F488253

General Info

Members Datasets Scaffolds Average Seq Length
1016 327 1013 227

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10516524|Ga0070717_105165242
Length 271
Sequence VPHPSFALLRKRVGNLTFCKPAASTLFPRDFSTFPHCCYHSCATRMAIDWQTFRLTLELAFTVSVMLLALGLPIAYWIAFSRWRWRFLVEAFVALPIVLPPTVLGFYVLVALGPRSPLGRWWISLTGHTLAFTFTGLVVGSILYSLPFAVQPFASAFLAVDRKLIAASATLGASPFRTFRTVTVPLSVSGIVTGIALSFAHTMGEFGVVLMVGGNIPGITRTVSIDIYDRVQSSDYAGANQTALILLFICFALLALVYGLNRRAALMDAWK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221642 Caulobacter sp. Root343 Isolate Unclassified
3 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
133 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
225 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.08
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.92
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_201130 2162886012 Bacteria 5475
2 MBSR1b_contig_3160416 2162886012 Bacteria 6945
3 LJNas_1000129 3300000546 Bacteria 11792
4 JGI24752J21851_1006373 3300001976 Unclassified 1542
5 JGI24740J21852_10097993 3300001979 Unclassified 749
6 JGI24737J22298_10034298 3300001990 Unclassified 1573
7 JGI24743J22301_10007079 3300001991 Bacteria 1935
8 JGI24034J26672_10000570 3300002239 Bacteria 4702
9 JGI24742J22300_10036682 3300002244 Unclassified 866
10 JGI24751J29686_10023255 3300002459 Unclassified 1285
11 rootH1_10066128 3300003323 Bacteria 5407
12 Ga0065712_10082264 3300005290 Unclassified 2931
13 Ga0065715_10004441 3300005293 Bacteria 7976
14 Ga0065715_10203251 3300005293 Bacteria 1350
15 Ga0065707_10164984 3300005295 Unclassified 1530
16 Ga0070658_10012517 3300005327 Bacteria 6806
17 Ga0070658_10172599 3300005327 Bacteria 1817
18 Ga0070676_10032029 3300005328 Bacteria 3009
19 Ga0070676_10092810 3300005328 Bacteria 1852
20 Ga0070683_100000180 3300005329 Bacteria 41854
21 Ga0070683_100184739 3300005329 Bacteria 1979
22 Ga0070683_100567660 3300005329 Bacteria 1085
23 Ga0070690_100198034 3300005330 Bacteria 1396
24 Ga0070670_100001706 3300005331 Bacteria 17892
25 Ga0070670_100155017 3300005331 Bacteria 1983
26 Ga0070670_100391214 3300005331 Bacteria 1226
27 Ga0068869_100002390 3300005334 Bacteria 11306
28 Ga0068869_100014353 3300005334 Bacteria 5289
29 Ga0070666_10040208 3300005335 Bacteria 3120
30 Ga0070666_10087335 3300005335 Bacteria 2137
31 Ga0070680_100163322 3300005336 Bacteria 1872
32 Ga0070680_100201821 3300005336 Bacteria 1677
33 Ga0070680_100240366 3300005336 Bacteria 1531
34 Ga0070682_100047195 3300005337 Bacteria 2677
35 Ga0070682_100108040 3300005337 Unclassified 1849
36 Ga0068868_100002943 3300005338 Bacteria 11818
37 Ga0068868_100006066 3300005338 Bacteria 8533
38 Ga0068868_100019802 3300005338 Bacteria 5048
39 Ga0068868_100051856 3300005338 Bacteria 3229
40 Ga0068868_100261589 3300005338 Bacteria 1459
41 Ga0070660_100016682 3300005339 Bacteria 5338
42 Ga0070660_100240181 3300005339 Unclassified 1475
43 Ga0070660_100522864 3300005339 Bacteria 988
44 Ga0070689_100016928 3300005340 Bacteria 5344
45 Ga0070689_100170285 3300005340 Bacteria 1764
46 Ga0070687_100023249 3300005343 Bacteria 2944
47 Ga0070661_100000886 3300005344 Bacteria 21512
48 Ga0070661_100226734 3300005344 Bacteria 1435
49 Ga0070692_10463847 3300005345 Unclassified 813
50 Ga0070668_100013446 3300005347 Bacteria 6110
51 Ga0070669_100016274 3300005353 Bacteria 5305
52 Ga0070669_100095707 3300005353 Bacteria 2233
53 Ga0070675_100003414 3300005354 Bacteria 12028
54 Ga0070675_100507415 3300005354 Bacteria 1087
55 Ga0070671_100024798 3300005355 Bacteria 4913
56 Ga0070671_100032659 3300005355 Bacteria 4301
57 Ga0070671_100224112 3300005355 Unclassified 1595
58 Ga0070674_100008141 3300005356 Bacteria 6219
59 Ga0070674_100129520 3300005356 Bacteria 1879
60 Ga0070673_100106371 3300005364 Bacteria 2319
61 Ga0070673_100128982 3300005364 Bacteria 2119
62 Ga0070688_100001337 3300005365 Bacteria 12230
63 Ga0070659_100055418 3300005366 Bacteria 3124
64 Ga0070659_100083237 3300005366 Bacteria 2557
65 Ga0070659_100233724 3300005366 Bacteria 1519
66 Ga0070667_100009483 3300005367 Bacteria 8075
67 Ga0070667_100093961 3300005367 Bacteria 2583
68 Ga0070709_10015131 3300005434 Bacteria 4383
69 Ga0070709_10038441 3300005434 Bacteria 2930
70 Ga0070709_10057013 3300005434 Bacteria 2473
71 Ga0070709_10084591 3300005434 Bacteria 2078
72 Ga0070709_10147207 3300005434 Bacteria 1624
73 Ga0070709_10170516 3300005434 Bacteria 1520
74 Ga0070709_10170725 3300005434 Bacteria 1519
75 Ga0070709_10257488 3300005434 Bacteria 1259
76 Ga0070709_10667144 3300005434 Bacteria 806
77 Ga0070714_100001114 3300005435 Bacteria 19295
78 Ga0070714_100016666 3300005435 Bacteria 5939
79 Ga0070714_100224122 3300005435 Bacteria 1729
80 Ga0070713_100000543 3300005436 Bacteria 23927
81 Ga0070713_100002121 3300005436 Bacteria 12836
82 Ga0070713_100029017 3300005436 Bacteria 4375
83 Ga0070713_100037336 3300005436 Bacteria 3927
84 Ga0070713_100040170 3300005436 Unclassified 3803
85 Ga0070713_100084638 3300005436 Bacteria 2714
86 Ga0070713_100148407 3300005436 Bacteria 2083
87 Ga0070713_100204515 3300005436 Bacteria 1785
88 Ga0070713_100277423 3300005436 Bacteria 1537
89 Ga0070713_100309252 3300005436 Bacteria 1457
90 Ga0070713_100365107 3300005436 Bacteria 1342
91 Ga0070713_100505909 3300005436 Unclassified 1140
92 Ga0070710_10002568 3300005437 Bacteria 8621
93 Ga0070710_10220647 3300005437 Bacteria 1206
94 Ga0070701_10017180 3300005438 Unclassified 3378
95 Ga0070711_100000478 3300005439 Bacteria 20826
96 Ga0070711_100015078 3300005439 Bacteria 4884
97 Ga0070711_100176790 3300005439 Bacteria 1631
98 Ga0070711_100188148 3300005439 Bacteria 1585
99 Ga0070711_100279643 3300005439 Bacteria 1320
100 Ga0070711_100569782 3300005439 Bacteria 941
101 Ga0070711_100590184 3300005439 Bacteria 926
102 Ga0070711_100742228 3300005439 Bacteria 829
103 Ga0070705_100062843 3300005440 Bacteria 2212
104 Ga0070700_100312578 3300005441 Unclassified 1151
105 Ga0070694_100041259 3300005444 Bacteria 3078
106 Ga0070708_100000527 3300005445 Bacteria 28842
107 Ga0070708_100001078 3300005445 Bacteria 20858
108 Ga0070708_100003900 3300005445 Bacteria 11706
109 Ga0070708_100013160 3300005445 Bacteria 6769
110 Ga0070708_100035100 3300005445 Unclassified 4367
111 Ga0070708_100055104 3300005445 Bacteria 3535
112 Ga0070708_100066072 3300005445 Bacteria 3245
113 Ga0070708_100114938 3300005445 Bacteria 2477
114 Ga0070708_100206787 3300005445 Bacteria 1839
115 Ga0070708_100357972 3300005445 Bacteria 1375
116 Ga0070663_100032756 3300005455 Unclassified 3585
117 Ga0070663_100589773 3300005455 Unclassified 933
118 Ga0070678_100355225 3300005456 Bacteria 1261
119 Ga0070662_100005079 3300005457 Bacteria 8381
120 Ga0070662_100225056 3300005457 Unclassified 1498
121 Ga0070681_10000513 3300005458 Bacteria 31715
122 Ga0070681_10001443 3300005458 Bacteria 20931
123 Ga0070681_10047505 3300005458 Bacteria 4291
124 Ga0070681_10071265 3300005458 Bacteria 3440
125 Ga0070681_10231014 3300005458 Bacteria 1764
126 Ga0068867_100016708 3300005459 Bacteria 5214
127 Ga0068867_100053195 3300005459 Bacteria 2990
128 Ga0068867_100428822 3300005459 Bacteria 1122
129 Ga0070685_10001585 3300005466 Bacteria 12002
130 Ga0070685_10238101 3300005466 Bacteria 1200
131 Ga0070706_100000257 3300005467 Bacteria 64534
132 Ga0070706_100000991 3300005467 Bacteria 30868
133 Ga0070706_100094200 3300005467 Bacteria 2779
134 Ga0070706_100113003 3300005467 Bacteria 2529
135 Ga0070706_100204128 3300005467 Bacteria 1846
136 Ga0070707_100001774 3300005468 Bacteria 20733
137 Ga0070707_100062473 3300005468 Bacteria 3573
138 Ga0070707_100072935 3300005468 Bacteria 3310
139 Ga0070707_100535678 3300005468 Bacteria 1133
140 Ga0070707_100569754 3300005468 Bacteria 1095
141 Ga0070698_100000182 3300005471 Bacteria 59279
142 Ga0070698_100012583 3300005471 Bacteria 8959
143 Ga0070698_100389727 3300005471 Bacteria 1326
144 Ga0070698_100791264 3300005471 Bacteria 892
145 Ga0070699_100088406 3300005518 Bacteria 2706
146 Ga0070699_100209163 3300005518 Bacteria 1736
147 Ga0070699_100290372 3300005518 Bacteria 1466
148 Ga0070679_100008087 3300005530 Bacteria 9887
149 Ga0070679_100054487 3300005530 Bacteria 3982
150 Ga0070679_100151665 3300005530 Bacteria 2294
151 Ga0070679_100301683 3300005530 Bacteria 1552
152 Ga0070684_100007581 3300005535 Bacteria 8452
153 Ga0070684_100017780 3300005535 Bacteria 5842
154 Ga0070684_100034929 3300005535 Unclassified 4301
155 Ga0070684_100089161 3300005535 Bacteria 2741
156 Ga0070684_100100259 3300005535 Bacteria 2586
157 Ga0070684_100338931 3300005535 Unclassified 1382
158 Ga0070697_100001487 3300005536 Bacteria 17834
159 Ga0070697_100004056 3300005536 Bacteria 11237
160 Ga0070697_100008463 3300005536 Bacteria 8027
161 Ga0070697_100085791 3300005536 Bacteria 2597
162 Ga0070697_100131291 3300005536 Unclassified 2101
163 Ga0070697_100238772 3300005536 Bacteria 1551
164 Ga0070697_100506852 3300005536 Bacteria 1055
165 Ga0068853_100005004 3300005539 Bacteria 10328
166 Ga0068853_100065061 3300005539 Bacteria 3163
167 Ga0068853_100083675 3300005539 Bacteria 2796
168 Ga0068853_100111845 3300005539 Bacteria 2427
169 Ga0068853_100254637 3300005539 Bacteria 1612
170 Ga0070672_100133123 3300005543 Unclassified 2045
171 Ga0070672_100381838 3300005543 Bacteria 1205
172 Ga0070686_100011657 3300005544 Bacteria 4993
173 Ga0070686_100036014 3300005544 Bacteria 3060
174 Ga0070696_100033625 3300005546 Bacteria 3524
175 Ga0070693_100038251 3300005547 Bacteria 2680
176 Ga0070693_100159312 3300005547 Bacteria 1436
177 Ga0070693_100465557 3300005547 Unclassified 890
178 Ga0070665_100146087 3300005548 Bacteria 2368
179 Ga0068855_100000412 3300005563 Bacteria 52997
180 Ga0068855_100000425 3300005563 Bacteria 52146
181 Ga0068855_100018276 3300005563 Bacteria 8420
182 Ga0068855_100062777 3300005563 Bacteria 4336
183 Ga0068855_100106448 3300005563 Bacteria 3223
184 Ga0068855_100947328 3300005563 Bacteria 907
185 Ga0070664_100005786 3300005564 Bacteria 9974
186 Ga0070664_100047341 3300005564 Bacteria 3632
187 Ga0070664_100082144 3300005564 Bacteria 2778
188 Ga0068857_100002572 3300005577 Bacteria 14860
189 Ga0068857_100003408 3300005577 Bacteria 13246
190 Ga0068857_100005929 3300005577 Bacteria 10432
191 Ga0068857_100372991 3300005577 Unclassified 1324
192 Ga0068857_100574953 3300005577 Bacteria 1063
193 Ga0068854_100003492 3300005578 Bacteria 9822
194 Ga0068854_100004475 3300005578 Bacteria 8814
195 Ga0068854_100014550 3300005578 Bacteria 5191
196 Ga0068854_100020751 3300005578 Bacteria 4452
197 Ga0068856_100000670 3300005614 Bacteria 37158
198 Ga0068856_100000708 3300005614 Bacteria 36263
199 Ga0068856_100001577 3300005614 Bacteria 23871
200 Ga0068856_100003544 3300005614 Bacteria 15716
201 Ga0068856_100006243 3300005614 Bacteria 11695
202 Ga0068856_100009111 3300005614 Bacteria 9649
203 Ga0068856_100066387 3300005614 Bacteria 3565
204 Ga0068856_100079175 3300005614 Bacteria 3259
205 Ga0068856_100118901 3300005614 Bacteria 2643
206 Ga0068856_100198992 3300005614 Bacteria 2018
207 Ga0068856_100245198 3300005614 Bacteria 1807
208 Ga0068856_100350195 3300005614 Unclassified 1495
209 Ga0070702_100004396 3300005615 Bacteria 6431
210 Ga0070702_100082649 3300005615 Bacteria 1927
211 Ga0068852_100002637 3300005616 Bacteria 12389
212 Ga0068852_100104839 3300005616 Bacteria 2560
213 Ga0068852_100107391 3300005616 Bacteria 2532
214 Ga0068852_100282013 3300005616 Bacteria 1602
215 Ga0068852_100318137 3300005616 Bacteria 1510
216 Ga0068859_100000279 3300005617 Bacteria 50882
217 Ga0068859_100015855 3300005617 Bacteria 7572
218 Ga0068859_100114376 3300005617 Bacteria 2762
219 Ga0068859_100277541 3300005617 Unclassified 1768
220 Ga0068864_100000722 3300005618 Bacteria 27599
221 Ga0068864_100015807 3300005618 Bacteria 6279
222 Ga0068864_100046245 3300005618 Bacteria 3734
223 Ga0068866_10001418 3300005718 Bacteria 10276
224 Ga0068866_10005261 3300005718 Bacteria 5333
225 Ga0068866_10008503 3300005718 Bacteria 4330
226 Ga0068866_10408602 3300005718 Bacteria 878
227 Ga0068861_100051927 3300005719 Unclassified 3114
228 Ga0068861_100175545 3300005719 Bacteria 1779
229 Ga0068861_100392952 3300005719 Bacteria 1229
230 Ga0068851_10001381 3300005834 Bacteria 10595
231 Ga0068851_10015362 3300005834 Bacteria 3647
232 Ga0068851_10253493 3300005834 Unclassified 999
233 Ga0068870_10003763 3300005840 Bacteria 6454
234 Ga0068870_10056296 3300005840 Bacteria 2098
235 Ga0068870_10072395 3300005840 Bacteria 1883
236 Ga0068863_100002208 3300005841 Bacteria 19334
237 Ga0068863_100005729 3300005841 Bacteria 12193
238 Ga0068863_100015579 3300005841 Bacteria 7305
239 Ga0068863_100070921 3300005841 Bacteria 3296
240 Ga0068863_100155975 3300005841 Bacteria 2186
241 Ga0068863_100184605 3300005841 Unclassified 2003
242 Ga0068863_100290982 3300005841 Bacteria 1583
243 Ga0068858_100002272 3300005842 Bacteria 19444
244 Ga0068858_100033976 3300005842 Bacteria 4731
245 Ga0068858_100152304 3300005842 Bacteria 2174
246 Ga0068858_100189865 3300005842 Bacteria 1941
247 Ga0068858_100236897 3300005842 Bacteria 1731
248 Ga0068858_100399579 3300005842 Bacteria 1320
249 Ga0068860_100000202 3300005843 Bacteria 94520
250 Ga0068860_100007256 3300005843 Bacteria 11086
251 Ga0068860_100059449 3300005843 Bacteria 3633
252 Ga0068860_100323717 3300005843 Bacteria 1513
253 Ga0068862_100048413 3300005844 Bacteria 3629
254 Ga0068862_100151358 3300005844 Unclassified 2065
255 Ga0068862_100276330 3300005844 Bacteria 1538
256 Ga0081540_1025691 3300005983 Bacteria 3382
257 Ga0070717_10000577 3300006028 Bacteria 23420
258 Ga0070717_10002339 3300006028 Bacteria 13349
259 Ga0070717_10003511 3300006028 Bacteria 11227
260 Ga0070717_10036520 3300006028 Bacteria 3985
261 Ga0070717_10055045 3300006028 Bacteria 3282
262 Ga0070717_10094410 3300006028 Bacteria 2530
263 Ga0070717_10101727 3300006028 Bacteria 2441
264 Ga0070717_10115354 3300006028 Bacteria 2295
265 Ga0070717_10198558 3300006028 Bacteria 1756
266 Ga0070717_10206549 3300006028 Bacteria 1722
267 Ga0070717_10300122 3300006028 Bacteria 1428
268 Ga0070717_10446116 3300006028 Bacteria 1166
269 Ga0070717_10516524 3300006028 Bacteria 1080
270 Ga0070717_10562457 3300006028 Bacteria 1033
271 Ga0070717_10627222 3300006028 Bacteria 975
272 Ga0070715_10037645 3300006163 Bacteria 2003
273 Ga0070715_10042767 3300006163 Bacteria 1906
274 Ga0070715_10099905 3300006163 Bacteria 1351
275 Ga0070715_10122984 3300006163 Bacteria 1239
276 Ga0070716_100005911 3300006173 Bacteria 5955
277 Ga0070716_100028903 3300006173 Bacteria 2992
278 Ga0070716_100135159 3300006173 Bacteria 1565
279 Ga0070716_100155304 3300006173 Bacteria 1477
280 Ga0070716_100240696 3300006173 Bacteria 1227
281 Ga0070716_100380072 3300006173 Bacteria 1009
282 Ga0070716_100432041 3300006173 Unclassified 955
283 Ga0070712_100000948 3300006175 Bacteria 17440
284 Ga0070712_100002033 3300006175 Bacteria 12399
285 Ga0070712_100003822 3300006175 Bacteria 9275
286 Ga0070712_100014441 3300006175 Bacteria 5069
287 Ga0070712_100437864 3300006175 Bacteria 1086
288 Ga0070712_100752610 3300006175 Unclassified 834
289 Ga0097621_100000210 3300006237 Bacteria 38363
290 Ga0097621_100000598 3300006237 Bacteria 25444
291 Ga0097621_100001848 3300006237 Bacteria 14513
292 Ga0097621_100005957 3300006237 Bacteria 8615
293 Ga0097621_100006416 3300006237 Bacteria 8349
294 Ga0097621_100030212 3300006237 Bacteria 4287
295 Ga0097621_100049532 3300006237 Bacteria 3413
296 Ga0097621_100149672 3300006237 Bacteria 2001
297 Ga0097621_100569956 3300006237 Bacteria 1032
298 Ga0097621_100639759 3300006237 Unclassified 975
299 Ga0068871_100000168 3300006358 Bacteria 43632
300 Ga0068871_100000745 3300006358 Bacteria 22042
301 Ga0068871_100000787 3300006358 Bacteria 21292
302 Ga0068871_100009189 3300006358 Bacteria 7148
303 Ga0068871_100022428 3300006358 Unclassified 4866
304 Ga0068871_100025233 3300006358 Bacteria 4621
305 Ga0068871_100046525 3300006358 Bacteria 3495
306 Ga0068871_100092083 3300006358 Bacteria 2528
307 Ga0068871_100170830 3300006358 Bacteria 1863
308 Ga0068871_100339426 3300006358 Bacteria 1326
309 Ga0068871_100515283 3300006358 Bacteria 1079
310 Ga0068871_100878048 3300006358 Bacteria 830
311 Ga0075430_100064546 3300006846 Bacteria 3076
312 Ga0075433_10005922 3300006852 Bacteria 9624
313 Ga0075434_100000246 3300006871 Bacteria 37977
314 Ga0075434_100046235 3300006871 Bacteria 4320
315 Ga0075434_100225606 3300006871 Bacteria 1893
316 Ga0075434_100261670 3300006871 Bacteria 1749
317 Ga0075429_100112538 3300006880 Bacteria 2379
318 Ga0068865_100004430 3300006881 Bacteria 8464
319 Ga0068865_100005649 3300006881 Bacteria 7593
320 Ga0068865_100059134 3300006881 Bacteria 2680
321 Ga0068865_100076875 3300006881 Bacteria 2384
322 Ga0075436_100009403 3300006914 Bacteria 6682
323 Ga0075436_100052786 3300006914 Bacteria 2806
324 Ga0097620_100000279 3300006931 Bacteria 50882
325 Ga0097620_100015855 3300006931 Bacteria 7572
326 Ga0097620_100114372 3300006931 Bacteria 2762
327 Ga0097620_100277530 3300006931 Unclassified 1768
328 Ga0075435_100003413 3300007076 Bacteria 10775
329 Ga0099794_10013220 3300007265 Bacteria 3587
330 Ga0099794_10027987 3300007265 Bacteria 2618
331 Ga0099794_10032987 3300007265 Bacteria 2433
332 Ga0099794_10070247 3300007265 Bacteria 1714
333 Ga0099794_10312516 3300007265 Bacteria 814
334 Ga0105250_10023835 3300009092 Bacteria 2467
335 Ga0105240_10069762 3300009093 Bacteria 4349
336 Ga0105240_10126859 3300009093 Bacteria 3065
337 Ga0105240_10133132 3300009093 Bacteria 2979
338 Ga0105240_10142711 3300009093 Bacteria 2862
339 Ga0105240_10180234 3300009093 Bacteria 2493
340 Ga0105240_10198550 3300009093 Bacteria 2353
341 Ga0105240_10234012 3300009093 Bacteria 2133
342 Ga0105240_10255657 3300009093 Bacteria 2023
343 Ga0105240_10379745 3300009093 Bacteria 1596
344 Ga0111539_10296716 3300009094 Unclassified 1881
345 Ga0105245_10005402 3300009098 Bacteria 11229
346 Ga0105245_10006763 3300009098 Bacteria 10055
347 Ga0105245_10040838 3300009098 Bacteria 4134
348 Ga0105245_10056423 3300009098 Unclassified 3530
349 Ga0105245_10102519 3300009098 Bacteria 2650
350 Ga0105247_10009853 3300009101 Bacteria 5790
351 Ga0105247_10023440 3300009101 Bacteria 3719
352 Ga0105247_10025376 3300009101 Bacteria 3574
353 Ga0105247_10043865 3300009101 Bacteria 2741
354 Ga0105247_10287524 3300009101 Bacteria 1136
355 Ga0114129_10069552 3300009147 Bacteria 4907
356 Ga0105241_10003965 3300009174 Bacteria 10942
357 Ga0105241_10009776 3300009174 Bacteria 7049
358 Ga0105241_10014319 3300009174 Bacteria 5807
359 Ga0105241_10014699 3300009174 Bacteria 5729
360 Ga0105241_10080020 3300009174 Bacteria 2556
361 Ga0105241_10122744 3300009174 Bacteria 2094
362 Ga0105241_10184639 3300009174 Bacteria 1732
363 Ga0105241_10417172 3300009174 Unclassified 1180
364 Ga0105242_10067475 3300009176 Bacteria 2957
365 Ga0105242_10093037 3300009176 Bacteria 2541
366 Ga0105242_10296485 3300009176 Bacteria 1474
367 Ga0105242_10329709 3300009176 Unclassified 1403
368 Ga0105248_10019962 3300009177 Bacteria 7419
369 Ga0105248_10075041 3300009177 Bacteria 3800
370 Ga0105248_10111193 3300009177 Unclassified 3090
371 Ga0105248_10279014 3300009177 Bacteria 1881
372 Ga0105248_10498440 3300009177 Bacteria 1373
373 Ga0105248_10703549 3300009177 Unclassified 1140
374 Ga0105237_10050649 3300009545 Bacteria 4172
375 Ga0105237_10052099 3300009545 Bacteria 4109
376 Ga0105237_10166347 3300009545 Bacteria 2204
377 Ga0105237_10252481 3300009545 Bacteria 1766
378 Ga0105237_10336095 3300009545 Bacteria 1515
379 Ga0105238_10000382 3300009551 Bacteria 47455
380 Ga0105238_10038278 3300009551 Bacteria 4870
381 Ga0105238_10056428 3300009551 Bacteria 3940
382 Ga0105238_10195615 3300009551 Unclassified 1998
383 Ga0105238_10509822 3300009551 Bacteria 1205
384 Ga0105249_10002069 3300009553 Bacteria 17385
385 Ga0105249_10005159 3300009553 Bacteria 11268
386 Ga0105249_10027251 3300009553 Bacteria 5156
387 Ga0099796_10089984 3300010159 Bacteria 1139
388 Ga0105239_10008900 3300010375 Bacteria 11363
389 Ga0105239_10025445 3300010375 Bacteria 6517
390 Ga0105239_10071895 3300010375 Bacteria 3801
391 Ga0105239_10252226 3300010375 Bacteria 1982
392 Ga0105239_10276784 3300010375 Bacteria 1889
393 Ga0105239_10328075 3300010375 Bacteria 1726
394 Ga0105239_10586432 3300010375 Unclassified 1271
395 Ga0105239_10601201 3300010375 Bacteria 1255
396 Ga0105246_10005905 3300011119 Bacteria 7467
397 Ga0105246_10052960 3300011119 Bacteria 2791
398 Ga0157373_10001551 3300013100 Bacteria 17528
399 Ga0157373_10002773 3300013100 Bacteria 13254
400 Ga0157373_10037161 3300013100 Bacteria 3492
401 Ga0157371_10002011 3300013102 Bacteria 20094
402 Ga0157371_10004936 3300013102 Bacteria 11459
403 Ga0157371_10091878 3300013102 Bacteria 2150
404 Ga0157370_10013342 3300013104 Bacteria 8464
405 Ga0157370_10041226 3300013104 Bacteria 4456
406 Ga0157370_10041413 3300013104 Bacteria 4444
407 Ga0157370_10262601 3300013104 Bacteria 1596
408 Ga0157370_10386571 3300013104 Bacteria 1289
409 Ga0157370_10460855 3300013104 Unclassified 1168
410 Ga0157369_10000269 3300013105 Bacteria 69979
411 Ga0157369_10005474 3300013105 Bacteria 14757
412 Ga0157369_10006683 3300013105 Bacteria 13322
413 Ga0157369_10007966 3300013105 Bacteria 12173
414 Ga0157369_10011776 3300013105 Bacteria 9932
415 Ga0157369_10032265 3300013105 Bacteria 5761
416 Ga0157369_10091948 3300013105 Bacteria 3238
417 Ga0157369_10252497 3300013105 Bacteria 1840
418 Ga0157374_10000436 3300013296 Bacteria 37798
419 Ga0157374_10001029 3300013296 Bacteria 24206
420 Ga0157374_10001822 3300013296 Bacteria 17965
421 Ga0157374_10013417 3300013296 Bacteria 7152
422 Ga0157374_10034779 3300013296 Bacteria 4606
423 Ga0157374_10050314 3300013296 Bacteria 3873
424 Ga0157374_10079255 3300013296 Bacteria 3112
425 Ga0157374_10198645 3300013296 Bacteria 1963
426 Ga0157374_10223184 3300013296 Bacteria 1850
427 Ga0157374_10269873 3300013296 Bacteria 1677
428 Ga0157374_10278228 3300013296 Bacteria 1652
429 Ga0157374_10386565 3300013296 Bacteria 1394
430 Ga0157378_10000014 3300013297 Bacteria 144214
431 Ga0157378_10000344 3300013297 Bacteria 45774
432 Ga0157378_10000413 3300013297 Bacteria 42040
433 Ga0157378_10001268 3300013297 Bacteria 22736
434 Ga0157378_10007193 3300013297 Bacteria 9723
435 Ga0157378_10047597 3300013297 Bacteria 3813
436 Ga0157378_10084794 3300013297 Unclassified 2869
437 Ga0157378_10115437 3300013297 Bacteria 2467
438 Ga0157378_10206337 3300013297 Bacteria 1861
439 Ga0157378_10220523 3300013297 Bacteria 1803
440 Ga0163162_10002239 3300013306 Bacteria 18167
441 Ga0163162_10004542 3300013306 Bacteria 13372
442 Ga0163162_10011418 3300013306 Bacteria 8661
443 Ga0163162_10048955 3300013306 Bacteria 4235
444 Ga0163162_10092562 3300013306 Bacteria 3107
445 Ga0163162_10370132 3300013306 Bacteria 1566
446 Ga0163162_10505475 3300013306 Bacteria 1339
447 Ga0163162_11105459 3300013306 Unclassified 898
448 Ga0157372_10000423 3300013307 Bacteria 46475
449 Ga0157372_10000641 3300013307 Bacteria 38393
450 Ga0157372_10002544 3300013307 Bacteria 19779
451 Ga0157372_10004039 3300013307 Bacteria 15735
452 Ga0157372_10005138 3300013307 Bacteria 13911
453 Ga0157372_10015715 3300013307 Bacteria 8117
454 Ga0157372_10016602 3300013307 Bacteria 7900
455 Ga0157372_10022824 3300013307 Bacteria 6775
456 Ga0157372_10036431 3300013307 Bacteria 5422
457 Ga0157372_10062666 3300013307 Bacteria 4167
458 Ga0157372_10166041 3300013307 Bacteria 2553
459 Ga0157372_10198939 3300013307 Bacteria 2321
460 Ga0157375_10035816 3300013308 Bacteria 4742
461 Ga0157375_10044150 3300013308 Bacteria 4327
462 Ga0163163_10026605 3300014325 Bacteria 5533
463 Ga0163163_10027299 3300014325 Bacteria 5467
464 Ga0163163_10093541 3300014325 Bacteria 3023
465 Ga0163163_10096265 3300014325 Bacteria 2980
466 Ga0163163_10113779 3300014325 Unclassified 2736
467 Ga0163163_10386177 3300014325 Bacteria 1458
468 Ga0182008_10001531 3300014497 Bacteria 15380
469 Ga0182008_10009750 3300014497 Bacteria 5169
470 Ga0157377_10023683 3300014745 Bacteria 3257
471 Ga0157377_10166543 3300014745 Bacteria 1375
472 Ga0157377_10438598 3300014745 Unclassified 899
473 Ga0157379_10007798 3300014968 Bacteria 9271
474 Ga0157379_10010844 3300014968 Bacteria 7948
475 Ga0157379_10031809 3300014968 Bacteria 4701
476 Ga0157379_10035204 3300014968 Bacteria 4464
477 Ga0157379_10291860 3300014968 Unclassified 1485
478 Ga0157376_10014425 3300014969 Bacteria 5933
479 Ga0157376_10031198 3300014969 Bacteria 4265
480 Ga0157376_10045515 3300014969 Bacteria 3613
481 Ga0157376_10071439 3300014969 Bacteria 2950
482 Ga0157376_10083990 3300014969 Bacteria 2741
483 Ga0157376_10139774 3300014969 Bacteria 2171
484 Ga0157376_10232048 3300014969 Bacteria 1715
485 Ga0182007_10014472 3300015262 Bacteria 2973
486 Ga0224570_100631 3300022730 Bacteria 2797
487 Ga0224569_100133 3300022732 Bacteria 5518
488 Ga0224572_1000066 3300024225 Bacteria 7223
489 Ga0224572_1001114 3300024225 Bacteria 3797
490 Ga0224572_1009514 3300024225 Bacteria 1814
491 Ga0224572_1009608 3300024225 Bacteria 1807
492 Ga0228598_1001112 3300024227 Bacteria 5938
493 Ga0228598_1017099 3300024227 Bacteria 1430
494 Ga0209437_102112 3300025233 Bacteria 4015
495 Ga0209233_1007680 3300025261 Bacteria 3397
496 Ga0209050_1041325 3300025298 Bacteria 1273
497 Ga0207697_10002788 3300025315 Bacteria 8904
498 Ga0207656_10130194 3300025321 Unclassified 1178
499 Ga0207692_10010221 3300025898 Bacteria 3947
500 Ga0207642_10002117 3300025899 Bacteria 6143
501 Ga0207642_10014622 3300025899 Bacteria 2901
502 Ga0207710_10059340 3300025900 Bacteria 1732
503 Ga0207710_10085390 3300025900 Unclassified 1470
504 Ga0207688_10019381 3300025901 Unclassified 3705
505 Ga0207680_10010712 3300025903 Bacteria 4599
506 Ga0207680_10044690 3300025903 Bacteria 2607
507 Ga0207680_10330027 3300025903 Unclassified 1068
508 Ga0207647_10001477 3300025904 Bacteria 18059
509 Ga0207647_10006683 3300025904 Bacteria 8379
510 Ga0207647_10022413 3300025904 Bacteria 4195
511 Ga0207685_10072896 3300025905 Bacteria 1397
512 Ga0207699_10000815 3300025906 Bacteria 14849
513 Ga0207699_10018440 3300025906 Bacteria 3698
514 Ga0207699_10058663 3300025906 Bacteria 2303
515 Ga0207699_10095528 3300025906 Bacteria 1875
516 Ga0207699_10108927 3300025906 Bacteria 1772
517 Ga0207699_10373471 3300025906 Bacteria 1011
518 Ga0207645_10000181 3300025907 Bacteria 50200
519 Ga0207645_10007872 3300025907 Bacteria 7493
520 Ga0207643_10000474 3300025908 Bacteria 25980
521 Ga0207643_10097731 3300025908 Unclassified 1719
522 Ga0207705_10255787 3300025909 Bacteria 1336
523 Ga0207684_10001275 3300025910 Bacteria 27799
524 Ga0207684_10018088 3300025910 Bacteria 6039
525 Ga0207684_10081331 3300025910 Bacteria 2756
526 Ga0207684_10178688 3300025910 Bacteria 1830
527 Ga0207654_10002582 3300025911 Bacteria 9192
528 Ga0207654_10014318 3300025911 Bacteria 4097
529 Ga0207654_10056155 3300025911 Bacteria 2283
530 Ga0207654_10110051 3300025911 Bacteria 1713
531 Ga0207654_10123841 3300025911 Bacteria 1627
532 Ga0207654_10255190 3300025911 Unclassified 1177
533 Ga0207707_10000828 3300025912 Bacteria 30353
534 Ga0207707_10038831 3300025912 Bacteria 4161
535 Ga0207707_10081955 3300025912 Bacteria 2816
536 Ga0207707_10099151 3300025912 Bacteria 2547
537 Ga0207707_10220174 3300025912 Bacteria 1652
538 Ga0207695_10043656 3300025913 Bacteria 4777
539 Ga0207695_10077718 3300025913 Unclassified 3370
540 Ga0207695_10171125 3300025913 Bacteria 2098
541 Ga0207695_10271718 3300025913 Bacteria 1590
542 Ga0207695_10323787 3300025913 Bacteria 1431
543 Ga0207695_10711846 3300025913 Bacteria 884
544 Ga0207671_10055720 3300025914 Bacteria 2929
545 Ga0207671_10070131 3300025914 Bacteria 2612
546 Ga0207671_10131435 3300025914 Bacteria 1922
547 Ga0207671_10156068 3300025914 Bacteria 1765
548 Ga0207671_10464186 3300025914 Unclassified 1009
549 Ga0207693_10000090 3300025915 Bacteria 81069
550 Ga0207693_10000173 3300025915 Bacteria 58862
551 Ga0207693_10000621 3300025915 Bacteria 31746
552 Ga0207693_10013135 3300025915 Bacteria 6680
553 Ga0207693_10037643 3300025915 Bacteria 3813
554 Ga0207693_10107683 3300025915 Bacteria 2186
555 Ga0207663_10003822 3300025916 Bacteria 7435
556 Ga0207663_10033068 3300025916 Bacteria 3077
557 Ga0207663_10034666 3300025916 Bacteria 3021
558 Ga0207663_10149945 3300025916 Bacteria 1635
559 Ga0207663_10489488 3300025916 Bacteria 954
560 Ga0207660_10185955 3300025917 Bacteria 1616
561 Ga0207662_10001688 3300025918 Bacteria 10806
562 Ga0207657_10005643 3300025919 Bacteria 13060
563 Ga0207657_10007963 3300025919 Bacteria 10807
564 Ga0207657_10008288 3300025919 Bacteria 10575
565 Ga0207649_10000343 3300025920 Bacteria 35195
566 Ga0207652_10076233 3300025921 Bacteria 2924
567 Ga0207652_10120800 3300025921 Bacteria 2331
568 Ga0207646_10002760 3300025922 Bacteria 20509
569 Ga0207646_10007451 3300025922 Bacteria 11120
570 Ga0207646_10039981 3300025922 Bacteria 4220
571 Ga0207646_10103730 3300025922 Bacteria 2550
572 Ga0207681_10020312 3300025923 Bacteria 4206
573 Ga0207694_10000430 3300025924 Bacteria 39056
574 Ga0207694_10043179 3300025924 Bacteria 3479
575 Ga0207694_10089601 3300025924 Bacteria 2426
576 Ga0207694_10287710 3300025924 Bacteria 1351
577 Ga0207650_10000223 3300025925 Bacteria 64087
578 Ga0207650_10000224 3300025925 Bacteria 63557
579 Ga0207650_10000296 3300025925 Bacteria 50068
580 Ga0207650_10001691 3300025925 Bacteria 15671
581 Ga0207650_10289026 3300025925 Bacteria 1336
582 Ga0207659_10470005 3300025926 Unclassified 1061
583 Ga0207687_10017030 3300025927 Bacteria 4778
584 Ga0207687_10058417 3300025927 Bacteria 2714
585 Ga0207687_10173184 3300025927 Bacteria 1666
586 Ga0207687_10385996 3300025927 Bacteria 1148
587 Ga0207700_10002203 3300025928 Bacteria 11180
588 Ga0207700_10072614 3300025928 Bacteria 2654
589 Ga0207700_10073782 3300025928 Bacteria 2636
590 Ga0207700_10105374 3300025928 Bacteria 2258
591 Ga0207700_10180398 3300025928 Bacteria 1768
592 Ga0207700_10255170 3300025928 Bacteria 1499
593 Ga0207700_10287849 3300025928 Bacteria 1415
594 Ga0207700_10298476 3300025928 Bacteria 1390
595 Ga0207700_10331157 3300025928 Unclassified 1322
596 Ga0207700_10359701 3300025928 Bacteria 1269
597 Ga0207700_10360539 3300025928 Bacteria 1267
598 Ga0207700_10405700 3300025928 Unclassified 1195
599 Ga0207700_10650271 3300025928 Unclassified 940
600 Ga0207664_10002844 3300025929 Bacteria 11490
601 Ga0207664_10011335 3300025929 Bacteria 6328
602 Ga0207664_10241814 3300025929 Bacteria 1572
603 Ga0207644_10007871 3300025931 Bacteria 6964
604 Ga0207644_10108673 3300025931 Unclassified 2094
605 Ga0207690_10033784 3300025932 Bacteria 3291
606 Ga0207690_10317592 3300025932 Unclassified 1223
607 Ga0207690_10358566 3300025932 Bacteria 1154
608 Ga0207706_10000613 3300025933 Bacteria 37863
609 Ga0207706_10001122 3300025933 Bacteria 27226
610 Ga0207706_10015847 3300025933 Bacteria 6816
611 Ga0207686_10126583 3300025934 Bacteria 1747
612 Ga0207670_10181872 3300025936 Unclassified 1584
613 Ga0207670_10320786 3300025936 Bacteria 1219
614 Ga0207704_10054816 3300025938 Bacteria 2433
615 Ga0207704_10080675 3300025938 Unclassified 2101
616 Ga0207704_10494860 3300025938 Bacteria 984
617 Ga0207665_10000182 3300025939 Bacteria 42287
618 Ga0207665_10047330 3300025939 Bacteria 2883
619 Ga0207665_10048693 3300025939 Bacteria 2846
620 Ga0207665_10083112 3300025939 Bacteria 2208
621 Ga0207665_10112332 3300025939 Unclassified 1916
622 Ga0207665_10235785 3300025939 Bacteria 1346
623 Ga0207691_10000345 3300025940 Bacteria 46775
624 Ga0207691_10296071 3300025940 Bacteria 1391
625 Ga0207711_10002524 3300025941 Bacteria 16302
626 Ga0207711_10125650 3300025941 Bacteria 2294
627 Ga0207711_10248782 3300025941 Bacteria 1632
628 Ga0207689_10000499 3300025942 Bacteria 37043
629 Ga0207689_10001621 3300025942 Bacteria 21315
630 Ga0207689_10063023 3300025942 Bacteria 3049
631 Ga0207661_10001212 3300025944 Bacteria 17237
632 Ga0207661_10161297 3300025944 Bacteria 1945
633 Ga0207679_10000115 3300025945 Bacteria 64466
634 Ga0207679_10001482 3300025945 Bacteria 14719
635 Ga0207667_10000311 3300025949 Bacteria 67671
636 Ga0207667_10005374 3300025949 Bacteria 15617
637 Ga0207667_10028850 3300025949 Bacteria 6025
638 Ga0207667_10113360 3300025949 Bacteria 2795
639 Ga0207667_10142497 3300025949 Bacteria 2468
640 Ga0207667_10537447 3300025949 Bacteria 1183
641 Ga0207667_10723811 3300025949 Unclassified 996
642 Ga0207667_10964156 3300025949 Bacteria 842
643 Ga0207651_10003483 3300025960 Bacteria 7733
644 Ga0207712_10051568 3300025961 Bacteria 2878
645 Ga0207668_10052646 3300025972 Bacteria 2817
646 Ga0207668_10103914 3300025972 Bacteria 2116
647 Ga0207640_10003104 3300025981 Bacteria 8931
648 Ga0207640_10007732 3300025981 Bacteria 5940
649 Ga0207640_10030028 3300025981 Bacteria 3344
650 Ga0207640_10159412 3300025981 Unclassified 1667
651 Ga0207640_10363623 3300025981 Unclassified 1167
652 Ga0207640_10505528 3300025981 Bacteria 1007
653 Ga0207658_10007316 3300025986 Bacteria 7530
654 Ga0207658_10393707 3300025986 Bacteria 1216
655 Ga0207677_10002452 3300026023 Bacteria 9745
656 Ga0207677_10017631 3300026023 Bacteria 4263
657 Ga0207677_10053564 3300026023 Bacteria 2747
658 Ga0207677_10055683 3300026023 Bacteria 2706
659 Ga0207677_10569747 3300026023 Bacteria 990
660 Ga0207677_10593511 3300026023 Bacteria 971
661 Ga0207703_10001667 3300026035 Bacteria 19971
662 Ga0207703_10006667 3300026035 Bacteria 9212
663 Ga0207703_10067935 3300026035 Bacteria 2935
664 Ga0207703_10365821 3300026035 Bacteria 1331
665 Ga0207703_10712240 3300026035 Bacteria 955
666 Ga0207639_10092099 3300026041 Bacteria 2429
667 Ga0207639_10154627 3300026041 Bacteria 1925
668 Ga0207639_11077881 3300026041 Unclassified 753
669 Ga0207678_10000130 3300026067 Bacteria 63279
670 Ga0207678_10000950 3300026067 Bacteria 26463
671 Ga0207708_10246065 3300026075 Bacteria 1440
672 Ga0207708_10375804 3300026075 Unclassified 1171
673 Ga0207702_10000722 3300026078 Bacteria 35418
674 Ga0207702_10001654 3300026078 Bacteria 22011
675 Ga0207702_10002343 3300026078 Bacteria 18095
676 Ga0207702_10002543 3300026078 Bacteria 17174
677 Ga0207702_10019837 3300026078 Bacteria 5568
678 Ga0207702_10070027 3300026078 Unclassified 3016
679 Ga0207702_10070347 3300026078 Bacteria 3009
680 Ga0207702_10097251 3300026078 Unclassified 2591
681 Ga0207702_10176331 3300026078 Bacteria 1965
682 Ga0207702_10184663 3300026078 Bacteria 1922
683 Ga0207702_10196100 3300026078 Bacteria 1869
684 Ga0207702_10839055 3300026078 Bacteria 909
685 Ga0207641_10000287 3300026088 Bacteria 63251
686 Ga0207641_10001947 3300026088 Bacteria 19809
687 Ga0207641_10002584 3300026088 Bacteria 16638
688 Ga0207641_10031067 3300026088 Bacteria 4428
689 Ga0207641_10040850 3300026088 Bacteria 3886
690 Ga0207641_10111882 3300026088 Unclassified 2422
691 Ga0207641_10141200 3300026088 Unclassified 2173
692 Ga0207641_10305177 3300026088 Bacteria 1505
693 Ga0207648_10001253 3300026089 Bacteria 28381
694 Ga0207648_10159247 3300026089 Bacteria 1994
695 Ga0207648_10371630 3300026089 Bacteria 1291
696 Ga0207676_10000115 3300026095 Bacteria 71633
697 Ga0207676_10003051 3300026095 Bacteria 11952
698 Ga0207676_10035713 3300026095 Bacteria 3775
699 Ga0207676_10412252 3300026095 Unclassified 1265
700 Ga0207674_10000788 3300026116 Bacteria 41336
701 Ga0207674_10001340 3300026116 Bacteria 31912
702 Ga0207674_10007893 3300026116 Bacteria 12363
703 Ga0207674_10013852 3300026116 Bacteria 8922
704 Ga0207674_10487679 3300026116 Unclassified 1191
705 Ga0207674_10586096 3300026116 Bacteria 1077
706 Ga0207675_100083379 3300026118 Bacteria 2998
707 Ga0207683_10000217 3300026121 Bacteria 50192
708 Ga0207683_10291083 3300026121 Unclassified 1493
709 Ga0207698_10101020 3300026142 Bacteria 2391
710 Ga0207698_10149736 3300026142 Bacteria 2023
711 Ga0207698_10199580 3300026142 Bacteria 1790
712 Ga0207698_10447055 3300026142 Bacteria 1247
713 Ga0209179_1043846 3300027512 Unclassified 947
714 Ga0209588_1016400 3300027671 Bacteria 2287
715 Ga0209588_1070111 3300027671 Bacteria 1132
716 Ga0265356_1000344 3300028017 Bacteria 8506
717 Ga0268266_10000761 3300028379 Bacteria 43122
718 Ga0268265_10073055 3300028380 Unclassified 2677
719 Ga0268265_10296460 3300028380 Bacteria 1454
720 Ga0268264_10000241 3300028381 Bacteria 103608
721 Ga0268264_10004971 3300028381 Bacteria 11265
722 Ga0268264_10044778 3300028381 Bacteria 3672
723 Ga0268264_10046056 3300028381 Bacteria 3622
724 Ga0268264_10257370 3300028381 Bacteria 1624
725 Ga0265338_10001801 3300028800 Bacteria 33703
726 Ga0265338_10010396 3300028800 Bacteria 10918
727 Ga0265338_10080138 3300028800 Bacteria 2744
728 Ga0265338_10132286 3300028800 Bacteria 1967
729 Ga0265338_10241360 3300028800 Bacteria 1338
730 Ga0265338_10274634 3300028800 Bacteria 1234
731 Ga0265762_1004236 3300030760 Bacteria 2573
732 Ga0265762_1006001 3300030760 Bacteria 2177
733 Ga0265762_1015555 3300030760 Bacteria 1377
734 Ga0265762_1025991 3300030760 Unclassified 1094
735 Ga0265760_10000242 3300031090 Bacteria 14932
736 Ga0265760_10003610 3300031090 Bacteria 4490
737 Ga0265760_10005419 3300031090 Bacteria 3662
738 Ga0265760_10007787 3300031090 Bacteria 3061
739 Ga0265760_10017742 3300031090 Bacteria 2045
740 Ga0265760_10018276 3300031090 Bacteria 2017
741 Ga0265760_10058968 3300031090 Bacteria 1164
742 Ga0265330_10036864 3300031235 Bacteria 2178
743 Ga0265332_10071679 3300031238 Bacteria 1475
744 Ga0265325_10014097 3300031241 Bacteria 4528
745 Ga0265325_10015495 3300031241 Bacteria 4285
746 Ga0265325_10045920 3300031241 Bacteria 2268
747 Ga0265340_10149411 3300031247 Bacteria 1065
748 Ga0265339_10014422 3300031249 Bacteria 4761
749 Ga0265339_10051746 3300031249 Bacteria 2240
750 Ga0265339_10092440 3300031249 Bacteria 1584
751 Ga0265331_10094211 3300031250 Bacteria 1383
752 Ga0265327_10032180 3300031251 Bacteria 2938
753 Ga0265316_10019053 3300031344 Bacteria 5881
754 Ga0265316_10043022 3300031344 Bacteria 3605
755 Ga0265316_10450132 3300031344 Bacteria 923
756 Ga0265313_10014628 3300031595 Bacteria 4625
757 Ga0265314_10009028 3300031711 Bacteria 8474
758 Ga0265314_10108988 3300031711 Bacteria 1763
759 Ga0265314_10119534 3300031711 Bacteria 1661
760 Ga0265342_10112470 3300031712 Bacteria 1540
761 Ga0307416_101059012 3300032002 Bacteria 915
762 Ga0316214_1005106 3300033545 Bacteria 1712
763 Ga0316212_1006527 3300033547 Bacteria 1690
764 Ga0373926_0004598 3300035083 Bacteria 4529
765 Ga0373926_0005361 3300035083 Bacteria 4223
766 Ga0373928_0042513 3300035084 Bacteria 1048
767 Ga0373929_0020694 3300035085 Bacteria 1328
768 Ga0373944_0049754 3300035089 Bacteria 1318
769 Ga0373936_0004614 3300035113 Bacteria 5214
770 Ga0373936_0063311 3300035113 Bacteria 1514
771 Ga0373939_0046714 3300035114 Bacteria 1327
772 Ga0373941_0019085 3300035115 Bacteria 1904
773 Ga0373945_0082064 3300035116 Bacteria 1237
774 Ga0373954_0192457 3300035118 Bacteria 1002
775 Ga0373956_0121472 3300035119 Unclassified 1220
776 Ga0373957_0086822 3300035120 Bacteria 1239
777 Ga0373943_0052087 3300035170 Bacteria 2017
778 Ga0373943_0054311 3300035170 Bacteria 1981
779 Ga0373943_0067392 3300035170 Bacteria 1805
780 Ga0373943_0209225 3300035170 Unclassified 1082
781 Ga0373943_0298164 3300035170 Bacteria 915
782 Ga0373943_0302457 3300035170 Bacteria 908
783 Ga0373946_0004259 3300035171 Bacteria 5113
784 Ga0373946_0010395 3300035171 Unclassified 3444
785 Ga0373955_0042548 3300035172 Bacteria 2439
786 Ga0373955_0163829 3300035172 Bacteria 1314
787 Ga0373931_0052084 3300035691 Bacteria 2181
788 Ga0373931_0247997 3300035691 Bacteria 1082
789 Ga0373931_0309897 3300035691 Bacteria 977
790 Ga0373935_0033631 3300035692 Bacteria 3192
791 Ga0373935_0035710 3300035692 Bacteria 3103
792 Ga0373935_0079637 3300035692 Bacteria 2127
793 Ga0373935_0423944 3300035692 Unclassified 958
794 Ga0373935_0696763 3300035692 Unclassified 747
795 Ga0373927_0003975 3300035695 Bacteria 10456
796 Ga0373927_0015301 3300035695 Bacteria 5067
797 Ga0373927_0015335 3300035695 Bacteria 5061
798 Ga0373927_0054495 3300035695 Bacteria 2587
799 Ga0373927_0074146 3300035695 Unclassified 2203
800 Ga0373927_0124228 3300035695 Bacteria 1685
801 Ga0373933_0040395 3300035724 Bacteria 2749
802 Ga0373933_0046243 3300035724 Bacteria 2583
803 Ga0373933_0308046 3300035724 Bacteria 1026
804 Ga0373947_0001902 3300035725 Bacteria 12757
805 Ga0373947_0001950 3300035725 Bacteria 12629
806 Ga0373947_0046121 3300035725 Bacteria 2609
807 Ga0373947_0097458 3300035725 Bacteria 1843
808 Ga0373947_0336867 3300035725 Bacteria 1010
809 Ga0373947_0339554 3300035725 Unclassified 1006
810 Ga0373937_0018254 3300036401 Bacteria 6262
811 Ga0373937_0094316 3300036401 Bacteria 2775
812 Ga0373937_0406085 3300036401 Bacteria 1292
813 Ga0373937_0893321 3300036401 Bacteria 837
814 Ga0373937_0922139 3300036401 Bacteria 822
815 Ga0373925_0000165 3300037068 Bacteria 71445
816 Ga0373925_0017686 3300037068 Bacteria 5172
817 Ga0373925_0018110 3300037068 Bacteria 5115
818 Ga0373925_0023470 3300037068 Bacteria 4500
819 Ga0373925_0054200 3300037068 Bacteria 2999
820 Ga0373925_0282884 3300037068 Bacteria 1336
821 Ga0395905_0000096 3300037471 Bacteria 146075
822 Ga0436364_1137452 3300037853 Bacteria 2214
823 Ga0400490_03194 3300038726 Bacteria 2424
824 Ga0400486_20280 3300038742 Bacteria 2381
825 Ga0436365_1849740 3300039437 Unclassified 1737
826 Ga0436363_0684377 3300039450 Plasmid 2896
827 Ga0436363_1603702 3300039450 Bacteria 883
828 Ga0436363_1709607 3300039450 Bacteria 1943
829 Ga0436362_1117608 3300039453 Unclassified 4645
830 Ga0451577_0003762 3300042876 Bacteria 16540
831 Ga0451577_0064248 3300042876 Bacteria 3273
832 Ga0451577_0407021 3300042876 Bacteria 1235
833 Ga0453683_0004979 3300044673 Bacteria 9332
834 Ga0453683_0005490 3300044673 Bacteria 8845
835 Ga0453683_0251834 3300044673 Bacteria 1126
836 Ga0453684_0000377 3300044712 Bacteria 183445
837 Ga0453684_0005849 3300044712 Bacteria 23912
838 Ga0453684_0018504 3300044712 Bacteria 10686
839 Ga0453684_0061085 3300044712 Bacteria 4840
840 Ga0453684_0096456 3300044712 Bacteria 3632
841 Ga0466957_0000410 3300044842 Bacteria 21005
842 Ga0451576_0000033 3300045051 Bacteria 393131
843 Ga0451576_0018916 3300045051 Bacteria 7528
844 Ga0451576_0165440 3300045051 Bacteria 2308
845 Ga0451576_0220067 3300045051 Bacteria 1982
846 Ga0451576_0273153 3300045051 Bacteria 1767
847 Ga0451576_0301499 3300045051 Bacteria 1676
848 Ga0451576_0635259 3300045051 Bacteria 1122
849 Ga0451576_1312526 3300045051 Bacteria 754
850 Ga0466967_0119894 3300045976 Unclassified 2429
851 Ga0495592_0052355 3300046454 Bacteria 3031
852 Ga0495603_0004371 3300046455 Bacteria 8425
853 Ga0495629_0020122 3300046459 Bacteria 4765
854 Ga0495629_0088319 3300046459 Bacteria 2162
855 Ga0495651_0014952 3300046462 Bacteria 5999
856 Ga0495653_0019126 3300046463 Bacteria 5557
857 Ga0495580_0000074 3300046472 Bacteria 62279
858 Ga0495580_0000337 3300046472 Bacteria 38443
859 Ga0495580_0005142 3300046472 Bacteria 10883
860 Ga0495580_0014509 3300046472 Bacteria 5974
861 Ga0495580_0033054 3300046472 Bacteria 3728
862 Ga0495580_0053725 3300046472 Bacteria 2842
863 Ga0495580_0067428 3300046472 Bacteria 2504
864 Ga0495580_0081143 3300046472 Unclassified 2261
865 Ga0495580_0108116 3300046472 Bacteria 1931
866 Ga0495580_0149657 3300046472 Bacteria 1617
867 Ga0495580_0195440 3300046472 Bacteria 1395
868 Ga0495580_0208472 3300046472 Bacteria 1345
869 Ga0495580_0323642 3300046472 Unclassified 1048
870 Ga0495580_0348395 3300046472 Bacteria 1004
871 Ga0495582_0005452 3300046473 Bacteria 7094
872 Ga0495582_0009992 3300046473 Bacteria 5223
873 Ga0495582_0022220 3300046473 Bacteria 3471
874 Ga0495639_0071872 3300046475 Bacteria 1599
875 Ga0495664_0010014 3300046477 Bacteria 5319
876 Ga0495664_0023289 3300046477 Unclassified 3594
877 Ga0495584_0000002 3300046491 Bacteria 512179
878 Ga0495594_0007103 3300046499 Bacteria 5760
879 Ga0495594_0149616 3300046499 Bacteria 1325
880 Ga0495608_0015944 3300046511 Bacteria 5202
881 Ga0495608_0148646 3300046511 Unclassified 1494
882 Ga0495618_0014035 3300046514 Bacteria 4877
883 Ga0495628_0000167 3300046516 Bacteria 57173
884 Ga0495628_0049805 3300046516 Bacteria 3316
885 Ga0495630_0087969 3300046517 Bacteria 2346
886 Ga0495630_0093306 3300046517 Bacteria 2275
887 Ga0495630_0131284 3300046517 Bacteria 1902
888 Ga0495630_0133671 3300046517 Bacteria 1884
889 Ga0495666_0027633 3300046526 Bacteria 2793
890 Ga0495666_0106709 3300046526 Bacteria 1317
891 Ga0495652_0001713 3300046529 Bacteria 23626
892 Ga0495652_0088019 3300046529 Bacteria 2546
893 Ga0495665_0001072 3300046531 Bacteria 14517
894 Ga0495665_0025425 3300046531 Bacteria 3181
895 Ga0495665_0039056 3300046531 Bacteria 2529
896 Ga0495665_0084143 3300046531 Unclassified 1672
897 Ga0495665_0144780 3300046531 Unclassified 1241
898 Ga0495640_0027205 3300046533 Bacteria 4127
899 Ga0495640_0057591 3300046533 Bacteria 2652
900 Ga0495640_0245598 3300046533 Bacteria 1122
901 Ga0495586_0012586 3300046535 Bacteria 4488
902 Ga0495586_0058509 3300046535 Bacteria 2093
903 Ga0495586_0271800 3300046535 Bacteria 969
904 Ga0495587_0003037 3300046536 Bacteria 11210
905 Ga0495587_0069491 3300046536 Bacteria 2051
906 Ga0495645_0006650 3300046543 Bacteria 8032
907 Ga0495645_0007683 3300046543 Bacteria 7501
908 Ga0495645_0079896 3300046543 Bacteria 2348
909 Ga0495622_0159709 3300046557 Bacteria 1017
910 Ga0495667_0027483 3300046559 Bacteria 3834
911 Ga0495667_0216771 3300046559 Bacteria 1222
912 Ga0495634_0025416 3300046642 Bacteria 4143
913 Ga0495634_0069864 3300046642 Bacteria 2316
914 Ga0495657_0009233 3300046675 Bacteria 7483
915 Ga0495623_0011515 3300046679 Bacteria 5724
916 Ga0495623_0377775 3300046679 Bacteria 767
917 Ga0495647_0014408 3300046681 Unclassified 2755
918 Ga0495658_0158287 3300046683 Bacteria 1395
919 Ga0495669_0053711 3300046684 Bacteria 1812
920 Ga0495613_0317024 3300046689 Bacteria 1077
921 Ga0495624_0081571 3300046690 Bacteria 2003
922 Ga0495600_0043489 3300046809 Bacteria 2930
923 Ga0495600_0103323 3300046809 Bacteria 1857
924 Ga0495581_0059356 3300047315 Unclassified 2210
925 Ga0495581_0324868 3300047315 Bacteria 899
926 Ga0495604_0003790 3300047317 Bacteria 12033
927 Ga0495604_0076018 3300047317 Bacteria 2527
928 Ga0495636_0023394 3300047318 Bacteria 2501
929 Ga0495674_0013194 3300047319 Bacteria 7767
930 Ga0495674_0051869 3300047319 Bacteria 3614
931 Ga0495674_0139998 3300047319 Bacteria 2034
932 Ga0495674_0283446 3300047319 Bacteria 1357
933 Ga0495674_0315998 3300047319 Bacteria 1273
934 Ga0495676_0259262 3300047321 Bacteria 1183
935 Ga0495680_0001348 3300047322 Bacteria 26695
936 Ga0495680_0010330 3300047322 Bacteria 8332
937 Ga0495675_0000202 3300047444 Bacteria 43536
938 Ga0495675_0053586 3300047444 Bacteria 2561
939 Ga0495675_0240589 3300047444 Bacteria 1090
940 Ga0495684_0012098 3300047471 Bacteria 6658
941 Ga0495684_0022085 3300047471 Bacteria 4899
942 Ga0495684_0493365 3300047471 Bacteria 843
943 Ga0495593_0080671 3300047673 Bacteria 1683
944 Ga0495593_0174034 3300047673 Bacteria 1085
945 Ga0495593_0271292 3300047673 Unclassified 849
946 Ga0495602_0022805 3300048088 Bacteria 6120
947 Ga0496100_0114330 3300048903 Bacteria 1880
948 Ga0496100_0232842 3300048903 Bacteria 1356
949 Ga0496101_0143438 3300048904 Bacteria 1822
950 Ga0496101_0360541 3300048904 Bacteria 1143
951 Ga0496101_0369488 3300048904 Bacteria 1128
952 Ga0496101_0389535 3300048904 Bacteria 1097
953 Ga0496101_0563666 3300048904 Bacteria 901
954 Ga0496102_0006673 3300048905 Bacteria 9863
955 Ga0496102_0021353 3300048905 Bacteria 5726
956 Ga0496102_0058632 3300048905 Bacteria 3518
957 Ga0496102_0078406 3300048905 Bacteria 3041
958 Ga0496102_0343567 3300048905 Bacteria 1405
959 Ga0496102_0588681 3300048905 Bacteria 1035
960 Ga0496102_1071373 3300048905 Bacteria 726
961 Ga0496103_0014594 3300048906 Bacteria 4667
962 Ga0496103_0336809 3300048906 Unclassified 970
963 Ga0496103_0342546 3300048906 Bacteria 961
964 Ga0496104_0000074 3300048907 Bacteria 103117
965 Ga0496104_0024442 3300048907 Bacteria 5556
966 Ga0496104_0125291 3300048907 Unclassified 2467
967 Ga0496104_0317220 3300048907 Bacteria 1472
968 Ga0496104_0325422 3300048907 Bacteria 1450
969 Ga0496104_0630881 3300048907 Bacteria 981
970 Ga0496106_0031581 3300048909 Bacteria 3947
971 Ga0496106_0166006 3300048909 Bacteria 1748
972 Ga0496107_0056921 3300048910 Bacteria 2826
973 Ga0496107_0307304 3300048910 Bacteria 1180
974 Ga0496108_0000325 3300048911 Bacteria 40507
975 Ga0496109_0000117 3300048912 Bacteria 82245
976 Ga0496109_0306029 3300048912 Unclassified 1499
977 Ga0496109_0736047 3300048912 Bacteria 924
978 Ga0496110_0002628 3300048913 Bacteria 13526
979 Ga0496110_0061618 3300048913 Bacteria 3312
980 Ga0496111_0004540 3300048914 Bacteria 8786
981 Ga0496112_0000283 3300048915 Bacteria 32864
982 Ga0496112_0001864 3300048915 Bacteria 16604
983 Ga0496112_0076452 3300048915 Bacteria 3311
984 Ga0496112_0143818 3300048915 Bacteria 2353
985 Ga0496112_0168771 3300048915 Bacteria 2154
986 Ga0496112_0531873 3300048915 Unclassified 1110
987 Ga0496113_0000504 3300048916 Bacteria 19266
988 Ga0496113_0036419 3300048916 Bacteria 3605
989 Ga0496113_0435657 3300048916 Bacteria 1053
990 Ga0496113_0538124 3300048916 Bacteria 937
991 Ga0496114_0146119 3300048917 Bacteria 2050
992 Ga0496114_0155073 3300048917 Bacteria 1988
993 Ga0496115_0006382 3300048918 Bacteria 8641
994 Ga0496115_0010817 3300048918 Bacteria 6824
995 Ga0496115_0251515 3300048918 Bacteria 1455
996 Ga0496115_0600636 3300048918 Bacteria 875
997 Ga0496126_0000095 3300048929 Bacteria 207654
998 Ga0501040_0138574 3300049576 Bacteria 1713
999 nmdc:mga09592_61422_c1 3300050508 Bacteria 3178
1000 nmdc:mga0qj67_207052_c1 3300050509 Bacteria 1593
1001 nmdc:mga0n895_6139_c1 3300050512 Bacteria 10149
1002 nmdc:mga0n895_8844_c1 3300050512 Bacteria 8765
1003 nmdc:mga0n895_988254_c1 3300050512 Bacteria 823
1004 nmdc:mga0rr50_119696_c1 3300050513 Bacteria 2094
1005 nmdc:mga0rr50_22666_c1 3300050513 Bacteria 4315
1006 nmdc:mga0rr50_251177_c1 3300050513 Unclassified 1469
1007 nmdc:mga0rr50_88981_c1 3300050513 Bacteria 2400
1008 nmdc:mga08x19_119477_c1 3300050514 Bacteria 1766
1009 nmdc:mga08x19_575_c1 3300050514 Bacteria 23955
1010 nmdc:mga08x19_59017_c2 3300050514 Bacteria 2026
1011 nmdc:mga08x19_6689_c1 3300050514 Bacteria 6840
1012 nmdc:mga0a205_937_c1 3300050515 Bacteria 24079
1013 Ga0501084_0268223 3300054114 Bacteria 1441

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0600636 Ga0496115_0600636_55_723 197
2 3300025913 Ga0207695_10711846 Ga0207695_107118462 200
3 3300031090 Ga0265760_10003610 Ga0265760_100036103 206
4 3300006880 Ga0075429_100112538 Ga0075429_1001125382 209
5 3300024227 Ga0228598_1017099 Ga0228598_10170991 212
6 3300006028 Ga0070717_10300122 Ga0070717_103001222 214
7 3300009093 Ga0105240_10379745 Ga0105240_103797452 214
8 3300005329 Ga0070683_100567660 Ga0070683_1005676601 215
9 3300005336 Ga0070680_100240366 Ga0070680_1002403661 215
10 3300005434 Ga0070709_10257488 Ga0070709_102574882 215
11 3300005458 Ga0070681_10047505 Ga0070681_100475052 215
12 3300005530 Ga0070679_100054487 Ga0070679_1000544873 215
13 3300005614 Ga0068856_100079175 Ga0068856_1000791753 215
14 3300006028 Ga0070717_10627222 Ga0070717_106272222 215
15 3300006175 Ga0070712_100437864 Ga0070712_1004378642 215
16 3300013307 Ga0157372_10005138 Ga0157372_100051384 215
17 3300037853 Ga0436364_1137452 Ga0436364_1137452_1130_1792 215
18 3300003323 rootH1_10066128 rootH1_100661284 216
19 3300005843 Ga0068860_100000202 Ga0068860_10000020227 216
20 3300028381 Ga0268264_10000241 Ga0268264_1000024140 216
21 3300037471 Ga0395905_0000096 Ga0395905_0000096_68344_69039 216
22 3300046559 Ga0495667_0216771 Ga0495667_0216771_168_827 216
23 3300047444 Ga0495675_0240589 Ga0495675_0240589_416_1075 216
24 3300035170 Ga0373943_0067392 Ga0373943_0067392_566_1246 217
25 3300044712 Ga0453684_0000377 Ga0453684_0000377_56188_56862 217
26 3300045051 Ga0451576_0000033 Ga0451576_0000033_126584_127258 217
27 3300005439 Ga0070711_100742228 Ga0070711_1007422281 218
28 3300006173 Ga0070716_100005911 Ga0070716_1000059113 218
29 3300006173 Ga0070716_100380072 Ga0070716_1003800722 218
30 3300009551 Ga0105238_10509822 Ga0105238_105098222 218
31 3300025939 Ga0207665_10000182 Ga0207665_1000018226 218
32 3300032002 Ga0307416_101059012 Ga0307416_1010590121 218
33 3300035692 Ga0373935_0423944 Ga0373935_0423944_56_730 218
34 3300045051 Ga0451576_0273153 Ga0451576_0273153_621_1304 218
35 3300046491 Ga0495584_0000002 Ga0495584_0000002_188907_189581 218
36 iso_pu_bacteria 2643221642 2644236120 218
37 3300013104 Ga0157370_10013342 Ga0157370_100133423 219
38 3300013307 Ga0157372_10036431 Ga0157372_100364314 219
39 3300025233 Ga0209437_102112 Ga0209437_1021123 219
40 3300025261 Ga0209233_1007680 Ga0209233_10076804 219
41 3300031251 Ga0265327_10032180 Ga0265327_100321803 219
42 3300038742 Ga0400486_20280 Ga0400486_20280_1589_2278 219
43 3300046529 Ga0495652_0088019 Ga0495652_0088019_601_1269 219
44 3300046543 Ga0495645_0006650 Ga0495645_0006650_4262_4930 219
45 3300046809 Ga0495600_0103323 Ga0495600_0103323_739_1407 219
46 3300047317 Ga0495604_0076018 Ga0495604_0076018_1356_2024 219
47 3300047471 Ga0495684_0493365 Ga0495684_0493365_25_693 219
48 3300048929 Ga0496126_0000095 Ga0496126_0000095_71975_72643 219
49 iso_pu_bacteria 2887375801 2887377990 219
50 iso_pu_bacteria 646564506 646812225 219
51 3300005841 Ga0068863_100005729 Ga0068863_10000572912 220
52 3300006163 Ga0070715_10099905 Ga0070715_100999052 220
53 3300006237 Ga0097621_100639759 Ga0097621_1006397591 220
54 3300006358 Ga0068871_100878048 Ga0068871_1008780481 220
55 3300006871 Ga0075434_100046235 Ga0075434_1000462353 220
56 3300006871 Ga0075434_100225606 Ga0075434_1002256062 220
57 3300009093 Ga0105240_10126859 Ga0105240_101268592 220
58 3300013105 Ga0157369_10091948 Ga0157369_100919483 220
59 3300013296 Ga0157374_10278228 Ga0157374_102782282 220
60 3300013307 Ga0157372_10002544 Ga0157372_1000254415 220
61 3300014969 Ga0157376_10031198 Ga0157376_100311983 220
62 3300024225 Ga0224572_1009608 Ga0224572_10096082 220
63 3300025298 Ga0209050_1041325 Ga0209050_10413252 220
64 3300025913 Ga0207695_10271718 Ga0207695_102717182 220
65 3300026088 Ga0207641_10001947 Ga0207641_1000194712 220
66 3300031090 Ga0265760_10007787 Ga0265760_100077873 220
67 3300035116 Ga0373945_0082064 Ga0373945_0082064_229_906 220
68 3300035172 Ga0373955_0163829 Ga0373955_0163829_36_713 220
69 3300038726 Ga0400490_03194 Ga0400490_03194_291_986 220
70 3300039450 Ga0436363_1603702 Ga0436363_1603702_141_803 220
71 3300046455 Ga0495603_0004371 Ga0495603_0004371_2843_3520 220
72 3300046459 Ga0495629_0088319 Ga0495629_0088319_67_744 220
73 3300046472 Ga0495580_0081143 Ga0495580_0081143_472_1149 220
74 3300046473 Ga0495582_0009992 Ga0495582_0009992_67_744 220
75 3300046477 Ga0495664_0023289 Ga0495664_0023289_2102_2779 220
76 3300046499 Ga0495594_0007103 Ga0495594_0007103_1926_2603 220
77 3300046533 Ga0495640_0027205 Ga0495640_0027205_128_805 220
78 3300046535 Ga0495586_0012586 Ga0495586_0012586_1646_2323 220
79 3300046557 Ga0495622_0159709 Ga0495622_0159709_56_724 220
80 3300046642 Ga0495634_0069864 Ga0495634_0069864_1192_1869 220
81 3300046681 Ga0495647_0014408 Ga0495647_0014408_459_1136 220
82 3300047315 Ga0495581_0059356 Ga0495581_0059356_1196_1873 220
83 3300047319 Ga0495674_0315998 Ga0495674_0315998_444_1121 220
84 3300047471 Ga0495684_0022085 Ga0495684_0022085_3975_4652 220
85 3300048907 Ga0496104_0125291 Ga0496104_0125291_693_1370 220
86 3300048917 Ga0496114_0155073 Ga0496114_0155073_50_727 220
87 3300048918 Ga0496115_0010817 Ga0496115_0010817_1150_1827 220
88 3300050512 nmdc:mga0n895_6139_c1 nmdc:mga0n895_6139_c1_3079_3747 220
89 3300050513 nmdc:mga0rr50_119696_c1 nmdc:mga0rr50_119696_c1_1351_2019 220
90 3300005335 Ga0070666_10087335 Ga0070666_100873352 221
91 3300005338 Ga0068868_100006066 Ga0068868_1000060665 221
92 3300005339 Ga0070660_100016682 Ga0070660_1000166822 221
93 3300005347 Ga0070668_100013446 Ga0070668_1000134462 221
94 3300005353 Ga0070669_100016274 Ga0070669_1000162742 221
95 3300005366 Ga0070659_100233724 Ga0070659_1002337242 221
96 3300005367 Ga0070667_100009483 Ga0070667_1000094832 221
97 3300005434 Ga0070709_10038441 Ga0070709_100384413 221
98 3300005434 Ga0070709_10057013 Ga0070709_100570131 221
99 3300005434 Ga0070709_10667144 Ga0070709_106671441 221
100 3300005436 Ga0070713_100505909 Ga0070713_1005059091 221
101 3300005437 Ga0070710_10220647 Ga0070710_102206471 221
102 3300005439 Ga0070711_100000478 Ga0070711_1000004789 221
103 3300005439 Ga0070711_100188148 Ga0070711_1001881482 221
104 3300005440 Ga0070705_100062843 Ga0070705_1000628432 221
105 3300005444 Ga0070694_100041259 Ga0070694_1000412592 221
106 3300005445 Ga0070708_100003900 Ga0070708_10000390013 221
107 3300005457 Ga0070662_100005079 Ga0070662_1000050791 221
108 3300005458 Ga0070681_10231014 Ga0070681_102310142 221
109 3300005467 Ga0070706_100000257 Ga0070706_10000025748 221
110 3300005518 Ga0070699_100209163 Ga0070699_1002091631 221
111 3300005518 Ga0070699_100290372 Ga0070699_1002903722 221
112 3300005530 Ga0070679_100301683 Ga0070679_1003016832 221
113 3300005535 Ga0070684_100017780 Ga0070684_1000177805 221
114 3300005536 Ga0070697_100001487 Ga0070697_10000148713 221
115 3300005539 Ga0068853_100005004 Ga0068853_1000050047 221
116 3300005544 Ga0070686_100011657 Ga0070686_1000116574 221
117 3300005546 Ga0070696_100033625 Ga0070696_1000336253 221
118 3300005547 Ga0070693_100038251 Ga0070693_1000382511 221
119 3300005548 Ga0070665_100146087 Ga0070665_1001460871 221
120 3300005563 Ga0068855_100106448 Ga0068855_1001064482 221
121 3300005563 Ga0068855_100947328 Ga0068855_1009473281 221
122 3300005578 Ga0068854_100003492 Ga0068854_1000034923 221
123 3300005614 Ga0068856_100118901 Ga0068856_1001189013 221
124 3300005616 Ga0068852_100318137 Ga0068852_1003181371 221
125 3300005617 Ga0068859_100114376 Ga0068859_1001143762 221
126 3300005718 Ga0068866_10408602 Ga0068866_104086021 221
127 3300005719 Ga0068861_100392952 Ga0068861_1003929522 221
128 3300005834 Ga0068851_10001381 Ga0068851_100013816 221
129 3300005840 Ga0068870_10072395 Ga0068870_100723952 221
130 3300005841 Ga0068863_100070921 Ga0068863_1000709214 221
131 3300006163 Ga0070715_10122984 Ga0070715_101229842 221
132 3300006173 Ga0070716_100135159 Ga0070716_1001351591 221
133 3300006173 Ga0070716_100432041 Ga0070716_1004320411 221
134 3300006175 Ga0070712_100000948 Ga0070712_10000094811 221
135 3300006237 Ga0097621_100005957 Ga0097621_1000059576 221
136 3300006237 Ga0097621_100049532 Ga0097621_1000495322 221
137 3300006358 Ga0068871_100009189 Ga0068871_1000091896 221
138 3300006358 Ga0068871_100092083 Ga0068871_1000920832 221
139 3300006358 Ga0068871_100170830 Ga0068871_1001708302 221
140 3300006931 Ga0097620_100114372 Ga0097620_1001143722 221
141 3300009093 Ga0105240_10069762 Ga0105240_100697623 221
142 3300009093 Ga0105240_10255657 Ga0105240_102556572 221
143 3300009098 Ga0105245_10102519 Ga0105245_101025192 221
144 3300009101 Ga0105247_10023440 Ga0105247_100234401 221
145 3300009101 Ga0105247_10025376 Ga0105247_100253763 221
146 3300009101 Ga0105247_10043865 Ga0105247_100438654 221
147 3300009101 Ga0105247_10287524 Ga0105247_102875241 221
148 3300009174 Ga0105241_10014699 Ga0105241_100146997 221
149 3300009174 Ga0105241_10122744 Ga0105241_101227442 221
150 3300009174 Ga0105241_10184639 Ga0105241_101846392 221
151 3300009176 Ga0105242_10067475 Ga0105242_100674752 221
152 3300009177 Ga0105248_10019962 Ga0105248_100199623 221
153 3300009545 Ga0105237_10336095 Ga0105237_103360951 221
154 3300009551 Ga0105238_10195615 Ga0105238_101956152 221
155 3300009553 Ga0105249_10005159 Ga0105249_100051593 221
156 3300010375 Ga0105239_10328075 Ga0105239_103280752 221
157 3300010375 Ga0105239_10601201 Ga0105239_106012012 221
158 3300011119 Ga0105246_10052960 Ga0105246_100529602 221
159 3300013102 Ga0157371_10004936 Ga0157371_100049366 221
160 3300013104 Ga0157370_10262601 Ga0157370_102626012 221
161 3300013105 Ga0157369_10007966 Ga0157369_100079663 221
162 3300013296 Ga0157374_10013417 Ga0157374_100134176 221
163 3300013296 Ga0157374_10050314 Ga0157374_100503143 221
164 3300013296 Ga0157374_10079255 Ga0157374_100792553 221
165 3300013296 Ga0157374_10198645 Ga0157374_101986452 221
166 3300013297 Ga0157378_10001268 Ga0157378_100012688 221
167 3300013297 Ga0157378_10115437 Ga0157378_101154372 221
168 3300013297 Ga0157378_10206337 Ga0157378_102063371 221
169 3300013297 Ga0157378_10220523 Ga0157378_102205232 221
170 3300013306 Ga0163162_10002239 Ga0163162_1000223918 221
171 3300013306 Ga0163162_10011418 Ga0163162_100114186 221
172 3300013307 Ga0157372_10166041 Ga0157372_101660411 221
173 3300013308 Ga0157375_10035816 Ga0157375_100358162 221
174 3300014325 Ga0163163_10093541 Ga0163163_100935412 221
175 3300014325 Ga0163163_10096265 Ga0163163_100962652 221
176 3300014325 Ga0163163_10113779 Ga0163163_101137793 221
177 3300014968 Ga0157379_10007798 Ga0157379_100077985 221
178 3300014968 Ga0157379_10010844 Ga0157379_100108445 221
179 3300014969 Ga0157376_10083990 Ga0157376_100839903 221
180 3300014969 Ga0157376_10139774 Ga0157376_101397742 221
181 3300025900 Ga0207710_10059340 Ga0207710_100593402 221
182 3300025903 Ga0207680_10010712 Ga0207680_100107123 221
183 3300025906 Ga0207699_10000815 Ga0207699_100008156 221
184 3300025906 Ga0207699_10095528 Ga0207699_100955281 221
185 3300025907 Ga0207645_10007872 Ga0207645_100078725 221
186 3300025910 Ga0207684_10018088 Ga0207684_100180884 221
187 3300025911 Ga0207654_10056155 Ga0207654_100561552 221
188 3300025911 Ga0207654_10110051 Ga0207654_101100512 221
189 3300025911 Ga0207654_10255190 Ga0207654_102551902 221
190 3300025912 Ga0207707_10220174 Ga0207707_102201742 221
191 3300025913 Ga0207695_10043656 Ga0207695_100436562 221
192 3300025914 Ga0207671_10055720 Ga0207671_100557204 221
193 3300025915 Ga0207693_10000173 Ga0207693_1000017348 221
194 3300025916 Ga0207663_10003822 Ga0207663_100038228 221
195 3300025919 Ga0207657_10008288 Ga0207657_100082885 221
196 3300025921 Ga0207652_10076233 Ga0207652_100762331 221
197 3300025924 Ga0207694_10089601 Ga0207694_100896012 221
198 3300025924 Ga0207694_10287710 Ga0207694_102877101 221
199 3300025927 Ga0207687_10058417 Ga0207687_100584173 221
200 3300025927 Ga0207687_10173184 Ga0207687_101731842 221
201 3300025928 Ga0207700_10331157 Ga0207700_103311572 221
202 3300025933 Ga0207706_10001122 Ga0207706_1000112214 221
203 3300025939 Ga0207665_10048693 Ga0207665_100486933 221
204 3300025939 Ga0207665_10235785 Ga0207665_102357852 221
205 3300025941 Ga0207711_10002524 Ga0207711_100025243 221
206 3300025972 Ga0207668_10052646 Ga0207668_100526463 221
207 3300025981 Ga0207640_10007732 Ga0207640_100077325 221
208 3300026041 Ga0207639_10154627 Ga0207639_101546272 221
209 3300026067 Ga0207678_10000950 Ga0207678_1000095014 221
210 3300026075 Ga0207708_10246065 Ga0207708_102460651 221
211 3300026078 Ga0207702_10019837 Ga0207702_100198375 221
212 3300026078 Ga0207702_10097251 Ga0207702_100972513 221
213 3300026088 Ga0207641_10040850 Ga0207641_100408505 221
214 3300026116 Ga0207674_10013852 Ga0207674_100138522 221
215 3300026118 Ga0207675_100083379 Ga0207675_1000833794 221
216 3300031241 Ga0265325_10014097 Ga0265325_100140972 221
217 3300031247 Ga0265340_10149411 Ga0265340_101494112 221
218 3300031250 Ga0265331_10094211 Ga0265331_100942112 221
219 3300031344 Ga0265316_10019053 Ga0265316_100190534 221
220 3300031595 Ga0265313_10014628 Ga0265313_100146282 221
221 3300031711 Ga0265314_10119534 Ga0265314_101195341 221
222 3300031712 Ga0265342_10112470 Ga0265342_101124702 221
223 3300035084 Ga0373928_0042513 Ga0373928_0042513_17_712 221
224 3300035114 Ga0373939_0046714 Ga0373939_0046714_203_907 221
225 3300035115 Ga0373941_0019085 Ga0373941_0019085_1203_1868 221
226 3300035691 Ga0373931_0052084 Ga0373931_0052084_250_978 221
227 3300035691 Ga0373931_0247997 Ga0373931_0247997_61_768 221
228 3300035695 Ga0373927_0124228 Ga0373927_0124228_358_1032 221
229 3300035724 Ga0373933_0308046 Ga0373933_0308046_150_824 221
230 3300036401 Ga0373937_0893321 Ga0373937_0893321_133_807 221
231 3300037068 Ga0373925_0282884 Ga0373925_0282884_486_1160 221
232 3300039450 Ga0436363_0684377 Ga0436363_0684377_877_1560 221
233 3300044712 Ga0453684_0005849 Ga0453684_0005849_2872_3543 221
234 3300044712 Ga0453684_0061085 Ga0453684_0061085_2637_3308 221
235 3300045051 Ga0451576_0301499 Ga0451576_0301499_754_1425 221
236 3300046454 Ga0495592_0052355 Ga0495592_0052355_1260_1934 221
237 3300046462 Ga0495651_0014952 Ga0495651_0014952_1794_2468 221
238 3300046463 Ga0495653_0019126 Ga0495653_0019126_2567_3241 221
239 3300046472 Ga0495580_0033054 Ga0495580_0033054_323_988 221
240 3300046472 Ga0495580_0195440 Ga0495580_0195440_506_1180 221
241 3300046472 Ga0495580_0208472 Ga0495580_0208472_596_1261 221
242 3300046472 Ga0495580_0348395 Ga0495580_0348395_19_693 221
243 3300046477 Ga0495664_0010014 Ga0495664_0010014_3922_4596 221
244 3300046499 Ga0495594_0149616 Ga0495594_0149616_105_779 221
245 3300046511 Ga0495608_0015944 Ga0495608_0015944_2479_3153 221
246 3300046514 Ga0495618_0014035 Ga0495618_0014035_977_1651 221
247 3300046516 Ga0495628_0000167 Ga0495628_0000167_49179_49853 221
248 3300046517 Ga0495630_0131284 Ga0495630_0131284_801_1475 221
249 3300046529 Ga0495652_0001713 Ga0495652_0001713_19767_20441 221
250 3300046533 Ga0495640_0057591 Ga0495640_0057591_494_1168 221
251 3300046533 Ga0495640_0245598 Ga0495640_0245598_31_705 221
252 3300046535 Ga0495586_0271800 Ga0495586_0271800_110_784 221
253 3300046536 Ga0495587_0003037 Ga0495587_0003037_3310_3984 221
254 3300046543 Ga0495645_0007683 Ga0495645_0007683_4476_5150 221
255 3300046543 Ga0495645_0079896 Ga0495645_0079896_450_1124 221
256 3300046559 Ga0495667_0027483 Ga0495667_0027483_1654_2328 221
257 3300046642 Ga0495634_0025416 Ga0495634_0025416_114_788 221
258 3300046675 Ga0495657_0009233 Ga0495657_0009233_4126_4800 221
259 3300046679 Ga0495623_0011515 Ga0495623_0011515_2773_3447 221
260 3300046684 Ga0495669_0053711 Ga0495669_0053711_968_1642 221
261 3300046689 Ga0495613_0317024 Ga0495613_0317024_320_994 221
262 3300046809 Ga0495600_0043489 Ga0495600_0043489_982_1656 221
263 3300047315 Ga0495581_0324868 Ga0495581_0324868_41_715 221
264 3300047317 Ga0495604_0003790 Ga0495604_0003790_3946_4620 221
265 3300047318 Ga0495636_0023394 Ga0495636_0023394_506_1180 221
266 3300047319 Ga0495674_0013194 Ga0495674_0013194_2622_3296 221
267 3300047319 Ga0495674_0051869 Ga0495674_0051869_149_823 221
268 3300047322 Ga0495680_0001348 Ga0495680_0001348_8377_9051 221
269 3300047322 Ga0495680_0010330 Ga0495680_0010330_4594_5268 221
270 3300047444 Ga0495675_0000202 Ga0495675_0000202_539_1213 221
271 3300047444 Ga0495675_0053586 Ga0495675_0053586_452_1126 221
272 3300047471 Ga0495684_0012098 Ga0495684_0012098_5121_5795 221
273 3300047673 Ga0495593_0174034 Ga0495593_0174034_39_713 221
274 3300048088 Ga0495602_0022805 Ga0495602_0022805_67_741 221
275 3300048903 Ga0496100_0232842 Ga0496100_0232842_529_1209 221
276 3300048904 Ga0496101_0143438 Ga0496101_0143438_996_1703 221
277 3300048904 Ga0496101_0360541 Ga0496101_0360541_332_1027 221
278 3300048904 Ga0496101_0389535 Ga0496101_0389535_22_696 221
279 3300048905 Ga0496102_0006673 Ga0496102_0006673_4170_4877 221
280 3300048905 Ga0496102_0058632 Ga0496102_0058632_1854_2582 221
281 3300048905 Ga0496102_0343567 Ga0496102_0343567_607_1311 221
282 3300048906 Ga0496103_0014594 Ga0496103_0014594_319_1026 221
283 3300048906 Ga0496103_0342546 Ga0496103_0342546_25_690 221
284 3300048907 Ga0496104_0000074 Ga0496104_0000074_29745_30419 221
285 3300048907 Ga0496104_0024442 Ga0496104_0024442_4208_4888 221
286 3300048907 Ga0496104_0325422 Ga0496104_0325422_712_1386 221
287 3300048907 Ga0496104_0630881 Ga0496104_0630881_100_771 221
288 3300048909 Ga0496106_0031581 Ga0496106_0031581_633_1340 221
289 3300048910 Ga0496107_0307304 Ga0496107_0307304_324_1031 221
290 3300048912 Ga0496109_0736047 Ga0496109_0736047_75_749 221
291 3300048913 Ga0496110_0061618 Ga0496110_0061618_2485_3150 221
292 3300048915 Ga0496112_0531873 Ga0496112_0531873_147_821 221
293 3300048916 Ga0496113_0538124 Ga0496113_0538124_226_891 221
294 3300048917 Ga0496114_0146119 Ga0496114_0146119_199_873 221
295 3300050514 nmdc:mga08x19_59017_c2 nmdc:mga08x19_59017_c2_1032_1736 221
296 3300006846 Ga0075430_100064546 Ga0075430_1000645462 222
297 3300006914 Ga0075436_100052786 Ga0075436_1000527863 222
298 3300014497 Ga0182008_10001531 Ga0182008_100015316 222
299 3300031090 Ga0265760_10017742 Ga0265760_100177422 222
300 3300035083 Ga0373926_0004598 Ga0373926_0004598_1569_2249 222
301 3300035170 Ga0373943_0302457 Ga0373943_0302457_61_741 222
302 3300035171 Ga0373946_0004259 Ga0373946_0004259_3822_4502 222
303 3300035695 Ga0373927_0015335 Ga0373927_0015335_1523_2203 222
304 3300035725 Ga0373947_0001902 Ga0373947_0001902_1092_1772 222
305 3300037068 Ga0373925_0000165 Ga0373925_0000165_28509_29189 222
306 3300042876 Ga0451577_0003762 Ga0451577_0003762_9835_10509 222
307 3300042876 Ga0451577_0064248 Ga0451577_0064248_1420_2094 222
308 3300042876 Ga0451577_0407021 Ga0451577_0407021_317_991 222
309 3300044673 Ga0453683_0004979 Ga0453683_0004979_5173_5847 222
310 3300044673 Ga0453683_0005490 Ga0453683_0005490_2256_2930 222
311 3300044673 Ga0453683_0251834 Ga0453683_0251834_150_824 222
312 3300044712 Ga0453684_0018504 Ga0453684_0018504_9748_10422 222
313 3300044712 Ga0453684_0096456 Ga0453684_0096456_1200_1874 222
314 3300044842 Ga0466957_0000410 Ga0466957_0000410_20229_20900 222
315 3300045051 Ga0451576_0018916 Ga0451576_0018916_3065_3739 222
316 3300045051 Ga0451576_0220067 Ga0451576_0220067_244_918 222
317 3300046517 Ga0495630_0087969 Ga0495630_0087969_1249_1929 222
318 3300046526 Ga0495666_0027633 Ga0495666_0027633_447_1127 222
319 3300047321 Ga0495676_0259262 Ga0495676_0259262_428_1108 222
320 3300048915 Ga0496112_0143818 Ga0496112_0143818_736_1404 222
321 3300049576 Ga0501040_0138574 Ga0501040_0138574_657_1337 222
322 3300050508 nmdc:mga09592_61422_c1 nmdc:mga09592_61422_c1_1144_1818 222
323 3300050509 nmdc:mga0qj67_207052_c1 nmdc:mga0qj67_207052_c1_415_1089 222
324 3300050514 nmdc:mga08x19_575_c1 nmdc:mga08x19_575_c1_18313_18993 222
325 3300054114 Ga0501084_0268223 Ga0501084_0268223_502_1182 222
326 3300005535 Ga0070684_100100259 Ga0070684_1001002593 223
327 3300005536 Ga0070697_100085791 Ga0070697_1000857912 223
328 3300006028 Ga0070717_10002339 Ga0070717_100023398 223
329 3300006237 Ga0097621_100000598 Ga0097621_1000005987 223
330 3300006358 Ga0068871_100025233 Ga0068871_1000252333 223
331 3300013296 Ga0157374_10386565 Ga0157374_103865652 223
332 3300014969 Ga0157376_10232048 Ga0157376_102320482 223
333 3300025939 Ga0207665_10112332 Ga0207665_101123321 223
334 3300026089 Ga0207648_10371630 Ga0207648_103716301 223
335 3300035695 Ga0373927_0054495 Ga0373927_0054495_330_1001 223
336 3300046472 Ga0495580_0000337 Ga0495580_0000337_5926_6597 223
337 3300046472 Ga0495580_0108116 Ga0495580_0108116_1089_1763 223
338 3300046531 Ga0495665_0025425 Ga0495665_0025425_530_1201 223
339 3300050513 nmdc:mga0rr50_251177_c1 nmdc:mga0rr50_251177_c1_535_1221 223
340 2162886012 MBSR1b_contig_201130 MBSR1b_0159.00005530 224
341 2162886012 MBSR1b_contig_3160416 MBSR1b_0787.00000330 224
342 3300000546 LJNas_1000129 LJNas_10001292 224
343 3300001976 JGI24752J21851_1006373 JGI24752J21851_10063732 224
344 3300001979 JGI24740J21852_10097993 JGI24740J21852_100979931 224
345 3300001990 JGI24737J22298_10034298 JGI24737J22298_100342982 224
346 3300001991 JGI24743J22301_10007079 JGI24743J22301_100070792 224
347 3300002239 JGI24034J26672_10000570 JGI24034J26672_100005705 224
348 3300002244 JGI24742J22300_10036682 JGI24742J22300_100366822 224
349 3300002459 JGI24751J29686_10023255 JGI24751J29686_100232551 224
350 3300005290 Ga0065712_10082264 Ga0065712_100822643 224
351 3300005293 Ga0065715_10004441 Ga0065715_100044413 224
352 3300005293 Ga0065715_10203251 Ga0065715_102032512 224
353 3300005295 Ga0065707_10164984 Ga0065707_101649842 224
354 3300005327 Ga0070658_10012517 Ga0070658_100125175 224
355 3300005327 Ga0070658_10172599 Ga0070658_101725992 224
356 3300005328 Ga0070676_10032029 Ga0070676_100320293 224
357 3300005328 Ga0070676_10092810 Ga0070676_100928101 224
358 3300005329 Ga0070683_100000180 Ga0070683_1000001809 224
359 3300005329 Ga0070683_100184739 Ga0070683_1001847392 224
360 3300005330 Ga0070690_100198034 Ga0070690_1001980341 224
361 3300005331 Ga0070670_100001706 Ga0070670_10000170611 224
362 3300005331 Ga0070670_100155017 Ga0070670_1001550172 224
363 3300005331 Ga0070670_100391214 Ga0070670_1003912142 224
364 3300005334 Ga0068869_100002390 Ga0068869_1000023906 224
365 3300005334 Ga0068869_100014353 Ga0068869_1000143532 224
366 3300005335 Ga0070666_10040208 Ga0070666_100402082 224
367 3300005336 Ga0070680_100163322 Ga0070680_1001633222 224
368 3300005336 Ga0070680_100201821 Ga0070680_1002018212 224
369 3300005337 Ga0070682_100047195 Ga0070682_1000471953 224
370 3300005337 Ga0070682_100108040 Ga0070682_1001080401 224
371 3300005338 Ga0068868_100002943 Ga0068868_1000029435 224
372 3300005338 Ga0068868_100019802 Ga0068868_1000198025 224
373 3300005338 Ga0068868_100051856 Ga0068868_1000518564 224
374 3300005338 Ga0068868_100261589 Ga0068868_1002615892 224
375 3300005339 Ga0070660_100240181 Ga0070660_1002401812 224
376 3300005339 Ga0070660_100522864 Ga0070660_1005228641 224
377 3300005340 Ga0070689_100016928 Ga0070689_1000169285 224
378 3300005340 Ga0070689_100170285 Ga0070689_1001702852 224
379 3300005343 Ga0070687_100023249 Ga0070687_1000232491 224
380 3300005344 Ga0070661_100000886 Ga0070661_10000088617 224
381 3300005344 Ga0070661_100226734 Ga0070661_1002267342 224
382 3300005345 Ga0070692_10463847 Ga0070692_104638471 224
383 3300005353 Ga0070669_100095707 Ga0070669_1000957072 224
384 3300005354 Ga0070675_100003414 Ga0070675_1000034143 224
385 3300005354 Ga0070675_100507415 Ga0070675_1005074151 224
386 3300005355 Ga0070671_100024798 Ga0070671_1000247983 224
387 3300005355 Ga0070671_100032659 Ga0070671_1000326594 224
388 3300005355 Ga0070671_100224112 Ga0070671_1002241122 224
389 3300005356 Ga0070674_100008141 Ga0070674_1000081414 224
390 3300005356 Ga0070674_100129520 Ga0070674_1001295202 224
391 3300005364 Ga0070673_100106371 Ga0070673_1001063712 224
392 3300005364 Ga0070673_100128982 Ga0070673_1001289822 224
393 3300005365 Ga0070688_100001337 Ga0070688_10000133710 224
394 3300005366 Ga0070659_100055418 Ga0070659_1000554183 224
395 3300005366 Ga0070659_100083237 Ga0070659_1000832372 224
396 3300005367 Ga0070667_100093961 Ga0070667_1000939611 224
397 3300005434 Ga0070709_10015131 Ga0070709_100151315 224
398 3300005434 Ga0070709_10084591 Ga0070709_100845912 224
399 3300005434 Ga0070709_10147207 Ga0070709_101472072 224
400 3300005434 Ga0070709_10170516 Ga0070709_101705161 224
401 3300005434 Ga0070709_10170725 Ga0070709_101707252 224
402 3300005435 Ga0070714_100001114 Ga0070714_1000011143 224
403 3300005435 Ga0070714_100016666 Ga0070714_1000166663 224
404 3300005435 Ga0070714_100224122 Ga0070714_1002241222 224
405 3300005436 Ga0070713_100000543 Ga0070713_10000054319 224
406 3300005436 Ga0070713_100002121 Ga0070713_1000021216 224
407 3300005436 Ga0070713_100029017 Ga0070713_1000290174 224
408 3300005436 Ga0070713_100037336 Ga0070713_1000373363 224
409 3300005436 Ga0070713_100040170 Ga0070713_1000401703 224
410 3300005436 Ga0070713_100084638 Ga0070713_1000846382 224
411 3300005436 Ga0070713_100148407 Ga0070713_1001484072 224
412 3300005436 Ga0070713_100204515 Ga0070713_1002045152 224
413 3300005436 Ga0070713_100277423 Ga0070713_1002774232 224
414 3300005436 Ga0070713_100309252 Ga0070713_1003092521 224
415 3300005436 Ga0070713_100365107 Ga0070713_1003651072 224
416 3300005437 Ga0070710_10002568 Ga0070710_100025688 224
417 3300005438 Ga0070701_10017180 Ga0070701_100171801 224
418 3300005439 Ga0070711_100015078 Ga0070711_1000150782 224
419 3300005439 Ga0070711_100176790 Ga0070711_1001767902 224
420 3300005439 Ga0070711_100279643 Ga0070711_1002796432 224
421 3300005439 Ga0070711_100569782 Ga0070711_1005697821 224
422 3300005439 Ga0070711_100590184 Ga0070711_1005901842 224
423 3300005441 Ga0070700_100312578 Ga0070700_1003125782 224
424 3300005445 Ga0070708_100000527 Ga0070708_10000052713 224
425 3300005445 Ga0070708_100001078 Ga0070708_1000010784 224
426 3300005445 Ga0070708_100013160 Ga0070708_1000131608 224
427 3300005445 Ga0070708_100035100 Ga0070708_1000351002 224
428 3300005445 Ga0070708_100055104 Ga0070708_1000551042 224
429 3300005445 Ga0070708_100066072 Ga0070708_1000660721 224
430 3300005445 Ga0070708_100114938 Ga0070708_1001149382 224
431 3300005445 Ga0070708_100206787 Ga0070708_1002067872 224
432 3300005445 Ga0070708_100357972 Ga0070708_1003579722 224
433 3300005455 Ga0070663_100032756 Ga0070663_1000327564 224
434 3300005455 Ga0070663_100589773 Ga0070663_1005897731 224
435 3300005456 Ga0070678_100355225 Ga0070678_1003552252 224
436 3300005457 Ga0070662_100225056 Ga0070662_1002250561 224
437 3300005458 Ga0070681_10000513 Ga0070681_1000051322 224
438 3300005458 Ga0070681_10001443 Ga0070681_100014435 224
439 3300005458 Ga0070681_10071265 Ga0070681_100712654 224
440 3300005459 Ga0068867_100016708 Ga0068867_1000167085 224
441 3300005459 Ga0068867_100053195 Ga0068867_1000531952 224
442 3300005459 Ga0068867_100428822 Ga0068867_1004288222 224
443 3300005466 Ga0070685_10001585 Ga0070685_100015855 224
444 3300005466 Ga0070685_10238101 Ga0070685_102381011 224
445 3300005467 Ga0070706_100000991 Ga0070706_10000099112 224
446 3300005467 Ga0070706_100094200 Ga0070706_1000942002 224
447 3300005467 Ga0070706_100113003 Ga0070706_1001130032 224
448 3300005467 Ga0070706_100204128 Ga0070706_1002041282 224
449 3300005468 Ga0070707_100001774 Ga0070707_1000017742 224
450 3300005468 Ga0070707_100062473 Ga0070707_1000624733 224
451 3300005468 Ga0070707_100072935 Ga0070707_1000729353 224
452 3300005468 Ga0070707_100535678 Ga0070707_1005356782 224
453 3300005468 Ga0070707_100569754 Ga0070707_1005697542 224
454 3300005471 Ga0070698_100000182 Ga0070698_10000018223 224
455 3300005471 Ga0070698_100012583 Ga0070698_1000125833 224
456 3300005471 Ga0070698_100389727 Ga0070698_1003897272 224
457 3300005471 Ga0070698_100791264 Ga0070698_1007912641 224
458 3300005518 Ga0070699_100088406 Ga0070699_1000884062 224
459 3300005530 Ga0070679_100008087 Ga0070679_1000080874 224
460 3300005530 Ga0070679_100151665 Ga0070679_1001516652 224
461 3300005535 Ga0070684_100007581 Ga0070684_1000075812 224
462 3300005535 Ga0070684_100034929 Ga0070684_1000349295 224
463 3300005535 Ga0070684_100089161 Ga0070684_1000891612 224
464 3300005535 Ga0070684_100338931 Ga0070684_1003389311 224
465 3300005536 Ga0070697_100004056 Ga0070697_1000040566 224
466 3300005536 Ga0070697_100008463 Ga0070697_1000084636 224
467 3300005536 Ga0070697_100131291 Ga0070697_1001312913 224
468 3300005536 Ga0070697_100238772 Ga0070697_1002387722 224
469 3300005536 Ga0070697_100506852 Ga0070697_1005068521 224
470 3300005539 Ga0068853_100065061 Ga0068853_1000650613 224
471 3300005539 Ga0068853_100083675 Ga0068853_1000836752 224
472 3300005539 Ga0068853_100111845 Ga0068853_1001118452 224
473 3300005539 Ga0068853_100254637 Ga0068853_1002546371 224
474 3300005543 Ga0070672_100133123 Ga0070672_1001331231 224
475 3300005543 Ga0070672_100381838 Ga0070672_1003818381 224
476 3300005544 Ga0070686_100036014 Ga0070686_1000360143 224
477 3300005547 Ga0070693_100159312 Ga0070693_1001593122 224
478 3300005547 Ga0070693_100465557 Ga0070693_1004655572 224
479 3300005563 Ga0068855_100000412 Ga0068855_10000041233 224
480 3300005563 Ga0068855_100000425 Ga0068855_10000042517 224
481 3300005563 Ga0068855_100018276 Ga0068855_1000182764 224
482 3300005563 Ga0068855_100062777 Ga0068855_1000627773 224
483 3300005564 Ga0070664_100005786 Ga0070664_10000578610 224
484 3300005564 Ga0070664_100047341 Ga0070664_1000473412 224
485 3300005564 Ga0070664_100082144 Ga0070664_1000821442 224
486 3300005577 Ga0068857_100002572 Ga0068857_1000025727 224
487 3300005577 Ga0068857_100003408 Ga0068857_1000034082 224
488 3300005577 Ga0068857_100005929 Ga0068857_1000059297 224
489 3300005577 Ga0068857_100372991 Ga0068857_1003729912 224
490 3300005577 Ga0068857_100574953 Ga0068857_1005749532 224
491 3300005578 Ga0068854_100004475 Ga0068854_1000044757 224
492 3300005578 Ga0068854_100014550 Ga0068854_1000145502 224
493 3300005578 Ga0068854_100020751 Ga0068854_1000207512 224
494 3300005614 Ga0068856_100000670 Ga0068856_1000006707 224
495 3300005614 Ga0068856_100000708 Ga0068856_1000007084 224
496 3300005614 Ga0068856_100001577 Ga0068856_1000015777 224
497 3300005614 Ga0068856_100003544 Ga0068856_1000035445 224
498 3300005614 Ga0068856_100006243 Ga0068856_10000624310 224
499 3300005614 Ga0068856_100009111 Ga0068856_1000091117 224
500 3300005614 Ga0068856_100066387 Ga0068856_1000663873 224
501 3300005614 Ga0068856_100198992 Ga0068856_1001989922 224
502 3300005614 Ga0068856_100245198 Ga0068856_1002451982 224
503 3300005614 Ga0068856_100350195 Ga0068856_1003501952 224
504 3300005615 Ga0070702_100004396 Ga0070702_1000043963 224
505 3300005615 Ga0070702_100082649 Ga0070702_1000826492 224
506 3300005616 Ga0068852_100002637 Ga0068852_1000026376 224
507 3300005616 Ga0068852_100104839 Ga0068852_1001048392 224
508 3300005616 Ga0068852_100107391 Ga0068852_1001073913 224
509 3300005616 Ga0068852_100282013 Ga0068852_1002820132 224
510 3300005617 Ga0068859_100000279 Ga0068859_10000027938 224
511 3300005617 Ga0068859_100015855 Ga0068859_1000158556 224
512 3300005617 Ga0068859_100277541 Ga0068859_1002775412 224
513 3300005618 Ga0068864_100000722 Ga0068864_10000072221 224
514 3300005618 Ga0068864_100015807 Ga0068864_1000158075 224
515 3300005618 Ga0068864_100046245 Ga0068864_1000462454 224
516 3300005718 Ga0068866_10001418 Ga0068866_100014183 224
517 3300005718 Ga0068866_10005261 Ga0068866_100052614 224
518 3300005718 Ga0068866_10008503 Ga0068866_100085034 224
519 3300005719 Ga0068861_100051927 Ga0068861_1000519272 224
520 3300005719 Ga0068861_100175545 Ga0068861_1001755452 224
521 3300005834 Ga0068851_10015362 Ga0068851_100153622 224
522 3300005834 Ga0068851_10253493 Ga0068851_102534932 224
523 3300005840 Ga0068870_10003763 Ga0068870_100037635 224
524 3300005840 Ga0068870_10056296 Ga0068870_100562962 224
525 3300005841 Ga0068863_100002208 Ga0068863_10000220813 224
526 3300005841 Ga0068863_100015579 Ga0068863_1000155792 224
527 3300005841 Ga0068863_100155975 Ga0068863_1001559752 224
528 3300005841 Ga0068863_100184605 Ga0068863_1001846052 224
529 3300005841 Ga0068863_100290982 Ga0068863_1002909822 224
530 3300005842 Ga0068858_100002272 Ga0068858_1000022722 224
531 3300005842 Ga0068858_100033976 Ga0068858_1000339765 224
532 3300005842 Ga0068858_100152304 Ga0068858_1001523042 224
533 3300005842 Ga0068858_100189865 Ga0068858_1001898652 224
534 3300005842 Ga0068858_100236897 Ga0068858_1002368972 224
535 3300005842 Ga0068858_100399579 Ga0068858_1003995792 224
536 3300005843 Ga0068860_100007256 Ga0068860_1000072569 224
537 3300005843 Ga0068860_100059449 Ga0068860_1000594492 224
538 3300005843 Ga0068860_100323717 Ga0068860_1003237172 224
539 3300005844 Ga0068862_100048413 Ga0068862_1000484132 224
540 3300005844 Ga0068862_100151358 Ga0068862_1001513583 224
541 3300005844 Ga0068862_100276330 Ga0068862_1002763302 224
542 3300005983 Ga0081540_1025691 Ga0081540_10256914 224
543 3300006028 Ga0070717_10000577 Ga0070717_1000057716 224
544 3300006028 Ga0070717_10003511 Ga0070717_100035113 224
545 3300006028 Ga0070717_10036520 Ga0070717_100365202 224
546 3300006028 Ga0070717_10055045 Ga0070717_100550452 224
547 3300006028 Ga0070717_10094410 Ga0070717_100944102 224
548 3300006028 Ga0070717_10101727 Ga0070717_101017273 224
549 3300006028 Ga0070717_10115354 Ga0070717_101153542 224
550 3300006028 Ga0070717_10198558 Ga0070717_101985582 224
551 3300006028 Ga0070717_10206549 Ga0070717_102065492 224
552 3300006028 Ga0070717_10446116 Ga0070717_104461161 224
553 3300006028 Ga0070717_10516524 Ga0070717_105165242 224
554 3300006028 Ga0070717_10562457 Ga0070717_105624571 224
555 3300006163 Ga0070715_10037645 Ga0070715_100376452 224
556 3300006163 Ga0070715_10042767 Ga0070715_100427672 224
557 3300006173 Ga0070716_100028903 Ga0070716_1000289033 224
558 3300006173 Ga0070716_100155304 Ga0070716_1001553042 224
559 3300006173 Ga0070716_100240696 Ga0070716_1002406961 224
560 3300006175 Ga0070712_100002033 Ga0070712_1000020337 224
561 3300006175 Ga0070712_100003822 Ga0070712_1000038227 224
562 3300006175 Ga0070712_100014441 Ga0070712_1000144414 224
563 3300006175 Ga0070712_100752610 Ga0070712_1007526101 224
564 3300006237 Ga0097621_100000210 Ga0097621_10000021021 224
565 3300006237 Ga0097621_100001848 Ga0097621_10000184812 224
566 3300006237 Ga0097621_100006416 Ga0097621_1000064163 224
567 3300006237 Ga0097621_100030212 Ga0097621_1000302121 224
568 3300006237 Ga0097621_100149672 Ga0097621_1001496721 224
569 3300006237 Ga0097621_100569956 Ga0097621_1005699562 224
570 3300006358 Ga0068871_100000168 Ga0068871_10000016823 224
571 3300006358 Ga0068871_100000745 Ga0068871_10000074514 224
572 3300006358 Ga0068871_100000787 Ga0068871_10000078720 224
573 3300006358 Ga0068871_100022428 Ga0068871_1000224285 224
574 3300006358 Ga0068871_100046525 Ga0068871_1000465254 224
575 3300006358 Ga0068871_100339426 Ga0068871_1003394262 224
576 3300006358 Ga0068871_100515283 Ga0068871_1005152832 224
577 3300006852 Ga0075433_10005922 Ga0075433_100059228 224
578 3300006871 Ga0075434_100000246 Ga0075434_10000024615 224
579 3300006871 Ga0075434_100261670 Ga0075434_1002616702 224
580 3300006881 Ga0068865_100004430 Ga0068865_1000044302 224
581 3300006881 Ga0068865_100005649 Ga0068865_1000056495 224
582 3300006881 Ga0068865_100059134 Ga0068865_1000591342 224
583 3300006881 Ga0068865_100076875 Ga0068865_1000768752 224
584 3300006914 Ga0075436_100009403 Ga0075436_1000094032 224
585 3300006931 Ga0097620_100000279 Ga0097620_10000027938 224
586 3300006931 Ga0097620_100015855 Ga0097620_1000158556 224
587 3300006931 Ga0097620_100277530 Ga0097620_1002775302 224
588 3300007076 Ga0075435_100003413 Ga0075435_1000034137 224
589 3300007265 Ga0099794_10013220 Ga0099794_100132204 224
590 3300007265 Ga0099794_10027987 Ga0099794_100279874 224
591 3300007265 Ga0099794_10032987 Ga0099794_100329873 224
592 3300007265 Ga0099794_10070247 Ga0099794_100702472 224
593 3300007265 Ga0099794_10312516 Ga0099794_103125162 224
594 3300009092 Ga0105250_10023835 Ga0105250_100238352 224
595 3300009093 Ga0105240_10133132 Ga0105240_101331322 224
596 3300009093 Ga0105240_10142711 Ga0105240_101427112 224
597 3300009093 Ga0105240_10180234 Ga0105240_101802342 224
598 3300009093 Ga0105240_10198550 Ga0105240_101985503 224
599 3300009093 Ga0105240_10234012 Ga0105240_102340121 224
600 3300009094 Ga0111539_10296716 Ga0111539_102967162 224
601 3300009098 Ga0105245_10005402 Ga0105245_100054022 224
602 3300009098 Ga0105245_10006763 Ga0105245_100067638 224
603 3300009098 Ga0105245_10040838 Ga0105245_100408382 224
604 3300009098 Ga0105245_10056423 Ga0105245_100564233 224
605 3300009101 Ga0105247_10009853 Ga0105247_100098532 224
606 3300009147 Ga0114129_10069552 Ga0114129_100695524 224
607 3300009174 Ga0105241_10003965 Ga0105241_100039653 224
608 3300009174 Ga0105241_10009776 Ga0105241_100097766 224
609 3300009174 Ga0105241_10014319 Ga0105241_100143193 224
610 3300009174 Ga0105241_10080020 Ga0105241_100800204 224
611 3300009174 Ga0105241_10417172 Ga0105241_104171722 224
612 3300009176 Ga0105242_10093037 Ga0105242_100930372 224
613 3300009176 Ga0105242_10296485 Ga0105242_102964852 224
614 3300009176 Ga0105242_10329709 Ga0105242_103297092 224
615 3300009177 Ga0105248_10075041 Ga0105248_100750414 224
616 3300009177 Ga0105248_10111193 Ga0105248_101111932 224
617 3300009177 Ga0105248_10279014 Ga0105248_102790142 224
618 3300009177 Ga0105248_10498440 Ga0105248_104984402 224
619 3300009177 Ga0105248_10703549 Ga0105248_107035492 224
620 3300009545 Ga0105237_10050649 Ga0105237_100506492 224
621 3300009545 Ga0105237_10052099 Ga0105237_100520993 224
622 3300009545 Ga0105237_10166347 Ga0105237_101663472 224
623 3300009545 Ga0105237_10252481 Ga0105237_102524812 224
624 3300009551 Ga0105238_10000382 Ga0105238_1000038232 224
625 3300009551 Ga0105238_10038278 Ga0105238_100382783 224
626 3300009551 Ga0105238_10056428 Ga0105238_100564282 224
627 3300009553 Ga0105249_10002069 Ga0105249_1000206914 224
628 3300009553 Ga0105249_10027251 Ga0105249_100272512 224
629 3300010159 Ga0099796_10089984 Ga0099796_100899842 224
630 3300010375 Ga0105239_10008900 Ga0105239_100089002 224
631 3300010375 Ga0105239_10025445 Ga0105239_100254453 224
632 3300010375 Ga0105239_10071895 Ga0105239_100718952 224
633 3300010375 Ga0105239_10252226 Ga0105239_102522262 224
634 3300010375 Ga0105239_10276784 Ga0105239_102767842 224
635 3300010375 Ga0105239_10586432 Ga0105239_105864322 224
636 3300011119 Ga0105246_10005905 Ga0105246_100059055 224
637 3300013100 Ga0157373_10001551 Ga0157373_100015518 224
638 3300013100 Ga0157373_10002773 Ga0157373_100027737 224
639 3300013100 Ga0157373_10037161 Ga0157373_100371614 224
640 3300013102 Ga0157371_10002011 Ga0157371_100020118 224
641 3300013102 Ga0157371_10091878 Ga0157371_100918782 224
642 3300013104 Ga0157370_10041226 Ga0157370_100412264 224
643 3300013104 Ga0157370_10041413 Ga0157370_100414132 224
644 3300013104 Ga0157370_10386571 Ga0157370_103865712 224
645 3300013104 Ga0157370_10460855 Ga0157370_104608552 224
646 3300013105 Ga0157369_10000269 Ga0157369_1000026942 224
647 3300013105 Ga0157369_10005474 Ga0157369_100054749 224
648 3300013105 Ga0157369_10006683 Ga0157369_100066835 224
649 3300013105 Ga0157369_10011776 Ga0157369_100117764 224
650 3300013105 Ga0157369_10032265 Ga0157369_100322652 224
651 3300013105 Ga0157369_10252497 Ga0157369_102524972 224
652 3300013296 Ga0157374_10000436 Ga0157374_1000043623 224
653 3300013296 Ga0157374_10001029 Ga0157374_1000102923 224
654 3300013296 Ga0157374_10001822 Ga0157374_1000182218 224
655 3300013296 Ga0157374_10034779 Ga0157374_100347795 224
656 3300013296 Ga0157374_10223184 Ga0157374_102231841 224
657 3300013296 Ga0157374_10269873 Ga0157374_102698731 224
658 3300013297 Ga0157378_10000014 Ga0157378_1000001438 224
659 3300013297 Ga0157378_10000344 Ga0157378_1000034434 224
660 3300013297 Ga0157378_10000413 Ga0157378_1000041322 224
661 3300013297 Ga0157378_10007193 Ga0157378_100071934 224
662 3300013297 Ga0157378_10047597 Ga0157378_100475973 224
663 3300013297 Ga0157378_10084794 Ga0157378_100847943 224
664 3300013306 Ga0163162_10004542 Ga0163162_100045425 224
665 3300013306 Ga0163162_10048955 Ga0163162_100489553 224
666 3300013306 Ga0163162_10092562 Ga0163162_100925623 224
667 3300013306 Ga0163162_10370132 Ga0163162_103701322 224
668 3300013306 Ga0163162_10505475 Ga0163162_105054752 224
669 3300013306 Ga0163162_11105459 Ga0163162_111054591 224
670 3300013307 Ga0157372_10000423 Ga0157372_1000042323 224
671 3300013307 Ga0157372_10000641 Ga0157372_100006417 224
672 3300013307 Ga0157372_10004039 Ga0157372_100040397 224
673 3300013307 Ga0157372_10015715 Ga0157372_100157153 224
674 3300013307 Ga0157372_10016602 Ga0157372_100166023 224
675 3300013307 Ga0157372_10022824 Ga0157372_100228242 224
676 3300013307 Ga0157372_10062666 Ga0157372_100626663 224
677 3300013307 Ga0157372_10198939 Ga0157372_101989392 224
678 3300013308 Ga0157375_10044150 Ga0157375_100441503 224
679 3300014325 Ga0163163_10026605 Ga0163163_100266052 224
680 3300014325 Ga0163163_10027299 Ga0163163_100272992 224
681 3300014325 Ga0163163_10386177 Ga0163163_103861772 224
682 3300014497 Ga0182008_10009750 Ga0182008_100097503 224
683 3300014745 Ga0157377_10023683 Ga0157377_100236833 224
684 3300014745 Ga0157377_10166543 Ga0157377_101665432 224
685 3300014745 Ga0157377_10438598 Ga0157377_104385981 224
686 3300014968 Ga0157379_10031809 Ga0157379_100318095 224
687 3300014968 Ga0157379_10035204 Ga0157379_100352044 224
688 3300014968 Ga0157379_10291860 Ga0157379_102918602 224
689 3300014969 Ga0157376_10014425 Ga0157376_100144255 224
690 3300014969 Ga0157376_10045515 Ga0157376_100455153 224
691 3300014969 Ga0157376_10071439 Ga0157376_100714392 224
692 3300015262 Ga0182007_10014472 Ga0182007_100144723 224
693 3300022730 Ga0224570_100631 Ga0224570_1006312 224
694 3300022732 Ga0224569_100133 Ga0224569_1001332 224
695 3300024225 Ga0224572_1000066 Ga0224572_10000663 224
696 3300024225 Ga0224572_1001114 Ga0224572_10011143 224
697 3300024225 Ga0224572_1009514 Ga0224572_10095142 224
698 3300024227 Ga0228598_1001112 Ga0228598_10011123 224
699 3300025315 Ga0207697_10002788 Ga0207697_100027883 224
700 3300025321 Ga0207656_10130194 Ga0207656_101301942 224
701 3300025898 Ga0207692_10010221 Ga0207692_100102214 224
702 3300025899 Ga0207642_10002117 Ga0207642_100021176 224
703 3300025899 Ga0207642_10014622 Ga0207642_100146224 224
704 3300025900 Ga0207710_10085390 Ga0207710_100853902 224
705 3300025901 Ga0207688_10019381 Ga0207688_100193814 224
706 3300025903 Ga0207680_10044690 Ga0207680_100446902 224
707 3300025903 Ga0207680_10330027 Ga0207680_103300272 224
708 3300025904 Ga0207647_10001477 Ga0207647_100014772 224
709 3300025904 Ga0207647_10006683 Ga0207647_100066837 224
710 3300025904 Ga0207647_10022413 Ga0207647_100224134 224
711 3300025905 Ga0207685_10072896 Ga0207685_100728962 224
712 3300025906 Ga0207699_10018440 Ga0207699_100184403 224
713 3300025906 Ga0207699_10058663 Ga0207699_100586632 224
714 3300025906 Ga0207699_10108927 Ga0207699_101089272 224
715 3300025906 Ga0207699_10373471 Ga0207699_103734712 224
716 3300025907 Ga0207645_10000181 Ga0207645_1000018124 224
717 3300025908 Ga0207643_10000474 Ga0207643_100004749 224
718 3300025908 Ga0207643_10097731 Ga0207643_100977312 224
719 3300025909 Ga0207705_10255787 Ga0207705_102557872 224
720 3300025910 Ga0207684_10001275 Ga0207684_1000127516 224
721 3300025910 Ga0207684_10081331 Ga0207684_100813312 224
722 3300025910 Ga0207684_10178688 Ga0207684_101786882 224
723 3300025911 Ga0207654_10002582 Ga0207654_100025826 224
724 3300025911 Ga0207654_10014318 Ga0207654_100143183 224
725 3300025911 Ga0207654_10123841 Ga0207654_101238412 224
726 3300025912 Ga0207707_10000828 Ga0207707_1000082811 224
727 3300025912 Ga0207707_10038831 Ga0207707_100388314 224
728 3300025912 Ga0207707_10081955 Ga0207707_100819552 224
729 3300025912 Ga0207707_10099151 Ga0207707_100991512 224
730 3300025913 Ga0207695_10077718 Ga0207695_100777181 224
731 3300025913 Ga0207695_10171125 Ga0207695_101711252 224
732 3300025913 Ga0207695_10323787 Ga0207695_103237872 224
733 3300025914 Ga0207671_10070131 Ga0207671_100701313 224
734 3300025914 Ga0207671_10131435 Ga0207671_101314352 224
735 3300025914 Ga0207671_10156068 Ga0207671_101560682 224
736 3300025914 Ga0207671_10464186 Ga0207671_104641861 224
737 3300025915 Ga0207693_10000090 Ga0207693_1000009026 224
738 3300025915 Ga0207693_10000621 Ga0207693_100006212 224
739 3300025915 Ga0207693_10013135 Ga0207693_100131352 224
740 3300025915 Ga0207693_10037643 Ga0207693_100376433 224
741 3300025915 Ga0207693_10107683 Ga0207693_101076833 224
742 3300025916 Ga0207663_10033068 Ga0207663_100330684 224
743 3300025916 Ga0207663_10034666 Ga0207663_100346662 224
744 3300025916 Ga0207663_10149945 Ga0207663_101499453 224
745 3300025916 Ga0207663_10489488 Ga0207663_104894881 224
746 3300025917 Ga0207660_10185955 Ga0207660_101859552 224
747 3300025918 Ga0207662_10001688 Ga0207662_100016885 224
748 3300025919 Ga0207657_10005643 Ga0207657_100056434 224
749 3300025919 Ga0207657_10007963 Ga0207657_100079637 224
750 3300025920 Ga0207649_10000343 Ga0207649_1000034329 224
751 3300025921 Ga0207652_10120800 Ga0207652_101208002 224
752 3300025922 Ga0207646_10002760 Ga0207646_100027608 224
753 3300025922 Ga0207646_10007451 Ga0207646_100074513 224
754 3300025922 Ga0207646_10039981 Ga0207646_100399813 224
755 3300025922 Ga0207646_10103730 Ga0207646_101037303 224
756 3300025923 Ga0207681_10020312 Ga0207681_100203123 224
757 3300025924 Ga0207694_10000430 Ga0207694_1000043014 224
758 3300025924 Ga0207694_10043179 Ga0207694_100431793 224
759 3300025925 Ga0207650_10000223 Ga0207650_1000022324 224
760 3300025925 Ga0207650_10000224 Ga0207650_1000022413 224
761 3300025925 Ga0207650_10000296 Ga0207650_1000029613 224
762 3300025925 Ga0207650_10001691 Ga0207650_100016919 224
763 3300025925 Ga0207650_10289026 Ga0207650_102890262 224
764 3300025926 Ga0207659_10470005 Ga0207659_104700052 224
765 3300025927 Ga0207687_10017030 Ga0207687_100170305 224
766 3300025927 Ga0207687_10385996 Ga0207687_103859962 224
767 3300025928 Ga0207700_10002203 Ga0207700_100022032 224
768 3300025928 Ga0207700_10072614 Ga0207700_100726144 224
769 3300025928 Ga0207700_10073782 Ga0207700_100737822 224
770 3300025928 Ga0207700_10105374 Ga0207700_101053743 224
771 3300025928 Ga0207700_10180398 Ga0207700_101803982 224
772 3300025928 Ga0207700_10255170 Ga0207700_102551702 224
773 3300025928 Ga0207700_10287849 Ga0207700_102878492 224
774 3300025928 Ga0207700_10298476 Ga0207700_102984762 224
775 3300025928 Ga0207700_10359701 Ga0207700_103597012 224
776 3300025928 Ga0207700_10360539 Ga0207700_103605391 224
777 3300025928 Ga0207700_10405700 Ga0207700_104057002 224
778 3300025928 Ga0207700_10650271 Ga0207700_106502711 224
779 3300025929 Ga0207664_10002844 Ga0207664_100028448 224
780 3300025929 Ga0207664_10011335 Ga0207664_100113354 224
781 3300025929 Ga0207664_10241814 Ga0207664_102418142 224
782 3300025931 Ga0207644_10007871 Ga0207644_100078716 224
783 3300025931 Ga0207644_10108673 Ga0207644_101086732 224
784 3300025932 Ga0207690_10033784 Ga0207690_100337842 224
785 3300025932 Ga0207690_10317592 Ga0207690_103175922 224
786 3300025932 Ga0207690_10358566 Ga0207690_103585661 224
787 3300025933 Ga0207706_10000613 Ga0207706_1000061316 224
788 3300025933 Ga0207706_10015847 Ga0207706_100158473 224
789 3300025934 Ga0207686_10126583 Ga0207686_101265832 224
790 3300025936 Ga0207670_10181872 Ga0207670_101818722 224
791 3300025936 Ga0207670_10320786 Ga0207670_103207861 224
792 3300025938 Ga0207704_10054816 Ga0207704_100548162 224
793 3300025938 Ga0207704_10080675 Ga0207704_100806753 224
794 3300025938 Ga0207704_10494860 Ga0207704_104948602 224
795 3300025939 Ga0207665_10047330 Ga0207665_100473302 224
796 3300025939 Ga0207665_10083112 Ga0207665_100831123 224
797 3300025940 Ga0207691_10000345 Ga0207691_1000034524 224
798 3300025940 Ga0207691_10296071 Ga0207691_102960711 224
799 3300025941 Ga0207711_10125650 Ga0207711_101256502 224
800 3300025941 Ga0207711_10248782 Ga0207711_102487822 224
801 3300025942 Ga0207689_10000499 Ga0207689_100004999 224
802 3300025942 Ga0207689_10001621 Ga0207689_1000162114 224
803 3300025942 Ga0207689_10063023 Ga0207689_100630232 224
804 3300025944 Ga0207661_10001212 Ga0207661_1000121214 224
805 3300025944 Ga0207661_10161297 Ga0207661_101612972 224
806 3300025945 Ga0207679_10000115 Ga0207679_1000011538 224
807 3300025945 Ga0207679_10001482 Ga0207679_100014829 224
808 3300025949 Ga0207667_10000311 Ga0207667_1000031117 224
809 3300025949 Ga0207667_10005374 Ga0207667_1000537413 224
810 3300025949 Ga0207667_10028850 Ga0207667_100288506 224
811 3300025949 Ga0207667_10113360 Ga0207667_101133602 224
812 3300025949 Ga0207667_10142497 Ga0207667_101424972 224
813 3300025949 Ga0207667_10537447 Ga0207667_105374471 224
814 3300025949 Ga0207667_10723811 Ga0207667_107238112 224
815 3300025949 Ga0207667_10964156 Ga0207667_109641561 224
816 3300025960 Ga0207651_10003483 Ga0207651_100034836 224
817 3300025961 Ga0207712_10051568 Ga0207712_100515684 224
818 3300025972 Ga0207668_10103914 Ga0207668_101039141 224
819 3300025981 Ga0207640_10003104 Ga0207640_100031047 224
820 3300025981 Ga0207640_10030028 Ga0207640_100300283 224
821 3300025981 Ga0207640_10159412 Ga0207640_101594122 224
822 3300025981 Ga0207640_10363623 Ga0207640_103636231 224
823 3300025981 Ga0207640_10505528 Ga0207640_105055281 224
824 3300025986 Ga0207658_10007316 Ga0207658_100073166 224
825 3300025986 Ga0207658_10393707 Ga0207658_103937072 224
826 3300026023 Ga0207677_10002452 Ga0207677_100024529 224
827 3300026023 Ga0207677_10017631 Ga0207677_100176314 224
828 3300026023 Ga0207677_10053564 Ga0207677_100535642 224
829 3300026023 Ga0207677_10055683 Ga0207677_100556834 224
830 3300026023 Ga0207677_10569747 Ga0207677_105697471 224
831 3300026023 Ga0207677_10593511 Ga0207677_105935112 224
832 3300026035 Ga0207703_10001667 Ga0207703_100016672 224
833 3300026035 Ga0207703_10006667 Ga0207703_100066677 224
834 3300026035 Ga0207703_10067935 Ga0207703_100679353 224
835 3300026035 Ga0207703_10365821 Ga0207703_103658212 224
836 3300026035 Ga0207703_10712240 Ga0207703_107122402 224
837 3300026041 Ga0207639_10092099 Ga0207639_100920992 224
838 3300026041 Ga0207639_11077881 Ga0207639_110778811 224
839 3300026067 Ga0207678_10000130 Ga0207678_1000013024 224
840 3300026075 Ga0207708_10375804 Ga0207708_103758042 224
841 3300026078 Ga0207702_10000722 Ga0207702_1000072213 224
842 3300026078 Ga0207702_10001654 Ga0207702_1000165418 224
843 3300026078 Ga0207702_10002343 Ga0207702_100023437 224
844 3300026078 Ga0207702_10002543 Ga0207702_100025435 224
845 3300026078 Ga0207702_10070027 Ga0207702_100700272 224
846 3300026078 Ga0207702_10070347 Ga0207702_100703473 224
847 3300026078 Ga0207702_10176331 Ga0207702_101763312 224
848 3300026078 Ga0207702_10184663 Ga0207702_101846631 224
849 3300026078 Ga0207702_10196100 Ga0207702_101961002 224
850 3300026078 Ga0207702_10839055 Ga0207702_108390552 224
851 3300026088 Ga0207641_10000287 Ga0207641_1000028724 224
852 3300026088 Ga0207641_10002584 Ga0207641_1000258410 224
853 3300026088 Ga0207641_10031067 Ga0207641_100310676 224
854 3300026088 Ga0207641_10111882 Ga0207641_101118823 224
855 3300026088 Ga0207641_10141200 Ga0207641_101412002 224
856 3300026088 Ga0207641_10305177 Ga0207641_103051772 224
857 3300026089 Ga0207648_10001253 Ga0207648_1000125323 224
858 3300026089 Ga0207648_10159247 Ga0207648_101592472 224
859 3300026095 Ga0207676_10000115 Ga0207676_1000011519 224
860 3300026095 Ga0207676_10003051 Ga0207676_1000305112 224
861 3300026095 Ga0207676_10035713 Ga0207676_100357132 224
862 3300026095 Ga0207676_10412252 Ga0207676_104122522 224
863 3300026116 Ga0207674_10000788 Ga0207674_100007885 224
864 3300026116 Ga0207674_10001340 Ga0207674_1000134019 224
865 3300026116 Ga0207674_10007893 Ga0207674_100078937 224
866 3300026116 Ga0207674_10487679 Ga0207674_104876792 224
867 3300026116 Ga0207674_10586096 Ga0207674_105860962 224
868 3300026121 Ga0207683_10000217 Ga0207683_1000021725 224
869 3300026121 Ga0207683_10291083 Ga0207683_102910832 224
870 3300026142 Ga0207698_10101020 Ga0207698_101010203 224
871 3300026142 Ga0207698_10149736 Ga0207698_101497362 224
872 3300026142 Ga0207698_10199580 Ga0207698_101995802 224
873 3300026142 Ga0207698_10447055 Ga0207698_104470551 224
874 3300027512 Ga0209179_1043846 Ga0209179_10438461 224
875 3300027671 Ga0209588_1016400 Ga0209588_10164002 224
876 3300027671 Ga0209588_1070111 Ga0209588_10701112 224
877 3300028017 Ga0265356_1000344 Ga0265356_10003449 224
878 3300028379 Ga0268266_10000761 Ga0268266_1000076116 224
879 3300028380 Ga0268265_10073055 Ga0268265_100730552 224
880 3300028380 Ga0268265_10296460 Ga0268265_102964602 224
881 3300028381 Ga0268264_10004971 Ga0268264_100049713 224
882 3300028381 Ga0268264_10044778 Ga0268264_100447782 224
883 3300028381 Ga0268264_10046056 Ga0268264_100460564 224
884 3300028381 Ga0268264_10257370 Ga0268264_102573702 224
885 3300028800 Ga0265338_10001801 Ga0265338_1000180120 224
886 3300028800 Ga0265338_10010396 Ga0265338_100103963 224
887 3300028800 Ga0265338_10080138 Ga0265338_100801383 224
888 3300028800 Ga0265338_10132286 Ga0265338_101322863 224
889 3300028800 Ga0265338_10241360 Ga0265338_102413602 224
890 3300028800 Ga0265338_10274634 Ga0265338_102746342 224
891 3300030760 Ga0265762_1004236 Ga0265762_10042362 224
892 3300030760 Ga0265762_1006001 Ga0265762_10060012 224
893 3300030760 Ga0265762_1015555 Ga0265762_10155552 224
894 3300030760 Ga0265762_1025991 Ga0265762_10259912 224
895 3300031090 Ga0265760_10000242 Ga0265760_100002422 224
896 3300031090 Ga0265760_10005419 Ga0265760_100054193 224
897 3300031090 Ga0265760_10018276 Ga0265760_100182761 224
898 3300031090 Ga0265760_10058968 Ga0265760_100589681 224
899 3300031235 Ga0265330_10036864 Ga0265330_100368643 224
900 3300031238 Ga0265332_10071679 Ga0265332_100716792 224
901 3300031241 Ga0265325_10015495 Ga0265325_100154954 224
902 3300031241 Ga0265325_10045920 Ga0265325_100459202 224
903 3300031249 Ga0265339_10014422 Ga0265339_100144223 224
904 3300031249 Ga0265339_10051746 Ga0265339_100517461 224
905 3300031249 Ga0265339_10092440 Ga0265339_100924402 224
906 3300031344 Ga0265316_10043022 Ga0265316_100430223 224
907 3300031344 Ga0265316_10450132 Ga0265316_104501321 224
908 3300031711 Ga0265314_10009028 Ga0265314_100090283 224
909 3300031711 Ga0265314_10108988 Ga0265314_101089881 224
910 3300033545 Ga0316214_1005106 Ga0316214_10051062 224
911 3300033547 Ga0316212_1006527 Ga0316212_10065272 224
912 3300035083 Ga0373926_0005361 Ga0373926_0005361_2706_3380 224
913 3300035085 Ga0373929_0020694 Ga0373929_0020694_12_686 224
914 3300035089 Ga0373944_0049754 Ga0373944_0049754_520_1194 224
915 3300035113 Ga0373936_0004614 Ga0373936_0004614_3343_4017 224
916 3300035113 Ga0373936_0063311 Ga0373936_0063311_769_1449 224
917 3300035118 Ga0373954_0192457 Ga0373954_0192457_44_718 224
918 3300035119 Ga0373956_0121472 Ga0373956_0121472_505_1197 224
919 3300035120 Ga0373957_0086822 Ga0373957_0086822_187_870 224
920 3300035170 Ga0373943_0052087 Ga0373943_0052087_30_704 224
921 3300035170 Ga0373943_0054311 Ga0373943_0054311_1107_1781 224
922 3300035170 Ga0373943_0209225 Ga0373943_0209225_120_803 224
923 3300035170 Ga0373943_0298164 Ga0373943_0298164_122_796 224
924 3300035171 Ga0373946_0010395 Ga0373946_0010395_511_1194 224
925 3300035172 Ga0373955_0042548 Ga0373955_0042548_306_989 224
926 3300035691 Ga0373931_0309897 Ga0373931_0309897_229_903 224
927 3300035692 Ga0373935_0033631 Ga0373935_0033631_2094_2774 224
928 3300035692 Ga0373935_0035710 Ga0373935_0035710_438_1112 224
929 3300035692 Ga0373935_0079637 Ga0373935_0079637_772_1452 224
930 3300035692 Ga0373935_0696763 Ga0373935_0696763_41_715 224
931 3300035695 Ga0373927_0003975 Ga0373927_0003975_195_869 224
932 3300035695 Ga0373927_0015301 Ga0373927_0015301_4034_4708 224
933 3300035695 Ga0373927_0074146 Ga0373927_0074146_264_947 224
934 3300035724 Ga0373933_0040395 Ga0373933_0040395_727_1419 224
935 3300035724 Ga0373933_0046243 Ga0373933_0046243_586_1269 224
936 3300035725 Ga0373947_0001950 Ga0373947_0001950_11670_12344 224
937 3300035725 Ga0373947_0046121 Ga0373947_0046121_155_835 224
938 3300035725 Ga0373947_0097458 Ga0373947_0097458_462_1136 224
939 3300035725 Ga0373947_0336867 Ga0373947_0336867_297_980 224
940 3300035725 Ga0373947_0339554 Ga0373947_0339554_28_702 224
941 3300036401 Ga0373937_0018254 Ga0373937_0018254_940_1614 224
942 3300036401 Ga0373937_0094316 Ga0373937_0094316_1081_1773 224
943 3300036401 Ga0373937_0406085 Ga0373937_0406085_426_1109 224
944 3300036401 Ga0373937_0922139 Ga0373937_0922139_59_751 224
945 3300037068 Ga0373925_0017686 Ga0373925_0017686_3327_4007 224
946 3300037068 Ga0373925_0018110 Ga0373925_0018110_919_1593 224
947 3300037068 Ga0373925_0023470 Ga0373925_0023470_474_1148 224
948 3300037068 Ga0373925_0054200 Ga0373925_0054200_932_1606 224
949 3300039437 Ga0436365_1849740 Ga0436365_1849740_426_1109 224
950 3300039450 Ga0436363_1709607 Ga0436363_1709607_671_1354 224
951 3300039453 Ga0436362_1117608 Ga0436362_1117608_90_764 224
952 3300045051 Ga0451576_0165440 Ga0451576_0165440_174_848 224
953 3300045051 Ga0451576_0635259 Ga0451576_0635259_254_928 224
954 3300045051 Ga0451576_1312526 Ga0451576_1312526_47_721 224
955 3300045976 Ga0466967_0119894 Ga0466967_0119894_1551_2225 224
956 3300046459 Ga0495629_0020122 Ga0495629_0020122_1980_2660 224
957 3300046472 Ga0495580_0000074 Ga0495580_0000074_28111_28791 224
958 3300046472 Ga0495580_0005142 Ga0495580_0005142_3961_4635 224
959 3300046472 Ga0495580_0014509 Ga0495580_0014509_3038_3718 224
960 3300046472 Ga0495580_0053725 Ga0495580_0053725_937_1611 224
961 3300046472 Ga0495580_0067428 Ga0495580_0067428_1321_2058 224
962 3300046472 Ga0495580_0149657 Ga0495580_0149657_571_1245 224
963 3300046472 Ga0495580_0323642 Ga0495580_0323642_296_979 224
964 3300046473 Ga0495582_0005452 Ga0495582_0005452_537_1217 224
965 3300046473 Ga0495582_0022220 Ga0495582_0022220_265_939 224
966 3300046475 Ga0495639_0071872 Ga0495639_0071872_23_697 224
967 3300046511 Ga0495608_0148646 Ga0495608_0148646_783_1457 224
968 3300046516 Ga0495628_0049805 Ga0495628_0049805_2431_3114 224
969 3300046517 Ga0495630_0093306 Ga0495630_0093306_1072_1746 224
970 3300046517 Ga0495630_0133671 Ga0495630_0133671_990_1670 224
971 3300046526 Ga0495666_0106709 Ga0495666_0106709_447_1121 224
972 3300046531 Ga0495665_0001072 Ga0495665_0001072_3216_3890 224
973 3300046531 Ga0495665_0039056 Ga0495665_0039056_710_1390 224
974 3300046531 Ga0495665_0084143 Ga0495665_0084143_898_1578 224
975 3300046531 Ga0495665_0144780 Ga0495665_0144780_472_1146 224
976 3300046535 Ga0495586_0058509 Ga0495586_0058509_568_1242 224
977 3300046536 Ga0495587_0069491 Ga0495587_0069491_119_793 224
978 3300046679 Ga0495623_0377775 Ga0495623_0377775_36_710 224
979 3300046683 Ga0495658_0158287 Ga0495658_0158287_562_1236 224
980 3300046690 Ga0495624_0081571 Ga0495624_0081571_617_1291 224
981 3300047319 Ga0495674_0139998 Ga0495674_0139998_780_1463 224
982 3300047319 Ga0495674_0283446 Ga0495674_0283446_278_1015 224
983 3300047673 Ga0495593_0080671 Ga0495593_0080671_323_997 224
984 3300047673 Ga0495593_0271292 Ga0495593_0271292_51_734 224
985 3300048903 Ga0496100_0114330 Ga0496100_0114330_918_1592 224
986 3300048904 Ga0496101_0369488 Ga0496101_0369488_103_777 224
987 3300048904 Ga0496101_0563666 Ga0496101_0563666_210_890 224
988 3300048905 Ga0496102_0021353 Ga0496102_0021353_2628_3302 224
989 3300048905 Ga0496102_0078406 Ga0496102_0078406_903_1577 224
990 3300048905 Ga0496102_0588681 Ga0496102_0588681_170_844 224
991 3300048905 Ga0496102_1071373 Ga0496102_1071373_16_690 224
992 3300048906 Ga0496103_0336809 Ga0496103_0336809_140_814 224
993 3300048907 Ga0496104_0317220 Ga0496104_0317220_296_970 224
994 3300048909 Ga0496106_0166006 Ga0496106_0166006_305_979 224
995 3300048910 Ga0496107_0056921 Ga0496107_0056921_2081_2755 224
996 3300048911 Ga0496108_0000325 Ga0496108_0000325_16598_17272 224
997 3300048912 Ga0496109_0000117 Ga0496109_0000117_45235_45909 224
998 3300048912 Ga0496109_0306029 Ga0496109_0306029_686_1360 224
999 3300048913 Ga0496110_0002628 Ga0496110_0002628_5337_6011 224
1000 3300048914 Ga0496111_0004540 Ga0496111_0004540_685_1359 224
1001 3300048915 Ga0496112_0000283 Ga0496112_0000283_26473_27147 224
1002 3300048915 Ga0496112_0001864 Ga0496112_0001864_374_1048 224
1003 3300048915 Ga0496112_0076452 Ga0496112_0076452_1655_2329 224
1004 3300048915 Ga0496112_0168771 Ga0496112_0168771_1352_2026 224
1005 3300048916 Ga0496113_0000504 Ga0496113_0000504_10403_11077 224
1006 3300048916 Ga0496113_0036419 Ga0496113_0036419_560_1234 224
1007 3300048916 Ga0496113_0435657 Ga0496113_0435657_222_896 224
1008 3300048918 Ga0496115_0006382 Ga0496115_0006382_295_975 224
1009 3300048918 Ga0496115_0251515 Ga0496115_0251515_321_1001 224
1010 3300050512 nmdc:mga0n895_8844_c1 nmdc:mga0n895_8844_c1_3128_3802 224
1011 3300050512 nmdc:mga0n895_988254_c1 nmdc:mga0n895_988254_c1_15_689 224
1012 3300050513 nmdc:mga0rr50_22666_c1 nmdc:mga0rr50_22666_c1_747_1421 224
1013 3300050513 nmdc:mga0rr50_88981_c1 nmdc:mga0rr50_88981_c1_19_693 224
1014 3300050514 nmdc:mga08x19_119477_c1 nmdc:mga08x19_119477_c1_216_890 224
1015 3300050514 nmdc:mga08x19_6689_c1 nmdc:mga08x19_6689_c1_645_1319 224
1016 3300050515 nmdc:mga0a205_937_c1 nmdc:mga0a205_937_c1_20221_20895 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

71

266

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9295 4 210
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8968 2 214
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.841 3 210
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8351 4 210
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.835 4 210
ID Description Score Start End Superfamily
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9727 4 218 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9596 4 218 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9595 2 217 1.10.3720.10
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.953 4 210 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9452 4 214 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A537QC36-F1-model_v4 Molybdenum transport system permease 0.9973 1 216 GO:0005886
GO:0015098
AF-A0A848VX28-F1-model_v4 Molybdenum transport system permease 0.9936 1 215 GO:0005886
GO:0015098
AF-A0A2W0A0E5-F1-model_v4 Molybdenum transport system permease 0.9901 1 189 GO:0005886
GO:0015098
AF-A0A7Y4WE71-F1-model_v4 Molybdenum transport system permease 0.9892 1 216 GO:0005886
GO:0015098
AF-A0A840I4S3-F1-model_v4 Molybdenum transport system permease 0.989 2 215 GO:0005886
GO:0015098

Feature Viewer

pLDDT pTM Quality
88.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map