 173 | Ga0070686_100036014 | 3300005544 | Bacteria | 3060 |
| 174 | Ga0070696_100033625 | 3300005546 | Bacteria | 3524 |
| 175 | Ga0070693_100038251 | 3300005547 | Bacteria | 2680 |
| 176 | Ga0070693_100159312 | 3300005547 | Bacteria | 1436 |
| 177 | Ga0070693_100465557 | 3300005547 | Unclassified | 890 |
| 178 | Ga0070665_100146087 | 3300005548 | Bacteria | 2368 |
| 179 | Ga0068855_100000412 | 3300005563 | Bacteria | 52997 |
| 180 | Ga0068855_100000425 | 3300005563 | Bacteria | 52146 |
| 181 | Ga0068855_100018276 | 3300005563 | Bacteria | 8420 |
| 182 | Ga0068855_100062777 | 3300005563 | Bacteria | 4336 |
| 183 | Ga0068855_100106448 | 3300005563 | Bacteria | 3223 |
| 184 | Ga0068855_100947328 | 3300005563 | Bacteria | 907 |
| 185 | Ga0070664_100005786 | 3300005564 | Bacteria | 9974 |
| 186 | Ga0070664_100047341 | 3300005564 | Bacteria | 3632 |
| 187 | Ga0070664_100082144 | 3300005564 | Bacteria | 2778 |
| 188 | Ga0068857_100002572 | 3300005577 | Bacteria | 14860 |
| 189 | Ga0068857_100003408 | 3300005577 | Bacteria | 13246 |
| 190 | Ga0068857_100005929 | 3300005577 | Bacteria | 10432 |
| 191 | Ga0068857_100372991 | 3300005577 | Unclassified | 1324 |
| 192 | Ga0068857_100574953 | 3300005577 | Bacteria | 1063 |
| 193 | Ga0068854_100003492 | 3300005578 | Bacteria | 9822 |
| 194 | Ga0068854_100004475 | 3300005578 | Bacteria | 8814 |
| 195 | Ga0068854_100014550 | 3300005578 | Bacteria | 5191 |
| 196 | Ga0068854_100020751 | 3300005578 | Bacteria | 4452 |
| 197 | Ga0068856_100000670 | 3300005614 | Bacteria | 37158 |
| 198 | Ga0068856_100000708 | 3300005614 | Bacteria | 36263 |
| 199 | Ga0068856_100001577 | 3300005614 | Bacteria | 23871 |
| 200 | Ga0068856_100003544 | 3300005614 | Bacteria | 15716 |
| 201 | Ga0068856_100006243 | 3300005614 | Bacteria | 11695 |
| 202 | Ga0068856_100009111 | 3300005614 | Bacteria | 9649 |
| 203 | Ga0068856_100066387 | 3300005614 | Bacteria | 3565 |
| 204 | Ga0068856_100079175 | 3300005614 | Bacteria | 3259 |
| 205 | Ga0068856_100118901 | 3300005614 | Bacteria | 2643 |
| 206 | Ga0068856_100198992 | 3300005614 | Bacteria | 2018 |
| 207 | Ga0068856_100245198 | 3300005614 | Bacteria | 1807 |
| 208 | Ga0068856_100350195 | 3300005614 | Unclassified | 1495 |
| 209 | Ga0070702_100004396 | 3300005615 | Bacteria | 6431 |
| 210 | Ga0070702_100082649 | 3300005615 | Bacteria | 1927 |
| 211 | Ga0068852_100002637 | 3300005616 | Bacteria | 12389 |
| 212 | Ga0068852_100104839 | 3300005616 | Bacteria | 2560 |
| 213 | Ga0068852_100107391 | 3300005616 | Bacteria | 2532 |
| 214 | Ga0068852_100282013 | 3300005616 | Bacteria | 1602 |
| 215 | Ga0068852_100318137 | 3300005616 | Bacteria | 1510 |
| 216 | Ga0068859_100000279 | 3300005617 | Bacteria | 50882 |
| 217 | Ga0068859_100015855 | 3300005617 | Bacteria | 7572 |
| 218 | Ga0068859_100114376 | 3300005617 | Bacteria | 2762 |
| 219 | Ga0068859_100277541 | 3300005617 | Unclassified | 1768 |
| 220 | Ga0068864_100000722 | 3300005618 | Bacteria | 27599 |
| 221 | Ga0068864_100015807 | 3300005618 | Bacteria | 6279 |
| 222 | Ga0068864_100046245 | 3300005618 | Bacteria | 3734 |
| 223 | Ga0068866_10001418 | 3300005718 | Bacteria | 10276 |
| 224 | Ga0068866_10005261 | 3300005718 | Bacteria | 5333 |
| 225 | Ga0068866_10008503 | 3300005718 | Bacteria | 4330 |
| 226 | Ga0068866_10408602 | 3300005718 | Bacteria | 878 |
| 227 | Ga0068861_100051927 | 3300005719 | Unclassified | 3114 |
| 228 | Ga0068861_100175545 | 3300005719 | Bacteria | 1779 |
| 229 | Ga0068861_100392952 | 3300005719 | Bacteria | 1229 |
| 230 | Ga0068851_10001381 | 3300005834 | Bacteria | 10595 |
| 231 | Ga0068851_10015362 | 3300005834 | Bacteria | 3647 |
| 232 | Ga0068851_10253493 | 3300005834 | Unclassified | 999 |
| 233 | Ga0068870_10003763 | 3300005840 | Bacteria | 6454 |
| 234 | Ga0068870_10056296 | 3300005840 | Bacteria | 2098 |
| 235 | Ga0068870_10072395 | 3300005840 | Bacteria | 1883 |
| 236 | Ga0068863_100002208 | 3300005841 | Bacteria | 19334 |
| 237 | Ga0068863_100005729 | 3300005841 | Bacteria | 12193 |
| 238 | Ga0068863_100015579 | 3300005841 | Bacteria | 7305 |
| 239 | Ga0068863_100070921 | 3300005841 | Bacteria | 3296 |
| 240 | Ga0068863_100155975 | 3300005841 | Bacteria | 2186 |
| 241 | Ga0068863_100184605 | 3300005841 | Unclassified | 2003 |
| 242 | Ga0068863_100290982 | 3300005841 | Bacteria | 1583 |
| 243 | Ga0068858_100002272 | 3300005842 | Bacteria | 19444 |
| 244 | Ga0068858_100033976 | 3300005842 | Bacteria | 4731 |
| 245 | Ga0068858_100152304 | 3300005842 | Bacteria | 2174 |
| 246 | Ga0068858_100189865 | 3300005842 | Bacteria | 1941 |
| 247 | Ga0068858_100236897 | 3300005842 | Bacteria | 1731 |
| 248 | Ga0068858_100399579 | 3300005842 | Bacteria | 1320 |
| 249 | Ga0068860_100000202 | 3300005843 | Bacteria | 94520 |
| 250 | Ga0068860_100007256 | 3300005843 | Bacteria | 11086 |
| 251 | Ga0068860_100059449 | 3300005843 | Bacteria | 3633 |
| 252 | Ga0068860_100323717 | 3300005843 | Bacteria | 1513 |
| 253 | Ga0068862_100048413 | 3300005844 | Bacteria | 3629 |
| 254 | Ga0068862_100151358 | 3300005844 | Unclassified | 2065 |
| 255 | Ga0068862_100276330 | 3300005844 | Bacteria | 1538 |
| 256 | Ga0081540_1025691 | 3300005983 | Bacteria | 3382 |
| 257 | Ga0070717_10000577 | 3300006028 | Bacteria | 23420 |
| 258 | Ga0070717_10002339 | 3300006028 | Bacteria | 13349 |
| 259 | Ga0070717_10003511 | 3300006028 | Bacteria | 11227 |
| 260 | Ga0070717_10036520 | 3300006028 | Bacteria | 3985 |
| 261 | Ga0070717_10055045 | 3300006028 | Bacteria | 3282 |
| 262 | Ga0070717_10094410 | 3300006028 | Bacteria | 2530 |
| 263 | Ga0070717_10101727 | 3300006028 | Bacteria | 2441 |
| 264 | Ga0070717_10115354 | 3300006028 | Bacteria | 2295 |
| 265 | Ga0070717_10198558 | 3300006028 | Bacteria | 1756 |
| 266 | Ga0070717_10206549 | 3300006028 | Bacteria | 1722 |
| 267 | Ga0070717_10300122 | 3300006028 | Bacteria | 1428 |
| 268 | Ga0070717_10446116 | 3300006028 | Bacteria | 1166 |
| 269 | Ga0070717_10516524 | 3300006028 | Bacteria | 1080 |
| 270 | Ga0070717_10562457 | 3300006028 | Bacteria | 1033 |
| 271 | Ga0070717_10627222 | 3300006028 | Bacteria | 975 |
| 272 | Ga0070715_10037645 | 3300006163 | Bacteria | 2003 |
| 273 | Ga0070715_10042767 | 3300006163 | Bacteria | 1906 |
| 274 | Ga0070715_10099905 | 3300006163 | Bacteria | 1351 |
| 275 | Ga0070715_10122984 | 3300006163 | Bacteria | 1239 |
| 276 | Ga0070716_100005911 | 3300006173 | Bacteria | 5955 |
| 277 | Ga0070716_100028903 | 3300006173 | Bacteria | 2992 |
| 278 | Ga0070716_100135159 | 3300006173 | Bacteria | 1565 |
| 279 | Ga0070716_100155304 | 3300006173 | Bacteria | 1477 |
| 280 | Ga0070716_100240696 | 3300006173 | Bacteria | 1227 |
| 281 | Ga0070716_100380072 | 3300006173 | Bacteria | 1009 |
| 282 | Ga0070716_100432041 | 3300006173 | Unclassified | 955 |
| 283 | Ga0070712_100000948 | 3300006175 | Bacteria | 17440 |
| 284 | Ga0070712_100002033 | 3300006175 | Bacteria | 12399 |
| 285 | Ga0070712_100003822 | 3300006175 | Bacteria | 9275 |
| 286 | Ga0070712_100014441 | 3300006175 | Bacteria | 5069 |
| 287 | Ga0070712_100437864 | 3300006175 | Bacteria | 1086 |
| 288 | Ga0070712_100752610 | 3300006175 | Unclassified | 834 |
| 289 | Ga0097621_100000210 | 3300006237 | Bacteria | 38363 |
| 290 | Ga0097621_100000598 | 3300006237 | Bacteria | 25444 |
| 291 | Ga0097621_100001848 | 3300006237 | Bacteria | 14513 |
| 292 | Ga0097621_100005957 | 3300006237 | Bacteria | 8615 |
| 293 | Ga0097621_100006416 | 3300006237 | Bacteria | 8349 |
| 294 | Ga0097621_100030212 | 3300006237 | Bacteria | 4287 |
| 295 | Ga0097621_100049532 | 3300006237 | Bacteria | 3413 |
| 296 | Ga0097621_100149672 | 3300006237 | Bacteria | 2001 |
| 297 | Ga0097621_100569956 | 3300006237 | Bacteria | 1032 |
| 298 | Ga0097621_100639759 | 3300006237 | Unclassified | 975 |
| 299 | Ga0068871_100000168 | 3300006358 | Bacteria | 43632 |
| 300 | Ga0068871_100000745 | 3300006358 | Bacteria | 22042 |
| 301 | Ga0068871_100000787 | 3300006358 | Bacteria | 21292 |
| 302 | Ga0068871_100009189 | 3300006358 | Bacteria | 7148 |
| 303 | Ga0068871_100022428 | 3300006358 | Unclassified | 4866 |
| 304 | Ga0068871_100025233 | 3300006358 | Bacteria | 4621 |
| 305 | Ga0068871_100046525 | 3300006358 | Bacteria | 3495 |
| 306 | Ga0068871_100092083 | 3300006358 | Bacteria | 2528 |
| 307 | Ga0068871_100170830 | 3300006358 | Bacteria | 1863 |
| 308 | Ga0068871_100339426 | 3300006358 | Bacteria | 1326 |
| 309 | Ga0068871_100515283 | 3300006358 | Bacteria | 1079 |
| 310 | Ga0068871_100878048 | 3300006358 | Bacteria | 830 |
| 311 | Ga0075430_100064546 | 3300006846 | Bacteria | 3076 |
| 312 | Ga0075433_10005922 | 3300006852 | Bacteria | 9624 |
| 313 | Ga0075434_100000246 | 3300006871 | Bacteria | 37977 |
| 314 | Ga0075434_100046235 | 3300006871 | Bacteria | 4320 |
| 315 | Ga0075434_100225606 | 3300006871 | Bacteria | 1893 |
| 316 | Ga0075434_100261670 | 3300006871 | Bacteria | 1749 |
| 317 | Ga0075429_100112538 | 3300006880 | Bacteria | 2379 |
| 318 | Ga0068865_100004430 | 3300006881 | Bacteria | 8464 |
| 319 | Ga0068865_100005649 | 3300006881 | Bacteria | 7593 |
| 320 | Ga0068865_100059134 | 3300006881 | Bacteria | 2680 |
| 321 | Ga0068865_100076875 | 3300006881 | Bacteria | 2384 |
| 322 | Ga0075436_100009403 | 3300006914 | Bacteria | 6682 |
| 323 | Ga0075436_100052786 | 3300006914 | Bacteria | 2806 |
| 324 | Ga0097620_100000279 | 3300006931 | Bacteria | 50882 |
| 325 | Ga0097620_100015855 | 3300006931 | Bacteria | 7572 |
| 326 | Ga0097620_100114372 | 3300006931 | Bacteria | 2762 |
| 327 | Ga0097620_100277530 | 3300006931 | Unclassified | 1768 |
| 328 | Ga0075435_100003413 | 3300007076 | Bacteria | 10775 |
| 329 | Ga0099794_10013220 | 3300007265 | Bacteria | 3587 |
| 330 | Ga0099794_10027987 | 3300007265 | Bacteria | 2618 |
| 331 | Ga0099794_10032987 | 3300007265 | Bacteria | 2433 |
| 332 | Ga0099794_10070247 | 3300007265 | Bacteria | 1714 |
| 333 | Ga0099794_10312516 | 3300007265 | Bacteria | 814 |
| 334 | Ga0105250_10023835 | 3300009092 | Bacteria | 2467 |
| 335 | Ga0105240_10069762 | 3300009093 | Bacteria | 4349 |
| 336 | Ga0105240_10126859 | 3300009093 | Bacteria | 3065 |
| 337 | Ga0105240_10133132 | 3300009093 | Bacteria | 2979 |
| 338 | Ga0105240_10142711 | 3300009093 | Bacteria | 2862 |
| 339 | Ga0105240_10180234 | 3300009093 | Bacteria | 2493 |
| 340 | Ga0105240_10198550 | 3300009093 | Bacteria | 2353 |
| 341 | Ga0105240_10234012 | 3300009093 | Bacteria | 2133 |
| 342 | Ga0105240_10255657 | 3300009093 | Bacteria | 2023 |
| 343 | Ga0105240_10379745 | 3300009093 | Bacteria | 1596 |
| 344 | Ga0111539_10296716 | 3300009094 | Unclassified | 1881 |
| 345 | Ga0105245_10005402 | 3300009098 | Bacteria | 11229 |
| 346 | Ga0105245_10006763 | 3300009098 | Bacteria | 10055 |
| 347 | Ga0105245_10040838 | 3300009098 | Bacteria | 4134 |
| 348 | Ga0105245_10056423 | 3300009098 | Unclassified | 3530 |
| 349 | Ga0105245_10102519 | 3300009098 | Bacteria | 2650 |
| 350 | Ga0105247_10009853 | 3300009101 | Bacteria | 5790 |
| 351 | Ga0105247_10023440 | 3300009101 | Bacteria | 3719 |
| 352 | Ga0105247_10025376 | 3300009101 | Bacteria | 3574 |
| 353 | Ga0105247_10043865 | 3300009101 | Bacteria | 2741 |
| 354 | Ga0105247_10287524 | 3300009101 | Bacteria | 1136 |
| 355 | Ga0114129_10069552 | 3300009147 | Bacteria | 4907 |
| 356 | Ga0105241_10003965 | 3300009174 | Bacteria | 10942 |
| 357 | Ga0105241_10009776 | 3300009174 | Bacteria | 7049 |
| 358 | Ga0105241_10014319 | 3300009174 | Bacteria | 5807 |
| 359 | Ga0105241_10014699 | 3300009174 | Bacteria | 5729 |
| 360 | Ga0105241_10080020 | 3300009174 | Bacteria | 2556 |
| 361 | Ga0105241_10122744 | 3300009174 | Bacteria | 2094 |
| 362 | Ga0105241_10184639 | 3300009174 | Bacteria | 1732 |
| 363 | Ga0105241_10417172 | 3300009174 | Unclassified | 1180 |
| 364 | Ga0105242_10067475 | 3300009176 | Bacteria | 2957 |
| 365 | Ga0105242_10093037 | 3300009176 | Bacteria | 2541 |
| 366 | Ga0105242_10296485 | 3300009176 | Bacteria | 1474 |
| 367 | Ga0105242_10329709 | 3300009176 | Unclassified | 1403 |
| 368 | Ga0105248_10019962 | 3300009177 | Bacteria | 7419 |
| 369 | Ga0105248_10075041 | 3300009177 | Bacteria | 3800 |
| 370 | Ga0105248_10111193 | 3300009177 | Unclassified | 3090 |
| 371 | Ga0105248_10279014 | 3300009177 | Bacteria | 1881 |
| 372 | Ga0105248_10498440 | 3300009177 | Bacteria | 1373 |
| 373 | Ga0105248_10703549 | 3300009177 | Unclassified | 1140 |
| 374 | Ga0105237_10050649 | 3300009545 | Bacteria | 4172 |
| 375 | Ga0105237_10052099 | 3300009545 | Bacteria | 4109 |
| 376 | Ga0105237_10166347 | 3300009545 | Bacteria | 2204 |
| 377 | Ga0105237_10252481 | 3300009545 | Bacteria | 1766 |
| 378 | Ga0105237_10336095 | 3300009545 | Bacteria | 1515 |
| 379 | Ga0105238_10000382 | 3300009551 | Bacteria | 47455 |
| 380 | Ga0105238_10038278 | 3300009551 | Bacteria | 4870 |
| 381 | Ga0105238_10056428 | 3300009551 | Bacteria | 3940 |
| 382 | Ga0105238_10195615 | 3300009551 | Unclassified | 1998 |
| 383 | Ga0105238_10509822 | 3300009551 | Bacteria | 1205 |
| 384 | Ga0105249_10002069 | 3300009553 | Bacteria | 17385 |
| 385 | Ga0105249_10005159 | 3300009553 | Bacteria | 11268 |
| 386 | Ga0105249_10027251 | 3300009553 | Bacteria | 5156 |
| 387 | Ga0099796_10089984 | 3300010159 | Bacteria | 1139 |
| 388 | Ga0105239_10008900 | 3300010375 | Bacteria | 11363 |
| 389 | Ga0105239_10025445 | 3300010375 | Bacteria | 6517 |
| 390 | Ga0105239_10071895 | 3300010375 | Bacteria | 3801 |
| 391 | Ga0105239_10252226 | 3300010375 | Bacteria | 1982 |
| 392 | Ga0105239_10276784 | 3300010375 | Bacteria | 1889 |
| 393 | Ga0105239_10328075 | 3300010375 | Bacteria | 1726 |
| 394 | Ga0105239_10586432 | 3300010375 | Unclassified | 1271 |
| 395 | Ga0105239_10601201 | 3300010375 | Bacteria | 1255 |
| 396 | Ga0105246_10005905 | 3300011119 | Bacteria | 7467 |
| 397 | Ga0105246_10052960 | 3300011119 | Bacteria | 2791 |
| 398 | Ga0157373_10001551 | 3300013100 | Bacteria | 17528 |
| 399 | Ga0157373_10002773 | 3300013100 | Bacteria | 13254 |
| 400 | Ga0157373_10037161 | 3300013100 | Bacteria | 3492 |
| 401 | Ga0157371_10002011 | 3300013102 | Bacteria | 20094 |
| 402 | Ga0157371_10004936 | 3300013102 | Bacteria | 11459 |
| 403 | Ga0157371_10091878 | 3300013102 | Bacteria | 2150 |
| 404 | Ga0157370_10013342 | 3300013104 | Bacteria | 8464 |
| 405 | Ga0157370_10041226 | 3300013104 | Bacteria | 4456 |
| 406 | Ga0157370_10041413 | 3300013104 | Bacteria | 4444 |
| 407 | Ga0157370_10262601 | 3300013104 | Bacteria | 1596 |
| 408 | Ga0157370_10386571 | 3300013104 | Bacteria | 1289 |
| 409 | Ga0157370_10460855 | 3300013104 | Unclassified | 1168 |
| 410 | Ga0157369_10000269 | 3300013105 | Bacteria | 69979 |
| 411 | Ga0157369_10005474 | 3300013105 | Bacteria | 14757 |
| 412 | Ga0157369_10006683 | 3300013105 | Bacteria | 13322 |
| 413 | Ga0157369_10007966 | 3300013105 | Bacteria | 12173 |
| 414 | Ga0157369_10011776 | 3300013105 | Bacteria | 9932 |
| 415 | Ga0157369_10032265 | 3300013105 | Bacteria | 5761 |
| 416 | Ga0157369_10091948 | 3300013105 | Bacteria | 3238 |
| 417 | Ga0157369_10252497 | 3300013105 | Bacteria | 1840 |
| 418 | Ga0157374_10000436 | 3300013296 | Bacteria | 37798 |
| 419 | Ga0157374_10001029 | 3300013296 | Bacteria | 24206 |
| 420 | Ga0157374_10001822 | 3300013296 | Bacteria | 17965 |
| 421 | Ga0157374_10013417 | 3300013296 | Bacteria | 7152 |
| 422 | Ga0157374_10034779 | 3300013296 | Bacteria | 4606 |
| 423 | Ga0157374_10050314 | 3300013296 | Bacteria | 3873 |
| 424 | Ga0157374_10079255 | 3300013296 | Bacteria | 3112 |
| 425 | Ga0157374_10198645 | 3300013296 | Bacteria | 1963 |
| 426 | Ga0157374_10223184 | 3300013296 | Bacteria | 1850 |
| 427 | Ga0157374_10269873 | 3300013296 | Bacteria | 1677 |
| 428 | Ga0157374_10278228 | 3300013296 | Bacteria | 1652 |
| 429 | Ga0157374_10386565 | 3300013296 | Bacteria | 1394 |
| 430 | Ga0157378_10000014 | 3300013297 | Bacteria | 144214 |
| 431 | Ga0157378_10000344 | 3300013297 | Bacteria | 45774 |
| 432 | Ga0157378_10000413 | 3300013297 | Bacteria | 42040 |
| 433 | Ga0157378_10001268 | 3300013297 | Bacteria | 22736 |
| 434 | Ga0157378_10007193 | 3300013297 | Bacteria | 9723 |
| 435 | Ga0157378_10047597 | 3300013297 | Bacteria | 3813 |
| 436 | Ga0157378_10084794 | 3300013297 | Unclassified | 2869 |
| 437 | Ga0157378_10115437 | 3300013297 | Bacteria | 2467 |
| 438 | Ga0157378_10206337 | 3300013297 | Bacteria | 1861 |
| 439 | Ga0157378_10220523 | 3300013297 | Bacteria | 1803 |
| 440 | Ga0163162_10002239 | 3300013306 | Bacteria | 18167 |
| 441 | Ga0163162_10004542 | 3300013306 | Bacteria | 13372 |
| 442 | Ga0163162_10011418 | 3300013306 | Bacteria | 8661 |
| 443 | Ga0163162_10048955 | 3300013306 | Bacteria | 4235 |
| 444 | Ga0163162_10092562 | 3300013306 | Bacteria | 3107 |
| 445 | Ga0163162_10370132 | 3300013306 | Bacteria | 1566 |
| 446 | Ga0163162_10505475 | 3300013306 | Bacteria | 1339 |
| 447 | Ga0163162_11105459 | 3300013306 | Unclassified | 898 |
| 448 | Ga0157372_10000423 | 3300013307 | Bacteria | 46475 |
| 449 | Ga0157372_10000641 | 3300013307 | Bacteria | 38393 |
| 450 | Ga0157372_10002544 | 3300013307 | Bacteria | 19779 |
| 451 | Ga0157372_10004039 | 3300013307 | Bacteria | 15735 |
| 452 | Ga0157372_10005138 | 3300013307 | Bacteria | 13911 |
| 453 | Ga0157372_10015715 | 3300013307 | Bacteria | 8117 |
| 454 | Ga0157372_10016602 | 3300013307 | Bacteria | 7900 |
| 455 | Ga0157372_10022824 | 3300013307 | Bacteria | 6775 |
| 456 | Ga0157372_10036431 | 3300013307 | Bacteria | 5422 |
| 457 | Ga0157372_10062666 | 3300013307 | Bacteria | 4167 |
| 458 | Ga0157372_10166041 | 3300013307 | Bacteria | 2553 |
| 459 | Ga0157372_10198939 | 3300013307 | Bacteria | 2321 |
| 460 | Ga0157375_10035816 | 3300013308 | Bacteria | 4742 |
| 461 | Ga0157375_10044150 | 3300013308 | Bacteria | 4327 |
| 462 | Ga0163163_10026605 | 3300014325 | Bacteria | 5533 |
| 463 | Ga0163163_10027299 | 3300014325 | Bacteria | 5467 |
| 464 | Ga0163163_10093541 | 3300014325 | Bacteria | 3023 |
| 465 | Ga0163163_10096265 | 3300014325 | Bacteria | 2980 |
| 466 | Ga0163163_10113779 | 3300014325 | Unclassified | 2736 |
| 467 | Ga0163163_10386177 | 3300014325 | Bacteria | 1458 |
| 468 | Ga0182008_10001531 | 3300014497 | Bacteria | 15380 |
| 469 | Ga0182008_10009750 | 3300014497 | Bacteria | 5169 |
| 470 | Ga0157377_10023683 | 3300014745 | Bacteria | 3257 |
| 471 | Ga0157377_10166543 | 3300014745 | Bacteria | 1375 |
| 472 | Ga0157377_10438598 | 3300014745 | Unclassified | 899 |
| 473 | Ga0157379_10007798 | 3300014968 | Bacteria | 9271 |
| 474 | Ga0157379_10010844 | 3300014968 | Bacteria | 7948 |
| 475 | Ga0157379_10031809 | 3300014968 | Bacteria | 4701 |
| 476 | Ga0157379_10035204 | 3300014968 | Bacteria | 4464 |
| 477 | Ga0157379_10291860 | 3300014968 | Unclassified | 1485 |
| 478 | Ga0157376_10014425 | 3300014969 | Bacteria | 5933 |
| 479 | Ga0157376_10031198 | 3300014969 | Bacteria | 4265 |
| 480 | Ga0157376_10045515 | 3300014969 | Bacteria | 3613 |
| 481 | Ga0157376_10071439 | 3300014969 | Bacteria | 2950 |
| 482 | Ga0157376_10083990 | 3300014969 | Bacteria | 2741 |
| 483 | Ga0157376_10139774 | 3300014969 | Bacteria | 2171 |
| 484 | Ga0157376_10232048 | 3300014969 | Bacteria | 1715 |
| 485 | Ga0182007_10014472 | 3300015262 | Bacteria | 2973 |
| 486 | Ga0224570_100631 | 3300022730 | Bacteria | 2797 |
| 487 | Ga0224569_100133 | 3300022732 | Bacteria | 5518 |
| 488 | Ga0224572_1000066 | 3300024225 | Bacteria | 7223 |
| 489 | Ga0224572_1001114 | 3300024225 | Bacteria | 3797 |
| 490 | Ga0224572_1009514 | 3300024225 | Bacteria | 1814 |
| 491 | Ga0224572_1009608 | 3300024225 | Bacteria | 1807 |
| 492 | Ga0228598_1001112 | 3300024227 | Bacteria | 5938 |
| 493 | Ga0228598_1017099 | 3300024227 | Bacteria | 1430 |
| 494 | Ga0209437_102112 | 3300025233 | Bacteria | 4015 |
| 495 | Ga0209233_1007680 | 3300025261 | Bacteria | 3397 |
| 496 | Ga0209050_1041325 | 3300025298 | Bacteria | 1273 |
| 497 | Ga0207697_10002788 | 3300025315 | Bacteria | 8904 |
| 498 | Ga0207656_10130194 | 3300025321 | Unclassified | 1178 |
| 499 | Ga0207692_10010221 | 3300025898 | Bacteria | 3947 |
| 500 | Ga0207642_10002117 | 3300025899 | Bacteria | 6143 |
| 501 | Ga0207642_10014622 | 3300025899 | Bacteria | 2901 |
| 502 | Ga0207710_10059340 | 3300025900 | Bacteria | 1732 |
| 503 | Ga0207710_10085390 | 3300025900 | Unclassified | 1470 |
| 504 | Ga0207688_10019381 | 3300025901 | Unclassified | 3705 |
| 505 | Ga0207680_10010712 | 3300025903 | Bacteria | 4599 |
| 506 | Ga0207680_10044690 | 3300025903 | Bacteria | 2607 |
| 507 | Ga0207680_10330027 | 3300025903 | Unclassified | 1068 |
| 508 | Ga0207647_10001477 | 3300025904 | Bacteria | 18059 |
| 509 | Ga0207647_10006683 | 3300025904 | Bacteria | 8379 |
| 510 | Ga0207647_10022413 | 3300025904 | Bacteria | 4195 |
| 511 | Ga0207685_10072896 | 3300025905 | Bacteria | 1397 |
| 512 | Ga0207699_10000815 | 3300025906 | Bacteria | 14849 |
| 513 | Ga0207699_10018440 | 3300025906 | Bacteria | 3698 |
| 514 | Ga0207699_10058663 | 3300025906 | Bacteria | 2303 |
| 515 | Ga0207699_10095528 | 3300025906 | Bacteria | 1875 |
| 516 | Ga0207699_10108927 | 3300025906 | Bacteria | 1772 |
| 517 | Ga0207699_10373471 | 3300025906 | Bacteria | 1011 |
| 518 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 519 | Ga0207645_10007872 | 3300025907 | Bacteria | 7493 |
| 520 | Ga0207643_10000474 | 3300025908 | Bacteria | 25980 |
| 521 | Ga0207643_10097731 | 3300025908 | Unclassified | 1719 |
| 522 | Ga0207705_10255787 | 3300025909 | Bacteria | 1336 |
| 523 | Ga0207684_10001275 | 3300025910 | Bacteria | 27799 |
| 524 | Ga0207684_10018088 | 3300025910 | Bacteria | 6039 |
| 525 | Ga0207684_10081331 | 3300025910 | Bacteria | 2756 |
| 526 | Ga0207684_10178688 | 3300025910 | Bacteria | 1830 |
| 527 | Ga0207654_10002582 | 3300025911 | Bacteria | 9192 |
| 528 | Ga0207654_10014318 | 3300025911 | Bacteria | 4097 |
| 529 | Ga0207654_10056155 | 3300025911 | Bacteria | 2283 |
| 530 | Ga0207654_10110051 | 3300025911 | Bacteria | 1713 |
| 531 | Ga0207654_10123841 | 3300025911 | Bacteria | 1627 |
| 532 | Ga0207654_10255190 | 3300025911 | Unclassified | 1177 |
| 533 | Ga0207707_10000828 | 3300025912 | Bacteria | 30353 |
| 534 | Ga0207707_10038831 | 3300025912 | Bacteria | 4161 |
| 535 | Ga0207707_10081955 | 3300025912 | Bacteria | 2816 |
| 536 | Ga0207707_10099151 | 3300025912 | Bacteria | 2547 |
| 537 | Ga0207707_10220174 | 3300025912 | Bacteria | 1652 |
| 538 | Ga0207695_10043656 | 3300025913 | Bacteria | 4777 |
| 539 | Ga0207695_10077718 | 3300025913 | Unclassified | 3370 |
| 540 | Ga0207695_10171125 | 3300025913 | Bacteria | 2098 |
| 541 | Ga0207695_10271718 | 3300025913 | Bacteria | 1590 |
| 542 | Ga0207695_10323787 | 3300025913 | Bacteria | 1431 |
| 543 | Ga0207695_10711846 | 3300025913 | Bacteria | 884 |
| 544 | Ga0207671_10055720 | 3300025914 | Bacteria | 2929 |
| 545 | Ga0207671_10070131 | 3300025914 | Bacteria | 2612 |
| 546 | Ga0207671_10131435 | 3300025914 | Bacteria | 1922 |
| 547 | Ga0207671_10156068 | 3300025914 | Bacteria | 1765 |
| 548 | Ga0207671_10464186 | 3300025914 | Unclassified | 1009 |
| 549 | Ga0207693_10000090 | 3300025915 | Bacteria | 81069 |
| 550 | Ga0207693_10000173 | 3300025915 | Bacteria | 58862 |
| 551 | Ga0207693_10000621 | 3300025915 | Bacteria | 31746 |
| 552 | Ga0207693_10013135 | 3300025915 | Bacteria | 6680 |
| 553 | Ga0207693_10037643 | 3300025915 | Bacteria | 3813 |
| 554 | Ga0207693_10107683 | 3300025915 | Bacteria | 2186 |
| 555 | Ga0207663_10003822 | 3300025916 | Bacteria | 7435 |
| 556 | Ga0207663_10033068 | 3300025916 | Bacteria | 3077 |
| 557 | Ga0207663_10034666 | 3300025916 | Bacteria | 3021 |
| 558 | Ga0207663_10149945 | 3300025916 | Bacteria | 1635 |
| 559 | Ga0207663_10489488 | 3300025916 | Bacteria | 954 |
| 560 | Ga0207660_10185955 | 3300025917 | Bacteria | 1616 |
| 561 | Ga0207662_10001688 | 3300025918 | Bacteria | 10806 |
| 562 | Ga0207657_10005643 | 3300025919 | Bacteria | 13060 |
| 563 | Ga0207657_10007963 | 3300025919 | Bacteria | 10807 |
| 564 | Ga0207657_10008288 | 3300025919 | Bacteria | 10575 |
| 565 | Ga0207649_10000343 | 3300025920 | Bacteria | 35195 |
| 566 | Ga0207652_10076233 | 3300025921 | Bacteria | 2924 |
| 567 | Ga0207652_10120800 | 3300025921 | Bacteria | 2331 |
| 568 | Ga0207646_10002760 | 3300025922 | Bacteria | 20509 |
| 569 | Ga0207646_10007451 | 3300025922 | Bacteria | 11120 |
| 570 | Ga0207646_10039981 | 3300025922 | Bacteria | 4220 |
| 571 | Ga0207646_10103730 | 3300025922 | Bacteria | 2550 |
| 572 | Ga0207681_10020312 | 3300025923 | Bacteria | 4206 |
| 573 | Ga0207694_10000430 | 3300025924 | Bacteria | 39056 |
| 574 | Ga0207694_10043179 | 3300025924 | Bacteria | 3479 |
| 575 | Ga0207694_10089601 | 3300025924 | Bacteria | 2426 |
| 576 | Ga0207694_10287710 | 3300025924 | Bacteria | 1351 |
| 577 | Ga0207650_10000223 | 3300025925 | Bacteria | 64087 |
| 578 | Ga0207650_10000224 | 3300025925 | Bacteria | 63557 |
| 579 | Ga0207650_10000296 | 3300025925 | Bacteria | 50068 |
| 580 | Ga0207650_10001691 | 3300025925 | Bacteria | 15671 |
| 581 | Ga0207650_10289026 | 3300025925 | Bacteria | 1336 |
| 582 | Ga0207659_10470005 | 3300025926 | Unclassified | 1061 |
| 583 | Ga0207687_10017030 | 3300025927 | Bacteria | 4778 |
| 584 | Ga0207687_10058417 | 3300025927 | Bacteria | 2714 |
| 585 | Ga0207687_10173184 | 3300025927 | Bacteria | 1666 |
| 586 | Ga0207687_10385996 | 3300025927 | Bacteria | 1148 |
| 587 | Ga0207700_10002203 | 3300025928 | Bacteria | 11180 |
| 588 | Ga0207700_10072614 | 3300025928 | Bacteria | 2654 |
| 589 | Ga0207700_10073782 | 3300025928 | Bacteria | 2636 |
| 590 | Ga0207700_10105374 | 3300025928 | Bacteria | 2258 |
| 591 | Ga0207700_10180398 | 3300025928 | Bacteria | 1768 |
| 592 | Ga0207700_10255170 | 3300025928 | Bacteria | 1499 |
| 593 | Ga0207700_10287849 | 3300025928 | Bacteria | 1415 |
| 594 | Ga0207700_10298476 | 3300025928 | Bacteria | 1390 |
| 595 | Ga0207700_10331157 | 3300025928 | Unclassified | 1322 |
| 596 | Ga0207700_10359701 | 3300025928 | Bacteria | 1269 |
| 597 | Ga0207700_10360539 | 3300025928 | Bacteria | 1267 |
| 598 | Ga0207700_10405700 | 3300025928 | Unclassified | 1195 |
| 599 | Ga0207700_10650271 | 3300025928 | Unclassified | 940 |
| 600 | Ga0207664_10002844 | 3300025929 | Bacteria | 11490 |
| 601 | Ga0207664_10011335 | 3300025929 | Bacteria | 6328 |
| 602 | Ga0207664_10241814 | 3300025929 | Bacteria | 1572 |
| 603 | Ga0207644_10007871 | 3300025931 | Bacteria | 6964 |
| 604 | Ga0207644_10108673 | 3300025931 | Unclassified | 2094 |
| 605 | Ga0207690_10033784 | 3300025932 | Bacteria | 3291 |
| 606 | Ga0207690_10317592 | 3300025932 | Unclassified | 1223 |
| 607 | Ga0207690_10358566 | 3300025932 | Bacteria | 1154 |
| 608 | Ga0207706_10000613 | 3300025933 | Bacteria | 37863 |
| 609 | Ga0207706_10001122 | 3300025933 | Bacteria | 27226 |
| 610 | Ga0207706_10015847 | 3300025933 | Bacteria | 6816 |
| 611 | Ga0207686_10126583 | 3300025934 | Bacteria | 1747 |
| 612 | Ga0207670_10181872 | 3300025936 | Unclassified | 1584 |
| 613 | Ga0207670_10320786 | 3300025936 | Bacteria | 1219 |
| 614 | Ga0207704_10054816 | 3300025938 | Bacteria | 2433 |
| 615 | Ga0207704_10080675 | 3300025938 | Unclassified | 2101 |
| 616 | Ga0207704_10494860 | 3300025938 | Bacteria | 984 |
| 617 | Ga0207665_10000182 | 3300025939 | Bacteria | 42287 |
| 618 | Ga0207665_10047330 | 3300025939 | Bacteria | 2883 |
| 619 | Ga0207665_10048693 | 3300025939 | Bacteria | 2846 |
| 620 | Ga0207665_10083112 | 3300025939 | Bacteria | 2208 |
| 621 | Ga0207665_10112332 | 3300025939 | Unclassified | 1916 |
| 622 | Ga0207665_10235785 | 3300025939 | Bacteria | 1346 |
| 623 | Ga0207691_10000345 | 3300025940 | Bacteria | 46775 |
| 624 | Ga0207691_10296071 | 3300025940 | Bacteria | 1391 |
| 625 | Ga0207711_10002524 | 3300025941 | Bacteria | 16302 |
| 626 | Ga0207711_10125650 | 3300025941 | Bacteria | 2294 |
| 627 | Ga0207711_10248782 | 3300025941 | Bacteria | 1632 |
| 628 | Ga0207689_10000499 | 3300025942 | Bacteria | 37043 |
| 629 | Ga0207689_10001621 | 3300025942 | Bacteria | 21315 |
| 630 | Ga0207689_10063023 | 3300025942 | Bacteria | 3049 |
| 631 | Ga0207661_10001212 | 3300025944 | Bacteria | 17237 |
| 632 | Ga0207661_10161297 | 3300025944 | Bacteria | 1945 |
| 633 | Ga0207679_10000115 | 3300025945 | Bacteria | 64466 |
| 634 | Ga0207679_10001482 | 3300025945 | Bacteria | 14719 |
| 635 | Ga0207667_10000311 | 3300025949 | Bacteria | 67671 |
| 636 | Ga0207667_10005374 | 3300025949 | Bacteria | 15617 |
| 637 | Ga0207667_10028850 | 3300025949 | Bacteria | 6025 |
| 638 | Ga0207667_10113360 | 3300025949 | Bacteria | 2795 |
| 639 | Ga0207667_10142497 | 3300025949 | Bacteria | 2468 |
| 640 | Ga0207667_10537447 | 3300025949 | Bacteria | 1183 |
| 641 | Ga0207667_10723811 | 3300025949 | Unclassified | 996 |
| 642 | Ga0207667_10964156 | 3300025949 | Bacteria | 842 |
| 643 | Ga0207651_10003483 | 3300025960 | Bacteria | 7733 |
| 644 | Ga0207712_10051568 | 3300025961 | Bacteria | 2878 |
| 645 | Ga0207668_10052646 | 3300025972 | Bacteria | 2817 |
| 646 | Ga0207668_10103914 | 3300025972 | Bacteria | 2116 |
| 647 | Ga0207640_10003104 | 3300025981 | Bacteria | 8931 |
| 648 | Ga0207640_10007732 | 3300025981 | Bacteria | 5940 |
| 649 | Ga0207640_10030028 | 3300025981 | Bacteria | 3344 |
| 650 | Ga0207640_10159412 | 3300025981 | Unclassified | 1667 |
| 651 | Ga0207640_10363623 | 3300025981 | Unclassified | 1167 |
| 652 | Ga0207640_10505528 | 3300025981 | Bacteria | 1007 |
| 653 | Ga0207658_10007316 | 3300025986 | Bacteria | 7530 |
| 654 | Ga0207658_10393707 | 3300025986 | Bacteria | 1216 |
| 655 | Ga0207677_10002452 | 3300026023 | Bacteria | 9745 |
| 656 | Ga0207677_10017631 | 3300026023 | Bacteria | 4263 |
| 657 | Ga0207677_10053564 | 3300026023 | Bacteria | 2747 |
| 658 | Ga0207677_10055683 | 3300026023 | Bacteria | 2706 |
| 659 | Ga0207677_10569747 | 3300026023 | Bacteria | 990 |
| 660 | Ga0207677_10593511 | 3300026023 | Bacteria | 971 |
| 661 | Ga0207703_10001667 | 3300026035 | Bacteria | 19971 |
| 662 | Ga0207703_10006667 | 3300026035 | Bacteria | 9212 |
| 663 | Ga0207703_10067935 | 3300026035 | Bacteria | 2935 |
| 664 | Ga0207703_10365821 | 3300026035 | Bacteria | 1331 |
| 665 | Ga0207703_10712240 | 3300026035 | Bacteria | 955 |
| 666 | Ga0207639_10092099 | 3300026041 | Bacteria | 2429 |
| 667 | Ga0207639_10154627 | 3300026041 | Bacteria | 1925 |
| 668 | Ga0207639_11077881 | 3300026041 | Unclassified | 753 |
| 669 | Ga0207678_10000130 | 3300026067 | Bacteria | 63279 |
| 670 | Ga0207678_10000950 | 3300026067 | Bacteria | 26463 |
| 671 | Ga0207708_10246065 | 3300026075 | Bacteria | 1440 |
| 672 | Ga0207708_10375804 | 3300026075 | Unclassified | 1171 |
| 673 | Ga0207702_10000722 | 3300026078 | Bacteria | 35418 |
| 674 | Ga0207702_10001654 | 3300026078 | Bacteria | 22011 |
| 675 | Ga0207702_10002343 | 3300026078 | Bacteria | 18095 |
| 676 | Ga0207702_10002543 | 3300026078 | Bacteria | 17174 |
| 677 | Ga0207702_10019837 | 3300026078 | Bacteria | 5568 |
| 678 | Ga0207702_10070027 | 3300026078 | Unclassified | 3016 |
| 679 | Ga0207702_10070347 | 3300026078 | Bacteria | 3009 |
| 680 | Ga0207702_10097251 | 3300026078 | Unclassified | 2591 |
| 681 | Ga0207702_10176331 | 3300026078 | Bacteria | 1965 |
| 682 | Ga0207702_10184663 | 3300026078 | Bacteria | 1922 |
| 683 | Ga0207702_10196100 | 3300026078 | Bacteria | 1869 |
| 684 | Ga0207702_10839055 | 3300026078 | Bacteria | 909 |
| 685 | Ga0207641_10000287 | 3300026088 | Bacteria | 63251 |
| 686 | Ga0207641_10001947 | 3300026088 | Bacteria | 19809 |
| 687 | Ga0207641_10002584 | 3300026088 | Bacteria | 16638 |
| 688 | Ga0207641_10031067 | 3300026088 | Bacteria | 4428 |
| 689 | Ga0207641_10040850 | 3300026088 | Bacteria | 3886 |
| 690 | Ga0207641_10111882 | 3300026088 | Unclassified | 2422 |
| 691 | Ga0207641_10141200 | 3300026088 | Unclassified | 2173 |
| 692 | Ga0207641_10305177 | 3300026088 | Bacteria | 1505 |
| 693 | Ga0207648_10001253 | 3300026089 | Bacteria | 28381 |
| 694 | Ga0207648_10159247 | 3300026089 | Bacteria | 1994 |
| 695 | Ga0207648_10371630 | 3300026089 | Bacteria | 1291 |
| 696 | Ga0207676_10000115 | 3300026095 | Bacteria | 71633 |
| 697 | Ga0207676_10003051 | 3300026095 | Bacteria | 11952 |
| 698 | Ga0207676_10035713 | 3300026095 | Bacteria | 3775 |
| 699 | Ga0207676_10412252 | 3300026095 | Unclassified | 1265 |
| 700 | Ga0207674_10000788 | 3300026116 | Bacteria | 41336 |
| 701 | Ga0207674_10001340 | 3300026116 | Bacteria | 31912 |
| 702 | Ga0207674_10007893 | 3300026116 | Bacteria | 12363 |
| 703 | Ga0207674_10013852 | 3300026116 | Bacteria | 8922 |
| 704 | Ga0207674_10487679 | 3300026116 | Unclassified | 1191 |
| 705 | Ga0207674_10586096 | 3300026116 | Bacteria | 1077 |
| 706 | Ga0207675_100083379 | 3300026118 | Bacteria | 2998 |
| 707 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 708 | Ga0207683_10291083 | 3300026121 | Unclassified | 1493 |
| 709 | Ga0207698_10101020 | 3300026142 | Bacteria | 2391 |
| 710 | Ga0207698_10149736 | 3300026142 | Bacteria | 2023 |
| 711 | Ga0207698_10199580 | 3300026142 | Bacteria | 1790 |
| 712 | Ga0207698_10447055 | 3300026142 | Bacteria | 1247 |
| 713 | Ga0209179_1043846 | 3300027512 | Unclassified | 947 |
| 714 | Ga0209588_1016400 | 3300027671 | Bacteria | 2287 |
| 715 | Ga0209588_1070111 | 3300027671 | Bacteria | 1132 |
| 716 | Ga0265356_1000344 | 3300028017 | Bacteria | 8506 |
| 717 | Ga0268266_10000761 | 3300028379 | Bacteria | 43122 |
| 718 | Ga0268265_10073055 | 3300028380 | Unclassified | 2677 |
| 719 | Ga0268265_10296460 | 3300028380 | Bacteria | 1454 |
| 720 | Ga0268264_10000241 | 3300028381 | Bacteria | 103608 |
| 721 | Ga0268264_10004971 | 3300028381 | Bacteria | 11265 |
| 722 | Ga0268264_10044778 | 3300028381 | Bacteria | 3672 |
| 723 | Ga0268264_10046056 | 3300028381 | Bacteria | 3622 |
| 724 | Ga0268264_10257370 | 3300028381 | Bacteria | 1624 |
| 725 | Ga0265338_10001801 | 3300028800 | Bacteria | 33703 |
| 726 | Ga0265338_10010396 | 3300028800 | Bacteria | 10918 |
| 727 | Ga0265338_10080138 | 3300028800 | Bacteria | 2744 |
| 728 | Ga0265338_10132286 | 3300028800 | Bacteria | 1967 |
| 729 | Ga0265338_10241360 | 3300028800 | Bacteria | 1338 |
| 730 | Ga0265338_10274634 | 3300028800 | Bacteria | 1234 |
| 731 | Ga0265762_1004236 | 3300030760 | Bacteria | 2573 |
| 732 | Ga0265762_1006001 | 3300030760 | Bacteria | 2177 |
| 733 | Ga0265762_1015555 | 3300030760 | Bacteria | 1377 |
| 734 | Ga0265762_1025991 | 3300030760 | Unclassified | 1094 |
| 735 | Ga0265760_10000242 | 3300031090 | Bacteria | 14932 |
| 736 | Ga0265760_10003610 | 3300031090 | Bacteria | 4490 |
| 737 | Ga0265760_10005419 | 3300031090 | Bacteria | 3662 |
| 738 | Ga0265760_10007787 | 3300031090 | Bacteria | 3061 |
| 739 | Ga0265760_10017742 | 3300031090 | Bacteria | 2045 |
| 740 | Ga0265760_10018276 | 3300031090 | Bacteria | 2017 |
| 741 | Ga0265760_10058968 | 3300031090 | Bacteria | 1164 |
| 742 | Ga0265330_10036864 | 3300031235 | Bacteria | 2178 |
| 743 | Ga0265332_10071679 | 3300031238 | Bacteria | 1475 |
| 744 | Ga0265325_10014097 | 3300031241 | Bacteria | 4528 |
| 745 | Ga0265325_10015495 | 3300031241 | Bacteria | 4285 |
| 746 | Ga0265325_10045920 | 3300031241 | Bacteria | 2268 |
| 747 | Ga0265340_10149411 | 3300031247 | Bacteria | 1065 |
| 748 | Ga0265339_10014422 | 3300031249 | Bacteria | 4761 |
| 749 | Ga0265339_10051746 | 3300031249 | Bacteria | 2240 |
| 750 | Ga0265339_10092440 | 3300031249 | Bacteria | 1584 |
| 751 | Ga0265331_10094211 | 3300031250 | Bacteria | 1383 |
| 752 | Ga0265327_10032180 | 3300031251 | Bacteria | 2938 |
| 753 | Ga0265316_10019053 | 3300031344 | Bacteria | 5881 |
| 754 | Ga0265316_10043022 | 3300031344 | Bacteria | 3605 |
| 755 | Ga0265316_10450132 | 3300031344 | Bacteria | 923 |
| 756 | Ga0265313_10014628 | 3300031595 | Bacteria | 4625 |
| 757 | Ga0265314_10009028 | 3300031711 | Bacteria | 8474 |
| 758 | Ga0265314_10108988 | 3300031711 | Bacteria | 1763 |
| 759 | Ga0265314_10119534 | 3300031711 | Bacteria | 1661 |
| 760 | Ga0265342_10112470 | 3300031712 | Bacteria | 1540 |
| 761 | Ga0307416_101059012 | 3300032002 | Bacteria | 915 |
| 762 | Ga0316214_1005106 | 3300033545 | Bacteria | 1712 |
| 763 | Ga0316212_1006527 | 3300033547 | Bacteria | 1690 |
| 764 | Ga0373926_0004598 | 3300035083 | Bacteria | 4529 |
| 765 | Ga0373926_0005361 | 3300035083 | Bacteria | 4223 |
| 766 | Ga0373928_0042513 | 3300035084 | Bacteria | 1048 |
| 767 | Ga0373929_0020694 | 3300035085 | Bacteria | 1328 |
| 768 | Ga0373944_0049754 | 3300035089 | Bacteria | 1318 |
| 769 | Ga0373936_0004614 | 3300035113 | Bacteria | 5214 |
| 770 | Ga0373936_0063311 | 3300035113 | Bacteria | 1514 |
| 771 | Ga0373939_0046714 | 3300035114 | Bacteria | 1327 |
| 772 | Ga0373941_0019085 | 3300035115 | Bacteria | 1904 |
| 773 | Ga0373945_0082064 | 3300035116 | Bacteria | 1237 |
| 774 | Ga0373954_0192457 | 3300035118 | Bacteria | 1002 |
| 775 | Ga0373956_0121472 | 3300035119 | Unclassified | 1220 |
| 776 | Ga0373957_0086822 | 3300035120 | Bacteria | 1239 |
| 777 | Ga0373943_0052087 | 3300035170 | Bacteria | 2017 |
| 778 | Ga0373943_0054311 | 3300035170 | Bacteria | 1981 |
| 779 | Ga0373943_0067392 | 3300035170 | Bacteria | 1805 |
| 780 | Ga0373943_0209225 | 3300035170 | Unclassified | 1082 |
| 781 | Ga0373943_0298164 | 3300035170 | Bacteria | 915 |
| 782 | Ga0373943_0302457 | 3300035170 | Bacteria | 908 |
| 783 | Ga0373946_0004259 | 3300035171 | Bacteria | 5113 |
| 784 | Ga0373946_0010395 | 3300035171 | Unclassified | 3444 |
| 785 | Ga0373955_0042548 | 3300035172 | Bacteria | 2439 |
| 786 | Ga0373955_0163829 | 3300035172 | Bacteria | 1314 |
| 787 | Ga0373931_0052084 | 3300035691 | Bacteria | 2181 |
| 788 | Ga0373931_0247997 | 3300035691 | Bacteria | 1082 |
| 789 | Ga0373931_0309897 | 3300035691 | Bacteria | 977 |
| 790 | Ga0373935_0033631 | 3300035692 | Bacteria | 3192 |
| 791 | Ga0373935_0035710 | 3300035692 | Bacteria | 3103 |
| 792 | Ga0373935_0079637 | 3300035692 | Bacteria | 2127 |
| 793 | Ga0373935_0423944 | 3300035692 | Unclassified | 958 |
| 794 | Ga0373935_0696763 | 3300035692 | Unclassified | 747 |
| 795 | Ga0373927_0003975 | 3300035695 | Bacteria | 10456 |
| 796 | Ga0373927_0015301 | 3300035695 | Bacteria | 5067 |
| 797 | Ga0373927_0015335 | 3300035695 | Bacteria | 5061 |
| 798 | Ga0373927_0054495 | 3300035695 | Bacteria | 2587 |
| 799 | Ga0373927_0074146 | 3300035695 | Unclassified | 2203 |
| 800 | Ga0373927_0124228 | 3300035695 | Bacteria | 1685 |
| 801 | Ga0373933_0040395 | 3300035724 | Bacteria | 2749 |
| 802 | Ga0373933_0046243 | 3300035724 | Bacteria | 2583 |
| 803 | Ga0373933_0308046 | 3300035724 | Bacteria | 1026 |
| 804 | Ga0373947_0001902 | 3300035725 | Bacteria | 12757 |
| 805 | Ga0373947_0001950 | 3300035725 | Bacteria | 12629 |
| 806 | Ga0373947_0046121 | 3300035725 | Bacteria | 2609 |
| 807 | Ga0373947_0097458 | 3300035725 | Bacteria | 1843 |
| 808 | Ga0373947_0336867 | 3300035725 | Bacteria | 1010 |
| 809 | Ga0373947_0339554 | 3300035725 | Unclassified | 1006 |
| 810 | Ga0373937_0018254 | 3300036401 | Bacteria | 6262 |
| 811 | Ga0373937_0094316 | 3300036401 | Bacteria | 2775 |
| 812 | Ga0373937_0406085 | 3300036401 | Bacteria | 1292 |
| 813 | Ga0373937_0893321 | 3300036401 | Bacteria | 837 |
| 814 | Ga0373937_0922139 | 3300036401 | Bacteria | 822 |
| 815 | Ga0373925_0000165 | 3300037068 | Bacteria | 71445 |
| 816 | Ga0373925_0017686 | 3300037068 | Bacteria | 5172 |
| 817 | Ga0373925_0018110 | 3300037068 | Bacteria | 5115 |
| 818 | Ga0373925_0023470 | 3300037068 | Bacteria | 4500 |
| 819 | Ga0373925_0054200 | 3300037068 | Bacteria | 2999 |
| 820 | Ga0373925_0282884 | 3300037068 | Bacteria | 1336 |
| 821 | Ga0395905_0000096 | 3300037471 | Bacteria | 146075 |
| 822 | Ga0436364_1137452 | 3300037853 | Bacteria | 2214 |
| 823 | Ga0400490_03194 | 3300038726 | Bacteria | 2424 |
| 824 | Ga0400486_20280 | 3300038742 | Bacteria | 2381 |
| 825 | Ga0436365_1849740 | 3300039437 | Unclassified | 1737 |
| 826 | Ga0436363_0684377 | 3300039450 | Plasmid | 2896 |
| 827 | Ga0436363_1603702 | 3300039450 | Bacteria | 883 |
| 828 | Ga0436363_1709607 | 3300039450 | Bacteria | 1943 |
| 829 | Ga0436362_1117608 | 3300039453 | Unclassified | 4645 |
| 830 | Ga0451577_0003762 | 3300042876 | Bacteria | 16540 |
| 831 | Ga0451577_0064248 | 3300042876 | Bacteria | 3273 |
| 832 | Ga0451577_0407021 | 3300042876 | Bacteria | 1235 |
| 833 | Ga0453683_0004979 | 3300044673 | Bacteria | 9332 |
| 834 | Ga0453683_0005490 | 3300044673 | Bacteria | 8845 |
| 835 | Ga0453683_0251834 | 3300044673 | Bacteria | 1126 |
| 836 | Ga0453684_0000377 | 3300044712 | Bacteria | 183445 |
| 837 | Ga0453684_0005849 | 3300044712 | Bacteria | 23912 |
| 838 | Ga0453684_0018504 | 3300044712 | Bacteria | 10686 |
| 839 | Ga0453684_0061085 | 3300044712 | Bacteria | 4840 |
| 840 | Ga0453684_0096456 | 3300044712 | Bacteria | 3632 |
| 841 | Ga0466957_0000410 | 3300044842 | Bacteria | 21005 |
| 842 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 843 | Ga0451576_0018916 | 3300045051 | Bacteria | 7528 |
| 844 | Ga0451576_0165440 | 3300045051 | Bacteria | 2308 |
| 845 | Ga0451576_0220067 | 3300045051 | Bacteria | 1982 |
| 846 | Ga0451576_0273153 | 3300045051 | Bacteria | 1767 |
| 847 | Ga0451576_0301499 | 3300045051 | Bacteria | 1676 |
| 848 | Ga0451576_0635259 | 3300045051 | Bacteria | 1122 |
| 849 | Ga0451576_1312526 | 3300045051 | Bacteria | 754 |
| 850 | Ga0466967_0119894 | 3300045976 | Unclassified | 2429 |
| 851 | Ga0495592_0052355 | 3300046454 | Bacteria | 3031 |
| 852 | Ga0495603_0004371 | 3300046455 | Bacteria | 8425 |
| 853 | Ga0495629_0020122 | 3300046459 | Bacteria | 4765 |
| 854 | Ga0495629_0088319 | 3300046459 | Bacteria | 2162 |
| 855 | Ga0495651_0014952 | 3300046462 | Bacteria | 5999 |
| 856 | Ga0495653_0019126 | 3300046463 | Bacteria | 5557 |
| 857 | Ga0495580_0000074 | 3300046472 | Bacteria | 62279 |
| 858 | Ga0495580_0000337 | 3300046472 | Bacteria | 38443 |
| 859 | Ga0495580_0005142 | 3300046472 | Bacteria | 10883 |
| 860 | Ga0495580_0014509 | 3300046472 | Bacteria | 5974 |
| 861 | Ga0495580_0033054 | 3300046472 | Bacteria | 3728 |
| 862 | Ga0495580_0053725 | 3300046472 | Bacteria | 2842 |
| 863 | Ga0495580_0067428 | 3300046472 | Bacteria | 2504 |
| 864 | Ga0495580_0081143 | 3300046472 | Unclassified | 2261 |
| 865 | Ga0495580_0108116 | 3300046472 | Bacteria | 1931 |
| 866 | Ga0495580_0149657 | 3300046472 | Bacteria | 1617 |
| 867 | Ga0495580_0195440 | 3300046472 | Bacteria | 1395 |
| 868 | Ga0495580_0208472 | 3300046472 | Bacteria | 1345 |
| 869 | Ga0495580_0323642 | 3300046472 | Unclassified | 1048 |
| 870 | Ga0495580_0348395 | 3300046472 | Bacteria | 1004 |
| 871 | Ga0495582_0005452 | 3300046473 | Bacteria | 7094 |
| 872 | Ga0495582_0009992 | 3300046473 | Bacteria | 5223 |
| 873 | Ga0495582_0022220 | 3300046473 | Bacteria | 3471 |
| 874 | Ga0495639_0071872 | 3300046475 | Bacteria | 1599 |
| 875 | Ga0495664_0010014 | 3300046477 | Bacteria | 5319 |
| 876 | Ga0495664_0023289 | 3300046477 | Unclassified | 3594 |
| 877 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 878 | Ga0495594_0007103 | 3300046499 | Bacteria | 5760 |
| 879 | Ga0495594_0149616 | 3300046499 | Bacteria | 1325 |
| 880 | Ga0495608_0015944 | 3300046511 | Bacteria | 5202 |
| 881 | Ga0495608_0148646 | 3300046511 | Unclassified | 1494 |
| 882 | Ga0495618_0014035 | 3300046514 | Bacteria | 4877 |
| 883 | Ga0495628_0000167 | 3300046516 | Bacteria | 57173 |
| 884 | Ga0495628_0049805 | 3300046516 | Bacteria | 3316 |
| 885 | Ga0495630_0087969 | 3300046517 | Bacteria | 2346 |
| 886 | Ga0495630_0093306 | 3300046517 | Bacteria | 2275 |
| 887 | Ga0495630_0131284 | 3300046517 | Bacteria | 1902 |
| 888 | Ga0495630_0133671 | 3300046517 | Bacteria | 1884 |
| 889 | Ga0495666_0027633 | 3300046526 | Bacteria | 2793 |
| 890 | Ga0495666_0106709 | 3300046526 | Bacteria | 1317 |
| 891 | Ga0495652_0001713 | 3300046529 | Bacteria | 23626 |
| 892 | Ga0495652_0088019 | 3300046529 | Bacteria | 2546 |
| 893 | Ga0495665_0001072 | 3300046531 | Bacteria | 14517 |
| 894 | Ga0495665_0025425 | 3300046531 | Bacteria | 3181 |
| 895 | Ga0495665_0039056 | 3300046531 | Bacteria | 2529 |
| 896 | Ga0495665_0084143 | 3300046531 | Unclassified | 1672 |
| 897 | Ga0495665_0144780 | 3300046531 | Unclassified | 1241 |
| 898 | Ga0495640_0027205 | 3300046533 | Bacteria | 4127 |
| 899 | Ga0495640_0057591 | 3300046533 | Bacteria | 2652 |
| 900 | Ga0495640_0245598 | 3300046533 | Bacteria | 1122 |
| 901 | Ga0495586_0012586 | 3300046535 | Bacteria | 4488 |
| 902 | Ga0495586_0058509 | 3300046535 | Bacteria | 2093 |
| 903 | Ga0495586_0271800 | 3300046535 | Bacteria | 969 |
| 904 | Ga0495587_0003037 | 3300046536 | Bacteria | 11210 |
| 905 | Ga0495587_0069491 | 3300046536 | Bacteria | 2051 |
| 906 | Ga0495645_0006650 | 3300046543 | Bacteria | 8032 |
| 907 | Ga0495645_0007683 | 3300046543 | Bacteria | 7501 |
| 908 | Ga0495645_0079896 | 3300046543 | Bacteria | 2348 |
| 909 | Ga0495622_0159709 | 3300046557 | Bacteria | 1017 |
| 910 | Ga0495667_0027483 | 3300046559 | Bacteria | 3834 |
| 911 | Ga0495667_0216771 | 3300046559 | Bacteria | 1222 |
| 912 | Ga0495634_0025416 | 3300046642 | Bacteria | 4143 |
| 913 | Ga0495634_0069864 | 3300046642 | Bacteria | 2316 |
| 914 | Ga0495657_0009233 | 3300046675 | Bacteria | 7483 |
| 915 | Ga0495623_0011515 | 3300046679 | Bacteria | 5724 |
| 916 | Ga0495623_0377775 | 3300046679 | Bacteria | 767 |
| 917 | Ga0495647_0014408 | 3300046681 | Unclassified | 2755 |
| 918 | Ga0495658_0158287 | 3300046683 | Bacteria | 1395 |
| 919 | Ga0495669_0053711 | 3300046684 | Bacteria | 1812 |
| 920 | Ga0495613_0317024 | 3300046689 | Bacteria | 1077 |
| 921 | Ga0495624_0081571 | 3300046690 | Bacteria | 2003 |
| 922 | Ga0495600_0043489 | 3300046809 | Bacteria | 2930 |
| 923 | Ga0495600_0103323 | 3300046809 | Bacteria | 1857 |
| 924 | Ga0495581_0059356 | 3300047315 | Unclassified | 2210 |
| 925 | Ga0495581_0324868 | 3300047315 | Bacteria | 899 |
| 926 | Ga0495604_0003790 | 3300047317 | Bacteria | 12033 |
| 927 | Ga0495604_0076018 | 3300047317 | Bacteria | 2527 |
| 928 | Ga0495636_0023394 | 3300047318 | Bacteria | 2501 |
| 929 | Ga0495674_0013194 | 3300047319 | Bacteria | 7767 |
| 930 | Ga0495674_0051869 | 3300047319 | Bacteria | 3614 |
| 931 | Ga0495674_0139998 | 3300047319 | Bacteria | 2034 |
| 932 | Ga0495674_0283446 | 3300047319 | Bacteria | 1357 |
| 933 | Ga0495674_0315998 | 3300047319 | Bacteria | 1273 |
| 934 | Ga0495676_0259262 | 3300047321 | Bacteria | 1183 |
| 935 | Ga0495680_0001348 | 3300047322 | Bacteria | 26695 |
| 936 | Ga0495680_0010330 | 3300047322 | Bacteria | 8332 |
| 937 | Ga0495675_0000202 | 3300047444 | Bacteria | 43536 |
| 938 | Ga0495675_0053586 | 3300047444 | Bacteria | 2561 |
| 939 | Ga0495675_0240589 | 3300047444 | Bacteria | 1090 |
| 940 | Ga0495684_0012098 | 3300047471 | Bacteria | 6658 |
| 941 | Ga0495684_0022085 | 3300047471 | Bacteria | 4899 |
| 942 | Ga0495684_0493365 | 3300047471 | Bacteria | 843 |
| 943 | Ga0495593_0080671 | 3300047673 | Bacteria | 1683 |
| 944 | Ga0495593_0174034 | 3300047673 | Bacteria | 1085 |
| 945 | Ga0495593_0271292 | 3300047673 | Unclassified | 849 |
| 946 | Ga0495602_0022805 | 3300048088 | Bacteria | 6120 |
| 947 | Ga0496100_0114330 | 3300048903 | Bacteria | 1880 |
| 948 | Ga0496100_0232842 | 3300048903 | Bacteria | 1356 |
| 949 | Ga0496101_0143438 | 3300048904 | Bacteria | 1822 |
| 950 | Ga0496101_0360541 | 3300048904 | Bacteria | 1143 |
| 951 | Ga0496101_0369488 | 3300048904 | Bacteria | 1128 |
| 952 | Ga0496101_0389535 | 3300048904 | Bacteria | 1097 |
| 953 | Ga0496101_0563666 | 3300048904 | Bacteria | 901 |
| 954 | Ga0496102_0006673 | 3300048905 | Bacteria | 9863 |
| 955 | Ga0496102_0021353 | 3300048905 | Bacteria | 5726 |
| 956 | Ga0496102_0058632 | 3300048905 | Bacteria | 3518 |
| 957 | Ga0496102_0078406 | 3300048905 | Bacteria | 3041 |
| 958 | Ga0496102_0343567 | 3300048905 | Bacteria | 1405 |
| 959 | Ga0496102_0588681 | 3300048905 | Bacteria | 1035 |
| 960 | Ga0496102_1071373 | 3300048905 | Bacteria | 726 |
| 961 | Ga0496103_0014594 | 3300048906 | Bacteria | 4667 |
| 962 | Ga0496103_0336809 | 3300048906 | Unclassified | 970 |
| 963 | Ga0496103_0342546 | 3300048906 | Bacteria | 961 |
| 964 | Ga0496104_0000074 | 3300048907 | Bacteria | 103117 |
| 965 | Ga0496104_0024442 | 3300048907 | Bacteria | 5556 |
| 966 | Ga0496104_0125291 | 3300048907 | Unclassified | 2467 |
| 967 | Ga0496104_0317220 | 3300048907 | Bacteria | 1472 |
| 968 | Ga0496104_0325422 | 3300048907 | Bacteria | 1450 |
| 969 | Ga0496104_0630881 | 3300048907 | Bacteria | 981 |
| 970 | Ga0496106_0031581 | 3300048909 | Bacteria | 3947 |
| 971 | Ga0496106_0166006 | 3300048909 | Bacteria | 1748 |
| 972 | Ga0496107_0056921 | 3300048910 | Bacteria | 2826 |
| 973 | Ga0496107_0307304 | 3300048910 | Bacteria | 1180 |
| 974 | Ga0496108_0000325 | 3300048911 | Bacteria | 40507 |
| 975 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 976 | Ga0496109_0306029 | 3300048912 | Unclassified | 1499 |
| 977 | Ga0496109_0736047 | 3300048912 | Bacteria | 924 |
| 978 | Ga0496110_0002628 | 3300048913 | Bacteria | 13526 |
| 979 | Ga0496110_0061618 | 3300048913 | Bacteria | 3312 |
| 980 | Ga0496111_0004540 | 3300048914 | Bacteria | 8786 |
| 981 | Ga0496112_0000283 | 3300048915 | Bacteria | 32864 |
| 982 | Ga0496112_0001864 | 3300048915 | Bacteria | 16604 |
| 983 | Ga0496112_0076452 | 3300048915 | Bacteria | 3311 |
| 984 | Ga0496112_0143818 | 3300048915 | Bacteria | 2353 |
| 985 | Ga0496112_0168771 | 3300048915 | Bacteria | 2154 |
| 986 | Ga0496112_0531873 | 3300048915 | Unclassified | 1110 |
| 987 | Ga0496113_0000504 | 3300048916 | Bacteria | 19266 |
| 988 | Ga0496113_0036419 | 3300048916 | Bacteria | 3605 |
| 989 | Ga0496113_0435657 | 3300048916 | Bacteria | 1053 |
| 990 | Ga0496113_0538124 | 3300048916 | Bacteria | 937 |
| 991 | Ga0496114_0146119 | 3300048917 | Bacteria | 2050 |
| 992 | Ga0496114_0155073 | 3300048917 | Bacteria | 1988 |
| 993 | Ga0496115_0006382 | 3300048918 | Bacteria | 8641 |
| 994 | Ga0496115_0010817 | 3300048918 | Bacteria | 6824 |
| 995 | Ga0496115_0251515 | 3300048918 | Bacteria | 1455 |
| 996 | Ga0496115_0600636 | 3300048918 | Bacteria | 875 |
| 997 | Ga0496126_0000095 | 3300048929 | Bacteria | 207654 |
| 998 | Ga0501040_0138574 | 3300049576 | Bacteria | 1713 |
| 999 | nmdc:mga09592_61422_c1 | 3300050508 | Bacteria | 3178 |
| 1000 | nmdc:mga0qj67_207052_c1 | 3300050509 | Bacteria | 1593 |
| 1001 | nmdc:mga0n895_6139_c1 | 3300050512 | Bacteria | 10149 |
| 1002 | nmdc:mga0n895_8844_c1 | 3300050512 | Bacteria | 8765 |
| 1003 | nmdc:mga0n895_988254_c1 | 3300050512 | Bacteria | 823 |
| 1004 | nmdc:mga0rr50_119696_c1 | 3300050513 | Bacteria | 2094 |
| 1005 | nmdc:mga0rr50_22666_c1 | 3300050513 | Bacteria | 4315 |
| 1006 | nmdc:mga0rr50_251177_c1 | 3300050513 | Unclassified | 1469 |
| 1007 | nmdc:mga0rr50_88981_c1 | 3300050513 | Bacteria | 2400 |
| 1008 | nmdc:mga08x19_119477_c1 | 3300050514 | Bacteria | 1766 |
| 1009 | nmdc:mga08x19_575_c1 | 3300050514 | Bacteria | 23955 |
| 1010 | nmdc:mga08x19_59017_c2 | 3300050514 | Bacteria | 2026 |
| 1011 | nmdc:mga08x19_6689_c1 | 3300050514 | Bacteria | 6840 |
| 1012 | nmdc:mga0a205_937_c1 | 3300050515 | Bacteria | 24079 |
| 1013 | Ga0501084_0268223 | 3300054114 | Bacteria | 1441 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0600636 | Ga0496115_0600636_55_723 | 197 |
| 2 | 3300025913 | Ga0207695_10711846 | Ga0207695_107118462 | 200 |
| 3 | 3300031090 | Ga0265760_10003610 | Ga0265760_100036103 | 206 |
| 4 | 3300006880 | Ga0075429_100112538 | Ga0075429_1001125382 | 209 |
| 5 | 3300024227 | Ga0228598_1017099 | Ga0228598_10170991 | 212 |
| 6 | 3300006028 | Ga0070717_10300122 | Ga0070717_103001222 | 214 |
| 7 | 3300009093 | Ga0105240_10379745 | Ga0105240_103797452 | 214 |
| 8 | 3300005329 | Ga0070683_100567660 | Ga0070683_1005676601 | 215 |
| 9 | 3300005336 | Ga0070680_100240366 | Ga0070680_1002403661 | 215 |
| 10 | 3300005434 | Ga0070709_10257488 | Ga0070709_102574882 | 215 |
| 11 | 3300005458 | Ga0070681_10047505 | Ga0070681_100475052 | 215 |
| 12 | 3300005530 | Ga0070679_100054487 | Ga0070679_1000544873 | 215 |
| 13 | 3300005614 | Ga0068856_100079175 | Ga0068856_1000791753 | 215 |
| 14 | 3300006028 | Ga0070717_10627222 | Ga0070717_106272222 | 215 |
| 15 | 3300006175 | Ga0070712_100437864 | Ga0070712_1004378642 | 215 |
| 16 | 3300013307 | Ga0157372_10005138 | Ga0157372_100051384 | 215 |
| 17 | 3300037853 | Ga0436364_1137452 | Ga0436364_1137452_1130_1792 | 215 |
| 18 | 3300003323 | rootH1_10066128 | rootH1_100661284 | 216 |
| 19 | 3300005843 | Ga0068860_100000202 | Ga0068860_10000020227 | 216 |
| 20 | 3300028381 | Ga0268264_10000241 | Ga0268264_1000024140 | 216 |
| 21 | 3300037471 | Ga0395905_0000096 | Ga0395905_0000096_68344_69039 | 216 |
| 22 | 3300046559 | Ga0495667_0216771 | Ga0495667_0216771_168_827 | 216 |
| 23 | 3300047444 | Ga0495675_0240589 | Ga0495675_0240589_416_1075 | 216 |
| 24 | 3300035170 | Ga0373943_0067392 | Ga0373943_0067392_566_1246 | 217 |
| 25 | 3300044712 | Ga0453684_0000377 | Ga0453684_0000377_56188_56862 | 217 |
| 26 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_126584_127258 | 217 |
| 27 | 3300005439 | Ga0070711_100742228 | Ga0070711_1007422281 | 218 |
| 28 | 3300006173 | Ga0070716_100005911 | Ga0070716_1000059113 | 218 |
| 29 | 3300006173 | Ga0070716_100380072 | Ga0070716_1003800722 | 218 |
| 30 | 3300009551 | Ga0105238_10509822 | Ga0105238_105098222 | 218 |
| 31 | 3300025939 | Ga0207665_10000182 | Ga0207665_1000018226 | 218 |
| 32 | 3300032002 | Ga0307416_101059012 | Ga0307416_1010590121 | 218 |
| 33 | 3300035692 | Ga0373935_0423944 | Ga0373935_0423944_56_730 | 218 |
| 34 | 3300045051 | Ga0451576_0273153 | Ga0451576_0273153_621_1304 | 218 |
| 35 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_188907_189581 | 218 |
| 36 | iso_pu_bacteria | 2643221642 | 2644236120 | 218 |
| 37 | 3300013104 | Ga0157370_10013342 | Ga0157370_100133423 | 219 |
| 38 | 3300013307 | Ga0157372_10036431 | Ga0157372_100364314 | 219 |
| 39 | 3300025233 | Ga0209437_102112 | Ga0209437_1021123 | 219 |
| 40 | 3300025261 | Ga0209233_1007680 | Ga0209233_10076804 | 219 |
| 41 | 3300031251 | Ga0265327_10032180 | Ga0265327_100321803 | 219 |
| 42 | 3300038742 | Ga0400486_20280 | Ga0400486_20280_1589_2278 | 219 |
| 43 | 3300046529 | Ga0495652_0088019 | Ga0495652_0088019_601_1269 | 219 |
| 44 | 3300046543 | Ga0495645_0006650 | Ga0495645_0006650_4262_4930 | 219 |
| 45 | 3300046809 | Ga0495600_0103323 | Ga0495600_0103323_739_1407 | 219 |
| 46 | 3300047317 | Ga0495604_0076018 | Ga0495604_0076018_1356_2024 | 219 |
| 47 | 3300047471 | Ga0495684_0493365 | Ga0495684_0493365_25_693 | 219 |
| 48 | 3300048929 | Ga0496126_0000095 | Ga0496126_0000095_71975_72643 | 219 |
| 49 | iso_pu_bacteria | 2887375801 | 2887377990 | 219 |
| 50 | iso_pu_bacteria | 646564506 | 646812225 | 219 |
| 51 | 3300005841 | Ga0068863_100005729 | Ga0068863_10000572912 | 220 |
| 52 | 3300006163 | Ga0070715_10099905 | Ga0070715_100999052 | 220 |
| 53 | 3300006237 | Ga0097621_100639759 | Ga0097621_1006397591 | 220 |
| 54 | 3300006358 | Ga0068871_100878048 | Ga0068871_1008780481 | 220 |
| 55 | 3300006871 | Ga0075434_100046235 | Ga0075434_1000462353 | 220 |
| 56 | 3300006871 | Ga0075434_100225606 | Ga0075434_1002256062 | 220 |
| 57 | 3300009093 | Ga0105240_10126859 | Ga0105240_101268592 | 220 |
| 58 | 3300013105 | Ga0157369_10091948 | Ga0157369_100919483 | 220 |
| 59 | 3300013296 | Ga0157374_10278228 | Ga0157374_102782282 | 220 |
| 60 | 3300013307 | Ga0157372_10002544 | Ga0157372_1000254415 | 220 |
| 61 | 3300014969 | Ga0157376_10031198 | Ga0157376_100311983 | 220 |
| 62 | 3300024225 | Ga0224572_1009608 | Ga0224572_10096082 | 220 |
| 63 | 3300025298 | Ga0209050_1041325 | Ga0209050_10413252 | 220 |
| 64 | 3300025913 | Ga0207695_10271718 | Ga0207695_102717182 | 220 |
| 65 | 3300026088 | Ga0207641_10001947 | Ga0207641_1000194712 | 220 |
| 66 | 3300031090 | Ga0265760_10007787 | Ga0265760_100077873 | 220 |
| 67 | 3300035116 | Ga0373945_0082064 | Ga0373945_0082064_229_906 | 220 |
| 68 | 3300035172 | Ga0373955_0163829 | Ga0373955_0163829_36_713 | 220 |
| 69 | 3300038726 | Ga0400490_03194 | Ga0400490_03194_291_986 | 220 |
| 70 | 3300039450 | Ga0436363_1603702 | Ga0436363_1603702_141_803 | 220 |
| 71 | 3300046455 | Ga0495603_0004371 | Ga0495603_0004371_2843_3520 | 220 |
| 72 | 3300046459 | Ga0495629_0088319 | Ga0495629_0088319_67_744 | 220 |
| 73 | 3300046472 | Ga0495580_0081143 | Ga0495580_0081143_472_1149 | 220 |
| 74 | 3300046473 | Ga0495582_0009992 | Ga0495582_0009992_67_744 | 220 |
| 75 | 3300046477 | Ga0495664_0023289 | Ga0495664_0023289_2102_2779 | 220 |
| 76 | 3300046499 | Ga0495594_0007103 | Ga0495594_0007103_1926_2603 | 220 |
| 77 | 3300046533 | Ga0495640_0027205 | Ga0495640_0027205_128_805 | 220 |
| 78 | 3300046535 | Ga0495586_0012586 | Ga0495586_0012586_1646_2323 | 220 |
| 79 | 3300046557 | Ga0495622_0159709 | Ga0495622_0159709_56_724 | 220 |
| 80 | 3300046642 | Ga0495634_0069864 | Ga0495634_0069864_1192_1869 | 220 |
| 81 | 3300046681 | Ga0495647_0014408 | Ga0495647_0014408_459_1136 | 220 |
| 82 | 3300047315 | Ga0495581_0059356 | Ga0495581_0059356_1196_1873 | 220 |
| 83 | 3300047319 | Ga0495674_0315998 | Ga0495674_0315998_444_1121 | 220 |
| 84 | 3300047471 | Ga0495684_0022085 | Ga0495684_0022085_3975_4652 | 220 |
| 85 | 3300048907 | Ga0496104_0125291 | Ga0496104_0125291_693_1370 | 220 |
| 86 | 3300048917 | Ga0496114_0155073 | Ga0496114_0155073_50_727 | 220 |
| 87 | 3300048918 | Ga0496115_0010817 | Ga0496115_0010817_1150_1827 | 220 |
| 88 | 3300050512 | nmdc:mga0n895_6139_c1 | nmdc:mga0n895_6139_c1_3079_3747 | 220 |
| 89 | 3300050513 | nmdc:mga0rr50_119696_c1 | nmdc:mga0rr50_119696_c1_1351_2019 | 220 |
| 90 | 3300005335 | Ga0070666_10087335 | Ga0070666_100873352 | 221 |
| 91 | 3300005338 | Ga0068868_100006066 | Ga0068868_1000060665 | 221 |
| 92 | 3300005339 | Ga0070660_100016682 | Ga0070660_1000166822 | 221 |
| 93 | 3300005347 | Ga0070668_100013446 | Ga0070668_1000134462 | 221 |
| 94 | 3300005353 | Ga0070669_100016274 | Ga0070669_1000162742 | 221 |
| 95 | 3300005366 | Ga0070659_100233724 | Ga0070659_1002337242 | 221 |
| 96 | 3300005367 | Ga0070667_100009483 | Ga0070667_1000094832 | 221 |
| 97 | 3300005434 | Ga0070709_10038441 | Ga0070709_100384413 | 221 |
| 98 | 3300005434 | Ga0070709_10057013 | Ga0070709_100570131 | 221 |
| 99 | 3300005434 | Ga0070709_10667144 | Ga0070709_106671441 | 221 |
| 100 | 3300005436 | Ga0070713_100505909 | Ga0070713_1005059091 | 221 |
| 101 | 3300005437 | Ga0070710_10220647 | Ga0070710_102206471 | 221 |
| 102 | 3300005439 | Ga0070711_100000478 | Ga0070711_1000004789 | 221 |
| 103 | 3300005439 | Ga0070711_100188148 | Ga0070711_1001881482 | 221 |
| 104 | 3300005440 | Ga0070705_100062843 | Ga0070705_1000628432 | 221 |
| 105 | 3300005444 | Ga0070694_100041259 | Ga0070694_1000412592 | 221 |
| 106 | 3300005445 | Ga0070708_100003900 | Ga0070708_10000390013 | 221 |
| 107 | 3300005457 | Ga0070662_100005079 | Ga0070662_1000050791 | 221 |
| 108 | 3300005458 | Ga0070681_10231014 | Ga0070681_102310142 | 221 |
| 109 | 3300005467 | Ga0070706_100000257 | Ga0070706_10000025748 | 221 |
| 110 | 3300005518 | Ga0070699_100209163 | Ga0070699_1002091631 | 221 |
| 111 | 3300005518 | Ga0070699_100290372 | Ga0070699_1002903722 | 221 |
| 112 | 3300005530 | Ga0070679_100301683 | Ga0070679_1003016832 | 221 |
| 113 | 3300005535 | Ga0070684_100017780 | Ga0070684_1000177805 | 221 |
| 114 | 3300005536 | Ga0070697_100001487 | Ga0070697_10000148713 | 221 |
| 115 | 3300005539 | Ga0068853_100005004 | Ga0068853_1000050047 | 221 |
| 116 | 3300005544 | Ga0070686_100011657 | Ga0070686_1000116574 | 221 |
| 117 | 3300005546 | Ga0070696_100033625 | Ga0070696_1000336253 | 221 |
| 118 | 3300005547 | Ga0070693_100038251 | Ga0070693_1000382511 | 221 |
| 119 | 3300005548 | Ga0070665_100146087 | Ga0070665_1001460871 | 221 |
| 120 | 3300005563 | Ga0068855_100106448 | Ga0068855_1001064482 | 221 |
| 121 | 3300005563 | Ga0068855_100947328 | Ga0068855_1009473281 | 221 |
| 122 | 3300005578 | Ga0068854_100003492 | Ga0068854_1000034923 | 221 |
| 123 | 3300005614 | Ga0068856_100118901 | Ga0068856_1001189013 | 221 |
| 124 | 3300005616 | Ga0068852_100318137 | Ga0068852_1003181371 | 221 |
| 125 | 3300005617 | Ga0068859_100114376 | Ga0068859_1001143762 | 221 |
| 126 | 3300005718 | Ga0068866_10408602 | Ga0068866_104086021 | 221 |
| 127 | 3300005719 | Ga0068861_100392952 | Ga0068861_1003929522 | 221 |
| 128 | 3300005834 | Ga0068851_10001381 | Ga0068851_100013816 | 221 |
| 129 | 3300005840 | Ga0068870_10072395 | Ga0068870_100723952 | 221 |
| 130 | 3300005841 | Ga0068863_100070921 | Ga0068863_1000709214 | 221 |
| 131 | 3300006163 | Ga0070715_10122984 | Ga0070715_101229842 | 221 |
| 132 | 3300006173 | Ga0070716_100135159 | Ga0070716_1001351591 | 221 |
| 133 | 3300006173 | Ga0070716_100432041 | Ga0070716_1004320411 | 221 |
| 134 | 3300006175 | Ga0070712_100000948 | Ga0070712_10000094811 | 221 |
| 135 | 3300006237 | Ga0097621_100005957 | Ga0097621_1000059576 | 221 |
| 136 | 3300006237 | Ga0097621_100049532 | Ga0097621_1000495322 | 221 |
| 137 | 3300006358 | Ga0068871_100009189 | Ga0068871_1000091896 | 221 |
| 138 | 3300006358 | Ga0068871_100092083 | Ga0068871_1000920832 | 221 |
| 139 | 3300006358 | Ga0068871_100170830 | Ga0068871_1001708302 | 221 |
| 140 | 3300006931 | Ga0097620_100114372 | Ga0097620_1001143722 | 221 |
| 141 | 3300009093 | Ga0105240_10069762 | Ga0105240_100697623 | 221 |
| 142 | 3300009093 | Ga0105240_10255657 | Ga0105240_102556572 | 221 |
| 143 | 3300009098 | Ga0105245_10102519 | Ga0105245_101025192 | 221 |
| 144 | 3300009101 | Ga0105247_10023440 | Ga0105247_100234401 | 221 |
| 145 | 3300009101 | Ga0105247_10025376 | Ga0105247_100253763 | 221 |
| 146 | 3300009101 | Ga0105247_10043865 | Ga0105247_100438654 | 221 |
| 147 | 3300009101 | Ga0105247_10287524 | Ga0105247_102875241 | 221 |
| 148 | 3300009174 | Ga0105241_10014699 | Ga0105241_100146997 | 221 |
| 149 | 3300009174 | Ga0105241_10122744 | Ga0105241_101227442 | 221 |
| 150 | 3300009174 | Ga0105241_10184639 | Ga0105241_101846392 | 221 |
| 151 | 3300009176 | Ga0105242_10067475 | Ga0105242_100674752 | 221 |
| 152 | 3300009177 | Ga0105248_10019962 | Ga0105248_100199623 | 221 |
| 153 | 3300009545 | Ga0105237_10336095 | Ga0105237_103360951 | 221 |
| 154 | 3300009551 | Ga0105238_10195615 | Ga0105238_101956152 | 221 |
| 155 | 3300009553 | Ga0105249_10005159 | Ga0105249_100051593 | 221 |
| 156 | 3300010375 | Ga0105239_10328075 | Ga0105239_103280752 | 221 |
| 157 | 3300010375 | Ga0105239_10601201 | Ga0105239_106012012 | 221 |
| 158 | 3300011119 | Ga0105246_10052960 | Ga0105246_100529602 | 221 |
| 159 | 3300013102 | Ga0157371_10004936 | Ga0157371_100049366 | 221 |
| 160 | 3300013104 | Ga0157370_10262601 | Ga0157370_102626012 | 221 |
| 161 | 3300013105 | Ga0157369_10007966 | Ga0157369_100079663 | 221 |
| 162 | 3300013296 | Ga0157374_10013417 | Ga0157374_100134176 | 221 |
| 163 | 3300013296 | Ga0157374_10050314 | Ga0157374_100503143 | 221 |
| 164 | 3300013296 | Ga0157374_10079255 | Ga0157374_100792553 | 221 |
| 165 | 3300013296 | Ga0157374_10198645 | Ga0157374_101986452 | 221 |
| 166 | 3300013297 | Ga0157378_10001268 | Ga0157378_100012688 | 221 |
| 167 | 3300013297 | Ga0157378_10115437 | Ga0157378_101154372 | 221 |
| 168 | 3300013297 | Ga0157378_10206337 | Ga0157378_102063371 | 221 |
| 169 | 3300013297 | Ga0157378_10220523 | Ga0157378_102205232 | 221 |
| 170 | 3300013306 | Ga0163162_10002239 | Ga0163162_1000223918 | 221 |
| 171 | 3300013306 | Ga0163162_10011418 | Ga0163162_100114186 | 221 |
| 172 | 3300013307 | Ga0157372_10166041 | Ga0157372_101660411 | 221 |
| 173 | 3300013308 | Ga0157375_10035816 | Ga0157375_100358162 | 221 |
| 174 | 3300014325 | Ga0163163_10093541 | Ga0163163_100935412 | 221 |
| 175 | 3300014325 | Ga0163163_10096265 | Ga0163163_100962652 | 221 |
| 176 | 3300014325 | Ga0163163_10113779 | Ga0163163_101137793 | 221 |
| 177 | 3300014968 | Ga0157379_10007798 | Ga0157379_100077985 | 221 |
| 178 | 3300014968 | Ga0157379_10010844 | Ga0157379_100108445 | 221 |
| 179 | 3300014969 | Ga0157376_10083990 | Ga0157376_100839903 | 221 |
| 180 | 3300014969 | Ga0157376_10139774 | Ga0157376_101397742 | 221 |
| 181 | 3300025900 | Ga0207710_10059340 | Ga0207710_100593402 | 221 |
| 182 | 3300025903 | Ga0207680_10010712 | Ga0207680_100107123 | 221 |
| 183 | 3300025906 | Ga0207699_10000815 | Ga0207699_100008156 | 221 |
| 184 | 3300025906 | Ga0207699_10095528 | Ga0207699_100955281 | 221 |
| 185 | 3300025907 | Ga0207645_10007872 | Ga0207645_100078725 | 221 |
| 186 | 3300025910 | Ga0207684_10018088 | Ga0207684_100180884 | 221 |
| 187 | 3300025911 | Ga0207654_10056155 | Ga0207654_100561552 | 221 |
| 188 | 3300025911 | Ga0207654_10110051 | Ga0207654_101100512 | 221 |
| 189 | 3300025911 | Ga0207654_10255190 | Ga0207654_102551902 | 221 |
| 190 | 3300025912 | Ga0207707_10220174 | Ga0207707_102201742 | 221 |
| 191 | 3300025913 | Ga0207695_10043656 | Ga0207695_100436562 | 221 |
| 192 | 3300025914 | Ga0207671_10055720 | Ga0207671_100557204 | 221 |
| 193 | 3300025915 | Ga0207693_10000173 | Ga0207693_1000017348 | 221 |
| 194 | 3300025916 | Ga0207663_10003822 | Ga0207663_100038228 | 221 |
| 195 | 3300025919 | Ga0207657_10008288 | Ga0207657_100082885 | 221 |
| 196 | 3300025921 | Ga0207652_10076233 | Ga0207652_100762331 | 221 |
| 197 | 3300025924 | Ga0207694_10089601 | Ga0207694_100896012 | 221 |
| 198 | 3300025924 | Ga0207694_10287710 | Ga0207694_102877101 | 221 |
| 199 | 3300025927 | Ga0207687_10058417 | Ga0207687_100584173 | 221 |
| 200 | 3300025927 | Ga0207687_10173184 | Ga0207687_101731842 | 221 |
| 201 | 3300025928 | Ga0207700_10331157 | Ga0207700_103311572 | 221 |
| 202 | 3300025933 | Ga0207706_10001122 | Ga0207706_1000112214 | 221 |
| 203 | 3300025939 | Ga0207665_10048693 | Ga0207665_100486933 | 221 |
| 204 | 3300025939 | Ga0207665_10235785 | Ga0207665_102357852 | 221 |
| 205 | 3300025941 | Ga0207711_10002524 | Ga0207711_100025243 | 221 |
| 206 | 3300025972 | Ga0207668_10052646 | Ga0207668_100526463 | 221 |
| 207 | 3300025981 | Ga0207640_10007732 | Ga0207640_100077325 | 221 |
| 208 | 3300026041 | Ga0207639_10154627 | Ga0207639_101546272 | 221 |
| 209 | 3300026067 | Ga0207678_10000950 | Ga0207678_1000095014 | 221 |
| 210 | 3300026075 | Ga0207708_10246065 | Ga0207708_102460651 | 221 |
| 211 | 3300026078 | Ga0207702_10019837 | Ga0207702_100198375 | 221 |
| 212 | 3300026078 | Ga0207702_10097251 | Ga0207702_100972513 | 221 |
| 213 | 3300026088 | Ga0207641_10040850 | Ga0207641_100408505 | 221 |
| 214 | 3300026116 | Ga0207674_10013852 | Ga0207674_100138522 | 221 |
| 215 | 3300026118 | Ga0207675_100083379 | Ga0207675_1000833794 | 221 |
| 216 | 3300031241 | Ga0265325_10014097 | Ga0265325_100140972 | 221 |
| 217 | 3300031247 | Ga0265340_10149411 | Ga0265340_101494112 | 221 |
| 218 | 3300031250 | Ga0265331_10094211 | Ga0265331_100942112 | 221 |
| 219 | 3300031344 | Ga0265316_10019053 | Ga0265316_100190534 | 221 |
| 220 | 3300031595 | Ga0265313_10014628 | Ga0265313_100146282 | 221 |
| 221 | 3300031711 | Ga0265314_10119534 | Ga0265314_101195341 | 221 |
| 222 | 3300031712 | Ga0265342_10112470 | Ga0265342_101124702 | 221 |
| 223 | 3300035084 | Ga0373928_0042513 | Ga0373928_0042513_17_712 | 221 |
| 224 | 3300035114 | Ga0373939_0046714 | Ga0373939_0046714_203_907 | 221 |
| 225 | 3300035115 | Ga0373941_0019085 | Ga0373941_0019085_1203_1868 | 221 |
| 226 | 3300035691 | Ga0373931_0052084 | Ga0373931_0052084_250_978 | 221 |
| 227 | 3300035691 | Ga0373931_0247997 | Ga0373931_0247997_61_768 | 221 |
| 228 | 3300035695 | Ga0373927_0124228 | Ga0373927_0124228_358_1032 | 221 |
| 229 | 3300035724 | Ga0373933_0308046 | Ga0373933_0308046_150_824 | 221 |
| 230 | 3300036401 | Ga0373937_0893321 | Ga0373937_0893321_133_807 | 221 |
| 231 | 3300037068 | Ga0373925_0282884 | Ga0373925_0282884_486_1160 | 221 |
| 232 | 3300039450 | Ga0436363_0684377 | Ga0436363_0684377_877_1560 | 221 |
| 233 | 3300044712 | Ga0453684_0005849 | Ga0453684_0005849_2872_3543 | 221 |
| 234 | 3300044712 | Ga0453684_0061085 | Ga0453684_0061085_2637_3308 | 221 |
| 235 | 3300045051 | Ga0451576_0301499 | Ga0451576_0301499_754_1425 | 221 |
| 236 | 3300046454 | Ga0495592_0052355 | Ga0495592_0052355_1260_1934 | 221 |
| 237 | 3300046462 | Ga0495651_0014952 | Ga0495651_0014952_1794_2468 | 221 |
| 238 | 3300046463 | Ga0495653_0019126 | Ga0495653_0019126_2567_3241 | 221 |
| 239 | 3300046472 | Ga0495580_0033054 | Ga0495580_0033054_323_988 | 221 |
| 240 | 3300046472 | Ga0495580_0195440 | Ga0495580_0195440_506_1180 | 221 |
| 241 | 3300046472 | Ga0495580_0208472 | Ga0495580_0208472_596_1261 | 221 |
| 242 | 3300046472 | Ga0495580_0348395 | Ga0495580_0348395_19_693 | 221 |
| 243 | 3300046477 | Ga0495664_0010014 | Ga0495664_0010014_3922_4596 | 221 |
| 244 | 3300046499 | Ga0495594_0149616 | Ga0495594_0149616_105_779 | 221 |
| 245 | 3300046511 | Ga0495608_0015944 | Ga0495608_0015944_2479_3153 | 221 |
| 246 | 3300046514 | Ga0495618_0014035 | Ga0495618_0014035_977_1651 | 221 |
| 247 | 3300046516 | Ga0495628_0000167 | Ga0495628_0000167_49179_49853 | 221 |
| 248 | 3300046517 | Ga0495630_0131284 | Ga0495630_0131284_801_1475 | 221 |
| 249 | 3300046529 | Ga0495652_0001713 | Ga0495652_0001713_19767_20441 | 221 |
| 250 | 3300046533 | Ga0495640_0057591 | Ga0495640_0057591_494_1168 | 221 |
| 251 | 3300046533 | Ga0495640_0245598 | Ga0495640_0245598_31_705 | 221 |
| 252 | 3300046535 | Ga0495586_0271800 | Ga0495586_0271800_110_784 | 221 |
| 253 | 3300046536 | Ga0495587_0003037 | Ga0495587_0003037_3310_3984 | 221 |
| 254 | 3300046543 | Ga0495645_0007683 | Ga0495645_0007683_4476_5150 | 221 |
| 255 | 3300046543 | Ga0495645_0079896 | Ga0495645_0079896_450_1124 | 221 |
| 256 | 3300046559 | Ga0495667_0027483 | Ga0495667_0027483_1654_2328 | 221 |
| 257 | 3300046642 | Ga0495634_0025416 | Ga0495634_0025416_114_788 | 221 |
| 258 | 3300046675 | Ga0495657_0009233 | Ga0495657_0009233_4126_4800 | 221 |
| 259 | 3300046679 | Ga0495623_0011515 | Ga0495623_0011515_2773_3447 | 221 |
| 260 | 3300046684 | Ga0495669_0053711 | Ga0495669_0053711_968_1642 | 221 |
| 261 | 3300046689 | Ga0495613_0317024 | Ga0495613_0317024_320_994 | 221 |
| 262 | 3300046809 | Ga0495600_0043489 | Ga0495600_0043489_982_1656 | 221 |
| 263 | 3300047315 | Ga0495581_0324868 | Ga0495581_0324868_41_715 | 221 |
| 264 | 3300047317 | Ga0495604_0003790 | Ga0495604_0003790_3946_4620 | 221 |
| 265 | 3300047318 | Ga0495636_0023394 | Ga0495636_0023394_506_1180 | 221 |
| 266 | 3300047319 | Ga0495674_0013194 | Ga0495674_0013194_2622_3296 | 221 |
| 267 | 3300047319 | Ga0495674_0051869 | Ga0495674_0051869_149_823 | 221 |
| 268 | 3300047322 | Ga0495680_0001348 | Ga0495680_0001348_8377_9051 | 221 |
| 269 | 3300047322 | Ga0495680_0010330 | Ga0495680_0010330_4594_5268 | 221 |
| 270 | 3300047444 | Ga0495675_0000202 | Ga0495675_0000202_539_1213 | 221 |
| 271 | 3300047444 | Ga0495675_0053586 | Ga0495675_0053586_452_1126 | 221 |
| 272 | 3300047471 | Ga0495684_0012098 | Ga0495684_0012098_5121_5795 | 221 |
| 273 | 3300047673 | Ga0495593_0174034 | Ga0495593_0174034_39_713 | 221 |
| 274 | 3300048088 | Ga0495602_0022805 | Ga0495602_0022805_67_741 | 221 |
| 275 | 3300048903 | Ga0496100_0232842 | Ga0496100_0232842_529_1209 | 221 |
| 276 | 3300048904 | Ga0496101_0143438 | Ga0496101_0143438_996_1703 | 221 |
| 277 | 3300048904 | Ga0496101_0360541 | Ga0496101_0360541_332_1027 | 221 |
| 278 | 3300048904 | Ga0496101_0389535 | Ga0496101_0389535_22_696 | 221 |
| 279 | 3300048905 | Ga0496102_0006673 | Ga0496102_0006673_4170_4877 | 221 |
| 280 | 3300048905 | Ga0496102_0058632 | Ga0496102_0058632_1854_2582 | 221 |
| 281 | 3300048905 | Ga0496102_0343567 | Ga0496102_0343567_607_1311 | 221 |
| 282 | 3300048906 | Ga0496103_0014594 | Ga0496103_0014594_319_1026 | 221 |
| 283 | 3300048906 | Ga0496103_0342546 | Ga0496103_0342546_25_690 | 221 |
| 284 | 3300048907 | Ga0496104_0000074 | Ga0496104_0000074_29745_30419 | 221 |
| 285 | 3300048907 | Ga0496104_0024442 | Ga0496104_0024442_4208_4888 | 221 |
| 286 | 3300048907 | Ga0496104_0325422 | Ga0496104_0325422_712_1386 | 221 |
| 287 | 3300048907 | Ga0496104_0630881 | Ga0496104_0630881_100_771 | 221 |
| 288 | 3300048909 | Ga0496106_0031581 | Ga0496106_0031581_633_1340 | 221 |
| 289 | 3300048910 | Ga0496107_0307304 | Ga0496107_0307304_324_1031 | 221 |
| 290 | 3300048912 | Ga0496109_0736047 | Ga0496109_0736047_75_749 | 221 |
| 291 | 3300048913 | Ga0496110_0061618 | Ga0496110_0061618_2485_3150 | 221 |
| 292 | 3300048915 | Ga0496112_0531873 | Ga0496112_0531873_147_821 | 221 |
| 293 | 3300048916 | Ga0496113_0538124 | Ga0496113_0538124_226_891 | 221 |
| 294 | 3300048917 | Ga0496114_0146119 | Ga0496114_0146119_199_873 | 221 |
| 295 | 3300050514 | nmdc:mga08x19_59017_c2 | nmdc:mga08x19_59017_c2_1032_1736 | 221 |
| 296 | 3300006846 | Ga0075430_100064546 | Ga0075430_1000645462 | 222 |
| 297 | 3300006914 | Ga0075436_100052786 | Ga0075436_1000527863 | 222 |
| 298 | 3300014497 | Ga0182008_10001531 | Ga0182008_100015316 | 222 |
| 299 | 3300031090 | Ga0265760_10017742 | Ga0265760_100177422 | 222 |
| 300 | 3300035083 | Ga0373926_0004598 | Ga0373926_0004598_1569_2249 | 222 |
| 301 | 3300035170 | Ga0373943_0302457 | Ga0373943_0302457_61_741 | 222 |
| 302 | 3300035171 | Ga0373946_0004259 | Ga0373946_0004259_3822_4502 | 222 |
| 303 | 3300035695 | Ga0373927_0015335 | Ga0373927_0015335_1523_2203 | 222 |
| 304 | 3300035725 | Ga0373947_0001902 | Ga0373947_0001902_1092_1772 | 222 |
| 305 | 3300037068 | Ga0373925_0000165 | Ga0373925_0000165_28509_29189 | 222 |
| 306 | 3300042876 | Ga0451577_0003762 | Ga0451577_0003762_9835_10509 | 222 |
| 307 | 3300042876 | Ga0451577_0064248 | Ga0451577_0064248_1420_2094 | 222 |
| 308 | 3300042876 | Ga0451577_0407021 | Ga0451577_0407021_317_991 | 222 |
| 309 | 3300044673 | Ga0453683_0004979 | Ga0453683_0004979_5173_5847 | 222 |
| 310 | 3300044673 | Ga0453683_0005490 | Ga0453683_0005490_2256_2930 | 222 |
| 311 | 3300044673 | Ga0453683_0251834 | Ga0453683_0251834_150_824 | 222 |
| 312 | 3300044712 | Ga0453684_0018504 | Ga0453684_0018504_9748_10422 | 222 |
| 313 | 3300044712 | Ga0453684_0096456 | Ga0453684_0096456_1200_1874 | 222 |
| 314 | 3300044842 | Ga0466957_0000410 | Ga0466957_0000410_20229_20900 | 222 |
| 315 | 3300045051 | Ga0451576_0018916 | Ga0451576_0018916_3065_3739 | 222 |
| 316 | 3300045051 | Ga0451576_0220067 | Ga0451576_0220067_244_918 | 222 |
| 317 | 3300046517 | Ga0495630_0087969 | Ga0495630_0087969_1249_1929 | 222 |
| 318 | 3300046526 | Ga0495666_0027633 | Ga0495666_0027633_447_1127 | 222 |
| 319 | 3300047321 | Ga0495676_0259262 | Ga0495676_0259262_428_1108 | 222 |
| 320 | 3300048915 | Ga0496112_0143818 | Ga0496112_0143818_736_1404 | 222 |
| 321 | 3300049576 | Ga0501040_0138574 | Ga0501040_0138574_657_1337 | 222 |
| 322 | 3300050508 | nmdc:mga09592_61422_c1 | nmdc:mga09592_61422_c1_1144_1818 | 222 |
| 323 | 3300050509 | nmdc:mga0qj67_207052_c1 | nmdc:mga0qj67_207052_c1_415_1089 | 222 |
| 324 | 3300050514 | nmdc:mga08x19_575_c1 | nmdc:mga08x19_575_c1_18313_18993 | 222 |
| 325 | 3300054114 | Ga0501084_0268223 | Ga0501084_0268223_502_1182 | 222 |
| 326 | 3300005535 | Ga0070684_100100259 | Ga0070684_1001002593 | 223 |
| 327 | 3300005536 | Ga0070697_100085791 | Ga0070697_1000857912 | 223 |
| 328 | 3300006028 | Ga0070717_10002339 | Ga0070717_100023398 | 223 |
| 329 | 3300006237 | Ga0097621_100000598 | Ga0097621_1000005987 | 223 |
| 330 | 3300006358 | Ga0068871_100025233 | Ga0068871_1000252333 | 223 |
| 331 | 3300013296 | Ga0157374_10386565 | Ga0157374_103865652 | 223 |
| 332 | 3300014969 | Ga0157376_10232048 | Ga0157376_102320482 | 223 |
| 333 | 3300025939 | Ga0207665_10112332 | Ga0207665_101123321 | 223 |
| 334 | 3300026089 | Ga0207648_10371630 | Ga0207648_103716301 | 223 |
| 335 | 3300035695 | Ga0373927_0054495 | Ga0373927_0054495_330_1001 | 223 |
| 336 | 3300046472 | Ga0495580_0000337 | Ga0495580_0000337_5926_6597 | 223 |
| 337 | 3300046472 | Ga0495580_0108116 | Ga0495580_0108116_1089_1763 | 223 |
| 338 | 3300046531 | Ga0495665_0025425 | Ga0495665_0025425_530_1201 | 223 |
| 339 | 3300050513 | nmdc:mga0rr50_251177_c1 | nmdc:mga0rr50_251177_c1_535_1221 | 223 |
| 340 | 2162886012 | MBSR1b_contig_201130 | MBSR1b_0159.00005530 | 224 |
| 341 | 2162886012 | MBSR1b_contig_3160416 | MBSR1b_0787.00000330 | 224 |
| 342 | 3300000546 | LJNas_1000129 | LJNas_10001292 | 224 |
| 343 | 3300001976 | JGI24752J21851_1006373 | JGI24752J21851_10063732 | 224 |
| 344 | 3300001979 | JGI24740J21852_10097993 | JGI24740J21852_100979931 | 224 |
| 345 | 3300001990 | JGI24737J22298_10034298 | JGI24737J22298_100342982 | 224 |
| 346 | 3300001991 | JGI24743J22301_10007079 | JGI24743J22301_100070792 | 224 |
| 347 | 3300002239 | JGI24034J26672_10000570 | JGI24034J26672_100005705 | 224 |
| 348 | 3300002244 | JGI24742J22300_10036682 | JGI24742J22300_100366822 | 224 |
| 349 | 3300002459 | JGI24751J29686_10023255 | JGI24751J29686_100232551 | 224 |
| 350 | 3300005290 | Ga0065712_10082264 | Ga0065712_100822643 | 224 |
| 351 | 3300005293 | Ga0065715_10004441 | Ga0065715_100044413 | 224 |
| 352 | 3300005293 | Ga0065715_10203251 | Ga0065715_102032512 | 224 |
| 353 | 3300005295 | Ga0065707_10164984 | Ga0065707_101649842 | 224 |
| 354 | 3300005327 | Ga0070658_10012517 | Ga0070658_100125175 | 224 |
| 355 | 3300005327 | Ga0070658_10172599 | Ga0070658_101725992 | 224 |
| 356 | 3300005328 | Ga0070676_10032029 | Ga0070676_100320293 | 224 |
| 357 | 3300005328 | Ga0070676_10092810 | Ga0070676_100928101 | 224 |
| 358 | 3300005329 | Ga0070683_100000180 | Ga0070683_1000001809 | 224 |
| 359 | 3300005329 | Ga0070683_100184739 | Ga0070683_1001847392 | 224 |
| 360 | 3300005330 | Ga0070690_100198034 | Ga0070690_1001980341 | 224 |
| 361 | 3300005331 | Ga0070670_100001706 | Ga0070670_10000170611 | 224 |
| 362 | 3300005331 | Ga0070670_100155017 | Ga0070670_1001550172 | 224 |
| 363 | 3300005331 | Ga0070670_100391214 | Ga0070670_1003912142 | 224 |
| 364 | 3300005334 | Ga0068869_100002390 | Ga0068869_1000023906 | 224 |
| 365 | 3300005334 | Ga0068869_100014353 | Ga0068869_1000143532 | 224 |
| 366 | 3300005335 | Ga0070666_10040208 | Ga0070666_100402082 | 224 |
| 367 | 3300005336 | Ga0070680_100163322 | Ga0070680_1001633222 | 224 |
| 368 | 3300005336 | Ga0070680_100201821 | Ga0070680_1002018212 | 224 |
| 369 | 3300005337 | Ga0070682_100047195 | Ga0070682_1000471953 | 224 |
| 370 | 3300005337 | Ga0070682_100108040 | Ga0070682_1001080401 | 224 |
| 371 | 3300005338 | Ga0068868_100002943 | Ga0068868_1000029435 | 224 |
| 372 | 3300005338 | Ga0068868_100019802 | Ga0068868_1000198025 | 224 |
| 373 | 3300005338 | Ga0068868_100051856 | Ga0068868_1000518564 | 224 |
| 374 | 3300005338 | Ga0068868_100261589 | Ga0068868_1002615892 | 224 |
| 375 | 3300005339 | Ga0070660_100240181 | Ga0070660_1002401812 | 224 |
| 376 | 3300005339 | Ga0070660_100522864 | Ga0070660_1005228641 | 224 |
| 377 | 3300005340 | Ga0070689_100016928 | Ga0070689_1000169285 | 224 |
| 378 | 3300005340 | Ga0070689_100170285 | Ga0070689_1001702852 | 224 |
| 379 | 3300005343 | Ga0070687_100023249 | Ga0070687_1000232491 | 224 |
| 380 | 3300005344 | Ga0070661_100000886 | Ga0070661_10000088617 | 224 |
| 381 | 3300005344 | Ga0070661_100226734 | Ga0070661_1002267342 | 224 |
| 382 | 3300005345 | Ga0070692_10463847 | Ga0070692_104638471 | 224 |
| 383 | 3300005353 | Ga0070669_100095707 | Ga0070669_1000957072 | 224 |
| 384 | 3300005354 | Ga0070675_100003414 | Ga0070675_1000034143 | 224 |
| 385 | 3300005354 | Ga0070675_100507415 | Ga0070675_1005074151 | 224 |
| 386 | 3300005355 | Ga0070671_100024798 | Ga0070671_1000247983 | 224 |
| 387 | 3300005355 | Ga0070671_100032659 | Ga0070671_1000326594 | 224 |
| 388 | 3300005355 | Ga0070671_100224112 | Ga0070671_1002241122 | 224 |
| 389 | 3300005356 | Ga0070674_100008141 | Ga0070674_1000081414 | 224 |
| 390 | 3300005356 | Ga0070674_100129520 | Ga0070674_1001295202 | 224 |
| 391 | 3300005364 | Ga0070673_100106371 | Ga0070673_1001063712 | 224 |
| 392 | 3300005364 | Ga0070673_100128982 | Ga0070673_1001289822 | 224 |
| 393 | 3300005365 | Ga0070688_100001337 | Ga0070688_10000133710 | 224 |
| 394 | 3300005366 | Ga0070659_100055418 | Ga0070659_1000554183 | 224 |
| 395 | 3300005366 | Ga0070659_100083237 | Ga0070659_1000832372 | 224 |
| 396 | 3300005367 | Ga0070667_100093961 | Ga0070667_1000939611 | 224 |
| 397 | 3300005434 | Ga0070709_10015131 | Ga0070709_100151315 | 224 |
| 398 | 3300005434 | Ga0070709_10084591 | Ga0070709_100845912 | 224 |
| 399 | 3300005434 | Ga0070709_10147207 | Ga0070709_101472072 | 224 |
| 400 | 3300005434 | Ga0070709_10170516 | Ga0070709_101705161 | 224 |
| 401 | 3300005434 | Ga0070709_10170725 | Ga0070709_101707252 | 224 |
| 402 | 3300005435 | Ga0070714_100001114 | Ga0070714_1000011143 | 224 |
| 403 | 3300005435 | Ga0070714_100016666 | Ga0070714_1000166663 | 224 |
| 404 | 3300005435 | Ga0070714_100224122 | Ga0070714_1002241222 | 224 |
| 405 | 3300005436 | Ga0070713_100000543 | Ga0070713_10000054319 | 224 |
| 406 | 3300005436 | Ga0070713_100002121 | Ga0070713_1000021216 | 224 |
| 407 | 3300005436 | Ga0070713_100029017 | Ga0070713_1000290174 | 224 |
| 408 | 3300005436 | Ga0070713_100037336 | Ga0070713_1000373363 | 224 |
| 409 | 3300005436 | Ga0070713_100040170 | Ga0070713_1000401703 | 224 |
| 410 | 3300005436 | Ga0070713_100084638 | Ga0070713_1000846382 | 224 |
| 411 | 3300005436 | Ga0070713_100148407 | Ga0070713_1001484072 | 224 |
| 412 | 3300005436 | Ga0070713_100204515 | Ga0070713_1002045152 | 224 |
| 413 | 3300005436 | Ga0070713_100277423 | Ga0070713_1002774232 | 224 |
| 414 | 3300005436 | Ga0070713_100309252 | Ga0070713_1003092521 | 224 |
| 415 | 3300005436 | Ga0070713_100365107 | Ga0070713_1003651072 | 224 |
| 416 | 3300005437 | Ga0070710_10002568 | Ga0070710_100025688 | 224 |
| 417 | 3300005438 | Ga0070701_10017180 | Ga0070701_100171801 | 224 |
| 418 | 3300005439 | Ga0070711_100015078 | Ga0070711_1000150782 | 224 |
| 419 | 3300005439 | Ga0070711_100176790 | Ga0070711_1001767902 | 224 |
| 420 | 3300005439 | Ga0070711_100279643 | Ga0070711_1002796432 | 224 |
| 421 | 3300005439 | Ga0070711_100569782 | Ga0070711_1005697821 | 224 |
| 422 | 3300005439 | Ga0070711_100590184 | Ga0070711_1005901842 | 224 |
| 423 | 3300005441 | Ga0070700_100312578 | Ga0070700_1003125782 | 224 |
| 424 | 3300005445 | Ga0070708_100000527 | Ga0070708_10000052713 | 224 |
| 425 | 3300005445 | Ga0070708_100001078 | Ga0070708_1000010784 | 224 |
| 426 | 3300005445 | Ga0070708_100013160 | Ga0070708_1000131608 | 224 |
| 427 | 3300005445 | Ga0070708_100035100 | Ga0070708_1000351002 | 224 |
| 428 | 3300005445 | Ga0070708_100055104 | Ga0070708_1000551042 | 224 |
| 429 | 3300005445 | Ga0070708_100066072 | Ga0070708_1000660721 | 224 |
| 430 | 3300005445 | Ga0070708_100114938 | Ga0070708_1001149382 | 224 |
| 431 | 3300005445 | Ga0070708_100206787 | Ga0070708_1002067872 | 224 |
| 432 | 3300005445 | Ga0070708_100357972 | Ga0070708_1003579722 | 224 |
| 433 | 3300005455 | Ga0070663_100032756 | Ga0070663_1000327564 | 224 |
| 434 | 3300005455 | Ga0070663_100589773 | Ga0070663_1005897731 | 224 |
| 435 | 3300005456 | Ga0070678_100355225 | Ga0070678_1003552252 | 224 |
| 436 | 3300005457 | Ga0070662_100225056 | Ga0070662_1002250561 | 224 |
| 437 | 3300005458 | Ga0070681_10000513 | Ga0070681_1000051322 | 224 |
| 438 | 3300005458 | Ga0070681_10001443 | Ga0070681_100014435 | 224 |
| 439 | 3300005458 | Ga0070681_10071265 | Ga0070681_100712654 | 224 |
| 440 | 3300005459 | Ga0068867_100016708 | Ga0068867_1000167085 | 224 |
| 441 | 3300005459 | Ga0068867_100053195 | Ga0068867_1000531952 | 224 |
| 442 | 3300005459 | Ga0068867_100428822 | Ga0068867_1004288222 | 224 |
| 443 | 3300005466 | Ga0070685_10001585 | Ga0070685_100015855 | 224 |
| 444 | 3300005466 | Ga0070685_10238101 | Ga0070685_102381011 | 224 |
| 445 | 3300005467 | Ga0070706_100000991 | Ga0070706_10000099112 | 224 |
| 446 | 3300005467 | Ga0070706_100094200 | Ga0070706_1000942002 | 224 |
| 447 | 3300005467 | Ga0070706_100113003 | Ga0070706_1001130032 | 224 |
| 448 | 3300005467 | Ga0070706_100204128 | Ga0070706_1002041282 | 224 |
| 449 | 3300005468 | Ga0070707_100001774 | Ga0070707_1000017742 | 224 |
| 450 | 3300005468 | Ga0070707_100062473 | Ga0070707_1000624733 | 224 |
| 451 | 3300005468 | Ga0070707_100072935 | Ga0070707_1000729353 | 224 |
| 452 | 3300005468 | Ga0070707_100535678 | Ga0070707_1005356782 | 224 |
| 453 | 3300005468 | Ga0070707_100569754 | Ga0070707_1005697542 | 224 |
| 454 | 3300005471 | Ga0070698_100000182 | Ga0070698_10000018223 | 224 |
| 455 | 3300005471 | Ga0070698_100012583 | Ga0070698_1000125833 | 224 |
| 456 | 3300005471 | Ga0070698_100389727 | Ga0070698_1003897272 | 224 |
| 457 | 3300005471 | Ga0070698_100791264 | Ga0070698_1007912641 | 224 |
| 458 | 3300005518 | Ga0070699_100088406 | Ga0070699_1000884062 | 224 |
| 459 | 3300005530 | Ga0070679_100008087 | Ga0070679_1000080874 | 224 |
| 460 | 3300005530 | Ga0070679_100151665 | Ga0070679_1001516652 | 224 |
| 461 | 3300005535 | Ga0070684_100007581 | Ga0070684_1000075812 | 224 |
| 462 | 3300005535 | Ga0070684_100034929 | Ga0070684_1000349295 | 224 |
| 463 | 3300005535 | Ga0070684_100089161 | Ga0070684_1000891612 | 224 |
| 464 | 3300005535 | Ga0070684_100338931 | Ga0070684_1003389311 | 224 |
| 465 | 3300005536 | Ga0070697_100004056 | Ga0070697_1000040566 | 224 |
| 466 | 3300005536 | Ga0070697_100008463 | Ga0070697_1000084636 | 224 |
| 467 | 3300005536 | Ga0070697_100131291 | Ga0070697_1001312913 | 224 |
| 468 | 3300005536 | Ga0070697_100238772 | Ga0070697_1002387722 | 224 |
| 469 | 3300005536 | Ga0070697_100506852 | Ga0070697_1005068521 | 224 |
| 470 | 3300005539 | Ga0068853_100065061 | Ga0068853_1000650613 | 224 |
| 471 | 3300005539 | Ga0068853_100083675 | Ga0068853_1000836752 | 224 |
| 472 | 3300005539 | Ga0068853_100111845 | Ga0068853_1001118452 | 224 |
| 473 | 3300005539 | Ga0068853_100254637 | Ga0068853_1002546371 | 224 |
| 474 | 3300005543 | Ga0070672_100133123 | Ga0070672_1001331231 | 224 |
| 475 | 3300005543 | Ga0070672_100381838 | Ga0070672_1003818381 | 224 |
| 476 | 3300005544 | Ga0070686_100036014 | Ga0070686_1000360143 | 224 |
| 477 | 3300005547 | Ga0070693_100159312 | Ga0070693_1001593122 | 224 |
| 478 | 3300005547 | Ga0070693_100465557 | Ga0070693_1004655572 | 224 |
| 479 | 3300005563 | Ga0068855_100000412 | Ga0068855_10000041233 | 224 |
| 480 | 3300005563 | Ga0068855_100000425 | Ga0068855_10000042517 | 224 |
| 481 | 3300005563 | Ga0068855_100018276 | Ga0068855_1000182764 | 224 |
| 482 | 3300005563 | Ga0068855_100062777 | Ga0068855_1000627773 | 224 |
| 483 | 3300005564 | Ga0070664_100005786 | Ga0070664_10000578610 | 224 |
| 484 | 3300005564 | Ga0070664_100047341 | Ga0070664_1000473412 | 224 |
| 485 | 3300005564 | Ga0070664_100082144 | Ga0070664_1000821442 | 224 |
| 486 | 3300005577 | Ga0068857_100002572 | Ga0068857_1000025727 | 224 |
| 487 | 3300005577 | Ga0068857_100003408 | Ga0068857_1000034082 | 224 |
| 488 | 3300005577 | Ga0068857_100005929 | Ga0068857_1000059297 | 224 |
| 489 | 3300005577 | Ga0068857_100372991 | Ga0068857_1003729912 | 224 |
| 490 | 3300005577 | Ga0068857_100574953 | Ga0068857_1005749532 | 224 |
| 491 | 3300005578 | Ga0068854_100004475 | Ga0068854_1000044757 | 224 |
| 492 | 3300005578 | Ga0068854_100014550 | Ga0068854_1000145502 | 224 |
| 493 | 3300005578 | Ga0068854_100020751 | Ga0068854_1000207512 | 224 |
| 494 | 3300005614 | Ga0068856_100000670 | Ga0068856_1000006707 | 224 |
| 495 | 3300005614 | Ga0068856_100000708 | Ga0068856_1000007084 | 224 |
| 496 | 3300005614 | Ga0068856_100001577 | Ga0068856_1000015777 | 224 |
| 497 | 3300005614 | Ga0068856_100003544 | Ga0068856_1000035445 | 224 |
| 498 | 3300005614 | Ga0068856_100006243 | Ga0068856_10000624310 | 224 |
| 499 | 3300005614 | Ga0068856_100009111 | Ga0068856_1000091117 | 224 |
| 500 | 3300005614 | Ga0068856_100066387 | Ga0068856_1000663873 | 224 |
| 501 | 3300005614 | Ga0068856_100198992 | Ga0068856_1001989922 | 224 |
| 502 | 3300005614 | Ga0068856_100245198 | Ga0068856_1002451982 | 224 |
| 503 | 3300005614 | Ga0068856_100350195 | Ga0068856_1003501952 | 224 |
| 504 | 3300005615 | Ga0070702_100004396 | Ga0070702_1000043963 | 224 |
| 505 | 3300005615 | Ga0070702_100082649 | Ga0070702_1000826492 | 224 |
| 506 | 3300005616 | Ga0068852_100002637 | Ga0068852_1000026376 | 224 |
| 507 | 3300005616 | Ga0068852_100104839 | Ga0068852_1001048392 | 224 |
| 508 | 3300005616 | Ga0068852_100107391 | Ga0068852_1001073913 | 224 |
| 509 | 3300005616 | Ga0068852_100282013 | Ga0068852_1002820132 | 224 |
| 510 | 3300005617 | Ga0068859_100000279 | Ga0068859_10000027938 | 224 |
| 511 | 3300005617 | Ga0068859_100015855 | Ga0068859_1000158556 | 224 |
| 512 | 3300005617 | Ga0068859_100277541 | Ga0068859_1002775412 | 224 |
| 513 | 3300005618 | Ga0068864_100000722 | Ga0068864_10000072221 | 224 |
| 514 | 3300005618 | Ga0068864_100015807 | Ga0068864_1000158075 | 224 |
| 515 | 3300005618 | Ga0068864_100046245 | Ga0068864_1000462454 | 224 |
| 516 | 3300005718 | Ga0068866_10001418 | Ga0068866_100014183 | 224 |
| 517 | 3300005718 | Ga0068866_10005261 | Ga0068866_100052614 | 224 |
| 518 | 3300005718 | Ga0068866_10008503 | Ga0068866_100085034 | 224 |
| 519 | 3300005719 | Ga0068861_100051927 | Ga0068861_1000519272 | 224 |
| 520 | 3300005719 | Ga0068861_100175545 | Ga0068861_1001755452 | 224 |
| 521 | 3300005834 | Ga0068851_10015362 | Ga0068851_100153622 | 224 |
| 522 | 3300005834 | Ga0068851_10253493 | Ga0068851_102534932 | 224 |
| 523 | 3300005840 | Ga0068870_10003763 | Ga0068870_100037635 | 224 |
| 524 | 3300005840 | Ga0068870_10056296 | Ga0068870_100562962 | 224 |
| 525 | 3300005841 | Ga0068863_100002208 | Ga0068863_10000220813 | 224 |
| 526 | 3300005841 | Ga0068863_100015579 | Ga0068863_1000155792 | 224 |
| 527 | 3300005841 | Ga0068863_100155975 | Ga0068863_1001559752 | 224 |
| 528 | 3300005841 | Ga0068863_100184605 | Ga0068863_1001846052 | 224 |
| 529 | 3300005841 | Ga0068863_100290982 | Ga0068863_1002909822 | 224 |
| 530 | 3300005842 | Ga0068858_100002272 | Ga0068858_1000022722 | 224 |
| 531 | 3300005842 | Ga0068858_100033976 | Ga0068858_1000339765 | 224 |
| 532 | 3300005842 | Ga0068858_100152304 | Ga0068858_1001523042 | 224 |
| 533 | 3300005842 | Ga0068858_100189865 | Ga0068858_1001898652 | 224 |
| 534 | 3300005842 | Ga0068858_100236897 | Ga0068858_1002368972 | 224 |
| 535 | 3300005842 | Ga0068858_100399579 | Ga0068858_1003995792 | 224 |
| 536 | 3300005843 | Ga0068860_100007256 | Ga0068860_1000072569 | 224 |
| 537 | 3300005843 | Ga0068860_100059449 | Ga0068860_1000594492 | 224 |
| 538 | 3300005843 | Ga0068860_100323717 | Ga0068860_1003237172 | 224 |
| 539 | 3300005844 | Ga0068862_100048413 | Ga0068862_1000484132 | 224 |
| 540 | 3300005844 | Ga0068862_100151358 | Ga0068862_1001513583 | 224 |
| 541 | 3300005844 | Ga0068862_100276330 | Ga0068862_1002763302 | 224 |
| 542 | 3300005983 | Ga0081540_1025691 | Ga0081540_10256914 | 224 |
| 543 | 3300006028 | Ga0070717_10000577 | Ga0070717_1000057716 | 224 |
| 544 | 3300006028 | Ga0070717_10003511 | Ga0070717_100035113 | 224 |
| 545 | 3300006028 | Ga0070717_10036520 | Ga0070717_100365202 | 224 |
| 546 | 3300006028 | Ga0070717_10055045 | Ga0070717_100550452 | 224 |
| 547 | 3300006028 | Ga0070717_10094410 | Ga0070717_100944102 | 224 |
| 548 | 3300006028 | Ga0070717_10101727 | Ga0070717_101017273 | 224 |
| 549 | 3300006028 | Ga0070717_10115354 | Ga0070717_101153542 | 224 |
| 550 | 3300006028 | Ga0070717_10198558 | Ga0070717_101985582 | 224 |
| 551 | 3300006028 | Ga0070717_10206549 | Ga0070717_102065492 | 224 |
| 552 | 3300006028 | Ga0070717_10446116 | Ga0070717_104461161 | 224 |
| 553 | 3300006028 | Ga0070717_10516524 | Ga0070717_105165242 | 224 |
| 554 | 3300006028 | Ga0070717_10562457 | Ga0070717_105624571 | 224 |
| 555 | 3300006163 | Ga0070715_10037645 | Ga0070715_100376452 | 224 |
| 556 | 3300006163 | Ga0070715_10042767 | Ga0070715_100427672 | 224 |
| 557 | 3300006173 | Ga0070716_100028903 | Ga0070716_1000289033 | 224 |
| 558 | 3300006173 | Ga0070716_100155304 | Ga0070716_1001553042 | 224 |
| 559 | 3300006173 | Ga0070716_100240696 | Ga0070716_1002406961 | 224 |
| 560 | 3300006175 | Ga0070712_100002033 | Ga0070712_1000020337 | 224 |
| 561 | 3300006175 | Ga0070712_100003822 | Ga0070712_1000038227 | 224 |
| 562 | 3300006175 | Ga0070712_100014441 | Ga0070712_1000144414 | 224 |
| 563 | 3300006175 | Ga0070712_100752610 | Ga0070712_1007526101 | 224 |
| 564 | 3300006237 | Ga0097621_100000210 | Ga0097621_10000021021 | 224 |
| 565 | 3300006237 | Ga0097621_100001848 | Ga0097621_10000184812 | 224 |
| 566 | 3300006237 | Ga0097621_100006416 | Ga0097621_1000064163 | 224 |
| 567 | 3300006237 | Ga0097621_100030212 | Ga0097621_1000302121 | 224 |
| 568 | 3300006237 | Ga0097621_100149672 | Ga0097621_1001496721 | 224 |
| 569 | 3300006237 | Ga0097621_100569956 | Ga0097621_1005699562 | 224 |
| 570 | 3300006358 | Ga0068871_100000168 | Ga0068871_10000016823 | 224 |
| 571 | 3300006358 | Ga0068871_100000745 | Ga0068871_10000074514 | 224 |
| 572 | 3300006358 | Ga0068871_100000787 | Ga0068871_10000078720 | 224 |
| 573 | 3300006358 | Ga0068871_100022428 | Ga0068871_1000224285 | 224 |
| 574 | 3300006358 | Ga0068871_100046525 | Ga0068871_1000465254 | 224 |
| 575 | 3300006358 | Ga0068871_100339426 | Ga0068871_1003394262 | 224 |
| 576 | 3300006358 | Ga0068871_100515283 | Ga0068871_1005152832 | 224 |
| 577 | 3300006852 | Ga0075433_10005922 | Ga0075433_100059228 | 224 |
| 578 | 3300006871 | Ga0075434_100000246 | Ga0075434_10000024615 | 224 |
| 579 | 3300006871 | Ga0075434_100261670 | Ga0075434_1002616702 | 224 |
| 580 | 3300006881 | Ga0068865_100004430 | Ga0068865_1000044302 | 224 |
| 581 | 3300006881 | Ga0068865_100005649 | Ga0068865_1000056495 | 224 |
| 582 | 3300006881 | Ga0068865_100059134 | Ga0068865_1000591342 | 224 |
| 583 | 3300006881 | Ga0068865_100076875 | Ga0068865_1000768752 | 224 |
| 584 | 3300006914 | Ga0075436_100009403 | Ga0075436_1000094032 | 224 |
| 585 | 3300006931 | Ga0097620_100000279 | Ga0097620_10000027938 | 224 |
| 586 | 3300006931 | Ga0097620_100015855 | Ga0097620_1000158556 | 224 |
| 587 | 3300006931 | Ga0097620_100277530 | Ga0097620_1002775302 | 224 |
| 588 | 3300007076 | Ga0075435_100003413 | Ga0075435_1000034137 | 224 |
| 589 | 3300007265 | Ga0099794_10013220 | Ga0099794_100132204 | 224 |
| 590 | 3300007265 | Ga0099794_10027987 | Ga0099794_100279874 | 224 |
| 591 | 3300007265 | Ga0099794_10032987 | Ga0099794_100329873 | 224 |
| 592 | 3300007265 | Ga0099794_10070247 | Ga0099794_100702472 | 224 |
| 593 | 3300007265 | Ga0099794_10312516 | Ga0099794_103125162 | 224 |
| 594 | 3300009092 | Ga0105250_10023835 | Ga0105250_100238352 | 224 |
| 595 | 3300009093 | Ga0105240_10133132 | Ga0105240_101331322 | 224 |
| 596 | 3300009093 | Ga0105240_10142711 | Ga0105240_101427112 | 224 |
| 597 | 3300009093 | Ga0105240_10180234 | Ga0105240_101802342 | 224 |
| 598 | 3300009093 | Ga0105240_10198550 | Ga0105240_101985503 | 224 |
| 599 | 3300009093 | Ga0105240_10234012 | Ga0105240_102340121 | 224 |
| 600 | 3300009094 | Ga0111539_10296716 | Ga0111539_102967162 | 224 |
| 601 | 3300009098 | Ga0105245_10005402 | Ga0105245_100054022 | 224 |
| 602 | 3300009098 | Ga0105245_10006763 | Ga0105245_100067638 | 224 |
| 603 | 3300009098 | Ga0105245_10040838 | Ga0105245_100408382 | 224 |
| 604 | 3300009098 | Ga0105245_10056423 | Ga0105245_100564233 | 224 |
| 605 | 3300009101 | Ga0105247_10009853 | Ga0105247_100098532 | 224 |
| 606 | 3300009147 | Ga0114129_10069552 | Ga0114129_100695524 | 224 |
| 607 | 3300009174 | Ga0105241_10003965 | Ga0105241_100039653 | 224 |
| 608 | 3300009174 | Ga0105241_10009776 | Ga0105241_100097766 | 224 |
| 609 | 3300009174 | Ga0105241_10014319 | Ga0105241_100143193 | 224 |
| 610 | 3300009174 | Ga0105241_10080020 | Ga0105241_100800204 | 224 |
| 611 | 3300009174 | Ga0105241_10417172 | Ga0105241_104171722 | 224 |
| 612 | 3300009176 | Ga0105242_10093037 | Ga0105242_100930372 | 224 |
| 613 | 3300009176 | Ga0105242_10296485 | Ga0105242_102964852 | 224 |
| 614 | 3300009176 | Ga0105242_10329709 | Ga0105242_103297092 | 224 |
| 615 | 3300009177 | Ga0105248_10075041 | Ga0105248_100750414 | 224 |
| 616 | 3300009177 | Ga0105248_10111193 | Ga0105248_101111932 | 224 |
| 617 | 3300009177 | Ga0105248_10279014 | Ga0105248_102790142 | 224 |
| 618 | 3300009177 | Ga0105248_10498440 | Ga0105248_104984402 | 224 |
| 619 | 3300009177 | Ga0105248_10703549 | Ga0105248_107035492 | 224 |
| 620 | 3300009545 | Ga0105237_10050649 | Ga0105237_100506492 | 224 |
| 621 | 3300009545 | Ga0105237_10052099 | Ga0105237_100520993 | 224 |
| 622 | 3300009545 | Ga0105237_10166347 | Ga0105237_101663472 | 224 |
| 623 | 3300009545 | Ga0105237_10252481 | Ga0105237_102524812 | 224 |
| 624 | 3300009551 | Ga0105238_10000382 | Ga0105238_1000038232 | 224 |
| 625 | 3300009551 | Ga0105238_10038278 | Ga0105238_100382783 | 224 |
| 626 | 3300009551 | Ga0105238_10056428 | Ga0105238_100564282 | 224 |
| 627 | 3300009553 | Ga0105249_10002069 | Ga0105249_1000206914 | 224 |
| 628 | 3300009553 | Ga0105249_10027251 | Ga0105249_100272512 | 224 |
| 629 | 3300010159 | Ga0099796_10089984 | Ga0099796_100899842 | 224 |
| 630 | 3300010375 | Ga0105239_10008900 | Ga0105239_100089002 | 224 |
| 631 | 3300010375 | Ga0105239_10025445 | Ga0105239_100254453 | 224 |
| 632 | 3300010375 | Ga0105239_10071895 | Ga0105239_100718952 | 224 |
| 633 | 3300010375 | Ga0105239_10252226 | Ga0105239_102522262 | 224 |
| 634 | 3300010375 | Ga0105239_10276784 | Ga0105239_102767842 | 224 |
| 635 | 3300010375 | Ga0105239_10586432 | Ga0105239_105864322 | 224 |
| 636 | 3300011119 | Ga0105246_10005905 | Ga0105246_100059055 | 224 |
| 637 | 3300013100 | Ga0157373_10001551 | Ga0157373_100015518 | 224 |
| 638 | 3300013100 | Ga0157373_10002773 | Ga0157373_100027737 | 224 |
| 639 | 3300013100 | Ga0157373_10037161 | Ga0157373_100371614 | 224 |
| 640 | 3300013102 | Ga0157371_10002011 | Ga0157371_100020118 | 224 |
| 641 | 3300013102 | Ga0157371_10091878 | Ga0157371_100918782 | 224 |
| 642 | 3300013104 | Ga0157370_10041226 | Ga0157370_100412264 | 224 |
| 643 | 3300013104 | Ga0157370_10041413 | Ga0157370_100414132 | 224 |
| 644 | 3300013104 | Ga0157370_10386571 | Ga0157370_103865712 | 224 |
| 645 | 3300013104 | Ga0157370_10460855 | Ga0157370_104608552 | 224 |
| 646 | 3300013105 | Ga0157369_10000269 | Ga0157369_1000026942 | 224 |
| 647 | 3300013105 | Ga0157369_10005474 | Ga0157369_100054749 | 224 |
| 648 | 3300013105 | Ga0157369_10006683 | Ga0157369_100066835 | 224 |
| 649 | 3300013105 | Ga0157369_10011776 | Ga0157369_100117764 | 224 |
| 650 | 3300013105 | Ga0157369_10032265 | Ga0157369_100322652 | 224 |
| 651 | 3300013105 | Ga0157369_10252497 | Ga0157369_102524972 | 224 |
| 652 | 3300013296 | Ga0157374_10000436 | Ga0157374_1000043623 | 224 |
| 653 | 3300013296 | Ga0157374_10001029 | Ga0157374_1000102923 | 224 |
| 654 | 3300013296 | Ga0157374_10001822 | Ga0157374_1000182218 | 224 |
| 655 | 3300013296 | Ga0157374_10034779 | Ga0157374_100347795 | 224 |
| 656 | 3300013296 | Ga0157374_10223184 | Ga0157374_102231841 | 224 |
| 657 | 3300013296 | Ga0157374_10269873 | Ga0157374_102698731 | 224 |
| 658 | 3300013297 | Ga0157378_10000014 | Ga0157378_1000001438 | 224 |
| 659 | 3300013297 | Ga0157378_10000344 | Ga0157378_1000034434 | 224 |
| 660 | 3300013297 | Ga0157378_10000413 | Ga0157378_1000041322 | 224 |
| 661 | 3300013297 | Ga0157378_10007193 | Ga0157378_100071934 | 224 |
| 662 | 3300013297 | Ga0157378_10047597 | Ga0157378_100475973 | 224 |
| 663 | 3300013297 | Ga0157378_10084794 | Ga0157378_100847943 | 224 |
| 664 | 3300013306 | Ga0163162_10004542 | Ga0163162_100045425 | 224 |
| 665 | 3300013306 | Ga0163162_10048955 | Ga0163162_100489553 | 224 |
| 666 | 3300013306 | Ga0163162_10092562 | Ga0163162_100925623 | 224 |
| 667 | 3300013306 | Ga0163162_10370132 | Ga0163162_103701322 | 224 |
| 668 | 3300013306 | Ga0163162_10505475 | Ga0163162_105054752 | 224 |
| 669 | 3300013306 | Ga0163162_11105459 | Ga0163162_111054591 | 224 |
| 670 | 3300013307 | Ga0157372_10000423 | Ga0157372_1000042323 | 224 |
| 671 | 3300013307 | Ga0157372_10000641 | Ga0157372_100006417 | 224 |
| 672 | 3300013307 | Ga0157372_10004039 | Ga0157372_100040397 | 224 |
| 673 | 3300013307 | Ga0157372_10015715 | Ga0157372_100157153 | 224 |
| 674 | 3300013307 | Ga0157372_10016602 | Ga0157372_100166023 | 224 |
| 675 | 3300013307 | Ga0157372_10022824 | Ga0157372_100228242 | 224 |
| 676 | 3300013307 | Ga0157372_10062666 | Ga0157372_100626663 | 224 |
| 677 | 3300013307 | Ga0157372_10198939 | Ga0157372_101989392 | 224 |
| 678 | 3300013308 | Ga0157375_10044150 | Ga0157375_100441503 | 224 |
| 679 | 3300014325 | Ga0163163_10026605 | Ga0163163_100266052 | 224 |
| 680 | 3300014325 | Ga0163163_10027299 | Ga0163163_100272992 | 224 |
| 681 | 3300014325 | Ga0163163_10386177 | Ga0163163_103861772 | 224 |
| 682 | 3300014497 | Ga0182008_10009750 | Ga0182008_100097503 | 224 |
| 683 | 3300014745 | Ga0157377_10023683 | Ga0157377_100236833 | 224 |
| 684 | 3300014745 | Ga0157377_10166543 | Ga0157377_101665432 | 224 |
| 685 | 3300014745 | Ga0157377_10438598 | Ga0157377_104385981 | 224 |
| 686 | 3300014968 | Ga0157379_10031809 | Ga0157379_100318095 | 224 |
| 687 | 3300014968 | Ga0157379_10035204 | Ga0157379_100352044 | 224 |
| 688 | 3300014968 | Ga0157379_10291860 | Ga0157379_102918602 | 224 |
| 689 | 3300014969 | Ga0157376_10014425 | Ga0157376_100144255 | 224 |
| 690 | 3300014969 | Ga0157376_10045515 | Ga0157376_100455153 | 224 |
| 691 | 3300014969 | Ga0157376_10071439 | Ga0157376_100714392 | 224 |
| 692 | 3300015262 | Ga0182007_10014472 | Ga0182007_100144723 | 224 |
| 693 | 3300022730 | Ga0224570_100631 | Ga0224570_1006312 | 224 |
| 694 | 3300022732 | Ga0224569_100133 | Ga0224569_1001332 | 224 |
| 695 | 3300024225 | Ga0224572_1000066 | Ga0224572_10000663 | 224 |
| 696 | 3300024225 | Ga0224572_1001114 | Ga0224572_10011143 | 224 |
| 697 | 3300024225 | Ga0224572_1009514 | Ga0224572_10095142 | 224 |
| 698 | 3300024227 | Ga0228598_1001112 | Ga0228598_10011123 | 224 |
| 699 | 3300025315 | Ga0207697_10002788 | Ga0207697_100027883 | 224 |
| 700 | 3300025321 | Ga0207656_10130194 | Ga0207656_101301942 | 224 |
| 701 | 3300025898 | Ga0207692_10010221 | Ga0207692_100102214 | 224 |
| 702 | 3300025899 | Ga0207642_10002117 | Ga0207642_100021176 | 224 |
| 703 | 3300025899 | Ga0207642_10014622 | Ga0207642_100146224 | 224 |
| 704 | 3300025900 | Ga0207710_10085390 | Ga0207710_100853902 | 224 |
| 705 | 3300025901 | Ga0207688_10019381 | Ga0207688_100193814 | 224 |
| 706 | 3300025903 | Ga0207680_10044690 | Ga0207680_100446902 | 224 |
| 707 | 3300025903 | Ga0207680_10330027 | Ga0207680_103300272 | 224 |
| 708 | 3300025904 | Ga0207647_10001477 | Ga0207647_100014772 | 224 |
| 709 | 3300025904 | Ga0207647_10006683 | Ga0207647_100066837 | 224 |
| 710 | 3300025904 | Ga0207647_10022413 | Ga0207647_100224134 | 224 |
| 711 | 3300025905 | Ga0207685_10072896 | Ga0207685_100728962 | 224 |
| 712 | 3300025906 | Ga0207699_10018440 | Ga0207699_100184403 | 224 |
| 713 | 3300025906 | Ga0207699_10058663 | Ga0207699_100586632 | 224 |
| 714 | 3300025906 | Ga0207699_10108927 | Ga0207699_101089272 | 224 |
| 715 | 3300025906 | Ga0207699_10373471 | Ga0207699_103734712 | 224 |
| 716 | 3300025907 | Ga0207645_10000181 | Ga0207645_1000018124 | 224 |
| 717 | 3300025908 | Ga0207643_10000474 | Ga0207643_100004749 | 224 |
| 718 | 3300025908 | Ga0207643_10097731 | Ga0207643_100977312 | 224 |
| 719 | 3300025909 | Ga0207705_10255787 | Ga0207705_102557872 | 224 |
| 720 | 3300025910 | Ga0207684_10001275 | Ga0207684_1000127516 | 224 |
| 721 | 3300025910 | Ga0207684_10081331 | Ga0207684_100813312 | 224 |
| 722 | 3300025910 | Ga0207684_10178688 | Ga0207684_101786882 | 224 |
| 723 | 3300025911 | Ga0207654_10002582 | Ga0207654_100025826 | 224 |
| 724 | 3300025911 | Ga0207654_10014318 | Ga0207654_100143183 | 224 |
| 725 | 3300025911 | Ga0207654_10123841 | Ga0207654_101238412 | 224 |
| 726 | 3300025912 | Ga0207707_10000828 | Ga0207707_1000082811 | 224 |
| 727 | 3300025912 | Ga0207707_10038831 | Ga0207707_100388314 | 224 |
| 728 | 3300025912 | Ga0207707_10081955 | Ga0207707_100819552 | 224 |
| 729 | 3300025912 | Ga0207707_10099151 | Ga0207707_100991512 | 224 |
| 730 | 3300025913 | Ga0207695_10077718 | Ga0207695_100777181 | 224 |
| 731 | 3300025913 | Ga0207695_10171125 | Ga0207695_101711252 | 224 |
| 732 | 3300025913 | Ga0207695_10323787 | Ga0207695_103237872 | 224 |
| 733 | 3300025914 | Ga0207671_10070131 | Ga0207671_100701313 | 224 |
| 734 | 3300025914 | Ga0207671_10131435 | Ga0207671_101314352 | 224 |
| 735 | 3300025914 | Ga0207671_10156068 | Ga0207671_101560682 | 224 |
| 736 | 3300025914 | Ga0207671_10464186 | Ga0207671_104641861 | 224 |
| 737 | 3300025915 | Ga0207693_10000090 | Ga0207693_1000009026 | 224 |
| 738 | 3300025915 | Ga0207693_10000621 | Ga0207693_100006212 | 224 |
| 739 | 3300025915 | Ga0207693_10013135 | Ga0207693_100131352 | 224 |
| 740 | 3300025915 | Ga0207693_10037643 | Ga0207693_100376433 | 224 |
| 741 | 3300025915 | Ga0207693_10107683 | Ga0207693_101076833 | 224 |
| 742 | 3300025916 | Ga0207663_10033068 | Ga0207663_100330684 | 224 |
| 743 | 3300025916 | Ga0207663_10034666 | Ga0207663_100346662 | 224 |
| 744 | 3300025916 | Ga0207663_10149945 | Ga0207663_101499453 | 224 |
| 745 | 3300025916 | Ga0207663_10489488 | Ga0207663_104894881 | 224 |
| 746 | 3300025917 | Ga0207660_10185955 | Ga0207660_101859552 | 224 |
| 747 | 3300025918 | Ga0207662_10001688 | Ga0207662_100016885 | 224 |
| 748 | 3300025919 | Ga0207657_10005643 | Ga0207657_100056434 | 224 |
| 749 | 3300025919 | Ga0207657_10007963 | Ga0207657_100079637 | 224 |
| 750 | 3300025920 | Ga0207649_10000343 | Ga0207649_1000034329 | 224 |
| 751 | 3300025921 | Ga0207652_10120800 | Ga0207652_101208002 | 224 |
| 752 | 3300025922 | Ga0207646_10002760 | Ga0207646_100027608 | 224 |
| 753 | 3300025922 | Ga0207646_10007451 | Ga0207646_100074513 | 224 |
| 754 | 3300025922 | Ga0207646_10039981 | Ga0207646_100399813 | 224 |
| 755 | 3300025922 | Ga0207646_10103730 | Ga0207646_101037303 | 224 |
| 756 | 3300025923 | Ga0207681_10020312 | Ga0207681_100203123 | 224 |
| 757 | 3300025924 | Ga0207694_10000430 | Ga0207694_1000043014 | 224 |
| 758 | 3300025924 | Ga0207694_10043179 | Ga0207694_100431793 | 224 |
| 759 | 3300025925 | Ga0207650_10000223 | Ga0207650_1000022324 | 224 |
| 760 | 3300025925 | Ga0207650_10000224 | Ga0207650_1000022413 | 224 |
| 761 | 3300025925 | Ga0207650_10000296 | Ga0207650_1000029613 | 224 |
| 762 | 3300025925 | Ga0207650_10001691 | Ga0207650_100016919 | 224 |
| 763 | 3300025925 | Ga0207650_10289026 | Ga0207650_102890262 | 224 |
| 764 | 3300025926 | Ga0207659_10470005 | Ga0207659_104700052 | 224 |
| 765 | 3300025927 | Ga0207687_10017030 | Ga0207687_100170305 | 224 |
| 766 | 3300025927 | Ga0207687_10385996 | Ga0207687_103859962 | 224 |
| 767 | 3300025928 | Ga0207700_10002203 | Ga0207700_100022032 | 224 |
| 768 | 3300025928 | Ga0207700_10072614 | Ga0207700_100726144 | 224 |
| 769 | 3300025928 | Ga0207700_10073782 | Ga0207700_100737822 | 224 |
| 770 | 3300025928 | Ga0207700_10105374 | Ga0207700_101053743 | 224 |
| 771 | 3300025928 | Ga0207700_10180398 | Ga0207700_101803982 | 224 |
| 772 | 3300025928 | Ga0207700_10255170 | Ga0207700_102551702 | 224 |
| 773 | 3300025928 | Ga0207700_10287849 | Ga0207700_102878492 | 224 |
| 774 | 3300025928 | Ga0207700_10298476 | Ga0207700_102984762 | 224 |
| 775 | 3300025928 | Ga0207700_10359701 | Ga0207700_103597012 | 224 |
| 776 | 3300025928 | Ga0207700_10360539 | Ga0207700_103605391 | 224 |
| 777 | 3300025928 | Ga0207700_10405700 | Ga0207700_104057002 | 224 |
| 778 | 3300025928 | Ga0207700_10650271 | Ga0207700_106502711 | 224 |
| 779 | 3300025929 | Ga0207664_10002844 | Ga0207664_100028448 | 224 |
| 780 | 3300025929 | Ga0207664_10011335 | Ga0207664_100113354 | 224 |
| 781 | 3300025929 | Ga0207664_10241814 | Ga0207664_102418142 | 224 |
| 782 | 3300025931 | Ga0207644_10007871 | Ga0207644_100078716 | 224 |
| 783 | 3300025931 | Ga0207644_10108673 | Ga0207644_101086732 | 224 |
| 784 | 3300025932 | Ga0207690_10033784 | Ga0207690_100337842 | 224 |
| 785 | 3300025932 | Ga0207690_10317592 | Ga0207690_103175922 | 224 |
| 786 | 3300025932 | Ga0207690_10358566 | Ga0207690_103585661 | 224 |
| 787 | 3300025933 | Ga0207706_10000613 | Ga0207706_1000061316 | 224 |
| 788 | 3300025933 | Ga0207706_10015847 | Ga0207706_100158473 | 224 |
| 789 | 3300025934 | Ga0207686_10126583 | Ga0207686_101265832 | 224 |
| 790 | 3300025936 | Ga0207670_10181872 | Ga0207670_101818722 | 224 |
| 791 | 3300025936 | Ga0207670_10320786 | Ga0207670_103207861 | 224 |
| 792 | 3300025938 | Ga0207704_10054816 | Ga0207704_100548162 | 224 |
| 793 | 3300025938 | Ga0207704_10080675 | Ga0207704_100806753 | 224 |
| 794 | 3300025938 | Ga0207704_10494860 | Ga0207704_104948602 | 224 |
| 795 | 3300025939 | Ga0207665_10047330 | Ga0207665_100473302 | 224 |
| 796 | 3300025939 | Ga0207665_10083112 | Ga0207665_100831123 | 224 |
| 797 | 3300025940 | Ga0207691_10000345 | Ga0207691_1000034524 | 224 |
| 798 | 3300025940 | Ga0207691_10296071 | Ga0207691_102960711 | 224 |
| 799 | 3300025941 | Ga0207711_10125650 | Ga0207711_101256502 | 224 |
| 800 | 3300025941 | Ga0207711_10248782 | Ga0207711_102487822 | 224 |
| 801 | 3300025942 | Ga0207689_10000499 | Ga0207689_100004999 | 224 |
| 802 | 3300025942 | Ga0207689_10001621 | Ga0207689_1000162114 | 224 |
| 803 | 3300025942 | Ga0207689_10063023 | Ga0207689_100630232 | 224 |
| 804 | 3300025944 | Ga0207661_10001212 | Ga0207661_1000121214 | 224 |
| 805 | 3300025944 | Ga0207661_10161297 | Ga0207661_101612972 | 224 |
| 806 | 3300025945 | Ga0207679_10000115 | Ga0207679_1000011538 | 224 |
| 807 | 3300025945 | Ga0207679_10001482 | Ga0207679_100014829 | 224 |
| 808 | 3300025949 | Ga0207667_10000311 | Ga0207667_1000031117 | 224 |
| 809 | 3300025949 | Ga0207667_10005374 | Ga0207667_1000537413 | 224 |
| 810 | 3300025949 | Ga0207667_10028850 | Ga0207667_100288506 | 224 |
| 811 | 3300025949 | Ga0207667_10113360 | Ga0207667_101133602 | 224 |
| 812 | 3300025949 | Ga0207667_10142497 | Ga0207667_101424972 | 224 |
| 813 | 3300025949 | Ga0207667_10537447 | Ga0207667_105374471 | 224 |
| 814 | 3300025949 | Ga0207667_10723811 | Ga0207667_107238112 | 224 |
| 815 | 3300025949 | Ga0207667_10964156 | Ga0207667_109641561 | 224 |
| 816 | 3300025960 | Ga0207651_10003483 | Ga0207651_100034836 | 224 |
| 817 | 3300025961 | Ga0207712_10051568 | Ga0207712_100515684 | 224 |
| 818 | 3300025972 | Ga0207668_10103914 | Ga0207668_101039141 | 224 |
| 819 | 3300025981 | Ga0207640_10003104 | Ga0207640_100031047 | 224 |
| 820 | 3300025981 | Ga0207640_10030028 | Ga0207640_100300283 | 224 |
| 821 | 3300025981 | Ga0207640_10159412 | Ga0207640_101594122 | 224 |
| 822 | 3300025981 | Ga0207640_10363623 | Ga0207640_103636231 | 224 |
| 823 | 3300025981 | Ga0207640_10505528 | Ga0207640_105055281 | 224 |
| 824 | 3300025986 | Ga0207658_10007316 | Ga0207658_100073166 | 224 |
| 825 | 3300025986 | Ga0207658_10393707 | Ga0207658_103937072 | 224 |
| 826 | 3300026023 | Ga0207677_10002452 | Ga0207677_100024529 | 224 |
| 827 | 3300026023 | Ga0207677_10017631 | Ga0207677_100176314 | 224 |
| 828 | 3300026023 | Ga0207677_10053564 | Ga0207677_100535642 | 224 |
| 829 | 3300026023 | Ga0207677_10055683 | Ga0207677_100556834 | 224 |
| 830 | 3300026023 | Ga0207677_10569747 | Ga0207677_105697471 | 224 |
| 831 | 3300026023 | Ga0207677_10593511 | Ga0207677_105935112 | 224 |
| 832 | 3300026035 | Ga0207703_10001667 | Ga0207703_100016672 | 224 |
| 833 | 3300026035 | Ga0207703_10006667 | Ga0207703_100066677 | 224 |
| 834 | 3300026035 | Ga0207703_10067935 | Ga0207703_100679353 | 224 |
| 835 | 3300026035 | Ga0207703_10365821 | Ga0207703_103658212 | 224 |
| 836 | 3300026035 | Ga0207703_10712240 | Ga0207703_107122402 | 224 |
| 837 | 3300026041 | Ga0207639_10092099 | Ga0207639_100920992 | 224 |
| 838 | 3300026041 | Ga0207639_11077881 | Ga0207639_110778811 | 224 |
| 839 | 3300026067 | Ga0207678_10000130 | Ga0207678_1000013024 | 224 |
| 840 | 3300026075 | Ga0207708_10375804 | Ga0207708_103758042 | 224 |
| 841 | 3300026078 | Ga0207702_10000722 | Ga0207702_1000072213 | 224 |
| 842 | 3300026078 | Ga0207702_10001654 | Ga0207702_1000165418 | 224 |
| 843 | 3300026078 | Ga0207702_10002343 | Ga0207702_100023437 | 224 |
| 844 | 3300026078 | Ga0207702_10002543 | Ga0207702_100025435 | 224 |
| 845 | 3300026078 | Ga0207702_10070027 | Ga0207702_100700272 | 224 |
| 846 | 3300026078 | Ga0207702_10070347 | Ga0207702_100703473 | 224 |
| 847 | 3300026078 | Ga0207702_10176331 | Ga0207702_101763312 | 224 |
| 848 | 3300026078 | Ga0207702_10184663 | Ga0207702_101846631 | 224 |
| 849 | 3300026078 | Ga0207702_10196100 | Ga0207702_101961002 | 224 |
| 850 | 3300026078 | Ga0207702_10839055 | Ga0207702_108390552 | 224 |
| 851 | 3300026088 | Ga0207641_10000287 | Ga0207641_1000028724 | 224 |
| 852 | 3300026088 | Ga0207641_10002584 | Ga0207641_1000258410 | 224 |
| 853 | 3300026088 | Ga0207641_10031067 | Ga0207641_100310676 | 224 |
| 854 | 3300026088 | Ga0207641_10111882 | Ga0207641_101118823 | 224 |
| 855 | 3300026088 | Ga0207641_10141200 | Ga0207641_101412002 | 224 |
| 856 | 3300026088 | Ga0207641_10305177 | Ga0207641_103051772 | 224 |
| 857 | 3300026089 | Ga0207648_10001253 | Ga0207648_1000125323 | 224 |
| 858 | 3300026089 | Ga0207648_10159247 | Ga0207648_101592472 | 224 |
| 859 | 3300026095 | Ga0207676_10000115 | Ga0207676_1000011519 | 224 |
| 860 | 3300026095 | Ga0207676_10003051 | Ga0207676_1000305112 | 224 |
| 861 | 3300026095 | Ga0207676_10035713 | Ga0207676_100357132 | 224 |
| 862 | 3300026095 | Ga0207676_10412252 | Ga0207676_104122522 | 224 |
| 863 | 3300026116 | Ga0207674_10000788 | Ga0207674_100007885 | 224 |
| 864 | 3300026116 | Ga0207674_10001340 | Ga0207674_1000134019 | 224 |
| 865 | 3300026116 | Ga0207674_10007893 | Ga0207674_100078937 | 224 |
| 866 | 3300026116 | Ga0207674_10487679 | Ga0207674_104876792 | 224 |
| 867 | 3300026116 | Ga0207674_10586096 | Ga0207674_105860962 | 224 |
| 868 | 3300026121 | Ga0207683_10000217 | Ga0207683_1000021725 | 224 |
| 869 | 3300026121 | Ga0207683_10291083 | Ga0207683_102910832 | 224 |
| 870 | 3300026142 | Ga0207698_10101020 | Ga0207698_101010203 | 224 |
| 871 | 3300026142 | Ga0207698_10149736 | Ga0207698_101497362 | 224 |
| 872 | 3300026142 | Ga0207698_10199580 | Ga0207698_101995802 | 224 |
| 873 | 3300026142 | Ga0207698_10447055 | Ga0207698_104470551 | 224 |
| 874 | 3300027512 | Ga0209179_1043846 | Ga0209179_10438461 | 224 |
| 875 | 3300027671 | Ga0209588_1016400 | Ga0209588_10164002 | 224 |
| 876 | 3300027671 | Ga0209588_1070111 | Ga0209588_10701112 | 224 |
| 877 | 3300028017 | Ga0265356_1000344 | Ga0265356_10003449 | 224 |
| 878 | 3300028379 | Ga0268266_10000761 | Ga0268266_1000076116 | 224 |
| 879 | 3300028380 | Ga0268265_10073055 | Ga0268265_100730552 | 224 |
| 880 | 3300028380 | Ga0268265_10296460 | Ga0268265_102964602 | 224 |
| 881 | 3300028381 | Ga0268264_10004971 | Ga0268264_100049713 | 224 |
| 882 | 3300028381 | Ga0268264_10044778 | Ga0268264_100447782 | 224 |
| 883 | 3300028381 | Ga0268264_10046056 | Ga0268264_100460564 | 224 |
| 884 | 3300028381 | Ga0268264_10257370 | Ga0268264_102573702 | 224 |
| 885 | 3300028800 | Ga0265338_10001801 | Ga0265338_1000180120 | 224 |
| 886 | 3300028800 | Ga0265338_10010396 | Ga0265338_100103963 | 224 |
| 887 | 3300028800 | Ga0265338_10080138 | Ga0265338_100801383 | 224 |
| 888 | 3300028800 | Ga0265338_10132286 | Ga0265338_101322863 | 224 |
| 889 | 3300028800 | Ga0265338_10241360 | Ga0265338_102413602 | 224 |
| 890 | 3300028800 | Ga0265338_10274634 | Ga0265338_102746342 | 224 |
| 891 | 3300030760 | Ga0265762_1004236 | Ga0265762_10042362 | 224 |
| 892 | 3300030760 | Ga0265762_1006001 | Ga0265762_10060012 | 224 |
| 893 | 3300030760 | Ga0265762_1015555 | Ga0265762_10155552 | 224 |
| 894 | 3300030760 | Ga0265762_1025991 | Ga0265762_10259912 | 224 |
| 895 | 3300031090 | Ga0265760_10000242 | Ga0265760_100002422 | 224 |
| 896 | 3300031090 | Ga0265760_10005419 | Ga0265760_100054193 | 224 |
| 897 | 3300031090 | Ga0265760_10018276 | Ga0265760_100182761 | 224 |
| 898 | 3300031090 | Ga0265760_10058968 | Ga0265760_100589681 | 224 |
| 899 | 3300031235 | Ga0265330_10036864 | Ga0265330_100368643 | 224 |
| 900 | 3300031238 | Ga0265332_10071679 | Ga0265332_100716792 | 224 |
| 901 | 3300031241 | Ga0265325_10015495 | Ga0265325_100154954 | 224 |
| 902 | 3300031241 | Ga0265325_10045920 | Ga0265325_100459202 | 224 |
| 903 | 3300031249 | Ga0265339_10014422 | Ga0265339_100144223 | 224 |
| 904 | 3300031249 | Ga0265339_10051746 | Ga0265339_100517461 | 224 |
| 905 | 3300031249 | Ga0265339_10092440 | Ga0265339_100924402 | 224 |
| 906 | 3300031344 | Ga0265316_10043022 | Ga0265316_100430223 | 224 |
| 907 | 3300031344 | Ga0265316_10450132 | Ga0265316_104501321 | 224 |
| 908 | 3300031711 | Ga0265314_10009028 | Ga0265314_100090283 | 224 |
| 909 | 3300031711 | Ga0265314_10108988 | Ga0265314_101089881 | 224 |
| 910 | 3300033545 | Ga0316214_1005106 | Ga0316214_10051062 | 224 |
| 911 | 3300033547 | Ga0316212_1006527 | Ga0316212_10065272 | 224 |
| 912 | 3300035083 | Ga0373926_0005361 | Ga0373926_0005361_2706_3380 | 224 |
| 913 | 3300035085 | Ga0373929_0020694 | Ga0373929_0020694_12_686 | 224 |
| 914 | 3300035089 | Ga0373944_0049754 | Ga0373944_0049754_520_1194 | 224 |
| 915 | 3300035113 | Ga0373936_0004614 | Ga0373936_0004614_3343_4017 | 224 |
| 916 | 3300035113 | Ga0373936_0063311 | Ga0373936_0063311_769_1449 | 224 |
| 917 | 3300035118 | Ga0373954_0192457 | Ga0373954_0192457_44_718 | 224 |
| 918 | 3300035119 | Ga0373956_0121472 | Ga0373956_0121472_505_1197 | 224 |
| 919 | 3300035120 | Ga0373957_0086822 | Ga0373957_0086822_187_870 | 224 |
| 920 | 3300035170 | Ga0373943_0052087 | Ga0373943_0052087_30_704 | 224 |
| 921 | 3300035170 | Ga0373943_0054311 | Ga0373943_0054311_1107_1781 | 224 |
| 922 | 3300035170 | Ga0373943_0209225 | Ga0373943_0209225_120_803 | 224 |
| 923 | 3300035170 | Ga0373943_0298164 | Ga0373943_0298164_122_796 | 224 |
| 924 | 3300035171 | Ga0373946_0010395 | Ga0373946_0010395_511_1194 | 224 |
| 925 | 3300035172 | Ga0373955_0042548 | Ga0373955_0042548_306_989 | 224 |
| 926 | 3300035691 | Ga0373931_0309897 | Ga0373931_0309897_229_903 | 224 |
| 927 | 3300035692 | Ga0373935_0033631 | Ga0373935_0033631_2094_2774 | 224 |
| 928 | 3300035692 | Ga0373935_0035710 | Ga0373935_0035710_438_1112 | 224 |
| 929 | 3300035692 | Ga0373935_0079637 | Ga0373935_0079637_772_1452 | 224 |
| 930 | 3300035692 | Ga0373935_0696763 | Ga0373935_0696763_41_715 | 224 |
| 931 | 3300035695 | Ga0373927_0003975 | Ga0373927_0003975_195_869 | 224 |
| 932 | 3300035695 | Ga0373927_0015301 | Ga0373927_0015301_4034_4708 | 224 |
| 933 | 3300035695 | Ga0373927_0074146 | Ga0373927_0074146_264_947 | 224 |
| 934 | 3300035724 | Ga0373933_0040395 | Ga0373933_0040395_727_1419 | 224 |
| 935 | 3300035724 | Ga0373933_0046243 | Ga0373933_0046243_586_1269 | 224 |
| 936 | 3300035725 | Ga0373947_0001950 | Ga0373947_0001950_11670_12344 | 224 |
| 937 | 3300035725 | Ga0373947_0046121 | Ga0373947_0046121_155_835 | 224 |
| 938 | 3300035725 | Ga0373947_0097458 | Ga0373947_0097458_462_1136 | 224 |
| 939 | 3300035725 | Ga0373947_0336867 | Ga0373947_0336867_297_980 | 224 |
| 940 | 3300035725 | Ga0373947_0339554 | Ga0373947_0339554_28_702 | 224 |
| 941 | 3300036401 | Ga0373937_0018254 | Ga0373937_0018254_940_1614 | 224 |
| 942 | 3300036401 | Ga0373937_0094316 | Ga0373937_0094316_1081_1773 | 224 |
| 943 | 3300036401 | Ga0373937_0406085 | Ga0373937_0406085_426_1109 | 224 |
| 944 | 3300036401 | Ga0373937_0922139 | Ga0373937_0922139_59_751 | 224 |
| 945 | 3300037068 | Ga0373925_0017686 | Ga0373925_0017686_3327_4007 | 224 |
| 946 | 3300037068 | Ga0373925_0018110 | Ga0373925_0018110_919_1593 | 224 |
| 947 | 3300037068 | Ga0373925_0023470 | Ga0373925_0023470_474_1148 | 224 |
| 948 | 3300037068 | Ga0373925_0054200 | Ga0373925_0054200_932_1606 | 224 |
| 949 | 3300039437 | Ga0436365_1849740 | Ga0436365_1849740_426_1109 | 224 |
| 950 | 3300039450 | Ga0436363_1709607 | Ga0436363_1709607_671_1354 | 224 |
| 951 | 3300039453 | Ga0436362_1117608 | Ga0436362_1117608_90_764 | 224 |
| 952 | 3300045051 | Ga0451576_0165440 | Ga0451576_0165440_174_848 | 224 |
| 953 | 3300045051 | Ga0451576_0635259 | Ga0451576_0635259_254_928 | 224 |
| 954 | 3300045051 | Ga0451576_1312526 | Ga0451576_1312526_47_721 | 224 |
| 955 | 3300045976 | Ga0466967_0119894 | Ga0466967_0119894_1551_2225 | 224 |
| 956 | 3300046459 | Ga0495629_0020122 | Ga0495629_0020122_1980_2660 | 224 |
| 957 | 3300046472 | Ga0495580_0000074 | Ga0495580_0000074_28111_28791 | 224 |
| 958 | 3300046472 | Ga0495580_0005142 | Ga0495580_0005142_3961_4635 | 224 |
| 959 | 3300046472 | Ga0495580_0014509 | Ga0495580_0014509_3038_3718 | 224 |
| 960 | 3300046472 | Ga0495580_0053725 | Ga0495580_0053725_937_1611 | 224 |
| 961 | 3300046472 | Ga0495580_0067428 | Ga0495580_0067428_1321_2058 | 224 |
| 962 | 3300046472 | Ga0495580_0149657 | Ga0495580_0149657_571_1245 | 224 |
| 963 | 3300046472 | Ga0495580_0323642 | Ga0495580_0323642_296_979 | 224 |
| 964 | 3300046473 | Ga0495582_0005452 | Ga0495582_0005452_537_1217 | 224 |
| 965 | 3300046473 | Ga0495582_0022220 | Ga0495582_0022220_265_939 | 224 |
| 966 | 3300046475 | Ga0495639_0071872 | Ga0495639_0071872_23_697 | 224 |
| 967 | 3300046511 | Ga0495608_0148646 | Ga0495608_0148646_783_1457 | 224 |
| 968 | 3300046516 | Ga0495628_0049805 | Ga0495628_0049805_2431_3114 | 224 |
| 969 | 3300046517 | Ga0495630_0093306 | Ga0495630_0093306_1072_1746 | 224 |
| 970 | 3300046517 | Ga0495630_0133671 | Ga0495630_0133671_990_1670 | 224 |
| 971 | 3300046526 | Ga0495666_0106709 | Ga0495666_0106709_447_1121 | 224 |
| 972 | 3300046531 | Ga0495665_0001072 | Ga0495665_0001072_3216_3890 | 224 |
| 973 | 3300046531 | Ga0495665_0039056 | Ga0495665_0039056_710_1390 | 224 |
| 974 | 3300046531 | Ga0495665_0084143 | Ga0495665_0084143_898_1578 | 224 |
| 975 | 3300046531 | Ga0495665_0144780 | Ga0495665_0144780_472_1146 | 224 |
| 976 | 3300046535 | Ga0495586_0058509 | Ga0495586_0058509_568_1242 | 224 |
| 977 | 3300046536 | Ga0495587_0069491 | Ga0495587_0069491_119_793 | 224 |
| 978 | 3300046679 | Ga0495623_0377775 | Ga0495623_0377775_36_710 | 224 |
| 979 | 3300046683 | Ga0495658_0158287 | Ga0495658_0158287_562_1236 | 224 |
| 980 | 3300046690 | Ga0495624_0081571 | Ga0495624_0081571_617_1291 | 224 |
| 981 | 3300047319 | Ga0495674_0139998 | Ga0495674_0139998_780_1463 | 224 |
| 982 | 3300047319 | Ga0495674_0283446 | Ga0495674_0283446_278_1015 | 224 |
| 983 | 3300047673 | Ga0495593_0080671 | Ga0495593_0080671_323_997 | 224 |
| 984 | 3300047673 | Ga0495593_0271292 | Ga0495593_0271292_51_734 | 224 |
| 985 | 3300048903 | Ga0496100_0114330 | Ga0496100_0114330_918_1592 | 224 |
| 986 | 3300048904 | Ga0496101_0369488 | Ga0496101_0369488_103_777 | 224 |
| 987 | 3300048904 | Ga0496101_0563666 | Ga0496101_0563666_210_890 | 224 |
| 988 | 3300048905 | Ga0496102_0021353 | Ga0496102_0021353_2628_3302 | 224 |
| 989 | 3300048905 | Ga0496102_0078406 | Ga0496102_0078406_903_1577 | 224 |
| 990 | 3300048905 | Ga0496102_0588681 | Ga0496102_0588681_170_844 | 224 |
| 991 | 3300048905 | Ga0496102_1071373 | Ga0496102_1071373_16_690 | 224 |
| 992 | 3300048906 | Ga0496103_0336809 | Ga0496103_0336809_140_814 | 224 |
| 993 | 3300048907 | Ga0496104_0317220 | Ga0496104_0317220_296_970 | 224 |
| 994 | 3300048909 | Ga0496106_0166006 | Ga0496106_0166006_305_979 | 224 |
| 995 | 3300048910 | Ga0496107_0056921 | Ga0496107_0056921_2081_2755 | 224 |
| 996 | 3300048911 | Ga0496108_0000325 | Ga0496108_0000325_16598_17272 | 224 |
| 997 | 3300048912 | Ga0496109_0000117 | Ga0496109_0000117_45235_45909 | 224 |
| 998 | 3300048912 | Ga0496109_0306029 | Ga0496109_0306029_686_1360 | 224 |
| 999 | 3300048913 | Ga0496110_0002628 | Ga0496110_0002628_5337_6011 | 224 |
| 1000 | 3300048914 | Ga0496111_0004540 | Ga0496111_0004540_685_1359 | 224 |
| 1001 | 3300048915 | Ga0496112_0000283 | Ga0496112_0000283_26473_27147 | 224 |
| 1002 | 3300048915 | Ga0496112_0001864 | Ga0496112_0001864_374_1048 | 224 |
| 1003 | 3300048915 | Ga0496112_0076452 | Ga0496112_0076452_1655_2329 | 224 |
| 1004 | 3300048915 | Ga0496112_0168771 | Ga0496112_0168771_1352_2026 | 224 |
| 1005 | 3300048916 | Ga0496113_0000504 | Ga0496113_0000504_10403_11077 | 224 |
| 1006 | 3300048916 | Ga0496113_0036419 | Ga0496113_0036419_560_1234 | 224 |
| 1007 | 3300048916 | Ga0496113_0435657 | Ga0496113_0435657_222_896 | 224 |
| 1008 | 3300048918 | Ga0496115_0006382 | Ga0496115_0006382_295_975 | 224 |
| 1009 | 3300048918 | Ga0496115_0251515 | Ga0496115_0251515_321_1001 | 224 |
| 1010 | 3300050512 | nmdc:mga0n895_8844_c1 | nmdc:mga0n895_8844_c1_3128_3802 | 224 |
| 1011 | 3300050512 | nmdc:mga0n895_988254_c1 | nmdc:mga0n895_988254_c1_15_689 | 224 |
| 1012 | 3300050513 | nmdc:mga0rr50_22666_c1 | nmdc:mga0rr50_22666_c1_747_1421 | 224 |
| 1013 | 3300050513 | nmdc:mga0rr50_88981_c1 | nmdc:mga0rr50_88981_c1_19_693 | 224 |
| 1014 | 3300050514 | nmdc:mga08x19_119477_c1 | nmdc:mga08x19_119477_c1_216_890 | 224 |
| 1015 | 3300050514 | nmdc:mga08x19_6689_c1 | nmdc:mga08x19_6689_c1_645_1319 | 224 |
| 1016 | 3300050515 | nmdc:mga0a205_937_c1 | nmdc:mga0a205_937_c1_20221_20895 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
71
266
0.85
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.9295 | 4 | 210 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8968 | 2 | 214 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.841 | 3 | 210 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8351 | 4 | 210 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.835 | 4 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVX5_4_220_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9727 | 4 | 218 | 1.10.3720.10 |
| af_Q2FVX5_4_220_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9596 | 4 | 218 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9595 | 2 | 217 | 1.10.3720.10 |
| af_P9WG13_10_255_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.953 | 4 | 210 | 1.10.3720.10 |
| af_P0AEB0_20_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9452 | 4 | 214 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QC36-F1-model_v4 | Molybdenum transport system permease | 0.9973 | 1 | 216 |
GO:0005886
GO:0015098 |
| AF-A0A848VX28-F1-model_v4 | Molybdenum transport system permease | 0.9936 | 1 | 215 |
GO:0005886
GO:0015098 |
| AF-A0A2W0A0E5-F1-model_v4 | Molybdenum transport system permease | 0.9901 | 1 | 189 |
GO:0005886
GO:0015098 |
| AF-A0A7Y4WE71-F1-model_v4 | Molybdenum transport system permease | 0.9892 | 1 | 216 |
GO:0005886
GO:0015098 |
| AF-A0A840I4S3-F1-model_v4 | Molybdenum transport system permease | 0.989 | 2 | 215 |
GO:0005886
GO:0015098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar