F488246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 439 | 897 | 445 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0033108|Ga0495633_0033108_483_2027 |
| Length | 514 |
| Sequence | LNRNYADRARGATLFLEGLVSAGLFVQIIEERRLCIGRAGPLGIFGGGFLLSAKEKTMAQSPANQSSATPATPRHIKLGFILHGVGRTWNDWRHPGRDVNASTSLAYYQRQAASAERGKFDFLFVADSLSITEKSSPHYLNRFEPITILSALAATTSRIGLVATLTVSYSEPFNVARQFASLDHLSGGRAGWNIVTSWLGDTAANFSKTEHPPHNVRYRIAGEYLDVVQGLWDSWEEDAHVADKESGQFVDPDRLHRLDHKGEFFQVRGPLNIKRTPQGQPVIFQAGASEDGRNFAARRAEVIFTHAETQEQGQAYYADVKARAKGFGRNPDQLFILPGIAPIIGDTDDEADALYRELAALESIDTGLGFLSRTFNDHDFRQYDLDAPFPDVGHIGLNSQQSGTLRILAEVRAENLTLRQVAERLASPRGVFVGAAETVADRIQHWFESGTADGFVLFEPLPGQLDIFVDKVIPILQARGLFREEYEGTTFRAHLGLAEPDNRYGADKRAKDAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 9 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 10 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 11 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 12 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 13 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 14 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 15 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 16 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 17 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 18 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 19 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 20 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 21 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 22 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 23 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 24 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 25 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 26 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 27 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 28 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 29 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 30 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 31 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 32 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 33 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 34 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 35 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 36 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 37 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 38 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 39 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 40 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 41 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 42 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 43 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 44 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 45 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 46 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 47 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 48 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 49 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 50 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 51 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 52 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 53 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 54 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 55 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 56 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 57 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 58 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 59 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 60 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 61 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 62 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 63 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 64 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 65 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 66 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 67 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 68 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 69 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 70 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 71 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 72 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 73 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 74 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 75 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 76 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 77 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 78 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 79 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 80 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 81 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 82 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 83 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 84 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 85 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 86 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 87 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 88 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 89 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 90 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 91 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 92 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 93 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 94 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 95 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 96 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 97 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 98 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 99 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 100 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 101 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 102 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 103 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 104 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 105 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 106 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 107 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 108 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 109 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 110 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 111 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 112 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 113 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 114 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 115 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 116 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 117 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 118 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 119 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 120 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 121 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 123 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 125 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 126 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 127 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 128 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 129 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 130 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 132 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 147 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 150 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 152 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 153 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 154 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 155 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 156 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 157 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 158 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 159 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 160 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 161 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 162 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 163 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 164 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 165 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 166 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 167 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 168 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 169 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 170 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 171 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 173 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 196 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 197 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 198 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 200 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 201 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 211 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 264 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 265 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 269 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 271 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 274 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 276 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 278 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 279 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 283 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 292 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 293 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 294 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 295 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 296 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 297 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 298 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 299 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 300 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 301 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 383 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 393 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 395 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 406 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 414 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 420 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 423 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 424 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 425 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 426 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 427 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 428 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 429 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 430 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 431 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 432 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 433 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 434 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 435 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 436 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 437 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 438 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 439 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.37 |
| Metatranscriptomes | 0 |
| Isolates | 11.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.33 |
| Nodule | 1.48 |
| Rhizoplane | 4.93 |
| Rhizosphere | 67.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_4057571 | 2162886011 | Bacteria | 2495 |
| 2 | JGI24740J21852_10000040 | 3300001979 | Bacteria | 43874 |
| 3 | JGI24740J21852_10003601 | 3300001979 | Bacteria | 6759 |
| 4 | JGI24740J21852_10003679 | 3300001979 | Bacteria | 6678 |
| 5 | JGI24740J21852_10005450 | 3300001979 | Bacteria | 5378 |
| 6 | JGI24740J21852_10036090 | 3300001979 | Bacteria | 1539 |
| 7 | JGI24739J22299_10000021 | 3300001989 | Bacteria | 46786 |
| 8 | JGI24739J22299_10004456 | 3300001989 | Bacteria | 5367 |
| 9 | JGI24739J22299_10005905 | 3300001989 | Bacteria | 4635 |
| 10 | JGI24737J22298_10001269 | 3300001990 | Bacteria | 8936 |
| 11 | JGI24737J22298_10009451 | 3300001990 | Bacteria | 3239 |
| 12 | JGI24737J22298_10019370 | 3300001990 | Bacteria | 2176 |
| 13 | JGI24735J21928_10002422 | 3300002067 | Bacteria | 6485 |
| 14 | JGI24735J21928_10003309 | 3300002067 | Bacteria | 5496 |
| 15 | JGI24738J21930_10000001 | 3300002075 | Bacteria | 133921 |
| 16 | JGI24751J29686_10001447 | 3300002459 | Bacteria | 4973 |
| 17 | JGI25162J39368_1000448 | 3300002737 | Bacteria | 32592 |
| 18 | JGI25163J39215_1000169 | 3300002771 | Bacteria | 25589 |
| 19 | JGI25164J39214_1000306 | 3300002772 | Bacteria | 32696 |
| 20 | JGI25165J46597_1000121 | 3300003214 | Bacteria | 132705 |
| 21 | JGI25153J46596_10000016 | 3300003215 | Bacteria | 285917 |
| 22 | JGI25153J46596_10031842 | 3300003215 | Bacteria | 1768 |
| 23 | rootH1_10266568 | 3300003323 | Bacteria | 2865 |
| 24 | Ga0055538_1001047 | 3300003751 | Bacteria | 6204 |
| 25 | Ga0055539_1000990 | 3300003752 | Bacteria | 6204 |
| 26 | Ga0055533_1001472 | 3300003756 | Bacteria | 6204 |
| 27 | Ga0055532_1001544 | 3300003758 | Bacteria | 6204 |
| 28 | Ga0055525_1001160 | 3300003759 | Bacteria | 6204 |
| 29 | Ga0055537_1003505 | 3300003773 | Bacteria | 4806 |
| 30 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 31 | Ga0055536_1000027 | 3300003781 | Bacteria | 164595 |
| 32 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 33 | Ga0055530_10000079 | 3300003791 | Bacteria | 83270 |
| 34 | Ga0055530_10000165 | 3300003791 | Bacteria | 60120 |
| 35 | Ga0055540_1000186 | 3300003792 | Bacteria | 60120 |
| 36 | Ga0055540_1000258 | 3300003792 | Bacteria | 47854 |
| 37 | Ga0055531_10014786 | 3300003794 | Bacteria | 3489 |
| 38 | Ga0055541_1001087 | 3300003841 | Bacteria | 6204 |
| 39 | Ga0065165_1002059 | 3300005262 | Bacteria | 18596 |
| 40 | Ga0065714_10005985 | 3300005288 | Bacteria | 7190 |
| 41 | Ga0065714_10008360 | 3300005288 | Bacteria | 4753 |
| 42 | Ga0065714_10064839 | 3300005288 | Bacteria | 17232 |
| 43 | Ga0065714_10077303 | 3300005288 | Bacteria | 2703 |
| 44 | Ga0065714_10085296 | 3300005288 | Bacteria | 2155 |
| 45 | Ga0065704_10006301 | 3300005289 | Bacteria | 2989 |
| 46 | Ga0065704_10072214 | 3300005289 | Bacteria | 8931 |
| 47 | Ga0065704_10082902 | 3300005289 | Bacteria | 3536 |
| 48 | Ga0065704_10085666 | 3300005289 | Bacteria | 3198 |
| 49 | Ga0065712_10068364 | 3300005290 | Bacteria | 11276 |
| 50 | Ga0065712_10094642 | 3300005290 | Bacteria | 2239 |
| 51 | Ga0065707_10001308 | 3300005295 | Bacteria | 8844 |
| 52 | Ga0070670_100002244 | 3300005331 | Bacteria | 15889 |
| 53 | Ga0070670_100005599 | 3300005331 | Bacteria | 10595 |
| 54 | Ga0070670_100069781 | 3300005331 | Bacteria | 3017 |
| 55 | Ga0070666_10002911 | 3300005335 | Bacteria | 10351 |
| 56 | Ga0070666_10081034 | 3300005335 | Bacteria | 2219 |
| 57 | Ga0070682_100048039 | 3300005337 | Bacteria | 2656 |
| 58 | Ga0070660_100022198 | 3300005339 | Bacteria | 4690 |
| 59 | Ga0070661_100000163 | 3300005344 | Bacteria | 54929 |
| 60 | Ga0070668_100000045 | 3300005347 | Bacteria | 77362 |
| 61 | Ga0070668_100002438 | 3300005347 | Bacteria | 13684 |
| 62 | Ga0070668_100008385 | 3300005347 | Bacteria | 7675 |
| 63 | Ga0070668_100014187 | 3300005347 | Bacteria | 5952 |
| 64 | Ga0070668_100021709 | 3300005347 | Bacteria | 4850 |
| 65 | Ga0070668_100022840 | 3300005347 | Bacteria | 4728 |
| 66 | Ga0070668_100033112 | 3300005347 | Bacteria | 3934 |
| 67 | Ga0070668_100037615 | 3300005347 | Bacteria | 3696 |
| 68 | Ga0070668_100060798 | 3300005347 | Bacteria | 2927 |
| 69 | Ga0070669_100005542 | 3300005353 | Bacteria | 9115 |
| 70 | Ga0070669_100011837 | 3300005353 | Bacteria | 6189 |
| 71 | Ga0070669_100043004 | 3300005353 | Bacteria | 3289 |
| 72 | Ga0070671_100000003 | 3300005355 | Bacteria | 270186 |
| 73 | Ga0070671_100002400 | 3300005355 | Bacteria | 14480 |
| 74 | Ga0070671_100015086 | 3300005355 | Bacteria | 6241 |
| 75 | Ga0070671_100196385 | 3300005355 | Bacteria | 1710 |
| 76 | Ga0070659_100029656 | 3300005366 | Bacteria | 4228 |
| 77 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 78 | Ga0070667_100000336 | 3300005367 | Bacteria | 52390 |
| 79 | Ga0070667_100003055 | 3300005367 | Bacteria | 14387 |
| 80 | Ga0070667_100040423 | 3300005367 | Bacteria | 3911 |
| 81 | Ga0070667_100141689 | 3300005367 | Bacteria | 2106 |
| 82 | Ga0070663_100004705 | 3300005455 | Bacteria | 8049 |
| 83 | Ga0070662_100004680 | 3300005457 | Bacteria | 8679 |
| 84 | Ga0070662_100041202 | 3300005457 | Bacteria | 3293 |
| 85 | Ga0070662_100103589 | 3300005457 | Bacteria | 2158 |
| 86 | Ga0070699_100047360 | 3300005518 | Bacteria | 3720 |
| 87 | Ga0068853_100000323 | 3300005539 | Bacteria | 33372 |
| 88 | Ga0068853_100006913 | 3300005539 | Bacteria | 9058 |
| 89 | Ga0068853_100012273 | 3300005539 | Bacteria | 6967 |
| 90 | Ga0068853_100044233 | 3300005539 | Bacteria | 3811 |
| 91 | Ga0068853_100103945 | 3300005539 | Bacteria | 2514 |
| 92 | Ga0070672_100024078 | 3300005543 | Bacteria | 4493 |
| 93 | Ga0070665_100000816 | 3300005548 | Bacteria | 40734 |
| 94 | Ga0070665_100005929 | 3300005548 | Bacteria | 12514 |
| 95 | Ga0068855_100040101 | 3300005563 | Bacteria | 5558 |
| 96 | Ga0070664_100000101 | 3300005564 | Bacteria | 54929 |
| 97 | Ga0068857_100017091 | 3300005577 | Bacteria | 6355 |
| 98 | Ga0068857_100035699 | 3300005577 | Bacteria | 4403 |
| 99 | Ga0068854_100000370 | 3300005578 | Bacteria | 28720 |
| 100 | Ga0068854_100026295 | 3300005578 | Bacteria | 3999 |
| 101 | Ga0068854_100040560 | 3300005578 | Bacteria | 3285 |
| 102 | Ga0068854_100080545 | 3300005578 | Bacteria | 2403 |
| 103 | Ga0068856_100000374 | 3300005614 | Bacteria | 49224 |
| 104 | Ga0068852_100007527 | 3300005616 | Bacteria | 7951 |
| 105 | Ga0068852_100015318 | 3300005616 | Bacteria | 5939 |
| 106 | Ga0068859_100021404 | 3300005617 | Bacteria | 6489 |
| 107 | Ga0068864_100041916 | 3300005618 | Bacteria | 3916 |
| 108 | Ga0068851_10000045 | 3300005834 | Bacteria | 80884 |
| 109 | Ga0068851_10000147 | 3300005834 | Bacteria | 37787 |
| 110 | Ga0068863_100000225 | 3300005841 | Bacteria | 59865 |
| 111 | Ga0068863_100033449 | 3300005841 | Bacteria | 4898 |
| 112 | Ga0068863_100070480 | 3300005841 | Bacteria | 3306 |
| 113 | Ga0068863_100080560 | 3300005841 | Bacteria | 3084 |
| 114 | Ga0068858_100001386 | 3300005842 | Bacteria | 24950 |
| 115 | Ga0068858_100037216 | 3300005842 | Bacteria | 4512 |
| 116 | Ga0068858_100050201 | 3300005842 | Bacteria | 3861 |
| 117 | Ga0068860_100000051 | 3300005843 | Bacteria | 208179 |
| 118 | Ga0068860_100000193 | 3300005843 | Bacteria | 97253 |
| 119 | Ga0068860_100001524 | 3300005843 | Bacteria | 24955 |
| 120 | Ga0068860_100004640 | 3300005843 | Bacteria | 14034 |
| 121 | Ga0068860_100006123 | 3300005843 | Bacteria | 12100 |
| 122 | Ga0068860_100008197 | 3300005843 | Bacteria | 10399 |
| 123 | Ga0068860_100011953 | 3300005843 | Bacteria | 8557 |
| 124 | Ga0068860_100040398 | 3300005843 | Bacteria | 4459 |
| 125 | Ga0068860_100178234 | 3300005843 | Unclassified | 2054 |
| 126 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 127 | Ga0068862_100000083 | 3300005844 | Bacteria | 112991 |
| 128 | Ga0068862_100004726 | 3300005844 | Bacteria | 11469 |
| 129 | Ga0068862_100010282 | 3300005844 | Bacteria | 7720 |
| 130 | Ga0068862_100011846 | 3300005844 | Bacteria | 7201 |
| 131 | Ga0081455_10000872 | 3300005937 | Bacteria | 38964 |
| 132 | Ga0081455_10007504 | 3300005937 | Bacteria | 11472 |
| 133 | Ga0075368_10000863 | 3300006042 | Bacteria | 9372 |
| 134 | Ga0075363_100001725 | 3300006048 | Bacteria | 8497 |
| 135 | Ga0075432_10018313 | 3300006058 | Bacteria | 2389 |
| 136 | Ga0075362_10023032 | 3300006177 | Bacteria | 2630 |
| 137 | Ga0075367_10000269 | 3300006178 | Bacteria | 17930 |
| 138 | Ga0075369_10001433 | 3300006186 | Bacteria | 8136 |
| 139 | Ga0075366_10035008 | 3300006195 | Bacteria | 2960 |
| 140 | Ga0075366_10069282 | 3300006195 | Bacteria | 2100 |
| 141 | Ga0075370_10008619 | 3300006353 | Bacteria | 5257 |
| 142 | Ga0075370_10081181 | 3300006353 | Bacteria | 1864 |
| 143 | Ga0097620_100021404 | 3300006931 | Bacteria | 6489 |
| 144 | Ga0079104_1000006 | 3300006946 | Bacteria | 396255 |
| 145 | Ga0105251_10000612 | 3300009011 | Bacteria | 32744 |
| 146 | Ga0105251_10001159 | 3300009011 | Bacteria | 22899 |
| 147 | Ga0105251_10001293 | 3300009011 | Bacteria | 21634 |
| 148 | Ga0105251_10004188 | 3300009011 | Bacteria | 9985 |
| 149 | Ga0105244_10000738 | 3300009036 | Bacteria | 27985 |
| 150 | Ga0105244_10002527 | 3300009036 | Bacteria | 13749 |
| 151 | Ga0105244_10005252 | 3300009036 | Bacteria | 8640 |
| 152 | Ga0105244_10009145 | 3300009036 | Bacteria | 6114 |
| 153 | Ga0105244_10019703 | 3300009036 | Bacteria | 3759 |
| 154 | Ga0105244_10075830 | 3300009036 | Bacteria | 1670 |
| 155 | Ga0105250_10000089 | 3300009092 | Bacteria | 80765 |
| 156 | Ga0105250_10000109 | 3300009092 | Bacteria | 74557 |
| 157 | Ga0105250_10015604 | 3300009092 | Bacteria | 3110 |
| 158 | Ga0105240_10000220 | 3300009093 | Bacteria | 115299 |
| 159 | Ga0105240_10006254 | 3300009093 | Bacteria | 17515 |
| 160 | Ga0105240_10228184 | 3300009093 | Bacteria | 2165 |
| 161 | Ga0105245_10000721 | 3300009098 | Bacteria | 29771 |
| 162 | Ga0105243_10000047 | 3300009148 | Bacteria | 154272 |
| 163 | Ga0105243_10017725 | 3300009148 | Bacteria | 5386 |
| 164 | Ga0105241_10022859 | 3300009174 | Bacteria | 4635 |
| 165 | Ga0105242_10013185 | 3300009176 | Bacteria | 6380 |
| 166 | Ga0105248_10003730 | 3300009177 | Bacteria | 16894 |
| 167 | Ga0105248_10031570 | 3300009177 | Bacteria | 5919 |
| 168 | Ga0105248_10068301 | 3300009177 | Bacteria | 3991 |
| 169 | Ga0105248_10096387 | 3300009177 | Bacteria | 3332 |
| 170 | Ga0105248_10111527 | 3300009177 | Bacteria | 3085 |
| 171 | Ga0105248_10150369 | 3300009177 | Bacteria | 2627 |
| 172 | Ga0105248_10188965 | 3300009177 | Bacteria | 2321 |
| 173 | Ga0105237_10000096 | 3300009545 | Bacteria | 121683 |
| 174 | Ga0105237_10000099 | 3300009545 | Bacteria | 120098 |
| 175 | Ga0105237_10020144 | 3300009545 | Bacteria | 6885 |
| 176 | Ga0105238_10091370 | 3300009551 | Bacteria | 3031 |
| 177 | Ga0105249_10000102 | 3300009553 | Bacteria | 119003 |
| 178 | Ga0105249_10002432 | 3300009553 | Bacteria | 16167 |
| 179 | Ga0105249_10011862 | 3300009553 | Bacteria | 7661 |
| 180 | Ga0105249_10016242 | 3300009553 | Bacteria | 6602 |
| 181 | Ga0105249_10113894 | 3300009553 | Bacteria | 2560 |
| 182 | Ga0105249_10191623 | 3300009553 | Bacteria | 1996 |
| 183 | Ga0105239_10000111 | 3300010375 | Bacteria | 115283 |
| 184 | Ga0105239_10014227 | 3300010375 | Bacteria | 8831 |
| 185 | Ga0105239_10048852 | 3300010375 | Bacteria | 4638 |
| 186 | Ga0105239_10179715 | 3300010375 | Bacteria | 2367 |
| 187 | Ga0105246_10011380 | 3300011119 | Bacteria | 5523 |
| 188 | Ga0157373_10008703 | 3300013100 | Bacteria | 7529 |
| 189 | Ga0157371_10000925 | 3300013102 | Bacteria | 32949 |
| 190 | Ga0157371_10001152 | 3300013102 | Bacteria | 28455 |
| 191 | Ga0157371_10005656 | 3300013102 | Bacteria | 10495 |
| 192 | Ga0157371_10034266 | 3300013102 | Bacteria | 3642 |
| 193 | Ga0157370_10001082 | 3300013104 | Bacteria | 34114 |
| 194 | Ga0157370_10032814 | 3300013104 | Bacteria | 5068 |
| 195 | Ga0157370_10094246 | 3300013104 | Bacteria | 2809 |
| 196 | Ga0157369_10003418 | 3300013105 | Bacteria | 18834 |
| 197 | Ga0157369_10005493 | 3300013105 | Bacteria | 14729 |
| 198 | Ga0157369_10014781 | 3300013105 | Bacteria | 8807 |
| 199 | Ga0163162_10000551 | 3300013306 | Bacteria | 34607 |
| 200 | Ga0163162_10009185 | 3300013306 | Bacteria | 9621 |
| 201 | Ga0157372_10000411 | 3300013307 | Bacteria | 46913 |
| 202 | Ga0157372_10011852 | 3300013307 | Bacteria | 9285 |
| 203 | Ga0157372_10043888 | 3300013307 | Bacteria | 4953 |
| 204 | Ga0157375_10000819 | 3300013308 | Bacteria | 27196 |
| 205 | Ga0157375_10036562 | 3300013308 | Bacteria | 4699 |
| 206 | Ga0157375_10047654 | 3300013308 | Bacteria | 4187 |
| 207 | Ga0157379_10003646 | 3300014968 | Bacteria | 13071 |
| 208 | Ga0157379_10053777 | 3300014968 | Bacteria | 3598 |
| 209 | Ga0182006_1002424 | 3300015261 | Bacteria | 10195 |
| 210 | Ga0182006_1003647 | 3300015261 | Bacteria | 7811 |
| 211 | Ga0182007_10000682 | 3300015262 | Bacteria | 19509 |
| 212 | Ga0182005_1004741 | 3300015265 | Bacteria | 4340 |
| 213 | Ga0163161_10008403 | 3300017792 | Bacteria | 7143 |
| 214 | Ga0163161_10102611 | 3300017792 | Bacteria | 2130 |
| 215 | Ga0213872_10005680 | 3300021361 | Bacteria | 6358 |
| 216 | Ga0209435_101060 | 3300025206 | Bacteria | 3879 |
| 217 | Ga0209760_100185 | 3300025207 | Bacteria | 32620 |
| 218 | Ga0209784_100065 | 3300025224 | Bacteria | 155963 |
| 219 | Ga0209566_100081 | 3300025225 | Bacteria | 155963 |
| 220 | Ga0209674_100101 | 3300025226 | Bacteria | 155963 |
| 221 | Ga0209147_100152 | 3300025229 | Bacteria | 100822 |
| 222 | Ga0209147_100919 | 3300025229 | Bacteria | 13186 |
| 223 | Ga0209563_100098 | 3300025230 | Bacteria | 155963 |
| 224 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 225 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 226 | Ga0209437_104459 | 3300025233 | Bacteria | 2467 |
| 227 | Ga0209258_101731 | 3300025242 | Bacteria | 6782 |
| 228 | Ga0209646_1001452 | 3300025246 | Bacteria | 6331 |
| 229 | Ga0209677_100059 | 3300025253 | Bacteria | 155963 |
| 230 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 231 | Ga0209565_1000281 | 3300025263 | Bacteria | 50202 |
| 232 | Ga0209673_1001574 | 3300025273 | Bacteria | 20330 |
| 233 | Ga0209675_1006260 | 3300025291 | Bacteria | 4814 |
| 234 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 235 | Ga0209676_1000087 | 3300025292 | Bacteria | 263734 |
| 236 | Ga0209676_1001866 | 3300025292 | Bacteria | 17337 |
| 237 | Ga0209564_1005483 | 3300025295 | Bacteria | 7215 |
| 238 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 239 | Ga0209758_1000608 | 3300025297 | Bacteria | 55483 |
| 240 | Ga0209758_1015026 | 3300025297 | Bacteria | 4047 |
| 241 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 242 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 243 | Ga0209050_1000083 | 3300025298 | Bacteria | 263734 |
| 244 | Ga0209256_1006602 | 3300025299 | Bacteria | 6067 |
| 245 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 246 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 247 | Ga0209051_1008204 | 3300025303 | Bacteria | 5564 |
| 248 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 249 | Ga0209257_1001043 | 3300025304 | Bacteria | 36902 |
| 250 | Ga0209257_1002683 | 3300025304 | Bacteria | 17041 |
| 251 | Ga0207656_10000077 | 3300025321 | Bacteria | 36340 |
| 252 | Ga0207656_10000163 | 3300025321 | Bacteria | 24772 |
| 253 | Ga0207696_1000115 | 3300025711 | Bacteria | 150739 |
| 254 | Ga0207696_1000163 | 3300025711 | Bacteria | 106948 |
| 255 | Ga0207696_1032710 | 3300025711 | Bacteria | 1564 |
| 256 | Ga0207655_1000734 | 3300025728 | Bacteria | 36990 |
| 257 | Ga0207655_1001691 | 3300025728 | Bacteria | 19409 |
| 258 | Ga0207655_1002757 | 3300025728 | Bacteria | 13703 |
| 259 | Ga0207655_1032477 | 3300025728 | Bacteria | 2384 |
| 260 | Ga0207713_1000020 | 3300025735 | Bacteria | 359258 |
| 261 | Ga0207713_1000318 | 3300025735 | Bacteria | 54717 |
| 262 | Ga0207713_1001737 | 3300025735 | Bacteria | 16750 |
| 263 | Ga0207713_1003208 | 3300025735 | Bacteria | 11288 |
| 264 | Ga0207713_1003330 | 3300025735 | Bacteria | 11035 |
| 265 | Ga0207713_1006178 | 3300025735 | Bacteria | 7357 |
| 266 | Ga0207680_10001712 | 3300025903 | Bacteria | 10339 |
| 267 | Ga0207680_10007735 | 3300025903 | Bacteria | 5253 |
| 268 | Ga0207647_10024637 | 3300025904 | Bacteria | 3966 |
| 269 | Ga0207654_10020477 | 3300025911 | Bacteria | 3506 |
| 270 | Ga0207695_10000213 | 3300025913 | Bacteria | 155843 |
| 271 | Ga0207695_10011595 | 3300025913 | Bacteria | 10659 |
| 272 | Ga0207695_10062012 | 3300025913 | Bacteria | 3862 |
| 273 | Ga0207695_10165322 | 3300025913 | Bacteria | 2141 |
| 274 | Ga0207671_10000747 | 3300025914 | Bacteria | 41249 |
| 275 | Ga0207671_10000788 | 3300025914 | Bacteria | 40108 |
| 276 | Ga0207657_10063173 | 3300025919 | Bacteria | 3167 |
| 277 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 278 | Ga0207681_10000843 | 3300025923 | Bacteria | 20218 |
| 279 | Ga0207681_10003360 | 3300025923 | Bacteria | 10021 |
| 280 | Ga0207681_10005690 | 3300025923 | Bacteria | 7655 |
| 281 | Ga0207694_10116550 | 3300025924 | Bacteria | 2129 |
| 282 | Ga0207650_10000384 | 3300025925 | Bacteria | 40899 |
| 283 | Ga0207650_10001354 | 3300025925 | Bacteria | 17693 |
| 284 | Ga0207650_10011260 | 3300025925 | Bacteria | 6153 |
| 285 | Ga0207650_10023412 | 3300025925 | Bacteria | 4379 |
| 286 | Ga0207687_10000467 | 3300025927 | Bacteria | 27625 |
| 287 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 288 | Ga0207644_10000084 | 3300025931 | Bacteria | 69209 |
| 289 | Ga0207690_10011096 | 3300025932 | Bacteria | 5374 |
| 290 | Ga0207690_10025423 | 3300025932 | Bacteria | 3718 |
| 291 | Ga0207706_10000383 | 3300025933 | Bacteria | 48348 |
| 292 | Ga0207706_10003643 | 3300025933 | Bacteria | 14715 |
| 293 | Ga0207706_10059424 | 3300025933 | Bacteria | 3367 |
| 294 | Ga0207709_10000058 | 3300025935 | Bacteria | 212963 |
| 295 | Ga0207709_10007500 | 3300025935 | Bacteria | 6072 |
| 296 | Ga0207711_10001289 | 3300025941 | Bacteria | 23752 |
| 297 | Ga0207711_10062163 | 3300025941 | Bacteria | 3221 |
| 298 | Ga0207679_10000037 | 3300025945 | Bacteria | 133550 |
| 299 | Ga0207667_10048200 | 3300025949 | Bacteria | 4506 |
| 300 | Ga0207712_10000026 | 3300025961 | Bacteria | 271237 |
| 301 | Ga0207712_10012258 | 3300025961 | Bacteria | 5477 |
| 302 | Ga0207712_10013582 | 3300025961 | Bacteria | 5222 |
| 303 | Ga0207712_10165855 | 3300025961 | Bacteria | 1722 |
| 304 | Ga0207668_10000031 | 3300025972 | Bacteria | 122168 |
| 305 | Ga0207668_10000384 | 3300025972 | Bacteria | 28142 |
| 306 | Ga0207668_10000837 | 3300025972 | Bacteria | 18598 |
| 307 | Ga0207668_10003946 | 3300025972 | Bacteria | 8742 |
| 308 | Ga0207668_10005069 | 3300025972 | Bacteria | 7755 |
| 309 | Ga0207668_10005145 | 3300025972 | Bacteria | 7696 |
| 310 | Ga0207668_10027971 | 3300025972 | Bacteria | 3680 |
| 311 | Ga0207668_10030627 | 3300025972 | Bacteria | 3537 |
| 312 | Ga0207668_10054835 | 3300025972 | Bacteria | 2768 |
| 313 | Ga0207640_10000172 | 3300025981 | Bacteria | 47087 |
| 314 | Ga0207640_10010921 | 3300025981 | Bacteria | 5123 |
| 315 | Ga0207640_10021468 | 3300025981 | Bacteria | 3849 |
| 316 | Ga0207640_10032428 | 3300025981 | Bacteria | 3239 |
| 317 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 318 | Ga0207658_10000173 | 3300025986 | Bacteria | 69532 |
| 319 | Ga0207658_10002222 | 3300025986 | Bacteria | 14414 |
| 320 | Ga0207658_10004604 | 3300025986 | Bacteria | 9566 |
| 321 | Ga0207658_10006715 | 3300025986 | Bacteria | 7833 |
| 322 | Ga0207658_10114975 | 3300025986 | Bacteria | 2134 |
| 323 | Ga0207703_10005397 | 3300026035 | Bacteria | 10291 |
| 324 | Ga0207639_10001228 | 3300026041 | Bacteria | 17380 |
| 325 | Ga0207639_10001573 | 3300026041 | Bacteria | 15305 |
| 326 | Ga0207639_10010029 | 3300026041 | Bacteria | 6548 |
| 327 | Ga0207639_10071057 | 3300026041 | Bacteria | 2721 |
| 328 | Ga0207678_10012629 | 3300026067 | Bacteria | 7420 |
| 329 | Ga0207702_10001025 | 3300026078 | Bacteria | 28676 |
| 330 | Ga0207641_10000367 | 3300026088 | Bacteria | 53540 |
| 331 | Ga0207641_10004419 | 3300026088 | Bacteria | 12184 |
| 332 | Ga0207641_10005639 | 3300026088 | Bacteria | 10666 |
| 333 | Ga0207641_10016352 | 3300026088 | Bacteria | 6074 |
| 334 | Ga0207641_10023406 | 3300026088 | Bacteria | 5089 |
| 335 | Ga0207641_10054906 | 3300026088 | Bacteria | 3382 |
| 336 | Ga0207674_10025702 | 3300026116 | Bacteria | 6270 |
| 337 | Ga0207674_10047138 | 3300026116 | Bacteria | 4420 |
| 338 | Ga0207675_100039006 | 3300026118 | Bacteria | 4433 |
| 339 | Ga0207675_100063072 | 3300026118 | Bacteria | 3463 |
| 340 | Ga0207683_10058640 | 3300026121 | Bacteria | 3380 |
| 341 | Ga0207698_10018166 | 3300026142 | Bacteria | 4786 |
| 342 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 343 | Ga0209813_10000074 | 3300027866 | Bacteria | 36982 |
| 344 | Ga0268266_10000387 | 3300028379 | Bacteria | 67080 |
| 345 | Ga0268265_10000094 | 3300028380 | Bacteria | 113107 |
| 346 | Ga0268265_10000118 | 3300028380 | Bacteria | 99496 |
| 347 | Ga0268265_10002558 | 3300028380 | Bacteria | 13604 |
| 348 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 349 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 350 | Ga0268264_10000367 | 3300028381 | Bacteria | 66987 |
| 351 | Ga0268264_10002410 | 3300028381 | Bacteria | 16460 |
| 352 | Ga0268264_10008727 | 3300028381 | Bacteria | 8413 |
| 353 | Ga0268264_10059509 | 3300028381 | Bacteria | 3201 |
| 354 | Ga0265326_10018769 | 3300028558 | Bacteria | 1989 |
| 355 | Ga0265319_1013333 | 3300028563 | Bacteria | 3275 |
| 356 | Ga0265334_10010853 | 3300028573 | Bacteria | 3846 |
| 357 | Ga0265318_10000019 | 3300028577 | Bacteria | 169214 |
| 358 | Ga0307515_10068578 | 3300028794 | Bacteria | 4869 |
| 359 | Ga0307515_10091706 | 3300028794 | Bacteria | 3792 |
| 360 | Ga0307515_10136135 | 3300028794 | Bacteria | 2670 |
| 361 | Ga0307515_10247065 | 3300028794 | Bacteria | 1544 |
| 362 | Ga0265338_10108050 | 3300028800 | Bacteria | 2248 |
| 363 | Ga0268256_1019716 | 3300030500 | Bacteria | 1838 |
| 364 | Ga0316181_1279899 | 3300030744 | Bacteria | 3761 |
| 365 | Ga0265330_10000691 | 3300031235 | Bacteria | 21588 |
| 366 | Ga0265332_10000076 | 3300031238 | Bacteria | 84301 |
| 367 | Ga0265328_10038198 | 3300031239 | Bacteria | 1772 |
| 368 | Ga0265320_10000689 | 3300031240 | Bacteria | 25743 |
| 369 | Ga0265325_10000250 | 3300031241 | Bacteria | 38286 |
| 370 | Ga0265329_10000634 | 3300031242 | Bacteria | 17938 |
| 371 | Ga0265331_10000775 | 3300031250 | Bacteria | 26589 |
| 372 | Ga0265327_10007444 | 3300031251 | Bacteria | 8446 |
| 373 | Ga0265316_10000893 | 3300031344 | Bacteria | 32660 |
| 374 | Ga0265316_10006740 | 3300031344 | Bacteria | 10947 |
| 375 | Ga0307509_10008863 | 3300031507 | Bacteria | 12693 |
| 376 | Ga0307509_10185091 | 3300031507 | Bacteria | 1942 |
| 377 | Ga0307408_100051934 | 3300031548 | Bacteria | 2955 |
| 378 | Ga0307508_10000204 | 3300031616 | Bacteria | 71518 |
| 379 | Ga0265314_10002160 | 3300031711 | Bacteria | 20569 |
| 380 | Ga0265342_10001950 | 3300031712 | Bacteria | 18467 |
| 381 | Ga0307405_10000041 | 3300031731 | Bacteria | 81597 |
| 382 | Ga0307405_10003738 | 3300031731 | Bacteria | 7067 |
| 383 | Ga0307412_10002912 | 3300031911 | Bacteria | 9491 |
| 384 | Ga0307510_10095588 | 3300033180 | Bacteria | 2790 |
| 385 | Ga0373931_0027539 | 3300035691 | Bacteria | 2902 |
| 386 | Ga0373927_0042026 | 3300035695 | Bacteria | 2964 |
| 387 | Ga0395900_0217043 | 3300037418 | Bacteria | 1930 |
| 388 | Ga0436361_0551392 | 3300039447 | Bacteria | 9053 |
| 389 | Ga0436361_0863053 | 3300039447 | Bacteria | 2524 |
| 390 | Ga0439438_000544 | 3300041405 | Bacteria | 17157 |
| 391 | Ga0439438_000666 | 3300041405 | Bacteria | 15441 |
| 392 | Ga0439447_001030 | 3300041407 | Bacteria | 10122 |
| 393 | Ga0439466_0002734 | 3300041411 | Bacteria | 6902 |
| 394 | Ga0439441_003261 | 3300042001 | Bacteria | 2375 |
| 395 | Ga0439452_000115 | 3300042010 | Bacteria | 63101 |
| 396 | Ga0439456_002535 | 3300042013 | Bacteria | 3675 |
| 397 | Ga0450902_000434 | 3300042137 | Bacteria | 5171 |
| 398 | Ga0466968_0002632 | 3300044735 | Bacteria | 6606 |
| 399 | Ga0466970_0027931 | 3300044765 | Bacteria | 2963 |
| 400 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 401 | Ga0495617_000044 | 3300046452 | Bacteria | 119709 |
| 402 | Ga0495617_000344 | 3300046452 | Bacteria | 25643 |
| 403 | Ga0495617_001200 | 3300046452 | Bacteria | 11655 |
| 404 | Ga0495617_011875 | 3300046452 | Bacteria | 2970 |
| 405 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 406 | Ga0495627_000056 | 3300046453 | Bacteria | 147012 |
| 407 | Ga0495627_000084 | 3300046453 | Bacteria | 112950 |
| 408 | Ga0495627_000142 | 3300046453 | Bacteria | 85934 |
| 409 | Ga0495627_000334 | 3300046453 | Bacteria | 45155 |
| 410 | Ga0495627_001885 | 3300046453 | Bacteria | 11047 |
| 411 | Ga0495603_0000009 | 3300046455 | Bacteria | 72869 |
| 412 | Ga0495590_0000698 | 3300046457 | Bacteria | 15366 |
| 413 | Ga0495590_0001721 | 3300046457 | Bacteria | 9306 |
| 414 | Ga0495590_0003169 | 3300046457 | Bacteria | 6727 |
| 415 | Ga0495590_0030594 | 3300046457 | Bacteria | 1886 |
| 416 | Ga0495591_000088 | 3300046458 | Bacteria | 102486 |
| 417 | Ga0495591_000448 | 3300046458 | Bacteria | 33571 |
| 418 | Ga0495591_004529 | 3300046458 | Bacteria | 6749 |
| 419 | Ga0495591_009768 | 3300046458 | Bacteria | 3780 |
| 420 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 421 | Ga0495638_0000160 | 3300046460 | Bacteria | 105110 |
| 422 | Ga0495638_0000230 | 3300046460 | Bacteria | 76565 |
| 423 | Ga0495638_0000399 | 3300046460 | Bacteria | 53351 |
| 424 | Ga0495638_0004745 | 3300046460 | Bacteria | 10253 |
| 425 | Ga0495638_0015764 | 3300046460 | Bacteria | 5064 |
| 426 | Ga0495638_0016007 | 3300046460 | Bacteria | 5026 |
| 427 | Ga0495638_0018658 | 3300046460 | Bacteria | 4603 |
| 428 | Ga0495638_0074070 | 3300046460 | Bacteria | 2077 |
| 429 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 430 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 431 | Ga0495650_0000160 | 3300046471 | Bacteria | 152374 |
| 432 | Ga0495650_0002248 | 3300046471 | Bacteria | 16151 |
| 433 | Ga0495650_0003429 | 3300046471 | Bacteria | 11568 |
| 434 | Ga0495650_0003742 | 3300046471 | Bacteria | 10861 |
| 435 | Ga0495650_0005303 | 3300046471 | Bacteria | 8432 |
| 436 | Ga0495650_0012276 | 3300046471 | Bacteria | 4618 |
| 437 | Ga0495650_0022142 | 3300046471 | Bacteria | 3053 |
| 438 | Ga0495605_0000068 | 3300046474 | Bacteria | 137743 |
| 439 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 440 | Ga0495605_0000158 | 3300046474 | Bacteria | 86829 |
| 441 | Ga0495605_0000365 | 3300046474 | Bacteria | 43038 |
| 442 | Ga0495605_0000806 | 3300046474 | Bacteria | 22409 |
| 443 | Ga0495605_0002738 | 3300046474 | Bacteria | 10763 |
| 444 | Ga0495605_0004999 | 3300046474 | Bacteria | 7746 |
| 445 | Ga0495605_0011818 | 3300046474 | Bacteria | 4859 |
| 446 | Ga0495584_0000027 | 3300046491 | Bacteria | 112488 |
| 447 | Ga0495584_0000322 | 3300046491 | Bacteria | 33438 |
| 448 | Ga0495584_0000666 | 3300046491 | Bacteria | 22861 |
| 449 | Ga0495584_0001575 | 3300046491 | Bacteria | 13482 |
| 450 | Ga0495584_0003151 | 3300046491 | Bacteria | 9159 |
| 451 | Ga0495584_0018535 | 3300046491 | Bacteria | 3537 |
| 452 | Ga0495585_0000142 | 3300046492 | Bacteria | 79060 |
| 453 | Ga0495585_0006735 | 3300046492 | Bacteria | 7089 |
| 454 | Ga0495594_0002539 | 3300046499 | Bacteria | 9505 |
| 455 | Ga0495596_0000006 | 3300046500 | Bacteria | 161501 |
| 456 | Ga0495596_0000061 | 3300046500 | Bacteria | 79205 |
| 457 | Ga0495596_0001000 | 3300046500 | Bacteria | 16807 |
| 458 | Ga0495607_0000076 | 3300046501 | Bacteria | 99256 |
| 459 | Ga0495607_0000253 | 3300046501 | Bacteria | 57280 |
| 460 | Ga0495607_0007014 | 3300046501 | Bacteria | 7840 |
| 461 | Ga0495607_0012249 | 3300046501 | Bacteria | 5669 |
| 462 | Ga0495607_0016286 | 3300046501 | Bacteria | 4800 |
| 463 | Ga0495607_0029544 | 3300046501 | Bacteria | 3372 |
| 464 | Ga0495607_0029980 | 3300046501 | Bacteria | 3344 |
| 465 | Ga0495607_0050614 | 3300046501 | Bacteria | 2417 |
| 466 | Ga0495607_0075966 | 3300046501 | Bacteria | 1860 |
| 467 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 468 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 469 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 470 | Ga0495583_0000429 | 3300046506 | Bacteria | 63489 |
| 471 | Ga0495583_0000457 | 3300046506 | Bacteria | 60714 |
| 472 | Ga0495583_0001285 | 3300046506 | Bacteria | 26213 |
| 473 | Ga0495583_0002204 | 3300046506 | Bacteria | 17264 |
| 474 | Ga0495606_0000165 | 3300046507 | Bacteria | 116607 |
| 475 | Ga0495606_0000545 | 3300046507 | Bacteria | 60465 |
| 476 | Ga0495606_0000729 | 3300046507 | Bacteria | 50871 |
| 477 | Ga0495606_0000760 | 3300046507 | Bacteria | 49564 |
| 478 | Ga0495606_0004668 | 3300046507 | Bacteria | 13543 |
| 479 | Ga0495606_0007980 | 3300046507 | Bacteria | 9312 |
| 480 | Ga0495606_0021889 | 3300046507 | Bacteria | 4675 |
| 481 | Ga0495606_0034070 | 3300046507 | Bacteria | 3501 |
| 482 | Ga0495606_0054372 | 3300046507 | Bacteria | 2593 |
| 483 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 484 | Ga0495610_0000058 | 3300046512 | Bacteria | 137991 |
| 485 | Ga0495610_0000107 | 3300046512 | Bacteria | 97076 |
| 486 | Ga0495610_0001222 | 3300046512 | Bacteria | 23122 |
| 487 | Ga0495610_0002403 | 3300046512 | Bacteria | 15762 |
| 488 | Ga0495610_0002821 | 3300046512 | Bacteria | 14159 |
| 489 | Ga0495610_0006938 | 3300046512 | Bacteria | 7667 |
| 490 | Ga0495610_0007561 | 3300046512 | Bacteria | 7196 |
| 491 | Ga0495610_0009414 | 3300046512 | Bacteria | 6181 |
| 492 | Ga0495610_0017959 | 3300046512 | Bacteria | 4012 |
| 493 | Ga0495610_0024504 | 3300046512 | Bacteria | 3254 |
| 494 | Ga0495610_0032252 | 3300046512 | Bacteria | 2724 |
| 495 | Ga0495610_0038584 | 3300046512 | Bacteria | 2424 |
| 496 | Ga0495616_0000054 | 3300046513 | Bacteria | 104326 |
| 497 | Ga0495616_0000082 | 3300046513 | Bacteria | 80468 |
| 498 | Ga0495616_0000372 | 3300046513 | Bacteria | 34836 |
| 499 | Ga0495616_0000429 | 3300046513 | Bacteria | 32137 |
| 500 | Ga0495616_0027272 | 3300046513 | Bacteria | 3033 |
| 501 | Ga0495616_0034791 | 3300046513 | Bacteria | 2612 |
| 502 | Ga0495616_0045309 | 3300046513 | Bacteria | 2227 |
| 503 | Ga0495616_0049385 | 3300046513 | Bacteria | 2109 |
| 504 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 505 | Ga0495620_0000207 | 3300046515 | Bacteria | 44260 |
| 506 | Ga0495620_0005130 | 3300046515 | Bacteria | 7334 |
| 507 | Ga0495620_0022451 | 3300046515 | Bacteria | 3037 |
| 508 | Ga0495628_0036011 | 3300046516 | Bacteria | 3975 |
| 509 | Ga0495630_0000058 | 3300046517 | Bacteria | 90878 |
| 510 | Ga0495631_0000372 | 3300046518 | Bacteria | 30820 |
| 511 | Ga0495631_0013640 | 3300046518 | Bacteria | 3939 |
| 512 | Ga0495631_0033461 | 3300046518 | Bacteria | 2309 |
| 513 | Ga0495632_0000076 | 3300046519 | Bacteria | 101121 |
| 514 | Ga0495632_0000113 | 3300046519 | Bacteria | 83027 |
| 515 | Ga0495632_0000207 | 3300046519 | Bacteria | 59532 |
| 516 | Ga0495632_0000495 | 3300046519 | Bacteria | 37144 |
| 517 | Ga0495632_0000748 | 3300046519 | Bacteria | 29283 |
| 518 | Ga0495632_0000997 | 3300046519 | Bacteria | 24718 |
| 519 | Ga0495632_0007697 | 3300046519 | Bacteria | 6728 |
| 520 | Ga0495632_0009443 | 3300046519 | Bacteria | 5887 |
| 521 | Ga0495632_0013021 | 3300046519 | Bacteria | 4766 |
| 522 | Ga0495632_0014750 | 3300046519 | Bacteria | 4408 |
| 523 | Ga0495632_0017003 | 3300046519 | Bacteria | 4028 |
| 524 | Ga0495632_0040616 | 3300046519 | Bacteria | 2342 |
| 525 | Ga0495637_0000214 | 3300046520 | Bacteria | 45088 |
| 526 | Ga0495637_0000219 | 3300046520 | Bacteria | 44013 |
| 527 | Ga0495637_0001357 | 3300046520 | Bacteria | 14696 |
| 528 | Ga0495637_0001450 | 3300046520 | Bacteria | 13958 |
| 529 | Ga0495637_0001481 | 3300046520 | Bacteria | 13781 |
| 530 | Ga0495637_0002671 | 3300046520 | Bacteria | 9739 |
| 531 | Ga0495637_0004462 | 3300046520 | Bacteria | 7248 |
| 532 | Ga0495637_0005690 | 3300046520 | Bacteria | 6325 |
| 533 | Ga0495637_0007700 | 3300046520 | Bacteria | 5328 |
| 534 | Ga0495637_0013726 | 3300046520 | Bacteria | 3840 |
| 535 | Ga0495637_0016057 | 3300046520 | Bacteria | 3504 |
| 536 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 537 | Ga0495643_0000321 | 3300046522 | Bacteria | 65956 |
| 538 | Ga0495643_0000454 | 3300046522 | Bacteria | 52085 |
| 539 | Ga0495643_0001232 | 3300046522 | Bacteria | 24663 |
| 540 | Ga0495643_0002236 | 3300046522 | Bacteria | 15721 |
| 541 | Ga0495643_0005329 | 3300046522 | Bacteria | 8715 |
| 542 | Ga0495643_0018408 | 3300046522 | Bacteria | 4060 |
| 543 | Ga0495643_0020490 | 3300046522 | Bacteria | 3811 |
| 544 | Ga0495643_0045383 | 3300046522 | Bacteria | 2386 |
| 545 | Ga0495644_0000119 | 3300046523 | Bacteria | 37559 |
| 546 | Ga0495644_0013543 | 3300046523 | Bacteria | 3128 |
| 547 | Ga0495644_0019907 | 3300046523 | Bacteria | 2561 |
| 548 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 549 | Ga0495648_0000239 | 3300046524 | Bacteria | 62900 |
| 550 | Ga0495648_0001250 | 3300046524 | Bacteria | 25409 |
| 551 | Ga0495648_0001378 | 3300046524 | Bacteria | 23932 |
| 552 | Ga0495648_0008114 | 3300046524 | Bacteria | 8292 |
| 553 | Ga0495663_0000023 | 3300046525 | Bacteria | 105104 |
| 554 | Ga0495666_0061405 | 3300046526 | Bacteria | 1796 |
| 555 | Ga0495642_0000114 | 3300046528 | Bacteria | 45647 |
| 556 | Ga0495642_0000187 | 3300046528 | Bacteria | 36703 |
| 557 | Ga0495654_0000012 | 3300046530 | Bacteria | 328997 |
| 558 | Ga0495654_0000292 | 3300046530 | Bacteria | 45100 |
| 559 | Ga0495654_0000414 | 3300046530 | Bacteria | 36432 |
| 560 | Ga0495654_0001637 | 3300046530 | Bacteria | 15169 |
| 561 | Ga0495654_0001701 | 3300046530 | Bacteria | 14780 |
| 562 | Ga0495654_0009671 | 3300046530 | Bacteria | 5279 |
| 563 | Ga0495654_0014271 | 3300046530 | Bacteria | 4233 |
| 564 | Ga0495654_0017905 | 3300046530 | Bacteria | 3718 |
| 565 | Ga0495654_0023808 | 3300046530 | Bacteria | 3169 |
| 566 | Ga0495654_0033864 | 3300046530 | Bacteria | 2582 |
| 567 | Ga0495609_0000111 | 3300046538 | Bacteria | 94808 |
| 568 | Ga0495609_0000147 | 3300046538 | Bacteria | 73010 |
| 569 | Ga0495609_0000340 | 3300046538 | Bacteria | 41415 |
| 570 | Ga0495609_0000477 | 3300046538 | Bacteria | 32285 |
| 571 | Ga0495609_0008130 | 3300046538 | Bacteria | 5164 |
| 572 | Ga0495597_0000050 | 3300046542 | Bacteria | 98185 |
| 573 | Ga0495597_0006237 | 3300046542 | Bacteria | 6181 |
| 574 | Ga0495597_0016843 | 3300046542 | Bacteria | 3447 |
| 575 | Ga0495597_0025967 | 3300046542 | Bacteria | 2692 |
| 576 | Ga0495597_0054533 | 3300046542 | Bacteria | 1755 |
| 577 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 578 | Ga0495633_0000316 | 3300046558 | Bacteria | 54818 |
| 579 | Ga0495633_0000397 | 3300046558 | Bacteria | 45712 |
| 580 | Ga0495633_0000446 | 3300046558 | Bacteria | 42633 |
| 581 | Ga0495633_0002823 | 3300046558 | Bacteria | 11981 |
| 582 | Ga0495633_0021779 | 3300046558 | Bacteria | 3200 |
| 583 | Ga0495633_0028857 | 3300046558 | Bacteria | 2701 |
| 584 | Ga0495633_0033108 | 3300046558 | Bacteria | 2493 |
| 585 | Ga0495633_0048981 | 3300046558 | Bacteria | 1995 |
| 586 | Ga0495656_0061486 | 3300046615 | Bacteria | 1640 |
| 587 | Ga0495668_0000512 | 3300046616 | Bacteria | 48355 |
| 588 | Ga0495668_0001601 | 3300046616 | Bacteria | 21209 |
| 589 | Ga0495668_0007940 | 3300046616 | Bacteria | 6694 |
| 590 | Ga0495668_0010946 | 3300046616 | Bacteria | 5461 |
| 591 | Ga0495668_0022182 | 3300046616 | Bacteria | 3630 |
| 592 | Ga0495611_0001119 | 3300046648 | Bacteria | 14092 |
| 593 | Ga0495611_0001477 | 3300046648 | Bacteria | 11678 |
| 594 | Ga0495625_0000162 | 3300046660 | Bacteria | 103961 |
| 595 | Ga0495625_0001294 | 3300046660 | Bacteria | 31403 |
| 596 | Ga0495625_0002544 | 3300046660 | Bacteria | 19610 |
| 597 | Ga0495625_0004436 | 3300046660 | Bacteria | 13280 |
| 598 | Ga0495625_0011232 | 3300046660 | Bacteria | 7323 |
| 599 | Ga0495625_0018010 | 3300046660 | Bacteria | 5519 |
| 600 | Ga0495625_0033878 | 3300046660 | Bacteria | 3772 |
| 601 | Ga0495625_0051682 | 3300046660 | Bacteria | 2946 |
| 602 | Ga0495625_0063521 | 3300046660 | Bacteria | 2607 |
| 603 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 604 | Ga0495661_0000138 | 3300046665 | Bacteria | 85693 |
| 605 | Ga0495661_0000513 | 3300046665 | Bacteria | 40214 |
| 606 | Ga0495661_0001164 | 3300046665 | Bacteria | 22955 |
| 607 | Ga0495661_0003700 | 3300046665 | Bacteria | 11231 |
| 608 | Ga0495661_0017049 | 3300046665 | Bacteria | 4799 |
| 609 | Ga0495661_0017264 | 3300046665 | Bacteria | 4767 |
| 610 | Ga0495661_0020353 | 3300046665 | Bacteria | 4334 |
| 611 | Ga0495661_0058967 | 3300046665 | Bacteria | 2286 |
| 612 | Ga0495588_0000391 | 3300046674 | Bacteria | 24911 |
| 613 | Ga0495623_0128494 | 3300046679 | Bacteria | 1520 |
| 614 | Ga0495670_0016537 | 3300046691 | Bacteria | 3626 |
| 615 | Ga0495670_0030426 | 3300046691 | Bacteria | 2681 |
| 616 | Ga0495670_0059391 | 3300046691 | Bacteria | 1920 |
| 617 | Ga0495670_0078325 | 3300046691 | Bacteria | 1681 |
| 618 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 619 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 620 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 621 | Ga0495671_0000052 | 3300046692 | Bacteria | 133684 |
| 622 | Ga0495671_0006188 | 3300046692 | Bacteria | 6944 |
| 623 | Ga0495671_0006726 | 3300046692 | Bacteria | 6618 |
| 624 | Ga0495671_0011811 | 3300046692 | Bacteria | 4788 |
| 625 | Ga0495671_0018251 | 3300046692 | Bacteria | 3724 |
| 626 | Ga0495649_0000091 | 3300046694 | Bacteria | 77817 |
| 627 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 628 | Ga0495649_0005407 | 3300046694 | Bacteria | 8127 |
| 629 | Ga0495589_0001063 | 3300046794 | Bacteria | 16487 |
| 630 | Ga0495589_0001115 | 3300046794 | Bacteria | 16012 |
| 631 | Ga0495589_0001135 | 3300046794 | Bacteria | 15823 |
| 632 | Ga0495589_0005638 | 3300046794 | Bacteria | 6601 |
| 633 | Ga0495589_0025245 | 3300046794 | Bacteria | 3017 |
| 634 | Ga0495589_0041889 | 3300046794 | Bacteria | 2283 |
| 635 | Ga0495660_0000118 | 3300046810 | Bacteria | 85202 |
| 636 | Ga0495660_0000920 | 3300046810 | Bacteria | 21658 |
| 637 | Ga0495660_0001366 | 3300046810 | Bacteria | 16808 |
| 638 | Ga0495660_0002313 | 3300046810 | Bacteria | 12218 |
| 639 | Ga0495660_0009066 | 3300046810 | Bacteria | 5810 |
| 640 | Ga0495660_0012438 | 3300046810 | Bacteria | 4941 |
| 641 | Ga0495660_0026044 | 3300046810 | Bacteria | 3318 |
| 642 | Ga0495660_0029529 | 3300046810 | Bacteria | 3092 |
| 643 | Ga0495604_0084815 | 3300047317 | Bacteria | 2365 |
| 644 | Ga0495636_0000127 | 3300047318 | Bacteria | 31014 |
| 645 | Ga0495636_0000221 | 3300047318 | Bacteria | 22484 |
| 646 | Ga0495672_0000868 | 3300047320 | Bacteria | 31821 |
| 647 | Ga0495672_0001535 | 3300047320 | Bacteria | 22596 |
| 648 | Ga0495672_0001946 | 3300047320 | Bacteria | 19522 |
| 649 | Ga0495672_0002724 | 3300047320 | Bacteria | 15866 |
| 650 | Ga0495672_0003990 | 3300047320 | Bacteria | 12347 |
| 651 | Ga0495672_0018611 | 3300047320 | Bacteria | 4604 |
| 652 | Ga0495672_0021254 | 3300047320 | Bacteria | 4236 |
| 653 | Ga0495672_0050139 | 3300047320 | Bacteria | 2467 |
| 654 | Ga0495672_0080428 | 3300047320 | Bacteria | 1817 |
| 655 | Ga0495676_0064662 | 3300047321 | Bacteria | 2842 |
| 656 | Ga0495683_0000108 | 3300047323 | Bacteria | 84498 |
| 657 | Ga0495683_0001247 | 3300047323 | Bacteria | 17258 |
| 658 | Ga0495683_0002624 | 3300047323 | Bacteria | 10750 |
| 659 | Ga0495683_0012170 | 3300047323 | Bacteria | 4522 |
| 660 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 661 | Ga0495687_000572 | 3300047443 | Bacteria | 43367 |
| 662 | Ga0495687_000642 | 3300047443 | Bacteria | 40071 |
| 663 | Ga0495687_001017 | 3300047443 | Bacteria | 27988 |
| 664 | Ga0495687_001130 | 3300047443 | Bacteria | 25900 |
| 665 | Ga0495687_009882 | 3300047443 | Bacteria | 5285 |
| 666 | Ga0495687_015678 | 3300047443 | Bacteria | 3843 |
| 667 | Ga0495675_0000016 | 3300047444 | Bacteria | 129732 |
| 668 | Ga0495677_0000249 | 3300047445 | Bacteria | 23579 |
| 669 | Ga0495677_0002252 | 3300047445 | Bacteria | 7626 |
| 670 | Ga0495679_000198 | 3300047446 | Bacteria | 53238 |
| 671 | Ga0495679_001113 | 3300047446 | Bacteria | 16209 |
| 672 | Ga0495679_004175 | 3300047446 | Bacteria | 6740 |
| 673 | Ga0495679_004666 | 3300047446 | Bacteria | 6244 |
| 674 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 675 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 676 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 677 | Ga0495673_0000035 | 3300047469 | Bacteria | 316861 |
| 678 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 679 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 680 | Ga0495673_0000321 | 3300047469 | Bacteria | 61858 |
| 681 | Ga0495673_0001285 | 3300047469 | Bacteria | 20490 |
| 682 | Ga0495673_0003373 | 3300047469 | Bacteria | 10563 |
| 683 | Ga0495673_0003734 | 3300047469 | Bacteria | 9891 |
| 684 | Ga0495673_0005427 | 3300047469 | Bacteria | 7708 |
| 685 | Ga0495673_0019601 | 3300047469 | Bacteria | 3386 |
| 686 | Ga0495673_0073541 | 3300047469 | Bacteria | 1432 |
| 687 | Ga0495681_0000009 | 3300047470 | Bacteria | 205224 |
| 688 | Ga0495681_0000257 | 3300047470 | Bacteria | 43264 |
| 689 | Ga0495681_0001074 | 3300047470 | Bacteria | 20845 |
| 690 | Ga0495681_0001750 | 3300047470 | Bacteria | 16011 |
| 691 | Ga0495681_0005751 | 3300047470 | Bacteria | 8246 |
| 692 | Ga0495681_0012346 | 3300047470 | Bacteria | 5025 |
| 693 | Ga0495681_0036771 | 3300047470 | Bacteria | 2418 |
| 694 | Ga0495684_0021654 | 3300047471 | Bacteria | 4950 |
| 695 | Ga0495686_0000161 | 3300047472 | Bacteria | 126951 |
| 696 | Ga0495686_0000284 | 3300047472 | Bacteria | 89023 |
| 697 | Ga0495686_0000503 | 3300047472 | Bacteria | 57024 |
| 698 | Ga0495686_0000633 | 3300047472 | Bacteria | 48475 |
| 699 | Ga0495686_0001069 | 3300047472 | Bacteria | 32620 |
| 700 | Ga0495686_0032516 | 3300047472 | Bacteria | 3376 |
| 701 | Ga0495686_0052738 | 3300047472 | Bacteria | 2549 |
| 702 | Ga0495602_0134294 | 3300048088 | Bacteria | 1968 |
| 703 | Ga0495615_0000107 | 3300048090 | Bacteria | 22549 |
| 704 | Ga0495626_0000015 | 3300048091 | Bacteria | 232238 |
| 705 | Ga0495626_0000033 | 3300048091 | Bacteria | 184008 |
| 706 | Ga0495626_0000963 | 3300048091 | Bacteria | 24947 |
| 707 | Ga0495626_0002074 | 3300048091 | Bacteria | 14590 |
| 708 | Ga0495626_0019293 | 3300048091 | Bacteria | 3411 |
| 709 | Ga0495626_0034107 | 3300048091 | Bacteria | 2436 |
| 710 | Ga0496101_0009417 | 3300048904 | Bacteria | 6420 |
| 711 | Ga0496101_0077336 | 3300048904 | Bacteria | 2452 |
| 712 | Ga0496102_0000143 | 3300048905 | Bacteria | 96813 |
| 713 | Ga0496102_0000613 | 3300048905 | Bacteria | 36995 |
| 714 | Ga0496102_0083762 | 3300048905 | Bacteria | 2942 |
| 715 | Ga0496102_0092328 | 3300048905 | Bacteria | 2803 |
| 716 | Ga0496103_0000098 | 3300048906 | Bacteria | 96109 |
| 717 | Ga0496103_0000163 | 3300048906 | Bacteria | 70387 |
| 718 | Ga0496103_0001372 | 3300048906 | Bacteria | 16427 |
| 719 | Ga0496103_0008348 | 3300048906 | Bacteria | 6153 |
| 720 | Ga0496103_0019032 | 3300048906 | Bacteria | 4123 |
| 721 | Ga0496104_0003754 | 3300048907 | Bacteria | 13131 |
| 722 | Ga0496104_0007054 | 3300048907 | Bacteria | 9911 |
| 723 | Ga0496104_0279447 | 3300048907 | Bacteria | 1583 |
| 724 | Ga0496105_0001309 | 3300048908 | Bacteria | 17421 |
| 725 | Ga0496105_0005911 | 3300048908 | Bacteria | 9334 |
| 726 | Ga0496105_0123836 | 3300048908 | Bacteria | 2131 |
| 727 | Ga0496106_0000233 | 3300048909 | Bacteria | 38847 |
| 728 | Ga0496106_0007898 | 3300048909 | Bacteria | 7864 |
| 729 | Ga0496106_0030871 | 3300048909 | Bacteria | 3995 |
| 730 | Ga0496107_0000019 | 3300048910 | Bacteria | 150224 |
| 731 | Ga0496107_0000100 | 3300048910 | Bacteria | 41794 |
| 732 | Ga0496108_0135122 | 3300048911 | Bacteria | 2121 |
| 733 | Ga0496108_0146923 | 3300048911 | Bacteria | 2033 |
| 734 | Ga0496109_0028123 | 3300048912 | Bacteria | 5027 |
| 735 | Ga0496110_0226498 | 3300048913 | Bacteria | 1700 |
| 736 | Ga0496111_0216837 | 3300048914 | Bacteria | 1422 |
| 737 | Ga0496112_0000267 | 3300048915 | Bacteria | 33517 |
| 738 | Ga0496113_0000031 | 3300048916 | Bacteria | 59792 |
| 739 | Ga0496113_0000081 | 3300048916 | Bacteria | 42072 |
| 740 | Ga0496114_0055201 | 3300048917 | Bacteria | 3313 |
| 741 | Ga0496114_0055235 | 3300048917 | Bacteria | 3313 |
| 742 | Ga0496115_0003823 | 3300048918 | Bacteria | 10850 |
| 743 | Ga0496115_0009634 | 3300048918 | Bacteria | 7187 |
| 744 | Ga0496116_0001473 | 3300048919 | Bacteria | 26338 |
| 745 | Ga0496116_0008741 | 3300048919 | Bacteria | 8737 |
| 746 | Ga0496116_0041734 | 3300048919 | Bacteria | 3144 |
| 747 | Ga0496116_0097053 | 3300048919 | Bacteria | 1773 |
| 748 | Ga0496117_0000121 | 3300048920 | Bacteria | 171532 |
| 749 | Ga0496117_0005261 | 3300048920 | Bacteria | 13731 |
| 750 | Ga0496117_0005816 | 3300048920 | Bacteria | 12774 |
| 751 | Ga0496117_0010277 | 3300048920 | Bacteria | 8559 |
| 752 | Ga0496117_0011270 | 3300048920 | Bacteria | 8022 |
| 753 | Ga0496117_0020317 | 3300048920 | Bacteria | 5417 |
| 754 | Ga0496117_0048689 | 3300048920 | Bacteria | 3023 |
| 755 | Ga0496117_0062535 | 3300048920 | Bacteria | 2551 |
| 756 | Ga0496118_0000095 | 3300048921 | Bacteria | 164850 |
| 757 | Ga0496118_0003634 | 3300048921 | Bacteria | 19147 |
| 758 | Ga0496118_0004347 | 3300048921 | Bacteria | 16869 |
| 759 | Ga0496118_0005130 | 3300048921 | Bacteria | 15035 |
| 760 | Ga0496118_0006175 | 3300048921 | Bacteria | 13276 |
| 761 | Ga0496118_0007255 | 3300048921 | Bacteria | 11823 |
| 762 | Ga0496118_0008390 | 3300048921 | Bacteria | 10687 |
| 763 | Ga0496118_0029942 | 3300048921 | Bacteria | 4555 |
| 764 | Ga0496118_0119532 | 3300048921 | Bacteria | 1722 |
| 765 | Ga0496119_0012070 | 3300048922 | Bacteria | 7060 |
| 766 | Ga0496119_0020493 | 3300048922 | Bacteria | 4824 |
| 767 | Ga0496119_0034497 | 3300048922 | Bacteria | 3331 |
| 768 | Ga0496119_0073860 | 3300048922 | Bacteria | 1988 |
| 769 | Ga0496120_0007164 | 3300048923 | Bacteria | 8361 |
| 770 | Ga0496121_0000067 | 3300048924 | Bacteria | 261543 |
| 771 | Ga0496121_0000097 | 3300048924 | Bacteria | 201224 |
| 772 | Ga0496121_0000098 | 3300048924 | Bacteria | 200516 |
| 773 | Ga0496121_0000624 | 3300048924 | Bacteria | 65948 |
| 774 | Ga0496121_0004401 | 3300048924 | Bacteria | 18985 |
| 775 | Ga0496121_0006234 | 3300048924 | Bacteria | 14940 |
| 776 | Ga0496121_0007968 | 3300048924 | Bacteria | 12653 |
| 777 | Ga0496121_0029800 | 3300048924 | Bacteria | 5031 |
| 778 | Ga0496122_0000092 | 3300048925 | Bacteria | 204463 |
| 779 | Ga0496122_0001234 | 3300048925 | Bacteria | 43175 |
| 780 | Ga0496122_0004452 | 3300048925 | Bacteria | 17372 |
| 781 | Ga0496122_0004540 | 3300048925 | Bacteria | 17113 |
| 782 | Ga0496122_0005467 | 3300048925 | Bacteria | 15122 |
| 783 | Ga0496122_0005743 | 3300048925 | Bacteria | 14625 |
| 784 | Ga0496122_0010593 | 3300048925 | Bacteria | 9468 |
| 785 | Ga0496122_0012169 | 3300048925 | Bacteria | 8604 |
| 786 | Ga0496122_0029147 | 3300048925 | Bacteria | 4663 |
| 787 | Ga0496122_0032481 | 3300048925 | Bacteria | 4315 |
| 788 | Ga0496122_0066270 | 3300048925 | Bacteria | 2611 |
| 789 | Ga0496122_0070000 | 3300048925 | Bacteria | 2509 |
| 790 | Ga0496123_0000028 | 3300048926 | Bacteria | 306006 |
| 791 | Ga0496123_0000598 | 3300048926 | Bacteria | 61286 |
| 792 | Ga0496123_0001346 | 3300048926 | Bacteria | 34633 |
| 793 | Ga0496123_0002700 | 3300048926 | Bacteria | 21334 |
| 794 | Ga0496123_0005386 | 3300048926 | Bacteria | 12895 |
| 795 | Ga0496123_0006893 | 3300048926 | Bacteria | 10874 |
| 796 | Ga0496123_0036538 | 3300048926 | Bacteria | 3482 |
| 797 | Ga0496123_0042003 | 3300048926 | Bacteria | 3162 |
| 798 | Ga0496123_0055407 | 3300048926 | Bacteria | 2601 |
| 799 | Ga0496123_0095090 | 3300048926 | Bacteria | 1754 |
| 800 | Ga0496124_0000119 | 3300048927 | Bacteria | 163996 |
| 801 | Ga0496124_0000812 | 3300048927 | Bacteria | 50806 |
| 802 | Ga0496124_0000873 | 3300048927 | Bacteria | 49224 |
| 803 | Ga0496124_0018216 | 3300048927 | Bacteria | 6586 |
| 804 | Ga0496124_0018404 | 3300048927 | Bacteria | 6541 |
| 805 | Ga0496124_0019199 | 3300048927 | Bacteria | 6373 |
| 806 | Ga0496124_0020785 | 3300048927 | Bacteria | 6058 |
| 807 | Ga0496124_0045554 | 3300048927 | Bacteria | 3759 |
| 808 | Ga0496124_0051057 | 3300048927 | Bacteria | 3520 |
| 809 | Ga0496124_0063227 | 3300048927 | Bacteria | 3093 |
| 810 | Ga0496124_0077237 | 3300048927 | Bacteria | 2747 |
| 811 | Ga0496124_0125839 | 3300048927 | Bacteria | 2042 |
| 812 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 813 | Ga0496125_0001250 | 3300048928 | Bacteria | 37917 |
| 814 | Ga0496125_0001903 | 3300048928 | Bacteria | 28565 |
| 815 | Ga0496125_0005821 | 3300048928 | Bacteria | 13544 |
| 816 | Ga0496125_0007696 | 3300048928 | Bacteria | 11418 |
| 817 | Ga0496125_0020652 | 3300048928 | Bacteria | 6176 |
| 818 | Ga0496125_0071493 | 3300048928 | Bacteria | 2709 |
| 819 | Ga0496125_0100470 | 3300048928 | Bacteria | 2132 |
| 820 | Ga0496125_0104213 | 3300048928 | Bacteria | 2078 |
| 821 | Ga0496126_0000688 | 3300048929 | Bacteria | 61933 |
| 822 | Ga0496126_0002234 | 3300048929 | Bacteria | 26775 |
| 823 | Ga0496126_0004349 | 3300048929 | Bacteria | 16993 |
| 824 | Ga0496126_0006740 | 3300048929 | Bacteria | 12749 |
| 825 | Ga0496126_0022348 | 3300048929 | Bacteria | 6157 |
| 826 | Ga0496126_0025214 | 3300048929 | Bacteria | 5725 |
| 827 | Ga0496126_0084425 | 3300048929 | Bacteria | 2801 |
| 828 | Ga0496126_0136434 | 3300048929 | Bacteria | 2116 |
| 829 | Ga0495678_000032 | 3300049459 | Bacteria | 212537 |
| 830 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 831 | Ga0495678_000583 | 3300049459 | Bacteria | 34467 |
| 832 | Ga0495678_001014 | 3300049459 | Bacteria | 24007 |
| 833 | Ga0495678_002176 | 3300049459 | Bacteria | 13770 |
| 834 | Ga0495678_003272 | 3300049459 | Bacteria | 10125 |
| 835 | Ga0495678_007623 | 3300049459 | Bacteria | 5585 |
| 836 | Ga0495678_008247 | 3300049459 | Bacteria | 5280 |
| 837 | Ga0495678_026617 | 3300049459 | Bacteria | 2465 |
| 838 | Ga0495682_0000013 | 3300049460 | Bacteria | 259670 |
| 839 | Ga0495682_0000150 | 3300049460 | Bacteria | 59591 |
| 840 | Ga0495682_0000702 | 3300049460 | Bacteria | 21923 |
| 841 | Ga0495682_0003894 | 3300049460 | Bacteria | 6522 |
| 842 | Ga0495682_0007634 | 3300049460 | Bacteria | 4292 |
| 843 | Ga0501249_000141 | 3300049679 | Bacteria | 22514 |
| 844 | Ga0501249_000857 | 3300049679 | Bacteria | 6739 |
| 845 | Ga0501257_013040 | 3300049686 | Bacteria | 1904 |
| 846 | Ga0501266_000087 | 3300049763 | Bacteria | 11514 |
| 847 | Ga0501269_000169 | 3300049766 | Bacteria | 19940 |
| 848 | nmdc:mga03683_2471_c1 | 3300050489 | Bacteria | 3788 |
| 849 | nmdc:mga03n38_2748_c1 | 3300050490 | Bacteria | 5515 |
| 850 | nmdc:mga0k408_37235_c1 | 3300050493 | Bacteria | 2792 |
| 851 | nmdc:mga06z11_8_c1 | 3300050494 | Bacteria | 115826 |
| 852 | nmdc:mga04h51_8_c1 | 3300050495 | Bacteria | 107557 |
| 853 | nmdc:mga07m45_13206_c1 | 3300050496 | Bacteria | 4376 |
| 854 | nmdc:mga07m45_26754_c1 | 3300050496 | Bacteria | 3171 |
| 855 | nmdc:mga0sz30_1693_c1 | 3300050516 | Bacteria | 7833 |
| 856 | Ga0500578_0000234 | 3300053086 | Bacteria | 68455 |
| 857 | Ga0500643_000503 | 3300053087 | Bacteria | 27831 |
| 858 | Ga0500643_005015 | 3300053087 | Bacteria | 5800 |
| 859 | Ga0500644_0000189 | 3300053088 | Bacteria | 38264 |
| 860 | Ga0500647_0047334 | 3300053091 | Bacteria | 2067 |
| 861 | Ga0500555_000799 | 3300053103 | Bacteria | 11353 |
| 862 | Ga0500556_0001301 | 3300053104 | Bacteria | 11228 |
| 863 | Ga0500594_0000022 | 3300053118 | Bacteria | 54062 |
| 864 | Ga0500607_000035 | 3300053121 | Bacteria | 87430 |
| 865 | Ga0500607_000058 | 3300053121 | Bacteria | 77958 |
| 866 | Ga0500608_000076 | 3300053122 | Bacteria | 42438 |
| 867 | Ga0500608_000400 | 3300053122 | Bacteria | 16661 |
| 868 | Ga0500618_000066 | 3300053125 | Bacteria | 89937 |
| 869 | Ga0500618_000430 | 3300053125 | Bacteria | 27901 |
| 870 | Ga0500658_0013135 | 3300053134 | Bacteria | 3057 |
| 871 | Ga0500559_0000058 | 3300053136 | Bacteria | 88268 |
| 872 | Ga0500559_0001018 | 3300053136 | Bacteria | 17198 |
| 873 | Ga0500559_0001082 | 3300053136 | Bacteria | 16527 |
| 874 | Ga0500559_0002704 | 3300053136 | Bacteria | 9010 |
| 875 | Ga0500559_0003584 | 3300053136 | Bacteria | 7594 |
| 876 | Ga0500559_0005739 | 3300053136 | Bacteria | 5670 |
| 877 | Ga0500559_0024248 | 3300053136 | Bacteria | 2580 |
| 878 | Ga0500564_000059 | 3300053138 | Bacteria | 29435 |
| 879 | Ga0500573_0000053 | 3300053140 | Bacteria | 92344 |
| 880 | Ga0500573_0010835 | 3300053140 | Bacteria | 5093 |
| 881 | Ga0500586_001720 | 3300053145 | Bacteria | 4727 |
| 882 | Ga0500604_0005543 | 3300053151 | Bacteria | 3332 |
| 883 | Ga0500622_0000047 | 3300053156 | Bacteria | 149427 |
| 884 | Ga0500622_0005400 | 3300053156 | Bacteria | 7686 |
| 885 | Ga0500622_0028425 | 3300053156 | Bacteria | 2944 |
| 886 | Ga0500624_000017 | 3300053157 | Bacteria | 132088 |
| 887 | Ga0500627_0001133 | 3300053158 | Bacteria | 7295 |
| 888 | Ga0500627_0008343 | 3300053158 | Bacteria | 3674 |
| 889 | Ga0500634_0022859 | 3300053161 | Bacteria | 3395 |
| 890 | Ga0500567_001470 | 3300053723 | Bacteria | 9527 |
| 891 | Ga0500611_000783 | 3300053727 | Bacteria | 3290 |
| 892 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 893 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 894 | Ga0500645_000196 | 3300053730 | Bacteria | 47064 |
| 895 | Ga0500645_001940 | 3300053730 | Bacteria | 9809 |
| 896 | Ga0500645_004520 | 3300053730 | Bacteria | 5309 |
| 897 | Ga0500645_006527 | 3300053730 | Bacteria | 4149 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026088 | Ga0207641_10005639 | Ga0207641_100056394 | 377 |
| 2 | 3300009148 | Ga0105243_10000047 | Ga0105243_1000004733 | 403 |
| 3 | 3300009553 | Ga0105249_10011862 | Ga0105249_100118622 | 403 |
| 4 | 3300025935 | Ga0207709_10000058 | Ga0207709_10000058134 | 403 |
| 5 | 3300025961 | Ga0207712_10013582 | Ga0207712_100135822 | 403 |
| 6 | 3300048920 | Ga0496117_0010277 | Ga0496117_0010277_3119_4447 | 403 |
| 7 | 3300048924 | Ga0496121_0000097 | Ga0496121_0000097_169596_170924 | 403 |
| 8 | 3300048925 | Ga0496122_0004540 | Ga0496122_0004540_531_1859 | 403 |
| 9 | 3300048926 | Ga0496123_0002700 | Ga0496123_0002700_489_1817 | 403 |
| 10 | 3300002737 | JGI25162J39368_1000448 | JGI25162J39368_100044811 | 410 |
| 11 | 3300002771 | JGI25163J39215_1000169 | JGI25163J39215_10001696 | 410 |
| 12 | 3300002772 | JGI25164J39214_1000306 | JGI25164J39214_100030611 | 410 |
| 13 | 3300003214 | JGI25165J46597_1000121 | JGI25165J46597_100012118 | 410 |
| 14 | 3300025207 | Ga0209760_100185 | Ga0209760_10018518 | 410 |
| 15 | 3300025231 | Ga0207427_100014 | Ga0207427_100014147 | 410 |
| 16 | 3300025233 | Ga0209437_100016 | Ga0209437_100016490 | 410 |
| 17 | 3300025261 | Ga0209233_1000036 | Ga0209233_1000036147 | 410 |
| 18 | 3300047446 | Ga0495679_004175 | Ga0495679_004175_3423_4670 | 415 |
| 19 | 3300003323 | rootH1_10266568 | rootH1_102665682 | 417 |
| 20 | 3300028558 | Ga0265326_10018769 | Ga0265326_100187692 | 420 |
| 21 | 3300048090 | Ga0495615_0000107 | Ga0495615_0000107_13560_14894 | 423 |
| 22 | 3300048925 | Ga0496122_0005743 | Ga0496122_0005743_2010_3344 | 423 |
| 23 | 3300048926 | Ga0496123_0036538 | Ga0496123_0036538_284_1618 | 423 |
| 24 | 3300039447 | Ga0436361_0863053 | Ga0436361_0863053_897_2222 | 425 |
| 25 | 3300046457 | Ga0495590_0003169 | Ga0495590_0003169_3677_5047 | 425 |
| 26 | 3300046519 | Ga0495632_0000207 | Ga0495632_0000207_41495_42865 | 425 |
| 27 | 3300046520 | Ga0495637_0002671 | Ga0495637_0002671_3872_5242 | 425 |
| 28 | 3300046522 | Ga0495643_0002236 | Ga0495643_0002236_10856_12226 | 425 |
| 29 | 3300046528 | Ga0495642_0000114 | Ga0495642_0000114_39350_40720 | 425 |
| 30 | 3300046538 | Ga0495609_0000111 | Ga0495609_0000111_65696_67066 | 425 |
| 31 | 3300046692 | Ga0495671_0011811 | Ga0495671_0011811_269_1582 | 425 |
| 32 | 3300046694 | Ga0495649_0000091 | Ga0495649_0000091_10863_12233 | 425 |
| 33 | 3300046794 | Ga0495589_0041889 | Ga0495589_0041889_836_2206 | 425 |
| 34 | 3300047318 | Ga0495636_0000127 | Ga0495636_0000127_12960_14330 | 425 |
| 35 | 3300047320 | Ga0495672_0002724 | Ga0495672_0002724_1537_2907 | 425 |
| 36 | 3300047321 | Ga0495676_0064662 | Ga0495676_0064662_558_1871 | 425 |
| 37 | 3300047443 | Ga0495687_015678 | Ga0495687_015678_173_1543 | 425 |
| 38 | 3300049459 | Ga0495678_002176 | Ga0495678_002176_1538_2908 | 425 |
| 39 | 3300049460 | Ga0495682_0000702 | Ga0495682_0000702_12275_13645 | 425 |
| 40 | 3300026121 | Ga0207683_10058640 | Ga0207683_100586403 | 426 |
| 41 | 3300031507 | Ga0307509_10008863 | Ga0307509_1000886313 | 426 |
| 42 | 3300031616 | Ga0307508_10000204 | Ga0307508_100002043 | 426 |
| 43 | 3300033180 | Ga0307510_10095588 | Ga0307510_100955882 | 426 |
| 44 | 3300046542 | Ga0495597_0025967 | Ga0495597_0025967_54_1388 | 426 |
| 45 | 3300047443 | Ga0495687_000642 | Ga0495687_000642_23564_24898 | 426 |
| 46 | 3300048927 | Ga0496124_0077237 | Ga0496124_0077237_967_2289 | 426 |
| 47 | 3300005841 | Ga0068863_100033449 | Ga0068863_1000334493 | 427 |
| 48 | 3300005843 | Ga0068860_100178234 | Ga0068860_1001782341 | 427 |
| 49 | 3300013306 | Ga0163162_10009185 | Ga0163162_100091857 | 427 |
| 50 | 3300028794 | Ga0307515_10068578 | Ga0307515_100685785 | 427 |
| 51 | 3300047320 | Ga0495672_0021254 | Ga0495672_0021254_2891_4213 | 427 |
| 52 | 3300048904 | Ga0496101_0077336 | Ga0496101_0077336_988_2301 | 427 |
| 53 | 3300048905 | Ga0496102_0083762 | Ga0496102_0083762_1317_2630 | 427 |
| 54 | 3300048906 | Ga0496103_0019032 | Ga0496103_0019032_1153_2466 | 427 |
| 55 | 3300048907 | Ga0496104_0003754 | Ga0496104_0003754_5036_6349 | 427 |
| 56 | 3300048908 | Ga0496105_0005911 | Ga0496105_0005911_3552_4865 | 427 |
| 57 | 3300048909 | Ga0496106_0000233 | Ga0496106_0000233_15702_17015 | 427 |
| 58 | 3300048910 | Ga0496107_0000100 | Ga0496107_0000100_25951_27264 | 427 |
| 59 | 3300048912 | Ga0496109_0028123 | Ga0496109_0028123_184_1497 | 427 |
| 60 | 3300048913 | Ga0496110_0226498 | Ga0496110_0226498_367_1680 | 427 |
| 61 | 3300048915 | Ga0496112_0000267 | Ga0496112_0000267_23852_25165 | 427 |
| 62 | 3300048916 | Ga0496113_0000031 | Ga0496113_0000031_8448_9761 | 427 |
| 63 | iso_pu_bacteria | 2511231035 | 2511433098 | 427 |
| 64 | 3300002459 | JGI24751J29686_10001447 | JGI24751J29686_100014472 | 428 |
| 65 | 3300005295 | Ga0065707_10001308 | Ga0065707_100013083 | 428 |
| 66 | 3300005335 | Ga0070666_10081034 | Ga0070666_100810342 | 428 |
| 67 | 3300005347 | Ga0070668_100000045 | Ga0070668_10000004517 | 428 |
| 68 | 3300005355 | Ga0070671_100002400 | Ga0070671_1000024007 | 428 |
| 69 | 3300005367 | Ga0070667_100000009 | Ga0070667_100000009206 | 428 |
| 70 | 3300005842 | Ga0068858_100001386 | Ga0068858_10000138627 | 428 |
| 71 | 3300005843 | Ga0068860_100000193 | Ga0068860_10000019342 | 428 |
| 72 | 3300005844 | Ga0068862_100000031 | Ga0068862_10000003189 | 428 |
| 73 | 3300006177 | Ga0075362_10023032 | Ga0075362_100230323 | 428 |
| 74 | 3300006186 | Ga0075369_10001433 | Ga0075369_100014336 | 428 |
| 75 | 3300006353 | Ga0075370_10008619 | Ga0075370_100086194 | 428 |
| 76 | 3300006353 | Ga0075370_10081181 | Ga0075370_100811812 | 428 |
| 77 | 3300014968 | Ga0157379_10003646 | Ga0157379_100036464 | 428 |
| 78 | 3300025925 | Ga0207650_10001354 | Ga0207650_1000135412 | 428 |
| 79 | 3300025931 | Ga0207644_10000084 | Ga0207644_1000008426 | 428 |
| 80 | 3300025972 | Ga0207668_10000031 | Ga0207668_1000003112 | 428 |
| 81 | 3300025986 | Ga0207658_10000009 | Ga0207658_1000000960 | 428 |
| 82 | 3300025986 | Ga0207658_10000173 | Ga0207658_1000017326 | 428 |
| 83 | 3300026035 | Ga0207703_10005397 | Ga0207703_1000539711 | 428 |
| 84 | 3300026088 | Ga0207641_10004419 | Ga0207641_100044193 | 428 |
| 85 | 3300026118 | Ga0207675_100063072 | Ga0207675_1000630722 | 428 |
| 86 | 3300028380 | Ga0268265_10000118 | Ga0268265_1000011864 | 428 |
| 87 | 3300028381 | Ga0268264_10000001 | Ga0268264_1000000160 | 428 |
| 88 | 3300035691 | Ga0373931_0027539 | Ga0373931_0027539_150_1487 | 428 |
| 89 | 3300050489 | nmdc:mga03683_2471_c1 | nmdc:mga03683_2471_c1_1561_2886 | 428 |
| 90 | 3300050496 | nmdc:mga07m45_26754_c1 | nmdc:mga07m45_26754_c1_1647_2972 | 428 |
| 91 | 3300050516 | nmdc:mga0sz30_1693_c1 | nmdc:mga0sz30_1693_c1_2156_3481 | 428 |
| 92 | 3300046460 | Ga0495638_0000399 | Ga0495638_0000399_7862_9202 | 429 |
| 93 | iso_pu_bacteria | 8054795415 | 8054797880 | 429 |
| 94 | 3300005937 | Ga0081455_10000872 | Ga0081455_1000087211 | 430 |
| 95 | 3300048917 | Ga0496114_0055235 | Ga0496114_0055235_1304_2617 | 430 |
| 96 | 3300048925 | Ga0496122_0029147 | Ga0496122_0029147_384_1697 | 430 |
| 97 | 3300048926 | Ga0496123_0042003 | Ga0496123_0042003_1523_2836 | 430 |
| 98 | 3300048928 | Ga0496125_0001903 | Ga0496125_0001903_10962_12275 | 430 |
| 99 | 3300005355 | Ga0070671_100000003 | Ga0070671_10000000372 | 431 |
| 100 | 3300005367 | Ga0070667_100000336 | Ga0070667_10000033631 | 431 |
| 101 | 3300005367 | Ga0070667_100040423 | Ga0070667_1000404231 | 431 |
| 102 | 3300005841 | Ga0068863_100080560 | Ga0068863_1000805602 | 431 |
| 103 | 3300005843 | Ga0068860_100011953 | Ga0068860_1000119538 | 431 |
| 104 | 3300009177 | Ga0105248_10188965 | Ga0105248_101889652 | 431 |
| 105 | 3300014968 | Ga0157379_10053777 | Ga0157379_100537772 | 431 |
| 106 | 3300025903 | Ga0207680_10001712 | Ga0207680_100017122 | 431 |
| 107 | 3300025931 | Ga0207644_10000004 | Ga0207644_10000004394 | 431 |
| 108 | 3300025986 | Ga0207658_10004604 | Ga0207658_100046042 | 431 |
| 109 | 3300026088 | Ga0207641_10016352 | Ga0207641_100163524 | 431 |
| 110 | 3300028381 | Ga0268264_10059509 | Ga0268264_100595092 | 431 |
| 111 | 3300048904 | Ga0496101_0009417 | Ga0496101_0009417_439_1785 | 431 |
| 112 | 3300048905 | Ga0496102_0092328 | Ga0496102_0092328_182_1528 | 431 |
| 113 | 3300048907 | Ga0496104_0007054 | Ga0496104_0007054_3440_4786 | 431 |
| 114 | 3300048909 | Ga0496106_0030871 | Ga0496106_0030871_1203_2549 | 431 |
| 115 | 3300048911 | Ga0496108_0135122 | Ga0496108_0135122_137_1483 | 431 |
| 116 | 3300048918 | Ga0496115_0003823 | Ga0496115_0003823_1161_2507 | 431 |
| 117 | 3300005937 | Ga0081455_10007504 | Ga0081455_100075043 | 432 |
| 118 | iso_pu_bacteria | 2844315083 | 2844322842 | 433 |
| 119 | iso_pu_bacteria | 2903727486 | 2903734642 | 433 |
| 120 | iso_pu_bacteria | 2906602504 | 2906605047 | 433 |
| 121 | iso_pu_bacteria | 3005594810 | 3005602563 | 433 |
| 122 | iso_pu_bacteria | 3005718088 | 3005726033 | 433 |
| 123 | iso_pu_bacteria | 8056967851 | 8056976496 | 433 |
| 124 | 3300046520 | Ga0495637_0004462 | Ga0495637_0004462_1775_3079 | 434 |
| 125 | 3300047320 | Ga0495672_0001946 | Ga0495672_0001946_9366_10721 | 434 |
| 126 | 3300047323 | Ga0495683_0012170 | Ga0495683_0012170_2219_3532 | 434 |
| 127 | 3300053104 | Ga0500556_0001301 | Ga0500556_0001301_3868_5172 | 434 |
| 128 | 3300053727 | Ga0500611_000783 | Ga0500611_000783_801_2105 | 434 |
| 129 | 3300049763 | Ga0501266_000087 | Ga0501266_000087_10030_11364 | 435 |
| 130 | 3300053140 | Ga0500573_0000053 | Ga0500573_0000053_1489_2808 | 435 |
| 131 | iso_pu_bacteria | 8056533031 | 8056536957 | 435 |
| 132 | 3300048929 | Ga0496126_0136434 | Ga0496126_0136434_747_2096 | 436 |
| 133 | iso_pu_bacteria | 2675903420 | 2677899125 | 436 |
| 134 | iso_pu_bacteria | 2980182181 | 2980184152 | 436 |
| 135 | 3300015262 | Ga0182007_10000682 | Ga0182007_1000068211 | 437 |
| 136 | 3300035695 | Ga0373927_0042026 | Ga0373927_0042026_1065_2495 | 437 |
| 137 | 3300042013 | Ga0439456_002535 | Ga0439456_002535_1918_3237 | 437 |
| 138 | 3300048924 | Ga0496121_0029800 | Ga0496121_0029800_1383_2699 | 437 |
| 139 | 3300006195 | Ga0075366_10069282 | Ga0075366_100692822 | 438 |
| 140 | 3300025299 | Ga0209256_1006602 | Ga0209256_10066022 | 438 |
| 141 | 3300025913 | Ga0207695_10165322 | Ga0207695_101653221 | 438 |
| 142 | 3300046452 | Ga0495617_011875 | Ga0495617_011875_979_2301 | 438 |
| 143 | 3300046457 | Ga0495590_0030594 | Ga0495590_0030594_211_1533 | 438 |
| 144 | 3300046458 | Ga0495591_000088 | Ga0495591_000088_30828_32150 | 438 |
| 145 | 3300046471 | Ga0495650_0003742 | Ga0495650_0003742_7931_9253 | 438 |
| 146 | 3300046491 | Ga0495584_0018535 | Ga0495584_0018535_682_2004 | 438 |
| 147 | 3300046500 | Ga0495596_0000061 | Ga0495596_0000061_7550_8872 | 438 |
| 148 | 3300046513 | Ga0495616_0034791 | Ga0495616_0034791_222_1544 | 438 |
| 149 | 3300046520 | Ga0495637_0001450 | Ga0495637_0001450_8067_9386 | 438 |
| 150 | 3300046520 | Ga0495637_0001481 | Ga0495637_0001481_951_2273 | 438 |
| 151 | 3300046522 | Ga0495643_0018408 | Ga0495643_0018408_2385_3707 | 438 |
| 152 | 3300046523 | Ga0495644_0019907 | Ga0495644_0019907_142_1464 | 438 |
| 153 | 3300046530 | Ga0495654_0001637 | Ga0495654_0001637_7208_8530 | 438 |
| 154 | 3300046530 | Ga0495654_0014271 | Ga0495654_0014271_1554_2873 | 438 |
| 155 | 3300046542 | Ga0495597_0006237 | Ga0495597_0006237_682_2004 | 438 |
| 156 | 3300046616 | Ga0495668_0001601 | Ga0495668_0001601_7550_8872 | 438 |
| 157 | 3300046660 | Ga0495625_0018010 | Ga0495625_0018010_939_2261 | 438 |
| 158 | 3300046665 | Ga0495661_0017264 | Ga0495661_0017264_187_1509 | 438 |
| 159 | 3300046674 | Ga0495588_0000391 | Ga0495588_0000391_15818_17137 | 438 |
| 160 | 3300046794 | Ga0495589_0005638 | Ga0495589_0005638_1919_3241 | 438 |
| 161 | 3300047320 | Ga0495672_0050139 | Ga0495672_0050139_614_1936 | 438 |
| 162 | 3300047469 | Ga0495673_0019601 | Ga0495673_0019601_1383_2705 | 438 |
| 163 | 3300047470 | Ga0495681_0000257 | Ga0495681_0000257_22014_23336 | 438 |
| 164 | 3300048091 | Ga0495626_0000033 | Ga0495626_0000033_57638_58960 | 438 |
| 165 | 3300053156 | Ga0500622_0005400 | Ga0500622_0005400_6304_7638 | 438 |
| 166 | iso_pu_bacteria | 2510917020 | 2511120360 | 438 |
| 167 | iso_pu_bacteria | 2585428106 | 2587917624 | 438 |
| 168 | iso_pu_bacteria | 2643221552 | 2643778390 | 438 |
| 169 | iso_pu_bacteria | 2643221583 | 2643924771 | 438 |
| 170 | iso_pu_bacteria | 2643221584 | 2643927350 | 438 |
| 171 | iso_pu_bacteria | 2738541297 | 2738829803 | 438 |
| 172 | iso_pu_bacteria | 2738541357 | 2739153599 | 438 |
| 173 | iso_pu_bacteria | 2738543003 | 2739195519 | 438 |
| 174 | iso_pu_bacteria | 2738543026 | 2739321995 | 438 |
| 175 | iso_pu_bacteria | 2738543029 | 2739340236 | 438 |
| 176 | iso_pu_bacteria | 2791355048 | 2792462396 | 438 |
| 177 | iso_pu_bacteria | 2821131069 | 2821131760 | 438 |
| 178 | iso_pu_bacteria | 2843744320 | 2843748728 | 438 |
| 179 | iso_pu_bacteria | 2849560528 | 2849565298 | 438 |
| 180 | iso_pu_bacteria | 2851153111 | 2851156530 | 438 |
| 181 | iso_pu_bacteria | 2857504554 | 2857507762 | 438 |
| 182 | iso_pu_bacteria | 2898329390 | 2898330200 | 438 |
| 183 | iso_pu_bacteria | 2904113452 | 2904115983 | 438 |
| 184 | 3300005347 | Ga0070668_100008385 | Ga0070668_1000083854 | 439 |
| 185 | 3300005347 | Ga0070668_100021709 | Ga0070668_1000217094 | 439 |
| 186 | 3300005347 | Ga0070668_100022840 | Ga0070668_1000228404 | 439 |
| 187 | 3300005617 | Ga0068859_100021404 | Ga0068859_1000214043 | 439 |
| 188 | 3300005618 | Ga0068864_100041916 | Ga0068864_1000419164 | 439 |
| 189 | 3300005842 | Ga0068858_100050201 | Ga0068858_1000502013 | 439 |
| 190 | 3300005843 | Ga0068860_100000051 | Ga0068860_10000005173 | 439 |
| 191 | 3300005843 | Ga0068860_100040398 | Ga0068860_1000403984 | 439 |
| 192 | 3300005844 | Ga0068862_100011846 | Ga0068862_1000118463 | 439 |
| 193 | 3300006931 | Ga0097620_100021404 | Ga0097620_1000214045 | 439 |
| 194 | 3300009098 | Ga0105245_10000721 | Ga0105245_1000072116 | 439 |
| 195 | 3300009553 | Ga0105249_10113894 | Ga0105249_101138942 | 439 |
| 196 | 3300025927 | Ga0207687_10000467 | Ga0207687_1000046715 | 439 |
| 197 | 3300025972 | Ga0207668_10003946 | Ga0207668_100039464 | 439 |
| 198 | 3300025972 | Ga0207668_10027971 | Ga0207668_100279712 | 439 |
| 199 | 3300025972 | Ga0207668_10030627 | Ga0207668_100306272 | 439 |
| 200 | 3300025986 | Ga0207658_10006715 | Ga0207658_100067155 | 439 |
| 201 | 3300026118 | Ga0207675_100039006 | Ga0207675_1000390065 | 439 |
| 202 | 3300028380 | Ga0268265_10002558 | Ga0268265_100025588 | 439 |
| 203 | 3300028381 | Ga0268264_10000021 | Ga0268264_10000021366 | 439 |
| 204 | 3300046452 | Ga0495617_000003 | Ga0495617_000003_165181_166509 | 439 |
| 205 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_345817_347145 | 439 |
| 206 | 3300046471 | Ga0495650_0002248 | Ga0495650_0002248_9290_10618 | 439 |
| 207 | 3300046471 | Ga0495650_0012276 | Ga0495650_0012276_2516_3844 | 439 |
| 208 | 3300046474 | Ga0495605_0000068 | Ga0495605_0000068_41181_42509 | 439 |
| 209 | 3300046492 | Ga0495585_0006735 | Ga0495585_0006735_800_2128 | 439 |
| 210 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_849979_851307 | 439 |
| 211 | 3300046517 | Ga0495630_0000058 | Ga0495630_0000058_6973_8301 | 439 |
| 212 | 3300046520 | Ga0495637_0000214 | Ga0495637_0000214_10015_11343 | 439 |
| 213 | 3300046524 | Ga0495648_0001378 | Ga0495648_0001378_6215_7543 | 439 |
| 214 | 3300046524 | Ga0495648_0008114 | Ga0495648_0008114_839_2167 | 439 |
| 215 | 3300046530 | Ga0495654_0000292 | Ga0495654_0000292_33746_35074 | 439 |
| 216 | 3300046616 | Ga0495668_0000512 | Ga0495668_0000512_24947_26275 | 439 |
| 217 | 3300046660 | Ga0495625_0051682 | Ga0495625_0051682_911_2239 | 439 |
| 218 | 3300046665 | Ga0495661_0001164 | Ga0495661_0001164_2274_3602 | 439 |
| 219 | 3300046665 | Ga0495661_0017049 | Ga0495661_0017049_2658_3986 | 439 |
| 220 | 3300046692 | Ga0495671_0000010 | Ga0495671_0000010_103168_104496 | 439 |
| 221 | 3300046810 | Ga0495660_0009066 | Ga0495660_0009066_1561_2889 | 439 |
| 222 | 3300047446 | Ga0495679_004666 | Ga0495679_004666_803_2131 | 439 |
| 223 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1055551_1056879 | 439 |
| 224 | 3300047469 | Ga0495673_0000016 | Ga0495673_0000016_342382_343710 | 439 |
| 225 | 3300047472 | Ga0495686_0000503 | Ga0495686_0000503_50217_51584 | 439 |
| 226 | 3300048088 | Ga0495602_0134294 | Ga0495602_0134294_145_1473 | 439 |
| 227 | 3300048924 | Ga0496121_0000098 | Ga0496121_0000098_119830_121194 | 439 |
| 228 | 3300048924 | Ga0496121_0007968 | Ga0496121_0007968_1296_2624 | 439 |
| 229 | 3300048925 | Ga0496122_0004452 | Ga0496122_0004452_7982_9310 | 439 |
| 230 | 3300048926 | Ga0496123_0005386 | Ga0496123_0005386_957_2285 | 439 |
| 231 | 3300048929 | Ga0496126_0022348 | Ga0496126_0022348_871_2199 | 439 |
| 232 | 3300049686 | Ga0501257_013040 | Ga0501257_013040_413_1744 | 439 |
| 233 | 3300053145 | Ga0500586_001720 | Ga0500586_001720_2398_3726 | 439 |
| 234 | iso_pu_bacteria | 2599185354 | 2600200643 | 439 |
| 235 | iso_pu_bacteria | 2840764183 | 2840764384 | 439 |
| 236 | iso_pu_bacteria | 2874168670 | 2874173005 | 439 |
| 237 | iso_pu_bacteria | 2904424332 | 2904425783 | 439 |
| 238 | iso_pu_bacteria | 2919138771 | 2919141860 | 439 |
| 239 | iso_pu_bacteria | 8054302542 | 8054304600 | 439 |
| 240 | iso_pu_bacteria | 8057473075 | 8057473980 | 439 |
| 241 | 3300003751 | Ga0055538_1001047 | Ga0055538_10010475 | 440 |
| 242 | 3300003752 | Ga0055539_1000990 | Ga0055539_10009905 | 440 |
| 243 | 3300003756 | Ga0055533_1001472 | Ga0055533_10014725 | 440 |
| 244 | 3300003758 | Ga0055532_1001544 | Ga0055532_10015445 | 440 |
| 245 | 3300003759 | Ga0055525_1001160 | Ga0055525_10011605 | 440 |
| 246 | 3300003781 | Ga0055536_1000027 | Ga0055536_100002763 | 440 |
| 247 | 3300003791 | Ga0055530_10000079 | Ga0055530_1000007963 | 440 |
| 248 | 3300003841 | Ga0055541_1001087 | Ga0055541_10010875 | 440 |
| 249 | 3300005331 | Ga0070670_100005599 | Ga0070670_1000055994 | 440 |
| 250 | 3300009036 | Ga0105244_10002527 | Ga0105244_1000252712 | 440 |
| 251 | 3300013308 | Ga0157375_10000819 | Ga0157375_100008195 | 440 |
| 252 | 3300025206 | Ga0209435_101060 | Ga0209435_1010603 | 440 |
| 253 | 3300025224 | Ga0209784_100065 | Ga0209784_100065103 | 440 |
| 254 | 3300025225 | Ga0209566_100081 | Ga0209566_100081103 | 440 |
| 255 | 3300025226 | Ga0209674_100101 | Ga0209674_100101103 | 440 |
| 256 | 3300025229 | Ga0209147_100152 | Ga0209147_10015248 | 440 |
| 257 | 3300025230 | Ga0209563_100098 | Ga0209563_100098103 | 440 |
| 258 | 3300025233 | Ga0209437_104459 | Ga0209437_1044591 | 440 |
| 259 | 3300025242 | Ga0209258_101731 | Ga0209258_1017315 | 440 |
| 260 | 3300025246 | Ga0209646_1001452 | Ga0209646_10014521 | 440 |
| 261 | 3300025253 | Ga0209677_100059 | Ga0209677_100059103 | 440 |
| 262 | 3300025292 | Ga0209676_1000087 | Ga0209676_1000087159 | 440 |
| 263 | 3300025298 | Ga0209050_1000083 | Ga0209050_1000083159 | 440 |
| 264 | 3300025303 | Ga0209051_1008204 | Ga0209051_10082042 | 440 |
| 265 | 3300025304 | Ga0209257_1002683 | Ga0209257_10026835 | 440 |
| 266 | 3300025728 | Ga0207655_1002757 | Ga0207655_10027573 | 440 |
| 267 | 3300025925 | Ga0207650_10000384 | Ga0207650_1000038418 | 440 |
| 268 | 3300046453 | Ga0495627_000334 | Ga0495627_000334_29051_30382 | 440 |
| 269 | 3300046507 | Ga0495606_0054372 | Ga0495606_0054372_1172_2518 | 440 |
| 270 | 3300046512 | Ga0495610_0001222 | Ga0495610_0001222_1755_3086 | 440 |
| 271 | 3300046512 | Ga0495610_0009414 | Ga0495610_0009414_700_2034 | 440 |
| 272 | 3300046512 | Ga0495610_0032252 | Ga0495610_0032252_1143_2486 | 440 |
| 273 | 3300046513 | Ga0495616_0027272 | Ga0495616_0027272_1182_2516 | 440 |
| 274 | 3300046515 | Ga0495620_0022451 | Ga0495620_0022451_1455_2807 | 440 |
| 275 | 3300046516 | Ga0495628_0036011 | Ga0495628_0036011_1406_2737 | 440 |
| 276 | 3300046518 | Ga0495631_0033461 | Ga0495631_0033461_623_1957 | 440 |
| 277 | 3300046524 | Ga0495648_0000239 | Ga0495648_0000239_27483_28829 | 440 |
| 278 | 3300046616 | Ga0495668_0010946 | Ga0495668_0010946_2567_3913 | 440 |
| 279 | 3300046616 | Ga0495668_0022182 | Ga0495668_0022182_376_1722 | 440 |
| 280 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_87870_89201 | 440 |
| 281 | 3300047469 | Ga0495673_0000321 | Ga0495673_0000321_27512_28858 | 440 |
| 282 | 3300047472 | Ga0495686_0000284 | Ga0495686_0000284_36875_38209 | 440 |
| 283 | 3300047472 | Ga0495686_0032516 | Ga0495686_0032516_264_1595 | 440 |
| 284 | 3300048925 | Ga0496122_0012169 | Ga0496122_0012169_6100_7578 | 440 |
| 285 | 3300048927 | Ga0496124_0020785 | Ga0496124_0020785_4317_5663 | 440 |
| 286 | 3300048929 | Ga0496126_0002234 | Ga0496126_0002234_23424_24758 | 440 |
| 287 | 3300053086 | Ga0500578_0000234 | Ga0500578_0000234_41759_43093 | 440 |
| 288 | 3300053088 | Ga0500644_0000189 | Ga0500644_0000189_27375_28721 | 440 |
| 289 | 3300053118 | Ga0500594_0000022 | Ga0500594_0000022_17911_19245 | 440 |
| 290 | 3300053122 | Ga0500608_000076 | Ga0500608_000076_17335_18681 | 440 |
| 291 | 3300053136 | Ga0500559_0003584 | Ga0500559_0003584_525_1871 | 440 |
| 292 | 3300053138 | Ga0500564_000059 | Ga0500564_000059_11765_13111 | 440 |
| 293 | 3300053156 | Ga0500622_0000047 | Ga0500622_0000047_119572_120906 | 440 |
| 294 | iso_pu_bacteria | 2508501114 | 2509074668 | 440 |
| 295 | iso_pu_bacteria | 2582581279 | 2585149462 | 440 |
| 296 | iso_pu_bacteria | 2585427531 | 2585563968 | 440 |
| 297 | iso_pu_bacteria | 2775507049 | 2776914038 | 440 |
| 298 | iso_pu_bacteria | 2909399089 | 2909401126 | 440 |
| 299 | iso_pu_bacteria | 2919709256 | 2919710837 | 440 |
| 300 | iso_pu_bacteria | 2928531327 | 2928533758 | 440 |
| 301 | iso_pu_bacteria | 2928959182 | 2928961966 | 440 |
| 302 | iso_pu_bacteria | 2937836603 | 2937838510 | 440 |
| 303 | iso_pu_bacteria | 3007872151 | 3007873812 | 440 |
| 304 | iso_pu_bacteria | 8056137416 | 8056139505 | 440 |
| 305 | 3300005339 | Ga0070660_100022198 | Ga0070660_1000221983 | 441 |
| 306 | 3300005539 | Ga0068853_100000323 | Ga0068853_10000032320 | 441 |
| 307 | 3300009036 | Ga0105244_10009145 | Ga0105244_100091454 | 441 |
| 308 | 3300025728 | Ga0207655_1032477 | Ga0207655_10324772 | 441 |
| 309 | 3300025919 | Ga0207657_10063173 | Ga0207657_100631733 | 441 |
| 310 | 3300026041 | Ga0207639_10001573 | Ga0207639_1000157314 | 441 |
| 311 | 3300030500 | Ga0268256_1019716 | Ga0268256_10197162 | 441 |
| 312 | 3300030744 | Ga0316181_1279899 | Ga0316181_12798993 | 441 |
| 313 | 3300031507 | Ga0307509_10185091 | Ga0307509_101850912 | 441 |
| 314 | 3300044765 | Ga0466970_0027931 | Ga0466970_0027931_446_1780 | 441 |
| 315 | 3300046452 | Ga0495617_000344 | Ga0495617_000344_12396_13730 | 441 |
| 316 | 3300046452 | Ga0495617_001200 | Ga0495617_001200_2646_3983 | 441 |
| 317 | 3300046453 | Ga0495627_000008 | Ga0495627_000008_99795_101144 | 441 |
| 318 | 3300046453 | Ga0495627_000056 | Ga0495627_000056_39770_41104 | 441 |
| 319 | 3300046491 | Ga0495584_0000027 | Ga0495584_0000027_97176_98510 | 441 |
| 320 | 3300046500 | Ga0495596_0000006 | Ga0495596_0000006_128579_129913 | 441 |
| 321 | 3300046500 | Ga0495596_0001000 | Ga0495596_0001000_6690_8024 | 441 |
| 322 | 3300046501 | Ga0495607_0029544 | Ga0495607_0029544_624_1958 | 441 |
| 323 | 3300046506 | Ga0495583_0001285 | Ga0495583_0001285_5922_7256 | 441 |
| 324 | 3300046507 | Ga0495606_0000165 | Ga0495606_0000165_4974_6314 | 441 |
| 325 | 3300046507 | Ga0495606_0000545 | Ga0495606_0000545_24311_25648 | 441 |
| 326 | 3300046512 | Ga0495610_0000107 | Ga0495610_0000107_7360_8694 | 441 |
| 327 | 3300046512 | Ga0495610_0006938 | Ga0495610_0006938_4472_5806 | 441 |
| 328 | 3300046512 | Ga0495610_0017959 | Ga0495610_0017959_531_1871 | 441 |
| 329 | 3300046513 | Ga0495616_0000372 | Ga0495616_0000372_32677_34011 | 441 |
| 330 | 3300046518 | Ga0495631_0000372 | Ga0495631_0000372_8502_9836 | 441 |
| 331 | 3300046519 | Ga0495632_0013021 | Ga0495632_0013021_1415_2749 | 441 |
| 332 | 3300046519 | Ga0495632_0017003 | Ga0495632_0017003_1056_2387 | 441 |
| 333 | 3300046520 | Ga0495637_0007700 | Ga0495637_0007700_3633_4970 | 441 |
| 334 | 3300046522 | Ga0495643_0000321 | Ga0495643_0000321_9860_11194 | 441 |
| 335 | 3300046523 | Ga0495644_0000119 | Ga0495644_0000119_32650_33984 | 441 |
| 336 | 3300046530 | Ga0495654_0023808 | Ga0495654_0023808_540_1871 | 441 |
| 337 | 3300046538 | Ga0495609_0000340 | Ga0495609_0000340_31005_32354 | 441 |
| 338 | 3300046538 | Ga0495609_0008130 | Ga0495609_0008130_3182_4516 | 441 |
| 339 | 3300046558 | Ga0495633_0000446 | Ga0495633_0000446_24297_25631 | 441 |
| 340 | 3300046558 | Ga0495633_0028857 | Ga0495633_0028857_1242_2582 | 441 |
| 341 | 3300046615 | Ga0495656_0061486 | Ga0495656_0061486_232_1566 | 441 |
| 342 | 3300046648 | Ga0495611_0001477 | Ga0495611_0001477_6575_7909 | 441 |
| 343 | 3300046660 | Ga0495625_0011232 | Ga0495625_0011232_30_1370 | 441 |
| 344 | 3300046691 | Ga0495670_0016537 | Ga0495670_0016537_1225_2559 | 441 |
| 345 | 3300046692 | Ga0495671_0006188 | Ga0495671_0006188_5281_6615 | 441 |
| 346 | 3300046692 | Ga0495671_0018251 | Ga0495671_0018251_1043_2377 | 441 |
| 347 | 3300046810 | Ga0495660_0000118 | Ga0495660_0000118_41450_42799 | 441 |
| 348 | 3300046810 | Ga0495660_0001366 | Ga0495660_0001366_12403_13752 | 441 |
| 349 | 3300047320 | Ga0495672_0000868 | Ga0495672_0000868_21769_23103 | 441 |
| 350 | 3300047320 | Ga0495672_0018611 | Ga0495672_0018611_2822_4156 | 441 |
| 351 | 3300047445 | Ga0495677_0000249 | Ga0495677_0000249_16377_17711 | 441 |
| 352 | 3300047469 | Ga0495673_0000035 | Ga0495673_0000035_295663_297000 | 441 |
| 353 | 3300047470 | Ga0495681_0001750 | Ga0495681_0001750_6013_7362 | 441 |
| 354 | 3300048091 | Ga0495626_0000963 | Ga0495626_0000963_22007_23341 | 441 |
| 355 | 3300048906 | Ga0496103_0001372 | Ga0496103_0001372_13225_14562 | 441 |
| 356 | 3300048927 | Ga0496124_0018404 | Ga0496124_0018404_4427_5776 | 441 |
| 357 | 3300049459 | Ga0495678_000032 | Ga0495678_000032_184609_185958 | 441 |
| 358 | 3300049460 | Ga0495682_0000013 | Ga0495682_0000013_151572_152906 | 441 |
| 359 | 3300049460 | Ga0495682_0007634 | Ga0495682_0007634_2930_4264 | 441 |
| 360 | 3300049679 | Ga0501249_000857 | Ga0501249_000857_679_2019 | 441 |
| 361 | 3300049766 | Ga0501269_000169 | Ga0501269_000169_17633_18973 | 441 |
| 362 | 3300053091 | Ga0500647_0047334 | Ga0500647_0047334_456_1790 | 441 |
| 363 | 3300053122 | Ga0500608_000400 | Ga0500608_000400_474_1808 | 441 |
| 364 | 3300053125 | Ga0500618_000430 | Ga0500618_000430_24077_25411 | 441 |
| 365 | 3300053723 | Ga0500567_001470 | Ga0500567_001470_6700_8034 | 441 |
| 366 | 3300053729 | Ga0500625_000001 | Ga0500625_000001_247134_248468 | 441 |
| 367 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_265211_266542 | 441 |
| 368 | iso_pu_bacteria | 2512564014 | 2512642368 | 441 |
| 369 | iso_pu_bacteria | 2582581280 | 2585153315 | 441 |
| 370 | iso_pu_bacteria | 2582581293 | 2585197004 | 441 |
| 371 | iso_pu_bacteria | 2643221598 | 2644001321 | 441 |
| 372 | iso_pu_bacteria | 2738543012 | 2739246375 | 441 |
| 373 | iso_pu_bacteria | 2818991435 | 2819537359 | 441 |
| 374 | iso_pu_bacteria | 2818991454 | 2819646579 | 441 |
| 375 | iso_pu_bacteria | 2857553236 | 2857555982 | 441 |
| 376 | 3300005289 | Ga0065704_10082902 | Ga0065704_100829023 | 442 |
| 377 | 3300005289 | Ga0065704_10085666 | Ga0065704_100856662 | 442 |
| 378 | 3300005337 | Ga0070682_100048039 | Ga0070682_1000480392 | 442 |
| 379 | 3300005347 | Ga0070668_100037615 | Ga0070668_1000376152 | 442 |
| 380 | 3300005353 | Ga0070669_100005542 | Ga0070669_1000055421 | 442 |
| 381 | 3300005355 | Ga0070671_100196385 | Ga0070671_1001963851 | 442 |
| 382 | 3300005543 | Ga0070672_100024078 | Ga0070672_1000240783 | 442 |
| 383 | 3300005548 | Ga0070665_100005929 | Ga0070665_1000059299 | 442 |
| 384 | 3300005843 | Ga0068860_100008197 | Ga0068860_1000081972 | 442 |
| 385 | 3300009177 | Ga0105248_10068301 | Ga0105248_100683012 | 442 |
| 386 | 3300009177 | Ga0105248_10111527 | Ga0105248_101115273 | 442 |
| 387 | 3300009177 | Ga0105248_10150369 | Ga0105248_101503692 | 442 |
| 388 | 3300009545 | Ga0105237_10020144 | Ga0105237_100201444 | 442 |
| 389 | 3300009553 | Ga0105249_10191623 | Ga0105249_101916232 | 442 |
| 390 | 3300017792 | Ga0163161_10102611 | Ga0163161_101026111 | 442 |
| 391 | 3300025711 | Ga0207696_1032710 | Ga0207696_10327101 | 442 |
| 392 | 3300025941 | Ga0207711_10062163 | Ga0207711_100621633 | 442 |
| 393 | 3300025961 | Ga0207712_10165855 | Ga0207712_101658552 | 442 |
| 394 | 3300025972 | Ga0207668_10005069 | Ga0207668_100050694 | 442 |
| 395 | 3300028563 | Ga0265319_1013333 | Ga0265319_10133333 | 442 |
| 396 | 3300028573 | Ga0265334_10010853 | Ga0265334_100108533 | 442 |
| 397 | 3300028577 | Ga0265318_10000019 | Ga0265318_1000001944 | 442 |
| 398 | 3300028794 | Ga0307515_10136135 | Ga0307515_101361352 | 442 |
| 399 | 3300028794 | Ga0307515_10247065 | Ga0307515_102470651 | 442 |
| 400 | 3300028800 | Ga0265338_10108050 | Ga0265338_101080502 | 442 |
| 401 | 3300031235 | Ga0265330_10000691 | Ga0265330_100006917 | 442 |
| 402 | 3300031238 | Ga0265332_10000076 | Ga0265332_1000007625 | 442 |
| 403 | 3300031239 | Ga0265328_10038198 | Ga0265328_100381981 | 442 |
| 404 | 3300031240 | Ga0265320_10000689 | Ga0265320_100006898 | 442 |
| 405 | 3300031242 | Ga0265329_10000634 | Ga0265329_100006346 | 442 |
| 406 | 3300031250 | Ga0265331_10000775 | Ga0265331_100007751 | 442 |
| 407 | 3300031344 | Ga0265316_10006740 | Ga0265316_100067407 | 442 |
| 408 | 3300031711 | Ga0265314_10002160 | Ga0265314_1000216012 | 442 |
| 409 | 3300031712 | Ga0265342_10001950 | Ga0265342_100019507 | 442 |
| 410 | 3300037418 | Ga0395900_0217043 | Ga0395900_0217043_141_1478 | 442 |
| 411 | 3300046453 | Ga0495627_000142 | Ga0495627_000142_69146_70480 | 442 |
| 412 | 3300046458 | Ga0495591_000448 | Ga0495591_000448_12271_13620 | 442 |
| 413 | 3300046460 | Ga0495638_0018658 | Ga0495638_0018658_1605_2942 | 442 |
| 414 | 3300046471 | Ga0495650_0022142 | Ga0495650_0022142_987_2375 | 442 |
| 415 | 3300046474 | Ga0495605_0000365 | Ga0495605_0000365_31301_32650 | 442 |
| 416 | 3300046501 | Ga0495607_0000253 | Ga0495607_0000253_50532_51866 | 442 |
| 417 | 3300046542 | Ga0495597_0000050 | Ga0495597_0000050_31705_33054 | 442 |
| 418 | 3300046558 | Ga0495633_0021779 | Ga0495633_0021779_187_1524 | 442 |
| 419 | 3300046558 | Ga0495633_0048981 | Ga0495633_0048981_177_1514 | 442 |
| 420 | 3300046810 | Ga0495660_0000920 | Ga0495660_0000920_3489_4823 | 442 |
| 421 | 3300047443 | Ga0495687_001017 | Ga0495687_001017_10753_12090 | 442 |
| 422 | 3300048091 | Ga0495626_0000015 | Ga0495626_0000015_89031_90365 | 442 |
| 423 | 3300048905 | Ga0496102_0000613 | Ga0496102_0000613_15315_16652 | 442 |
| 424 | 3300048906 | Ga0496103_0000163 | Ga0496103_0000163_34275_35612 | 442 |
| 425 | 3300048908 | Ga0496105_0001309 | Ga0496105_0001309_15268_16653 | 442 |
| 426 | 3300048914 | Ga0496111_0216837 | Ga0496111_0216837_31_1368 | 442 |
| 427 | 3300048916 | Ga0496113_0000081 | Ga0496113_0000081_14395_15732 | 442 |
| 428 | 3300048919 | Ga0496116_0041734 | Ga0496116_0041734_330_1715 | 442 |
| 429 | 3300048920 | Ga0496117_0048689 | Ga0496117_0048689_1410_2795 | 442 |
| 430 | 3300048920 | Ga0496117_0062535 | Ga0496117_0062535_1135_2475 | 442 |
| 431 | 3300048921 | Ga0496118_0006175 | Ga0496118_0006175_2654_3994 | 442 |
| 432 | 3300048921 | Ga0496118_0007255 | Ga0496118_0007255_921_2258 | 442 |
| 433 | 3300048921 | Ga0496118_0029942 | Ga0496118_0029942_2244_3629 | 442 |
| 434 | 3300048922 | Ga0496119_0073860 | Ga0496119_0073860_386_1726 | 442 |
| 435 | 3300048924 | Ga0496121_0000067 | Ga0496121_0000067_49768_51108 | 442 |
| 436 | 3300048925 | Ga0496122_0001234 | Ga0496122_0001234_14564_15901 | 442 |
| 437 | 3300048925 | Ga0496122_0010593 | Ga0496122_0010593_7743_9128 | 442 |
| 438 | 3300048926 | Ga0496123_0055407 | Ga0496123_0055407_341_1726 | 442 |
| 439 | 3300048928 | Ga0496125_0001250 | Ga0496125_0001250_11118_12455 | 442 |
| 440 | 3300048929 | Ga0496126_0000688 | Ga0496126_0000688_13806_15143 | 442 |
| 441 | 3300048929 | Ga0496126_0004349 | Ga0496126_0004349_341_1726 | 442 |
| 442 | 3300053140 | Ga0500573_0010835 | Ga0500573_0010835_3234_4568 | 442 |
| 443 | iso_pu_bacteria | 2597489888 | 2597864393 | 442 |
| 444 | iso_pu_bacteria | 2599185189 | 2599510714 | 442 |
| 445 | iso_pu_bacteria | 2600255296 | 2601691541 | 442 |
| 446 | iso_pu_bacteria | 2623620446 | 2624491727 | 442 |
| 447 | iso_pu_bacteria | 2643221609 | 2644063261 | 442 |
| 448 | iso_pu_bacteria | 2643221611 | 2644071744 | 442 |
| 449 | iso_pu_bacteria | 2643221713 | 2644620593 | 442 |
| 450 | iso_pu_bacteria | 2721755607 | 2723248359 | 442 |
| 451 | iso_pu_bacteria | 2791355222 | 2793184147 | 442 |
| 452 | iso_pu_bacteria | 2816332133 | 2816475409 | 442 |
| 453 | iso_pu_bacteria | 2842826826 | 2842827320 | 442 |
| 454 | iso_pu_bacteria | 2842837860 | 2842841734 | 442 |
| 455 | iso_pu_bacteria | 2860867994 | 2860870250 | 442 |
| 456 | iso_pu_bacteria | 2929189879 | 2929192985 | 442 |
| 457 | iso_pu_bacteria | 2945961074 | 2945962994 | 442 |
| 458 | iso_pu_bacteria | 2946006987 | 2946010565 | 442 |
| 459 | iso_pu_bacteria | 2946027586 | 2946030483 | 442 |
| 460 | iso_pu_bacteria | 8054347763 | 8054347907 | 442 |
| 461 | 3300001979 | JGI24740J21852_10000040 | JGI24740J21852_100000409 | 443 |
| 462 | 3300001979 | JGI24740J21852_10003601 | JGI24740J21852_100036017 | 443 |
| 463 | 3300001979 | JGI24740J21852_10003679 | JGI24740J21852_100036797 | 443 |
| 464 | 3300001979 | JGI24740J21852_10005450 | JGI24740J21852_100054502 | 443 |
| 465 | 3300001979 | JGI24740J21852_10036090 | JGI24740J21852_100360901 | 443 |
| 466 | 3300001989 | JGI24739J22299_10000021 | JGI24739J22299_1000002130 | 443 |
| 467 | 3300001989 | JGI24739J22299_10004456 | JGI24739J22299_100044562 | 443 |
| 468 | 3300001989 | JGI24739J22299_10005905 | JGI24739J22299_100059054 | 443 |
| 469 | 3300001990 | JGI24737J22298_10001269 | JGI24737J22298_100012697 | 443 |
| 470 | 3300001990 | JGI24737J22298_10009451 | JGI24737J22298_100094514 | 443 |
| 471 | 3300001990 | JGI24737J22298_10019370 | JGI24737J22298_100193702 | 443 |
| 472 | 3300002067 | JGI24735J21928_10002422 | JGI24735J21928_100024227 | 443 |
| 473 | 3300002067 | JGI24735J21928_10003309 | JGI24735J21928_100033092 | 443 |
| 474 | 3300002075 | JGI24738J21930_10000001 | JGI24738J21930_1000000165 | 443 |
| 475 | 3300003215 | JGI25153J46596_10000016 | JGI25153J46596_10000016187 | 443 |
| 476 | 3300003215 | JGI25153J46596_10031842 | JGI25153J46596_100318421 | 443 |
| 477 | 3300003773 | Ga0055537_1003505 | Ga0055537_10035055 | 443 |
| 478 | 3300003794 | Ga0055531_10014786 | Ga0055531_100147862 | 443 |
| 479 | 3300005262 | Ga0065165_1002059 | Ga0065165_10020594 | 443 |
| 480 | 3300005289 | Ga0065704_10006301 | Ga0065704_100063011 | 443 |
| 481 | 3300005289 | Ga0065704_10072214 | Ga0065704_100722143 | 443 |
| 482 | 3300005331 | Ga0070670_100069781 | Ga0070670_1000697811 | 443 |
| 483 | 3300005335 | Ga0070666_10002911 | Ga0070666_100029119 | 443 |
| 484 | 3300005347 | Ga0070668_100002438 | Ga0070668_1000024388 | 443 |
| 485 | 3300005347 | Ga0070668_100014187 | Ga0070668_1000141872 | 443 |
| 486 | 3300005347 | Ga0070668_100033112 | Ga0070668_1000331124 | 443 |
| 487 | 3300005347 | Ga0070668_100060798 | Ga0070668_1000607983 | 443 |
| 488 | 3300005353 | Ga0070669_100011837 | Ga0070669_1000118373 | 443 |
| 489 | 3300005353 | Ga0070669_100043004 | Ga0070669_1000430041 | 443 |
| 490 | 3300005355 | Ga0070671_100015086 | Ga0070671_1000150864 | 443 |
| 491 | 3300005366 | Ga0070659_100029656 | Ga0070659_1000296563 | 443 |
| 492 | 3300005367 | Ga0070667_100003055 | Ga0070667_1000030558 | 443 |
| 493 | 3300005367 | Ga0070667_100141689 | Ga0070667_1001416892 | 443 |
| 494 | 3300005455 | Ga0070663_100004705 | Ga0070663_1000047059 | 443 |
| 495 | 3300005457 | Ga0070662_100004680 | Ga0070662_1000046808 | 443 |
| 496 | 3300005457 | Ga0070662_100041202 | Ga0070662_1000412022 | 443 |
| 497 | 3300005518 | Ga0070699_100047360 | Ga0070699_1000473602 | 443 |
| 498 | 3300005539 | Ga0068853_100006913 | Ga0068853_1000069139 | 443 |
| 499 | 3300005539 | Ga0068853_100044233 | Ga0068853_1000442331 | 443 |
| 500 | 3300005539 | Ga0068853_100103945 | Ga0068853_1001039452 | 443 |
| 501 | 3300005548 | Ga0070665_100000816 | Ga0070665_1000008167 | 443 |
| 502 | 3300005563 | Ga0068855_100040101 | Ga0068855_1000401014 | 443 |
| 503 | 3300005577 | Ga0068857_100017091 | Ga0068857_1000170913 | 443 |
| 504 | 3300005577 | Ga0068857_100035699 | Ga0068857_1000356992 | 443 |
| 505 | 3300005578 | Ga0068854_100000370 | Ga0068854_10000037031 | 443 |
| 506 | 3300005578 | Ga0068854_100026295 | Ga0068854_1000262951 | 443 |
| 507 | 3300005578 | Ga0068854_100040560 | Ga0068854_1000405604 | 443 |
| 508 | 3300005614 | Ga0068856_100000374 | Ga0068856_10000037436 | 443 |
| 509 | 3300005616 | Ga0068852_100007527 | Ga0068852_1000075273 | 443 |
| 510 | 3300005616 | Ga0068852_100015318 | Ga0068852_1000153184 | 443 |
| 511 | 3300005834 | Ga0068851_10000147 | Ga0068851_1000014730 | 443 |
| 512 | 3300005841 | Ga0068863_100000225 | Ga0068863_10000022534 | 443 |
| 513 | 3300005841 | Ga0068863_100070480 | Ga0068863_1000704801 | 443 |
| 514 | 3300005842 | Ga0068858_100037216 | Ga0068858_1000372165 | 443 |
| 515 | 3300005843 | Ga0068860_100001524 | Ga0068860_1000015246 | 443 |
| 516 | 3300005843 | Ga0068860_100004640 | Ga0068860_1000046408 | 443 |
| 517 | 3300005843 | Ga0068860_100006123 | Ga0068860_1000061237 | 443 |
| 518 | 3300005844 | Ga0068862_100000083 | Ga0068862_10000008355 | 443 |
| 519 | 3300005844 | Ga0068862_100004726 | Ga0068862_1000047264 | 443 |
| 520 | 3300005844 | Ga0068862_100010282 | Ga0068862_1000102828 | 443 |
| 521 | 3300006042 | Ga0075368_10000863 | Ga0075368_100008638 | 443 |
| 522 | 3300006048 | Ga0075363_100001725 | Ga0075363_1000017251 | 443 |
| 523 | 3300006178 | Ga0075367_10000269 | Ga0075367_100002692 | 443 |
| 524 | 3300006195 | Ga0075366_10035008 | Ga0075366_100350083 | 443 |
| 525 | 3300009011 | Ga0105251_10001159 | Ga0105251_1000115914 | 443 |
| 526 | 3300009011 | Ga0105251_10004188 | Ga0105251_1000418810 | 443 |
| 527 | 3300009036 | Ga0105244_10000738 | Ga0105244_1000073816 | 443 |
| 528 | 3300009036 | Ga0105244_10019703 | Ga0105244_100197033 | 443 |
| 529 | 3300009036 | Ga0105244_10075830 | Ga0105244_100758301 | 443 |
| 530 | 3300009092 | Ga0105250_10015604 | Ga0105250_100156042 | 443 |
| 531 | 3300009093 | Ga0105240_10000220 | Ga0105240_1000022090 | 443 |
| 532 | 3300009093 | Ga0105240_10006254 | Ga0105240_100062549 | 443 |
| 533 | 3300009093 | Ga0105240_10228184 | Ga0105240_102281842 | 443 |
| 534 | 3300009148 | Ga0105243_10017725 | Ga0105243_100177252 | 443 |
| 535 | 3300009174 | Ga0105241_10022859 | Ga0105241_100228593 | 443 |
| 536 | 3300009177 | Ga0105248_10003730 | Ga0105248_1000373010 | 443 |
| 537 | 3300009177 | Ga0105248_10031570 | Ga0105248_100315703 | 443 |
| 538 | 3300009545 | Ga0105237_10000099 | Ga0105237_1000009922 | 443 |
| 539 | 3300009551 | Ga0105238_10091370 | Ga0105238_100913702 | 443 |
| 540 | 3300009553 | Ga0105249_10000102 | Ga0105249_10000102125 | 443 |
| 541 | 3300009553 | Ga0105249_10002432 | Ga0105249_1000243215 | 443 |
| 542 | 3300009553 | Ga0105249_10016242 | Ga0105249_100162424 | 443 |
| 543 | 3300010375 | Ga0105239_10000111 | Ga0105239_1000011191 | 443 |
| 544 | 3300010375 | Ga0105239_10014227 | Ga0105239_100142273 | 443 |
| 545 | 3300010375 | Ga0105239_10048852 | Ga0105239_100488524 | 443 |
| 546 | 3300010375 | Ga0105239_10179715 | Ga0105239_101797152 | 443 |
| 547 | 3300013100 | Ga0157373_10008703 | Ga0157373_100087032 | 443 |
| 548 | 3300013102 | Ga0157371_10001152 | Ga0157371_1000115229 | 443 |
| 549 | 3300013102 | Ga0157371_10005656 | Ga0157371_100056566 | 443 |
| 550 | 3300013102 | Ga0157371_10034266 | Ga0157371_100342665 | 443 |
| 551 | 3300013104 | Ga0157370_10001082 | Ga0157370_100010822 | 443 |
| 552 | 3300013105 | Ga0157369_10005493 | Ga0157369_1000549311 | 443 |
| 553 | 3300013307 | Ga0157372_10000411 | Ga0157372_1000041115 | 443 |
| 554 | 3300013307 | Ga0157372_10011852 | Ga0157372_100118522 | 443 |
| 555 | 3300013307 | Ga0157372_10043888 | Ga0157372_100438882 | 443 |
| 556 | 3300025229 | Ga0209147_100919 | Ga0209147_1009192 | 443 |
| 557 | 3300025263 | Ga0209565_1000281 | Ga0209565_100028142 | 443 |
| 558 | 3300025273 | Ga0209673_1001574 | Ga0209673_10015746 | 443 |
| 559 | 3300025291 | Ga0209675_1006260 | Ga0209675_10062603 | 443 |
| 560 | 3300025295 | Ga0209564_1005483 | Ga0209564_10054834 | 443 |
| 561 | 3300025297 | Ga0209758_1000035 | Ga0209758_1000035258 | 443 |
| 562 | 3300025297 | Ga0209758_1000608 | Ga0209758_100060810 | 443 |
| 563 | 3300025297 | Ga0209758_1015026 | Ga0209758_10150262 | 443 |
| 564 | 3300025304 | Ga0209257_1000036 | Ga0209257_1000036456 | 443 |
| 565 | 3300025304 | Ga0209257_1001043 | Ga0209257_100104315 | 443 |
| 566 | 3300025321 | Ga0207656_10000077 | Ga0207656_1000007717 | 443 |
| 567 | 3300025728 | Ga0207655_1001691 | Ga0207655_10016912 | 443 |
| 568 | 3300025735 | Ga0207713_1001737 | Ga0207713_100173712 | 443 |
| 569 | 3300025735 | Ga0207713_1003330 | Ga0207713_10033308 | 443 |
| 570 | 3300025735 | Ga0207713_1006178 | Ga0207713_10061784 | 443 |
| 571 | 3300025903 | Ga0207680_10007735 | Ga0207680_100077353 | 443 |
| 572 | 3300025904 | Ga0207647_10024637 | Ga0207647_100246372 | 443 |
| 573 | 3300025911 | Ga0207654_10020477 | Ga0207654_100204773 | 443 |
| 574 | 3300025913 | Ga0207695_10000213 | Ga0207695_1000021364 | 443 |
| 575 | 3300025913 | Ga0207695_10011595 | Ga0207695_100115953 | 443 |
| 576 | 3300025913 | Ga0207695_10062012 | Ga0207695_100620122 | 443 |
| 577 | 3300025914 | Ga0207671_10000788 | Ga0207671_1000078821 | 443 |
| 578 | 3300025923 | Ga0207681_10000843 | Ga0207681_100008435 | 443 |
| 579 | 3300025923 | Ga0207681_10005690 | Ga0207681_100056905 | 443 |
| 580 | 3300025924 | Ga0207694_10116550 | Ga0207694_101165502 | 443 |
| 581 | 3300025925 | Ga0207650_10011260 | Ga0207650_100112607 | 443 |
| 582 | 3300025932 | Ga0207690_10011096 | Ga0207690_100110967 | 443 |
| 583 | 3300025932 | Ga0207690_10025423 | Ga0207690_100254232 | 443 |
| 584 | 3300025933 | Ga0207706_10000383 | Ga0207706_1000038346 | 443 |
| 585 | 3300025933 | Ga0207706_10003643 | Ga0207706_1000364310 | 443 |
| 586 | 3300025935 | Ga0207709_10007500 | Ga0207709_100075003 | 443 |
| 587 | 3300025941 | Ga0207711_10001289 | Ga0207711_1000128911 | 443 |
| 588 | 3300025949 | Ga0207667_10048200 | Ga0207667_100482002 | 443 |
| 589 | 3300025961 | Ga0207712_10000026 | Ga0207712_10000026256 | 443 |
| 590 | 3300025961 | Ga0207712_10012258 | Ga0207712_100122584 | 443 |
| 591 | 3300025972 | Ga0207668_10000384 | Ga0207668_1000038413 | 443 |
| 592 | 3300025972 | Ga0207668_10000837 | Ga0207668_1000083711 | 443 |
| 593 | 3300025972 | Ga0207668_10005145 | Ga0207668_100051455 | 443 |
| 594 | 3300025972 | Ga0207668_10054835 | Ga0207668_100548353 | 443 |
| 595 | 3300025981 | Ga0207640_10000172 | Ga0207640_1000017215 | 443 |
| 596 | 3300025981 | Ga0207640_10010921 | Ga0207640_100109212 | 443 |
| 597 | 3300025981 | Ga0207640_10021468 | Ga0207640_100214682 | 443 |
| 598 | 3300025981 | Ga0207640_10032428 | Ga0207640_100324284 | 443 |
| 599 | 3300025986 | Ga0207658_10002222 | Ga0207658_100022228 | 443 |
| 600 | 3300025986 | Ga0207658_10114975 | Ga0207658_101149752 | 443 |
| 601 | 3300026041 | Ga0207639_10001228 | Ga0207639_1000122816 | 443 |
| 602 | 3300026041 | Ga0207639_10010029 | Ga0207639_100100292 | 443 |
| 603 | 3300026041 | Ga0207639_10071057 | Ga0207639_100710572 | 443 |
| 604 | 3300026067 | Ga0207678_10012629 | Ga0207678_100126292 | 443 |
| 605 | 3300026078 | Ga0207702_10001025 | Ga0207702_1000102524 | 443 |
| 606 | 3300026088 | Ga0207641_10000367 | Ga0207641_1000036734 | 443 |
| 607 | 3300026088 | Ga0207641_10023406 | Ga0207641_100234066 | 443 |
| 608 | 3300026088 | Ga0207641_10054906 | Ga0207641_100549064 | 443 |
| 609 | 3300026116 | Ga0207674_10025702 | Ga0207674_100257023 | 443 |
| 610 | 3300026116 | Ga0207674_10047138 | Ga0207674_100471385 | 443 |
| 611 | 3300026142 | Ga0207698_10018166 | Ga0207698_100181662 | 443 |
| 612 | 3300027866 | Ga0209813_10000074 | Ga0209813_1000007418 | 443 |
| 613 | 3300028379 | Ga0268266_10000387 | Ga0268266_1000038731 | 443 |
| 614 | 3300028380 | Ga0268265_10000094 | Ga0268265_1000009481 | 443 |
| 615 | 3300028381 | Ga0268264_10000367 | Ga0268264_1000036713 | 443 |
| 616 | 3300028381 | Ga0268264_10002410 | Ga0268264_100024108 | 443 |
| 617 | 3300028381 | Ga0268264_10008727 | Ga0268264_100087276 | 443 |
| 618 | 3300028794 | Ga0307515_10091706 | Ga0307515_100917062 | 443 |
| 619 | 3300031251 | Ga0265327_10007444 | Ga0265327_100074443 | 443 |
| 620 | 3300031548 | Ga0307408_100051934 | Ga0307408_1000519342 | 443 |
| 621 | 3300031731 | Ga0307405_10003738 | Ga0307405_100037386 | 443 |
| 622 | 3300031911 | Ga0307412_10002912 | Ga0307412_100029122 | 443 |
| 623 | 3300041405 | Ga0439438_000544 | Ga0439438_000544_12641_13975 | 443 |
| 624 | 3300042001 | Ga0439441_003261 | Ga0439441_003261_272_1609 | 443 |
| 625 | 3300044735 | Ga0466968_0002632 | Ga0466968_0002632_3425_4768 | 443 |
| 626 | 3300046453 | Ga0495627_000084 | Ga0495627_000084_64604_65941 | 443 |
| 627 | 3300046460 | Ga0495638_0000018 | Ga0495638_0000018_219202_220539 | 443 |
| 628 | 3300046460 | Ga0495638_0000230 | Ga0495638_0000230_5460_6830 | 443 |
| 629 | 3300046460 | Ga0495638_0004745 | Ga0495638_0004745_1864_3201 | 443 |
| 630 | 3300046460 | Ga0495638_0016007 | Ga0495638_0016007_824_2254 | 443 |
| 631 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_422082_423419 | 443 |
| 632 | 3300046471 | Ga0495650_0000160 | Ga0495650_0000160_5906_7243 | 443 |
| 633 | 3300046471 | Ga0495650_0003429 | Ga0495650_0003429_1498_2835 | 443 |
| 634 | 3300046474 | Ga0495605_0011818 | Ga0495605_0011818_13_1350 | 443 |
| 635 | 3300046501 | Ga0495607_0000076 | Ga0495607_0000076_35962_37314 | 443 |
| 636 | 3300046501 | Ga0495607_0016286 | Ga0495607_0016286_1043_2380 | 443 |
| 637 | 3300046501 | Ga0495607_0075966 | Ga0495607_0075966_467_1804 | 443 |
| 638 | 3300046506 | Ga0495583_0000010 | Ga0495583_0000010_138989_140326 | 443 |
| 639 | 3300046506 | Ga0495583_0000029 | Ga0495583_0000029_221276_222652 | 443 |
| 640 | 3300046506 | Ga0495583_0000429 | Ga0495583_0000429_37186_38523 | 443 |
| 641 | 3300046507 | Ga0495606_0007980 | Ga0495606_0007980_6479_7816 | 443 |
| 642 | 3300046507 | Ga0495606_0034070 | Ga0495606_0034070_18_1355 | 443 |
| 643 | 3300046512 | Ga0495610_0000058 | Ga0495610_0000058_51451_52788 | 443 |
| 644 | 3300046513 | Ga0495616_0000054 | Ga0495616_0000054_89736_91166 | 443 |
| 645 | 3300046513 | Ga0495616_0000082 | Ga0495616_0000082_11569_12906 | 443 |
| 646 | 3300046513 | Ga0495616_0049385 | Ga0495616_0049385_148_1485 | 443 |
| 647 | 3300046519 | Ga0495632_0000076 | Ga0495632_0000076_48116_49453 | 443 |
| 648 | 3300046519 | Ga0495632_0000113 | Ga0495632_0000113_26484_27821 | 443 |
| 649 | 3300046519 | Ga0495632_0000997 | Ga0495632_0000997_1275_2672 | 443 |
| 650 | 3300046520 | Ga0495637_0000219 | Ga0495637_0000219_18735_20072 | 443 |
| 651 | 3300046522 | Ga0495643_0000009 | Ga0495643_0000009_77824_79161 | 443 |
| 652 | 3300046522 | Ga0495643_0000454 | Ga0495643_0000454_17838_19172 | 443 |
| 653 | 3300046522 | Ga0495643_0001232 | Ga0495643_0001232_21090_22427 | 443 |
| 654 | 3300046522 | Ga0495643_0020490 | Ga0495643_0020490_1722_3059 | 443 |
| 655 | 3300046524 | Ga0495648_0000018 | Ga0495648_0000018_61952_63289 | 443 |
| 656 | 3300046525 | Ga0495663_0000023 | Ga0495663_0000023_51669_53006 | 443 |
| 657 | 3300046530 | Ga0495654_0000012 | Ga0495654_0000012_110251_111588 | 443 |
| 658 | 3300046558 | Ga0495633_0000190 | Ga0495633_0000190_66524_67861 | 443 |
| 659 | 3300046558 | Ga0495633_0000397 | Ga0495633_0000397_7092_8429 | 443 |
| 660 | 3300046616 | Ga0495668_0007940 | Ga0495668_0007940_1739_3076 | 443 |
| 661 | 3300046660 | Ga0495625_0000162 | Ga0495625_0000162_77609_78946 | 443 |
| 662 | 3300046660 | Ga0495625_0001294 | Ga0495625_0001294_17847_19184 | 443 |
| 663 | 3300046660 | Ga0495625_0002544 | Ga0495625_0002544_620_1957 | 443 |
| 664 | 3300046660 | Ga0495625_0063521 | Ga0495625_0063521_164_1516 | 443 |
| 665 | 3300046665 | Ga0495661_0020353 | Ga0495661_0020353_2699_4036 | 443 |
| 666 | 3300046691 | Ga0495670_0059391 | Ga0495670_0059391_208_1545 | 443 |
| 667 | 3300046691 | Ga0495670_0078325 | Ga0495670_0078325_242_1579 | 443 |
| 668 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_281929_283266 | 443 |
| 669 | 3300046692 | Ga0495671_0000013 | Ga0495671_0000013_77824_79161 | 443 |
| 670 | 3300046810 | Ga0495660_0012438 | Ga0495660_0012438_2290_3627 | 443 |
| 671 | 3300046810 | Ga0495660_0026044 | Ga0495660_0026044_1128_2471 | 443 |
| 672 | 3300047320 | Ga0495672_0003990 | Ga0495672_0003990_10849_12186 | 443 |
| 673 | 3300047443 | Ga0495687_000045 | Ga0495687_000045_62972_64435 | 443 |
| 674 | 3300047445 | Ga0495677_0002252 | Ga0495677_0002252_3705_5042 | 443 |
| 675 | 3300047446 | Ga0495679_001113 | Ga0495679_001113_1217_2560 | 443 |
| 676 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_549993_551330 | 443 |
| 677 | 3300047469 | Ga0495673_0003734 | Ga0495673_0003734_3142_4479 | 443 |
| 678 | 3300047469 | Ga0495673_0073541 | Ga0495673_0073541_83_1420 | 443 |
| 679 | 3300047470 | Ga0495681_0005751 | Ga0495681_0005751_5628_6965 | 443 |
| 680 | 3300047472 | Ga0495686_0000161 | Ga0495686_0000161_47287_48624 | 443 |
| 681 | 3300047472 | Ga0495686_0001069 | Ga0495686_0001069_31043_32380 | 443 |
| 682 | 3300047472 | Ga0495686_0052738 | Ga0495686_0052738_923_2260 | 443 |
| 683 | 3300048905 | Ga0496102_0000143 | Ga0496102_0000143_77729_79066 | 443 |
| 684 | 3300048906 | Ga0496103_0000098 | Ga0496103_0000098_77713_79050 | 443 |
| 685 | 3300048906 | Ga0496103_0008348 | Ga0496103_0008348_71_1408 | 443 |
| 686 | 3300048907 | Ga0496104_0279447 | Ga0496104_0279447_194_1531 | 443 |
| 687 | 3300048908 | Ga0496105_0123836 | Ga0496105_0123836_384_1721 | 443 |
| 688 | 3300048909 | Ga0496106_0007898 | Ga0496106_0007898_4366_5703 | 443 |
| 689 | 3300048910 | Ga0496107_0000019 | Ga0496107_0000019_39266_40603 | 443 |
| 690 | 3300048911 | Ga0496108_0146923 | Ga0496108_0146923_504_1841 | 443 |
| 691 | 3300048917 | Ga0496114_0055201 | Ga0496114_0055201_325_1659 | 443 |
| 692 | 3300048918 | Ga0496115_0009634 | Ga0496115_0009634_952_2289 | 443 |
| 693 | 3300048919 | Ga0496116_0001473 | Ga0496116_0001473_24608_25945 | 443 |
| 694 | 3300048919 | Ga0496116_0097053 | Ga0496116_0097053_98_1435 | 443 |
| 695 | 3300048920 | Ga0496117_0000121 | Ga0496117_0000121_24596_25933 | 443 |
| 696 | 3300048920 | Ga0496117_0005261 | Ga0496117_0005261_7370_8704 | 443 |
| 697 | 3300048920 | Ga0496117_0005816 | Ga0496117_0005816_2689_4026 | 443 |
| 698 | 3300048920 | Ga0496117_0011270 | Ga0496117_0011270_1194_2528 | 443 |
| 699 | 3300048920 | Ga0496117_0020317 | Ga0496117_0020317_1432_2769 | 443 |
| 700 | 3300048921 | Ga0496118_0000095 | Ga0496118_0000095_145600_146937 | 443 |
| 701 | 3300048921 | Ga0496118_0003634 | Ga0496118_0003634_16549_17883 | 443 |
| 702 | 3300048921 | Ga0496118_0004347 | Ga0496118_0004347_8611_9945 | 443 |
| 703 | 3300048921 | Ga0496118_0005130 | Ga0496118_0005130_10730_12067 | 443 |
| 704 | 3300048921 | Ga0496118_0008390 | Ga0496118_0008390_4995_6332 | 443 |
| 705 | 3300048921 | Ga0496118_0119532 | Ga0496118_0119532_225_1592 | 443 |
| 706 | 3300048922 | Ga0496119_0012070 | Ga0496119_0012070_1803_3140 | 443 |
| 707 | 3300048922 | Ga0496119_0034497 | Ga0496119_0034497_1532_2869 | 443 |
| 708 | 3300048924 | Ga0496121_0000624 | Ga0496121_0000624_37432_38769 | 443 |
| 709 | 3300048924 | Ga0496121_0004401 | Ga0496121_0004401_13800_15137 | 443 |
| 710 | 3300048924 | Ga0496121_0006234 | Ga0496121_0006234_7507_8844 | 443 |
| 711 | 3300048925 | Ga0496122_0000092 | Ga0496122_0000092_165590_166972 | 443 |
| 712 | 3300048925 | Ga0496122_0032481 | Ga0496122_0032481_1538_2875 | 443 |
| 713 | 3300048925 | Ga0496122_0066270 | Ga0496122_0066270_74_1411 | 443 |
| 714 | 3300048926 | Ga0496123_0000028 | Ga0496123_0000028_37150_38484 | 443 |
| 715 | 3300048926 | Ga0496123_0000598 | Ga0496123_0000598_37474_38856 | 443 |
| 716 | 3300048926 | Ga0496123_0095090 | Ga0496123_0095090_13_1350 | 443 |
| 717 | 3300048927 | Ga0496124_0000119 | Ga0496124_0000119_145600_146937 | 443 |
| 718 | 3300048927 | Ga0496124_0018216 | Ga0496124_0018216_2000_3337 | 443 |
| 719 | 3300048927 | Ga0496124_0019199 | Ga0496124_0019199_386_1720 | 443 |
| 720 | 3300048927 | Ga0496124_0045554 | Ga0496124_0045554_1110_2489 | 443 |
| 721 | 3300048927 | Ga0496124_0051057 | Ga0496124_0051057_675_2012 | 443 |
| 722 | 3300048927 | Ga0496124_0063227 | Ga0496124_0063227_194_1531 | 443 |
| 723 | 3300048927 | Ga0496124_0125839 | Ga0496124_0125839_258_1595 | 443 |
| 724 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_13537_14871 | 443 |
| 725 | 3300048928 | Ga0496125_0007696 | Ga0496125_0007696_2695_4032 | 443 |
| 726 | 3300048928 | Ga0496125_0071493 | Ga0496125_0071493_1085_2422 | 443 |
| 727 | 3300048928 | Ga0496125_0104213 | Ga0496125_0104213_564_1901 | 443 |
| 728 | 3300048929 | Ga0496126_0006740 | Ga0496126_0006740_6505_7842 | 443 |
| 729 | 3300048929 | Ga0496126_0084425 | Ga0496126_0084425_285_1622 | 443 |
| 730 | 3300049679 | Ga0501249_000141 | Ga0501249_000141_7893_9230 | 443 |
| 731 | 3300050490 | nmdc:mga03n38_2748_c1 | nmdc:mga03n38_2748_c1_1470_2849 | 443 |
| 732 | 3300050493 | nmdc:mga0k408_37235_c1 | nmdc:mga0k408_37235_c1_84_1451 | 443 |
| 733 | 3300050494 | nmdc:mga06z11_8_c1 | nmdc:mga06z11_8_c1_72064_73443 | 443 |
| 734 | 3300050495 | nmdc:mga04h51_8_c1 | nmdc:mga04h51_8_c1_86641_88020 | 443 |
| 735 | 3300050496 | nmdc:mga07m45_13206_c1 | nmdc:mga07m45_13206_c1_2802_4181 | 443 |
| 736 | 3300053087 | Ga0500643_000503 | Ga0500643_000503_1206_2543 | 443 |
| 737 | 3300053087 | Ga0500643_005015 | Ga0500643_005015_2005_3342 | 443 |
| 738 | 3300053103 | Ga0500555_000799 | Ga0500555_000799_1274_2611 | 443 |
| 739 | 3300053121 | Ga0500607_000035 | Ga0500607_000035_41811_43148 | 443 |
| 740 | 3300053121 | Ga0500607_000058 | Ga0500607_000058_43079_44416 | 443 |
| 741 | 3300053125 | Ga0500618_000066 | Ga0500618_000066_54923_56260 | 443 |
| 742 | 3300053134 | Ga0500658_0013135 | Ga0500658_0013135_1087_2424 | 443 |
| 743 | 3300053136 | Ga0500559_0000058 | Ga0500559_0000058_9138_10475 | 443 |
| 744 | 3300053136 | Ga0500559_0001018 | Ga0500559_0001018_5597_6934 | 443 |
| 745 | 3300053136 | Ga0500559_0001082 | Ga0500559_0001082_4547_5884 | 443 |
| 746 | 3300053136 | Ga0500559_0002704 | Ga0500559_0002704_6466_7803 | 443 |
| 747 | 3300053136 | Ga0500559_0005739 | Ga0500559_0005739_2733_4070 | 443 |
| 748 | 3300053136 | Ga0500559_0024248 | Ga0500559_0024248_415_1755 | 443 |
| 749 | 3300053151 | Ga0500604_0005543 | Ga0500604_0005543_939_2276 | 443 |
| 750 | 3300053156 | Ga0500622_0028425 | Ga0500622_0028425_498_1835 | 443 |
| 751 | 3300053158 | Ga0500627_0001133 | Ga0500627_0001133_5327_6664 | 443 |
| 752 | 3300053158 | Ga0500627_0008343 | Ga0500627_0008343_818_2155 | 443 |
| 753 | 3300053730 | Ga0500645_000196 | Ga0500645_000196_39820_41157 | 443 |
| 754 | 3300053730 | Ga0500645_001940 | Ga0500645_001940_5730_7067 | 443 |
| 755 | 3300053730 | Ga0500645_004520 | Ga0500645_004520_1712_3049 | 443 |
| 756 | 3300053730 | Ga0500645_006527 | Ga0500645_006527_2699_4036 | 443 |
| 757 | iso_pu_bacteria | 2599185316 | 2600021791 | 443 |
| 758 | iso_pu_bacteria | 2599185317 | 2600030839 | 443 |
| 759 | iso_pu_bacteria | 2599185325 | 2600075064 | 443 |
| 760 | iso_pu_bacteria | 2600254930 | 2600360644 | 443 |
| 761 | iso_pu_bacteria | 2667528176 | 2671126875 | 443 |
| 762 | iso_pu_bacteria | 2980182181 | 2980185828 | 443 |
| 763 | iso_pu_bacteria | 3007395558 | 3007396554 | 443 |
| 764 | 3300031241 | Ga0265325_10000250 | Ga0265325_1000025021 | 444 |
| 765 | 3300031344 | Ga0265316_10000893 | Ga0265316_1000089329 | 444 |
| 766 | 3300046507 | Ga0495606_0000760 | Ga0495606_0000760_30298_31641 | 444 |
| 767 | 3300048919 | Ga0496116_0008741 | Ga0496116_0008741_6961_8307 | 444 |
| 768 | 3300048925 | Ga0496122_0070000 | Ga0496122_0070000_885_2231 | 444 |
| 769 | 3300048926 | Ga0496123_0001346 | Ga0496123_0001346_10886_12232 | 444 |
| 770 | 3300048927 | Ga0496124_0000873 | Ga0496124_0000873_36042_37388 | 444 |
| 771 | 3300048928 | Ga0496125_0005821 | Ga0496125_0005821_11966_13312 | 444 |
| 772 | 3300049459 | Ga0495678_008247 | Ga0495678_008247_585_1928 | 444 |
| 773 | iso_pu_bacteria | 2511231004 | 2511253368 | 444 |
| 774 | iso_pu_bacteria | 2511231007 | 2511269615 | 444 |
| 775 | iso_pu_bacteria | 2511231008 | 2511280838 | 444 |
| 776 | iso_pu_bacteria | 2511231016 | 2511324219 | 444 |
| 777 | iso_pu_bacteria | 2511231021 | 2511359945 | 444 |
| 778 | iso_pu_bacteria | 2512047018 | 2512326218 | 444 |
| 779 | iso_pu_bacteria | 2582580891 | 2583792561 | 444 |
| 780 | iso_pu_bacteria | 2599185167 | 2599399280 | 444 |
| 781 | iso_pu_bacteria | 2599185179 | 2599453618 | 444 |
| 782 | iso_pu_bacteria | 2599185190 | 2599513773 | 444 |
| 783 | iso_pu_bacteria | 2599185191 | 2599518953 | 444 |
| 784 | iso_pu_bacteria | 2599185290 | 2599892830 | 444 |
| 785 | iso_pu_bacteria | 2600255283 | 2601625367 | 444 |
| 786 | iso_pu_bacteria | 2619619299 | 2621300365 | 444 |
| 787 | iso_pu_bacteria | 2651869719 | 2652543960 | 444 |
| 788 | iso_pu_bacteria | 2738541265 | 2738675425 | 444 |
| 789 | iso_pu_bacteria | 2738541282 | 2738753828 | 444 |
| 790 | iso_pu_bacteria | 2738541303 | 2738862877 | 444 |
| 791 | iso_pu_bacteria | 2740892503 | 2743737698 | 444 |
| 792 | iso_pu_bacteria | 2816332298 | 2817490563 | 444 |
| 793 | iso_pu_bacteria | 2826581358 | 2826585021 | 444 |
| 794 | iso_pu_bacteria | 2842849001 | 2842850998 | 444 |
| 795 | iso_pu_bacteria | 2923153595 | 2923156743 | 444 |
| 796 | iso_pu_bacteria | 2923586266 | 2923588020 | 444 |
| 797 | iso_pu_bacteria | 2931369376 | 2931374713 | 444 |
| 798 | iso_pu_bacteria | 2931390751 | 2931394402 | 444 |
| 799 | iso_pu_bacteria | 2931396565 | 2931401295 | 444 |
| 800 | iso_pu_bacteria | 8015687852 | 8015690963 | 444 |
| 801 | iso_pu_bacteria | 8055770955 | 8055774103 | 444 |
| 802 | iso_pu_bacteria | 8056131705 | 8056134352 | 444 |
| 803 | iso_pu_bacteria | 8056177738 | 8056179005 | 444 |
| 804 | 3300021361 | Ga0213872_10005680 | Ga0213872_100056803 | 445 |
| 805 | 3300039447 | Ga0436361_0551392 | Ga0436361_0551392_1149_2531 | 445 |
| 806 | 3300046453 | Ga0495627_001885 | Ga0495627_001885_1806_3149 | 445 |
| 807 | 3300046458 | Ga0495591_004529 | Ga0495591_004529_3561_4904 | 445 |
| 808 | 3300046501 | Ga0495607_0012249 | Ga0495607_0012249_2003_3346 | 445 |
| 809 | 3300046507 | Ga0495606_0000729 | Ga0495606_0000729_46158_47501 | 445 |
| 810 | 3300046512 | Ga0495610_0007561 | Ga0495610_0007561_5615_6958 | 445 |
| 811 | 3300046515 | Ga0495620_0000207 | Ga0495620_0000207_1720_3063 | 445 |
| 812 | 3300046519 | Ga0495632_0007697 | Ga0495632_0007697_1719_3062 | 445 |
| 813 | 3300046522 | Ga0495643_0045383 | Ga0495643_0045383_506_1849 | 445 |
| 814 | 3300046530 | Ga0495654_0009671 | Ga0495654_0009671_1144_2487 | 445 |
| 815 | 3300046558 | Ga0495633_0033108 | Ga0495633_0033108_483_2027 | 445 |
| 816 | 3300046665 | Ga0495661_0000138 | Ga0495661_0000138_34390_35733 | 445 |
| 817 | 3300046794 | Ga0495589_0001115 | Ga0495589_0001115_11170_12513 | 445 |
| 818 | 3300047470 | Ga0495681_0012346 | Ga0495681_0012346_1936_3279 | 445 |
| 819 | 3300053157 | Ga0500624_000017 | Ga0500624_000017_28476_29849 | 445 |
| 820 | iso_pu_bacteria | 8054503363 | 8054506715 | 445 |
| 821 | 3300005344 | Ga0070661_100000163 | Ga0070661_10000016321 | 446 |
| 822 | 3300005564 | Ga0070664_100000101 | Ga0070664_10000010122 | 446 |
| 823 | 3300009011 | Ga0105251_10000612 | Ga0105251_1000061218 | 446 |
| 824 | 3300009036 | Ga0105244_10005252 | Ga0105244_100052523 | 446 |
| 825 | 3300009092 | Ga0105250_10000089 | Ga0105250_1000008968 | 446 |
| 826 | 3300009092 | Ga0105250_10000109 | Ga0105250_100001098 | 446 |
| 827 | 3300009176 | Ga0105242_10013185 | Ga0105242_100131853 | 446 |
| 828 | 3300009545 | Ga0105237_10000096 | Ga0105237_1000009667 | 446 |
| 829 | 3300011119 | Ga0105246_10011380 | Ga0105246_100113803 | 446 |
| 830 | 3300013104 | Ga0157370_10032814 | Ga0157370_100328142 | 446 |
| 831 | 3300013105 | Ga0157369_10003418 | Ga0157369_100034186 | 446 |
| 832 | 3300013308 | Ga0157375_10036562 | Ga0157375_100365623 | 446 |
| 833 | 3300025711 | Ga0207696_1000115 | Ga0207696_100011556 | 446 |
| 834 | 3300025711 | Ga0207696_1000163 | Ga0207696_10001638 | 446 |
| 835 | 3300025728 | Ga0207655_1000734 | Ga0207655_100073424 | 446 |
| 836 | 3300025735 | Ga0207713_1000020 | Ga0207713_10000209 | 446 |
| 837 | 3300025914 | Ga0207671_10000747 | Ga0207671_1000074726 | 446 |
| 838 | 3300025920 | Ga0207649_10000010 | Ga0207649_1000001029 | 446 |
| 839 | 3300025945 | Ga0207679_10000037 | Ga0207679_10000037112 | 446 |
| 840 | 3300046457 | Ga0495590_0001721 | Ga0495590_0001721_2541_3920 | 446 |
| 841 | 3300046474 | Ga0495605_0004999 | Ga0495605_0004999_4454_5824 | 446 |
| 842 | 3300046507 | Ga0495606_0021889 | Ga0495606_0021889_2748_4103 | 446 |
| 843 | iso_pu_bacteria | 2599185288 | 2599880105 | 446 |
| 844 | iso_pu_bacteria | 2599185303 | 2599947185 | 446 |
| 845 | iso_pu_bacteria | 2738541294 | 2738806326 | 446 |
| 846 | iso_pu_bacteria | 2738541309 | 2738893686 | 446 |
| 847 | iso_pu_bacteria | 8054285046 | 8054286676 | 446 |
| 848 | iso_pu_bacteria | 8055817908 | 8055820344 | 446 |
| 849 | 3300005290 | Ga0065712_10094642 | Ga0065712_100946422 | 447 |
| 850 | 3300013308 | Ga0157375_10047654 | Ga0157375_100476542 | 447 |
| 851 | 3300046506 | Ga0495583_0000457 | Ga0495583_0000457_29416_30804 | 447 |
| 852 | 3300046519 | Ga0495632_0000748 | Ga0495632_0000748_19270_20658 | 447 |
| 853 | 3300046520 | Ga0495637_0005690 | Ga0495637_0005690_4153_5541 | 447 |
| 854 | 3300046530 | Ga0495654_0001701 | Ga0495654_0001701_6128_7558 | 447 |
| 855 | 3300046665 | Ga0495661_0000513 | Ga0495661_0000513_29845_31233 | 447 |
| 856 | 3300046665 | Ga0495661_0003700 | Ga0495661_0003700_9338_10696 | 447 |
| 857 | 3300053161 | Ga0500634_0022859 | Ga0500634_0022859_1582_2940 | 447 |
| 858 | 2162886011 | MRS1b_contig_4057571 | MRS1b_0510.00002240 | 448 |
| 859 | 3300003781 | Ga0055536_1000005 | Ga0055536_1000005301 | 448 |
| 860 | 3300003791 | Ga0055530_10000001 | Ga0055530_1000000130 | 448 |
| 861 | 3300003791 | Ga0055530_10000165 | Ga0055530_1000016525 | 448 |
| 862 | 3300003792 | Ga0055540_1000186 | Ga0055540_100018625 | 448 |
| 863 | 3300003792 | Ga0055540_1000258 | Ga0055540_100025821 | 448 |
| 864 | 3300005288 | Ga0065714_10005985 | Ga0065714_100059854 | 448 |
| 865 | 3300005288 | Ga0065714_10008360 | Ga0065714_100083604 | 448 |
| 866 | 3300005288 | Ga0065714_10064839 | Ga0065714_100648394 | 448 |
| 867 | 3300005288 | Ga0065714_10077303 | Ga0065714_100773032 | 448 |
| 868 | 3300005288 | Ga0065714_10085296 | Ga0065714_100852961 | 448 |
| 869 | 3300005290 | Ga0065712_10068364 | Ga0065712_100683642 | 448 |
| 870 | 3300005331 | Ga0070670_100002244 | Ga0070670_10000224412 | 448 |
| 871 | 3300005457 | Ga0070662_100103589 | Ga0070662_1001035892 | 448 |
| 872 | 3300005539 | Ga0068853_100012273 | Ga0068853_1000122734 | 448 |
| 873 | 3300005578 | Ga0068854_100080545 | Ga0068854_1000805452 | 448 |
| 874 | 3300005834 | Ga0068851_10000045 | Ga0068851_1000004537 | 448 |
| 875 | 3300006058 | Ga0075432_10018313 | Ga0075432_100183132 | 448 |
| 876 | 3300006946 | Ga0079104_1000006 | Ga0079104_1000006297 | 448 |
| 877 | 3300009011 | Ga0105251_10001293 | Ga0105251_1000129316 | 448 |
| 878 | 3300009177 | Ga0105248_10096387 | Ga0105248_100963872 | 448 |
| 879 | 3300013102 | Ga0157371_10000925 | Ga0157371_1000092515 | 448 |
| 880 | 3300013104 | Ga0157370_10094246 | Ga0157370_100942462 | 448 |
| 881 | 3300013105 | Ga0157369_10014781 | Ga0157369_100147819 | 448 |
| 882 | 3300013306 | Ga0163162_10000551 | Ga0163162_1000055120 | 448 |
| 883 | 3300015261 | Ga0182006_1002424 | Ga0182006_10024247 | 448 |
| 884 | 3300015261 | Ga0182006_1003647 | Ga0182006_10036475 | 448 |
| 885 | 3300015265 | Ga0182005_1004741 | Ga0182005_10047413 | 448 |
| 886 | 3300017792 | Ga0163161_10008403 | Ga0163161_100084032 | 448 |
| 887 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003513 | 448 |
| 888 | 3300025292 | Ga0209676_1001866 | Ga0209676_100186610 | 448 |
| 889 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004495 | 448 |
| 890 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037228 | 448 |
| 891 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006480 | 448 |
| 892 | 3300025303 | Ga0209051_1000040 | Ga0209051_1000040229 | 448 |
| 893 | 3300025321 | Ga0207656_10000163 | Ga0207656_100001638 | 448 |
| 894 | 3300025735 | Ga0207713_1000318 | Ga0207713_100031849 | 448 |
| 895 | 3300025735 | Ga0207713_1003208 | Ga0207713_10032083 | 448 |
| 896 | 3300025923 | Ga0207681_10003360 | Ga0207681_100033605 | 448 |
| 897 | 3300025925 | Ga0207650_10023412 | Ga0207650_100234123 | 448 |
| 898 | 3300025933 | Ga0207706_10059424 | Ga0207706_100594242 | 448 |
| 899 | 3300027111 | Ga0209281_1000011 | Ga0209281_1000011484 | 448 |
| 900 | 3300031731 | Ga0307405_10000041 | Ga0307405_100000414 | 448 |
| 901 | 3300041405 | Ga0439438_000666 | Ga0439438_000666_4523_5869 | 448 |
| 902 | 3300041407 | Ga0439447_001030 | Ga0439447_001030_7238_8584 | 448 |
| 903 | 3300041411 | Ga0439466_0002734 | Ga0439466_0002734_2643_3989 | 448 |
| 904 | 3300042010 | Ga0439452_000115 | Ga0439452_000115_9929_11275 | 448 |
| 905 | 3300042137 | Ga0450902_000434 | Ga0450902_000434_1460_2806 | 448 |
| 906 | 3300046452 | Ga0495617_000044 | Ga0495617_000044_29569_30921 | 448 |
| 907 | 3300046455 | Ga0495603_0000009 | Ga0495603_0000009_47519_48865 | 448 |
| 908 | 3300046457 | Ga0495590_0000698 | Ga0495590_0000698_13657_15003 | 448 |
| 909 | 3300046458 | Ga0495591_009768 | Ga0495591_009768_991_2343 | 448 |
| 910 | 3300046460 | Ga0495638_0000160 | Ga0495638_0000160_49824_51176 | 448 |
| 911 | 3300046460 | Ga0495638_0015764 | Ga0495638_0015764_1098_2450 | 448 |
| 912 | 3300046460 | Ga0495638_0074070 | Ga0495638_0074070_456_1802 | 448 |
| 913 | 3300046471 | Ga0495650_0005303 | Ga0495650_0005303_3656_5008 | 448 |
| 914 | 3300046474 | Ga0495605_0000088 | Ga0495605_0000088_57461_58813 | 448 |
| 915 | 3300046474 | Ga0495605_0000158 | Ga0495605_0000158_39093_40439 | 448 |
| 916 | 3300046474 | Ga0495605_0000806 | Ga0495605_0000806_17645_18991 | 448 |
| 917 | 3300046474 | Ga0495605_0002738 | Ga0495605_0002738_2290_3642 | 448 |
| 918 | 3300046491 | Ga0495584_0000322 | Ga0495584_0000322_3641_4987 | 448 |
| 919 | 3300046491 | Ga0495584_0000666 | Ga0495584_0000666_5882_7234 | 448 |
| 920 | 3300046491 | Ga0495584_0001575 | Ga0495584_0001575_9747_11093 | 448 |
| 921 | 3300046491 | Ga0495584_0003151 | Ga0495584_0003151_2824_4173 | 448 |
| 922 | 3300046492 | Ga0495585_0000142 | Ga0495585_0000142_45215_46564 | 448 |
| 923 | 3300046499 | Ga0495594_0002539 | Ga0495594_0002539_535_1887 | 448 |
| 924 | 3300046501 | Ga0495607_0007014 | Ga0495607_0007014_3417_4763 | 448 |
| 925 | 3300046501 | Ga0495607_0029980 | Ga0495607_0029980_582_1970 | 448 |
| 926 | 3300046501 | Ga0495607_0050614 | Ga0495607_0050614_677_2044 | 448 |
| 927 | 3300046506 | Ga0495583_0000135 | Ga0495583_0000135_62263_63615 | 448 |
| 928 | 3300046506 | Ga0495583_0002204 | Ga0495583_0002204_8064_9428 | 448 |
| 929 | 3300046507 | Ga0495606_0004668 | Ga0495606_0004668_9419_10786 | 448 |
| 930 | 3300046512 | Ga0495610_0002403 | Ga0495610_0002403_8802_10154 | 448 |
| 931 | 3300046512 | Ga0495610_0002821 | Ga0495610_0002821_2257_3606 | 448 |
| 932 | 3300046512 | Ga0495610_0024504 | Ga0495610_0024504_534_1886 | 448 |
| 933 | 3300046512 | Ga0495610_0038584 | Ga0495610_0038584_896_2284 | 448 |
| 934 | 3300046513 | Ga0495616_0000429 | Ga0495616_0000429_15779_17125 | 448 |
| 935 | 3300046513 | Ga0495616_0045309 | Ga0495616_0045309_398_1750 | 448 |
| 936 | 3300046515 | Ga0495620_0000034 | Ga0495620_0000034_59241_60593 | 448 |
| 937 | 3300046515 | Ga0495620_0005130 | Ga0495620_0005130_1689_3041 | 448 |
| 938 | 3300046518 | Ga0495631_0013640 | Ga0495631_0013640_511_1857 | 448 |
| 939 | 3300046519 | Ga0495632_0000495 | Ga0495632_0000495_20026_21372 | 448 |
| 940 | 3300046519 | Ga0495632_0009443 | Ga0495632_0009443_2249_3595 | 448 |
| 941 | 3300046519 | Ga0495632_0014750 | Ga0495632_0014750_2875_4224 | 448 |
| 942 | 3300046519 | Ga0495632_0040616 | Ga0495632_0040616_721_2091 | 448 |
| 943 | 3300046520 | Ga0495637_0001357 | Ga0495637_0001357_12082_13434 | 448 |
| 944 | 3300046520 | Ga0495637_0013726 | Ga0495637_0013726_873_2219 | 448 |
| 945 | 3300046520 | Ga0495637_0016057 | Ga0495637_0016057_1891_3240 | 448 |
| 946 | 3300046522 | Ga0495643_0005329 | Ga0495643_0005329_3784_5130 | 448 |
| 947 | 3300046523 | Ga0495644_0013543 | Ga0495644_0013543_1055_2407 | 448 |
| 948 | 3300046524 | Ga0495648_0001250 | Ga0495648_0001250_16315_17667 | 448 |
| 949 | 3300046526 | Ga0495666_0061405 | Ga0495666_0061405_382_1728 | 448 |
| 950 | 3300046528 | Ga0495642_0000187 | Ga0495642_0000187_19582_20928 | 448 |
| 951 | 3300046530 | Ga0495654_0000414 | Ga0495654_0000414_8181_9545 | 448 |
| 952 | 3300046530 | Ga0495654_0017905 | Ga0495654_0017905_1223_2569 | 448 |
| 953 | 3300046530 | Ga0495654_0033864 | Ga0495654_0033864_966_2318 | 448 |
| 954 | 3300046538 | Ga0495609_0000147 | Ga0495609_0000147_60447_61799 | 448 |
| 955 | 3300046538 | Ga0495609_0000477 | Ga0495609_0000477_13195_14541 | 448 |
| 956 | 3300046542 | Ga0495597_0016843 | Ga0495597_0016843_857_2206 | 448 |
| 957 | 3300046542 | Ga0495597_0054533 | Ga0495597_0054533_92_1438 | 448 |
| 958 | 3300046558 | Ga0495633_0000316 | Ga0495633_0000316_15983_17335 | 448 |
| 959 | 3300046558 | Ga0495633_0002823 | Ga0495633_0002823_4038_5384 | 448 |
| 960 | 3300046648 | Ga0495611_0001119 | Ga0495611_0001119_5094_6446 | 448 |
| 961 | 3300046660 | Ga0495625_0004436 | Ga0495625_0004436_2660_4012 | 448 |
| 962 | 3300046660 | Ga0495625_0033878 | Ga0495625_0033878_1345_2691 | 448 |
| 963 | 3300046665 | Ga0495661_0000078 | Ga0495661_0000078_57360_58712 | 448 |
| 964 | 3300046665 | Ga0495661_0058967 | Ga0495661_0058967_13_1362 | 448 |
| 965 | 3300046679 | Ga0495623_0128494 | Ga0495623_0128494_82_1434 | 448 |
| 966 | 3300046691 | Ga0495670_0030426 | Ga0495670_0030426_386_1738 | 448 |
| 967 | 3300046692 | Ga0495671_0000052 | Ga0495671_0000052_21765_23111 | 448 |
| 968 | 3300046692 | Ga0495671_0006726 | Ga0495671_0006726_783_2135 | 448 |
| 969 | 3300046694 | Ga0495649_0000106 | Ga0495649_0000106_51067_52413 | 448 |
| 970 | 3300046694 | Ga0495649_0005407 | Ga0495649_0005407_6285_7637 | 448 |
| 971 | 3300046794 | Ga0495589_0001063 | Ga0495589_0001063_11158_12504 | 448 |
| 972 | 3300046794 | Ga0495589_0001135 | Ga0495589_0001135_13452_14804 | 448 |
| 973 | 3300046794 | Ga0495589_0025245 | Ga0495589_0025245_1345_2691 | 448 |
| 974 | 3300046810 | Ga0495660_0002313 | Ga0495660_0002313_147_1499 | 448 |
| 975 | 3300046810 | Ga0495660_0029529 | Ga0495660_0029529_1207_2571 | 448 |
| 976 | 3300047317 | Ga0495604_0084815 | Ga0495604_0084815_273_1625 | 448 |
| 977 | 3300047318 | Ga0495636_0000221 | Ga0495636_0000221_3394_4740 | 448 |
| 978 | 3300047320 | Ga0495672_0001535 | Ga0495672_0001535_11331_12677 | 448 |
| 979 | 3300047320 | Ga0495672_0080428 | Ga0495672_0080428_197_1549 | 448 |
| 980 | 3300047323 | Ga0495683_0000108 | Ga0495683_0000108_60353_61705 | 448 |
| 981 | 3300047323 | Ga0495683_0001247 | Ga0495683_0001247_3519_4865 | 448 |
| 982 | 3300047323 | Ga0495683_0002624 | Ga0495683_0002624_8906_10258 | 448 |
| 983 | 3300047443 | Ga0495687_000572 | Ga0495687_000572_36940_38286 | 448 |
| 984 | 3300047443 | Ga0495687_001130 | Ga0495687_001130_4520_5866 | 448 |
| 985 | 3300047443 | Ga0495687_009882 | Ga0495687_009882_3456_4808 | 448 |
| 986 | 3300047444 | Ga0495675_0000016 | Ga0495675_0000016_115403_116755 | 448 |
| 987 | 3300047446 | Ga0495679_000198 | Ga0495679_000198_2657_4009 | 448 |
| 988 | 3300047469 | Ga0495673_0000190 | Ga0495673_0000190_79624_80970 | 448 |
| 989 | 3300047469 | Ga0495673_0001285 | Ga0495673_0001285_5622_6989 | 448 |
| 990 | 3300047469 | Ga0495673_0003373 | Ga0495673_0003373_8852_10207 | 448 |
| 991 | 3300047469 | Ga0495673_0005427 | Ga0495673_0005427_2899_4245 | 448 |
| 992 | 3300047470 | Ga0495681_0000009 | Ga0495681_0000009_115305_116657 | 448 |
| 993 | 3300047470 | Ga0495681_0001074 | Ga0495681_0001074_11034_12386 | 448 |
| 994 | 3300047470 | Ga0495681_0036771 | Ga0495681_0036771_887_2239 | 448 |
| 995 | 3300047471 | Ga0495684_0021654 | Ga0495684_0021654_1263_2615 | 448 |
| 996 | 3300047472 | Ga0495686_0000633 | Ga0495686_0000633_45349_46698 | 448 |
| 997 | 3300048091 | Ga0495626_0002074 | Ga0495626_0002074_8510_9856 | 448 |
| 998 | 3300048091 | Ga0495626_0019293 | Ga0495626_0019293_691_2037 | 448 |
| 999 | 3300048091 | Ga0495626_0034107 | Ga0495626_0034107_400_1746 | 448 |
| 1000 | 3300048922 | Ga0496119_0020493 | Ga0496119_0020493_2785_4134 | 448 |
| 1001 | 3300048923 | Ga0496120_0007164 | Ga0496120_0007164_3245_4594 | 448 |
| 1002 | 3300048925 | Ga0496122_0005467 | Ga0496122_0005467_913_2265 | 448 |
| 1003 | 3300048926 | Ga0496123_0006893 | Ga0496123_0006893_8532_9884 | 448 |
| 1004 | 3300048927 | Ga0496124_0000812 | Ga0496124_0000812_26677_28023 | 448 |
| 1005 | 3300048928 | Ga0496125_0020652 | Ga0496125_0020652_1960_3324 | 448 |
| 1006 | 3300048928 | Ga0496125_0100470 | Ga0496125_0100470_457_1806 | 448 |
| 1007 | 3300048929 | Ga0496126_0025214 | Ga0496126_0025214_766_2115 | 448 |
| 1008 | 3300049459 | Ga0495678_000081 | Ga0495678_000081_57180_58532 | 448 |
| 1009 | 3300049459 | Ga0495678_000583 | Ga0495678_000583_13886_15238 | 448 |
| 1010 | 3300049459 | Ga0495678_001014 | Ga0495678_001014_2794_4140 | 448 |
| 1011 | 3300049459 | Ga0495678_003272 | Ga0495678_003272_2769_4115 | 448 |
| 1012 | 3300049459 | Ga0495678_007623 | Ga0495678_007623_443_1792 | 448 |
| 1013 | 3300049459 | Ga0495678_026617 | Ga0495678_026617_597_1943 | 448 |
| 1014 | 3300049460 | Ga0495682_0000150 | Ga0495682_0000150_16276_17622 | 448 |
| 1015 | 3300049460 | Ga0495682_0003894 | Ga0495682_0003894_2419_3765 | 448 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9596 | 3 | 431 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.9591 | 3 | 431 |
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9572 | 3 | 431 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.9543 | 3 | 431 |
| 3sdo-assembly1.cif.gz_B | structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei | 0.9492 | 4 | 436 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9492 | 4 | 436 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9469 | 4 | 436 | 3.20.20.30 |
| 6aslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9313 | 3 | 431 | 3.20.20.30 |
| 6aslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9272 | 3 | 431 | 3.20.20.30 |
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8965 | 6 | 428 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0FZG7-F1-model_v4 | Flavin-dependent oxidoreductase | 0.9929 | 12 | 159 |
GO:0016705
|
| AF-W1DL73-F1-model_v4 | Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) | 0.9869 | 22 | 231 |
GO:0004497
GO:0016705 |
| AF-A0A7G2IVK8-F1-model_v4 | Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) | 0.9868 | 23 | 181 |
GO:0004497
GO:0016705 |
| AF-W7YU60-F1-model_v4 | Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase | 0.9844 | 1 | 195 |
GO:0004497
GO:0016705 |
| AF-A0A529XC09-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9835 | 75 | 220 |
GO:0016705
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar