F488246

General Info

Members Datasets Scaffolds Average Seq Length
1015 439 897 445

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0033108|Ga0495633_0033108_483_2027
Length 514
Sequence LNRNYADRARGATLFLEGLVSAGLFVQIIEERRLCIGRAGPLGIFGGGFLLSAKEKTMAQSPANQSSATPATPRHIKLGFILHGVGRTWNDWRHPGRDVNASTSLAYYQRQAASAERGKFDFLFVADSLSITEKSSPHYLNRFEPITILSALAATTSRIGLVATLTVSYSEPFNVARQFASLDHLSGGRAGWNIVTSWLGDTAANFSKTEHPPHNVRYRIAGEYLDVVQGLWDSWEEDAHVADKESGQFVDPDRLHRLDHKGEFFQVRGPLNIKRTPQGQPVIFQAGASEDGRNFAARRAEVIFTHAETQEQGQAYYADVKARAKGFGRNPDQLFILPGIAPIIGDTDDEADALYRELAALESIDTGLGFLSRTFNDHDFRQYDLDAPFPDVGHIGLNSQQSGTLRILAEVRAENLTLRQVAERLASPRGVFVGAAETVADRIQHWFESGTADGFVLFEPLPGQLDIFVDKVIPILQARGLFREEYEGTTFRAHLGLAEPDNRYGADKRAKDAA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231021 Pseudomonas sp. GM78 Isolate Nodule
9 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
10 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
11 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
12 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
13 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
14 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
15 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
18 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
19 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
20 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
21 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
22 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
23 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
24 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
25 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
26 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
27 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
28 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
29 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
30 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
31 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
32 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
33 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
34 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
35 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
36 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
37 2643221583 Caulobacter sp. Root655 Isolate Unclassified
38 2643221584 Caulobacter sp. Root656 Isolate Unclassified
39 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
40 2643221609 Acidovorax sp. Root217 Isolate Unclassified
41 2643221611 Acidovorax sp. Root219 Isolate Unclassified
42 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
43 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
44 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
45 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
46 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
47 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
48 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
49 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
50 2738541297 Duganella sp. GV083 Isolate Unclassified
51 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
52 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
53 2738541357 Duganella sp. GV053 Isolate Unclassified
54 2738543003 Duganella sp. GV066 Isolate Unclassified
55 2738543012 Acidovorax sp. CF301 Isolate Unclassified
56 2738543026 Duganella sp. GV089 Isolate Unclassified
57 2738543029 Duganella sp. GV039 Isolate Unclassified
58 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
59 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
60 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
61 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
62 2816332133 Acidovorax radicis 2721A Isolate Unclassified
63 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
64 2818991435 Caulobacter henricii 536 Isolate Unclassified
65 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
66 2821131069 Duganella sp. 1224 Isolate Unclassified
67 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
68 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
69 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
70 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
71 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
72 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
73 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
74 2849560528 Caulobacter zeae 410 Isolate Unclassified
75 2851153111 Caulobacter radicis 736 Isolate Unclassified
76 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
77 2857553236 Duganella sp. R-74557 Isolate Unclassified
78 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
79 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
80 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
83 2904424332 Duganella sp. 1411 Isolate Rhizosphere
84 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
85 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
86 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
87 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
88 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
89 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
90 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
91 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
92 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
93 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
94 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
95 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
96 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
97 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
98 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
99 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
100 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
101 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
102 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
103 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
104 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
105 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
106 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
107 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
108 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
109 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
110 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
111 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
112 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
113 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
114 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
115 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
116 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
117 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
118 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
119 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
120 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
121 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
122 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
123 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
124 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
125 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
126 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
127 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
128 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
129 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
130 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
131 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
132 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
133 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
134 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
135 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
136 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
137 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
138 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
139 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
140 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
141 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
142 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
143 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
146 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
147 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
151 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
152 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
153 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
157 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
158 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
159 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
160 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
161 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
162 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
163 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
173 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
174 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
175 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
176 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
177 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
178 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
179 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
180 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
181 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
182 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
183 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
184 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
185 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
186 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
187 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
188 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
189 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
190 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
195 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
196 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
197 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
198 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
199 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
200 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
201 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
209 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
211 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
219 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
259 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
264 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
265 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
266 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
269 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
270 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
271 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
272 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
273 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
274 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
275 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
276 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
279 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
283 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
284 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
292 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
293 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
296 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
297 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
298 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
324 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
352 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
390 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
391 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
392 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
393 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
394 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
397 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
407 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
408 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
409 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
410 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
416 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
420 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
421 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
422 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
423 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
424 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
427 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
428 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
429 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
430 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
431 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
432 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
433 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
434 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
435 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
436 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
437 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
438 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
439 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.37
Metatranscriptomes 0
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 1.48
Rhizoplane 4.93
Rhizosphere 67.59
Stem 0
Stem Tuber 0
Unclassified 14.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4057571 2162886011 Bacteria 2495
2 JGI24740J21852_10000040 3300001979 Bacteria 43874
3 JGI24740J21852_10003601 3300001979 Bacteria 6759
4 JGI24740J21852_10003679 3300001979 Bacteria 6678
5 JGI24740J21852_10005450 3300001979 Bacteria 5378
6 JGI24740J21852_10036090 3300001979 Bacteria 1539
7 JGI24739J22299_10000021 3300001989 Bacteria 46786
8 JGI24739J22299_10004456 3300001989 Bacteria 5367
9 JGI24739J22299_10005905 3300001989 Bacteria 4635
10 JGI24737J22298_10001269 3300001990 Bacteria 8936
11 JGI24737J22298_10009451 3300001990 Bacteria 3239
12 JGI24737J22298_10019370 3300001990 Bacteria 2176
13 JGI24735J21928_10002422 3300002067 Bacteria 6485
14 JGI24735J21928_10003309 3300002067 Bacteria 5496
15 JGI24738J21930_10000001 3300002075 Bacteria 133921
16 JGI24751J29686_10001447 3300002459 Bacteria 4973
17 JGI25162J39368_1000448 3300002737 Bacteria 32592
18 JGI25163J39215_1000169 3300002771 Bacteria 25589
19 JGI25164J39214_1000306 3300002772 Bacteria 32696
20 JGI25165J46597_1000121 3300003214 Bacteria 132705
21 JGI25153J46596_10000016 3300003215 Bacteria 285917
22 JGI25153J46596_10031842 3300003215 Bacteria 1768
23 rootH1_10266568 3300003323 Bacteria 2865
24 Ga0055538_1001047 3300003751 Bacteria 6204
25 Ga0055539_1000990 3300003752 Bacteria 6204
26 Ga0055533_1001472 3300003756 Bacteria 6204
27 Ga0055532_1001544 3300003758 Bacteria 6204
28 Ga0055525_1001160 3300003759 Bacteria 6204
29 Ga0055537_1003505 3300003773 Bacteria 4806
30 Ga0055536_1000005 3300003781 Bacteria 383598
31 Ga0055536_1000027 3300003781 Bacteria 164595
32 Ga0055530_10000001 3300003791 Bacteria 383067
33 Ga0055530_10000079 3300003791 Bacteria 83270
34 Ga0055530_10000165 3300003791 Bacteria 60120
35 Ga0055540_1000186 3300003792 Bacteria 60120
36 Ga0055540_1000258 3300003792 Bacteria 47854
37 Ga0055531_10014786 3300003794 Bacteria 3489
38 Ga0055541_1001087 3300003841 Bacteria 6204
39 Ga0065165_1002059 3300005262 Bacteria 18596
40 Ga0065714_10005985 3300005288 Bacteria 7190
41 Ga0065714_10008360 3300005288 Bacteria 4753
42 Ga0065714_10064839 3300005288 Bacteria 17232
43 Ga0065714_10077303 3300005288 Bacteria 2703
44 Ga0065714_10085296 3300005288 Bacteria 2155
45 Ga0065704_10006301 3300005289 Bacteria 2989
46 Ga0065704_10072214 3300005289 Bacteria 8931
47 Ga0065704_10082902 3300005289 Bacteria 3536
48 Ga0065704_10085666 3300005289 Bacteria 3198
49 Ga0065712_10068364 3300005290 Bacteria 11276
50 Ga0065712_10094642 3300005290 Bacteria 2239
51 Ga0065707_10001308 3300005295 Bacteria 8844
52 Ga0070670_100002244 3300005331 Bacteria 15889
53 Ga0070670_100005599 3300005331 Bacteria 10595
54 Ga0070670_100069781 3300005331 Bacteria 3017
55 Ga0070666_10002911 3300005335 Bacteria 10351
56 Ga0070666_10081034 3300005335 Bacteria 2219
57 Ga0070682_100048039 3300005337 Bacteria 2656
58 Ga0070660_100022198 3300005339 Bacteria 4690
59 Ga0070661_100000163 3300005344 Bacteria 54929
60 Ga0070668_100000045 3300005347 Bacteria 77362
61 Ga0070668_100002438 3300005347 Bacteria 13684
62 Ga0070668_100008385 3300005347 Bacteria 7675
63 Ga0070668_100014187 3300005347 Bacteria 5952
64 Ga0070668_100021709 3300005347 Bacteria 4850
65 Ga0070668_100022840 3300005347 Bacteria 4728
66 Ga0070668_100033112 3300005347 Bacteria 3934
67 Ga0070668_100037615 3300005347 Bacteria 3696
68 Ga0070668_100060798 3300005347 Bacteria 2927
69 Ga0070669_100005542 3300005353 Bacteria 9115
70 Ga0070669_100011837 3300005353 Bacteria 6189
71 Ga0070669_100043004 3300005353 Bacteria 3289
72 Ga0070671_100000003 3300005355 Bacteria 270186
73 Ga0070671_100002400 3300005355 Bacteria 14480
74 Ga0070671_100015086 3300005355 Bacteria 6241
75 Ga0070671_100196385 3300005355 Bacteria 1710
76 Ga0070659_100029656 3300005366 Bacteria 4228
77 Ga0070667_100000009 3300005367 Bacteria 281488
78 Ga0070667_100000336 3300005367 Bacteria 52390
79 Ga0070667_100003055 3300005367 Bacteria 14387
80 Ga0070667_100040423 3300005367 Bacteria 3911
81 Ga0070667_100141689 3300005367 Bacteria 2106
82 Ga0070663_100004705 3300005455 Bacteria 8049
83 Ga0070662_100004680 3300005457 Bacteria 8679
84 Ga0070662_100041202 3300005457 Bacteria 3293
85 Ga0070662_100103589 3300005457 Bacteria 2158
86 Ga0070699_100047360 3300005518 Bacteria 3720
87 Ga0068853_100000323 3300005539 Bacteria 33372
88 Ga0068853_100006913 3300005539 Bacteria 9058
89 Ga0068853_100012273 3300005539 Bacteria 6967
90 Ga0068853_100044233 3300005539 Bacteria 3811
91 Ga0068853_100103945 3300005539 Bacteria 2514
92 Ga0070672_100024078 3300005543 Bacteria 4493
93 Ga0070665_100000816 3300005548 Bacteria 40734
94 Ga0070665_100005929 3300005548 Bacteria 12514
95 Ga0068855_100040101 3300005563 Bacteria 5558
96 Ga0070664_100000101 3300005564 Bacteria 54929
97 Ga0068857_100017091 3300005577 Bacteria 6355
98 Ga0068857_100035699 3300005577 Bacteria 4403
99 Ga0068854_100000370 3300005578 Bacteria 28720
100 Ga0068854_100026295 3300005578 Bacteria 3999
101 Ga0068854_100040560 3300005578 Bacteria 3285
102 Ga0068854_100080545 3300005578 Bacteria 2403
103 Ga0068856_100000374 3300005614 Bacteria 49224
104 Ga0068852_100007527 3300005616 Bacteria 7951
105 Ga0068852_100015318 3300005616 Bacteria 5939
106 Ga0068859_100021404 3300005617 Bacteria 6489
107 Ga0068864_100041916 3300005618 Bacteria 3916
108 Ga0068851_10000045 3300005834 Bacteria 80884
109 Ga0068851_10000147 3300005834 Bacteria 37787
110 Ga0068863_100000225 3300005841 Bacteria 59865
111 Ga0068863_100033449 3300005841 Bacteria 4898
112 Ga0068863_100070480 3300005841 Bacteria 3306
113 Ga0068863_100080560 3300005841 Bacteria 3084
114 Ga0068858_100001386 3300005842 Bacteria 24950
115 Ga0068858_100037216 3300005842 Bacteria 4512
116 Ga0068858_100050201 3300005842 Bacteria 3861
117 Ga0068860_100000051 3300005843 Bacteria 208179
118 Ga0068860_100000193 3300005843 Bacteria 97253
119 Ga0068860_100001524 3300005843 Bacteria 24955
120 Ga0068860_100004640 3300005843 Bacteria 14034
121 Ga0068860_100006123 3300005843 Bacteria 12100
122 Ga0068860_100008197 3300005843 Bacteria 10399
123 Ga0068860_100011953 3300005843 Bacteria 8557
124 Ga0068860_100040398 3300005843 Bacteria 4459
125 Ga0068860_100178234 3300005843 Unclassified 2054
126 Ga0068862_100000031 3300005844 Bacteria 180203
127 Ga0068862_100000083 3300005844 Bacteria 112991
128 Ga0068862_100004726 3300005844 Bacteria 11469
129 Ga0068862_100010282 3300005844 Bacteria 7720
130 Ga0068862_100011846 3300005844 Bacteria 7201
131 Ga0081455_10000872 3300005937 Bacteria 38964
132 Ga0081455_10007504 3300005937 Bacteria 11472
133 Ga0075368_10000863 3300006042 Bacteria 9372
134 Ga0075363_100001725 3300006048 Bacteria 8497
135 Ga0075432_10018313 3300006058 Bacteria 2389
136 Ga0075362_10023032 3300006177 Bacteria 2630
137 Ga0075367_10000269 3300006178 Bacteria 17930
138 Ga0075369_10001433 3300006186 Bacteria 8136
139 Ga0075366_10035008 3300006195 Bacteria 2960
140 Ga0075366_10069282 3300006195 Bacteria 2100
141 Ga0075370_10008619 3300006353 Bacteria 5257
142 Ga0075370_10081181 3300006353 Bacteria 1864
143 Ga0097620_100021404 3300006931 Bacteria 6489
144 Ga0079104_1000006 3300006946 Bacteria 396255
145 Ga0105251_10000612 3300009011 Bacteria 32744
146 Ga0105251_10001159 3300009011 Bacteria 22899
147 Ga0105251_10001293 3300009011 Bacteria 21634
148 Ga0105251_10004188 3300009011 Bacteria 9985
149 Ga0105244_10000738 3300009036 Bacteria 27985
150 Ga0105244_10002527 3300009036 Bacteria 13749
151 Ga0105244_10005252 3300009036 Bacteria 8640
152 Ga0105244_10009145 3300009036 Bacteria 6114
153 Ga0105244_10019703 3300009036 Bacteria 3759
154 Ga0105244_10075830 3300009036 Bacteria 1670
155 Ga0105250_10000089 3300009092 Bacteria 80765
156 Ga0105250_10000109 3300009092 Bacteria 74557
157 Ga0105250_10015604 3300009092 Bacteria 3110
158 Ga0105240_10000220 3300009093 Bacteria 115299
159 Ga0105240_10006254 3300009093 Bacteria 17515
160 Ga0105240_10228184 3300009093 Bacteria 2165
161 Ga0105245_10000721 3300009098 Bacteria 29771
162 Ga0105243_10000047 3300009148 Bacteria 154272
163 Ga0105243_10017725 3300009148 Bacteria 5386
164 Ga0105241_10022859 3300009174 Bacteria 4635
165 Ga0105242_10013185 3300009176 Bacteria 6380
166 Ga0105248_10003730 3300009177 Bacteria 16894
167 Ga0105248_10031570 3300009177 Bacteria 5919
168 Ga0105248_10068301 3300009177 Bacteria 3991
169 Ga0105248_10096387 3300009177 Bacteria 3332
170 Ga0105248_10111527 3300009177 Bacteria 3085
171 Ga0105248_10150369 3300009177 Bacteria 2627
172 Ga0105248_10188965 3300009177 Bacteria 2321
173 Ga0105237_10000096 3300009545 Bacteria 121683
174 Ga0105237_10000099 3300009545 Bacteria 120098
175 Ga0105237_10020144 3300009545 Bacteria 6885
176 Ga0105238_10091370 3300009551 Bacteria 3031
177 Ga0105249_10000102 3300009553 Bacteria 119003
178 Ga0105249_10002432 3300009553 Bacteria 16167
179 Ga0105249_10011862 3300009553 Bacteria 7661
180 Ga0105249_10016242 3300009553 Bacteria 6602
181 Ga0105249_10113894 3300009553 Bacteria 2560
182 Ga0105249_10191623 3300009553 Bacteria 1996
183 Ga0105239_10000111 3300010375 Bacteria 115283
184 Ga0105239_10014227 3300010375 Bacteria 8831
185 Ga0105239_10048852 3300010375 Bacteria 4638
186 Ga0105239_10179715 3300010375 Bacteria 2367
187 Ga0105246_10011380 3300011119 Bacteria 5523
188 Ga0157373_10008703 3300013100 Bacteria 7529
189 Ga0157371_10000925 3300013102 Bacteria 32949
190 Ga0157371_10001152 3300013102 Bacteria 28455
191 Ga0157371_10005656 3300013102 Bacteria 10495
192 Ga0157371_10034266 3300013102 Bacteria 3642
193 Ga0157370_10001082 3300013104 Bacteria 34114
194 Ga0157370_10032814 3300013104 Bacteria 5068
195 Ga0157370_10094246 3300013104 Bacteria 2809
196 Ga0157369_10003418 3300013105 Bacteria 18834
197 Ga0157369_10005493 3300013105 Bacteria 14729
198 Ga0157369_10014781 3300013105 Bacteria 8807
199 Ga0163162_10000551 3300013306 Bacteria 34607
200 Ga0163162_10009185 3300013306 Bacteria 9621
201 Ga0157372_10000411 3300013307 Bacteria 46913
202 Ga0157372_10011852 3300013307 Bacteria 9285
203 Ga0157372_10043888 3300013307 Bacteria 4953
204 Ga0157375_10000819 3300013308 Bacteria 27196
205 Ga0157375_10036562 3300013308 Bacteria 4699
206 Ga0157375_10047654 3300013308 Bacteria 4187
207 Ga0157379_10003646 3300014968 Bacteria 13071
208 Ga0157379_10053777 3300014968 Bacteria 3598
209 Ga0182006_1002424 3300015261 Bacteria 10195
210 Ga0182006_1003647 3300015261 Bacteria 7811
211 Ga0182007_10000682 3300015262 Bacteria 19509
212 Ga0182005_1004741 3300015265 Bacteria 4340
213 Ga0163161_10008403 3300017792 Bacteria 7143
214 Ga0163161_10102611 3300017792 Bacteria 2130
215 Ga0213872_10005680 3300021361 Bacteria 6358
216 Ga0209435_101060 3300025206 Bacteria 3879
217 Ga0209760_100185 3300025207 Bacteria 32620
218 Ga0209784_100065 3300025224 Bacteria 155963
219 Ga0209566_100081 3300025225 Bacteria 155963
220 Ga0209674_100101 3300025226 Bacteria 155963
221 Ga0209147_100152 3300025229 Bacteria 100822
222 Ga0209147_100919 3300025229 Bacteria 13186
223 Ga0209563_100098 3300025230 Bacteria 155963
224 Ga0207427_100014 3300025231 Bacteria 561361
225 Ga0209437_100016 3300025233 Bacteria 710118
226 Ga0209437_104459 3300025233 Bacteria 2467
227 Ga0209258_101731 3300025242 Bacteria 6782
228 Ga0209646_1001452 3300025246 Bacteria 6331
229 Ga0209677_100059 3300025253 Bacteria 155963
230 Ga0209233_1000036 3300025261 Bacteria 561361
231 Ga0209565_1000281 3300025263 Bacteria 50202
232 Ga0209673_1001574 3300025273 Bacteria 20330
233 Ga0209675_1006260 3300025291 Bacteria 4814
234 Ga0209676_1000003 3300025292 Bacteria 1454178
235 Ga0209676_1000087 3300025292 Bacteria 263734
236 Ga0209676_1001866 3300025292 Bacteria 17337
237 Ga0209564_1005483 3300025295 Bacteria 7215
238 Ga0209758_1000035 3300025297 Bacteria 448190
239 Ga0209758_1000608 3300025297 Bacteria 55483
240 Ga0209758_1015026 3300025297 Bacteria 4047
241 Ga0209050_1000004 3300025298 Bacteria 1600040
242 Ga0209050_1000037 3300025298 Bacteria 415612
243 Ga0209050_1000083 3300025298 Bacteria 263734
244 Ga0209256_1006602 3300025299 Bacteria 6067
245 Ga0209051_1000006 3300025303 Bacteria 1015785
246 Ga0209051_1000040 3300025303 Bacteria 315055
247 Ga0209051_1008204 3300025303 Bacteria 5564
248 Ga0209257_1000036 3300025304 Bacteria 616006
249 Ga0209257_1001043 3300025304 Bacteria 36902
250 Ga0209257_1002683 3300025304 Bacteria 17041
251 Ga0207656_10000077 3300025321 Bacteria 36340
252 Ga0207656_10000163 3300025321 Bacteria 24772
253 Ga0207696_1000115 3300025711 Bacteria 150739
254 Ga0207696_1000163 3300025711 Bacteria 106948
255 Ga0207696_1032710 3300025711 Bacteria 1564
256 Ga0207655_1000734 3300025728 Bacteria 36990
257 Ga0207655_1001691 3300025728 Bacteria 19409
258 Ga0207655_1002757 3300025728 Bacteria 13703
259 Ga0207655_1032477 3300025728 Bacteria 2384
260 Ga0207713_1000020 3300025735 Bacteria 359258
261 Ga0207713_1000318 3300025735 Bacteria 54717
262 Ga0207713_1001737 3300025735 Bacteria 16750
263 Ga0207713_1003208 3300025735 Bacteria 11288
264 Ga0207713_1003330 3300025735 Bacteria 11035
265 Ga0207713_1006178 3300025735 Bacteria 7357
266 Ga0207680_10001712 3300025903 Bacteria 10339
267 Ga0207680_10007735 3300025903 Bacteria 5253
268 Ga0207647_10024637 3300025904 Bacteria 3966
269 Ga0207654_10020477 3300025911 Bacteria 3506
270 Ga0207695_10000213 3300025913 Bacteria 155843
271 Ga0207695_10011595 3300025913 Bacteria 10659
272 Ga0207695_10062012 3300025913 Bacteria 3862
273 Ga0207695_10165322 3300025913 Bacteria 2141
274 Ga0207671_10000747 3300025914 Bacteria 41249
275 Ga0207671_10000788 3300025914 Bacteria 40108
276 Ga0207657_10063173 3300025919 Bacteria 3167
277 Ga0207649_10000010 3300025920 Bacteria 284354
278 Ga0207681_10000843 3300025923 Bacteria 20218
279 Ga0207681_10003360 3300025923 Bacteria 10021
280 Ga0207681_10005690 3300025923 Bacteria 7655
281 Ga0207694_10116550 3300025924 Bacteria 2129
282 Ga0207650_10000384 3300025925 Bacteria 40899
283 Ga0207650_10001354 3300025925 Bacteria 17693
284 Ga0207650_10011260 3300025925 Bacteria 6153
285 Ga0207650_10023412 3300025925 Bacteria 4379
286 Ga0207687_10000467 3300025927 Bacteria 27625
287 Ga0207644_10000004 3300025931 Bacteria 566613
288 Ga0207644_10000084 3300025931 Bacteria 69209
289 Ga0207690_10011096 3300025932 Bacteria 5374
290 Ga0207690_10025423 3300025932 Bacteria 3718
291 Ga0207706_10000383 3300025933 Bacteria 48348
292 Ga0207706_10003643 3300025933 Bacteria 14715
293 Ga0207706_10059424 3300025933 Bacteria 3367
294 Ga0207709_10000058 3300025935 Bacteria 212963
295 Ga0207709_10007500 3300025935 Bacteria 6072
296 Ga0207711_10001289 3300025941 Bacteria 23752
297 Ga0207711_10062163 3300025941 Bacteria 3221
298 Ga0207679_10000037 3300025945 Bacteria 133550
299 Ga0207667_10048200 3300025949 Bacteria 4506
300 Ga0207712_10000026 3300025961 Bacteria 271237
301 Ga0207712_10012258 3300025961 Bacteria 5477
302 Ga0207712_10013582 3300025961 Bacteria 5222
303 Ga0207712_10165855 3300025961 Bacteria 1722
304 Ga0207668_10000031 3300025972 Bacteria 122168
305 Ga0207668_10000384 3300025972 Bacteria 28142
306 Ga0207668_10000837 3300025972 Bacteria 18598
307 Ga0207668_10003946 3300025972 Bacteria 8742
308 Ga0207668_10005069 3300025972 Bacteria 7755
309 Ga0207668_10005145 3300025972 Bacteria 7696
310 Ga0207668_10027971 3300025972 Bacteria 3680
311 Ga0207668_10030627 3300025972 Bacteria 3537
312 Ga0207668_10054835 3300025972 Bacteria 2768
313 Ga0207640_10000172 3300025981 Bacteria 47087
314 Ga0207640_10010921 3300025981 Bacteria 5123
315 Ga0207640_10021468 3300025981 Bacteria 3849
316 Ga0207640_10032428 3300025981 Bacteria 3239
317 Ga0207658_10000009 3300025986 Bacteria 264118
318 Ga0207658_10000173 3300025986 Bacteria 69532
319 Ga0207658_10002222 3300025986 Bacteria 14414
320 Ga0207658_10004604 3300025986 Bacteria 9566
321 Ga0207658_10006715 3300025986 Bacteria 7833
322 Ga0207658_10114975 3300025986 Bacteria 2134
323 Ga0207703_10005397 3300026035 Bacteria 10291
324 Ga0207639_10001228 3300026041 Bacteria 17380
325 Ga0207639_10001573 3300026041 Bacteria 15305
326 Ga0207639_10010029 3300026041 Bacteria 6548
327 Ga0207639_10071057 3300026041 Bacteria 2721
328 Ga0207678_10012629 3300026067 Bacteria 7420
329 Ga0207702_10001025 3300026078 Bacteria 28676
330 Ga0207641_10000367 3300026088 Bacteria 53540
331 Ga0207641_10004419 3300026088 Bacteria 12184
332 Ga0207641_10005639 3300026088 Bacteria 10666
333 Ga0207641_10016352 3300026088 Bacteria 6074
334 Ga0207641_10023406 3300026088 Bacteria 5089
335 Ga0207641_10054906 3300026088 Bacteria 3382
336 Ga0207674_10025702 3300026116 Bacteria 6270
337 Ga0207674_10047138 3300026116 Bacteria 4420
338 Ga0207675_100039006 3300026118 Bacteria 4433
339 Ga0207675_100063072 3300026118 Bacteria 3463
340 Ga0207683_10058640 3300026121 Bacteria 3380
341 Ga0207698_10018166 3300026142 Bacteria 4786
342 Ga0209281_1000011 3300027111 Bacteria 695292
343 Ga0209813_10000074 3300027866 Bacteria 36982
344 Ga0268266_10000387 3300028379 Bacteria 67080
345 Ga0268265_10000094 3300028380 Bacteria 113107
346 Ga0268265_10000118 3300028380 Bacteria 99496
347 Ga0268265_10002558 3300028380 Bacteria 13604
348 Ga0268264_10000001 3300028381 Bacteria 1221000
349 Ga0268264_10000021 3300028381 Bacteria 481580
350 Ga0268264_10000367 3300028381 Bacteria 66987
351 Ga0268264_10002410 3300028381 Bacteria 16460
352 Ga0268264_10008727 3300028381 Bacteria 8413
353 Ga0268264_10059509 3300028381 Bacteria 3201
354 Ga0265326_10018769 3300028558 Bacteria 1989
355 Ga0265319_1013333 3300028563 Bacteria 3275
356 Ga0265334_10010853 3300028573 Bacteria 3846
357 Ga0265318_10000019 3300028577 Bacteria 169214
358 Ga0307515_10068578 3300028794 Bacteria 4869
359 Ga0307515_10091706 3300028794 Bacteria 3792
360 Ga0307515_10136135 3300028794 Bacteria 2670
361 Ga0307515_10247065 3300028794 Bacteria 1544
362 Ga0265338_10108050 3300028800 Bacteria 2248
363 Ga0268256_1019716 3300030500 Bacteria 1838
364 Ga0316181_1279899 3300030744 Bacteria 3761
365 Ga0265330_10000691 3300031235 Bacteria 21588
366 Ga0265332_10000076 3300031238 Bacteria 84301
367 Ga0265328_10038198 3300031239 Bacteria 1772
368 Ga0265320_10000689 3300031240 Bacteria 25743
369 Ga0265325_10000250 3300031241 Bacteria 38286
370 Ga0265329_10000634 3300031242 Bacteria 17938
371 Ga0265331_10000775 3300031250 Bacteria 26589
372 Ga0265327_10007444 3300031251 Bacteria 8446
373 Ga0265316_10000893 3300031344 Bacteria 32660
374 Ga0265316_10006740 3300031344 Bacteria 10947
375 Ga0307509_10008863 3300031507 Bacteria 12693
376 Ga0307509_10185091 3300031507 Bacteria 1942
377 Ga0307408_100051934 3300031548 Bacteria 2955
378 Ga0307508_10000204 3300031616 Bacteria 71518
379 Ga0265314_10002160 3300031711 Bacteria 20569
380 Ga0265342_10001950 3300031712 Bacteria 18467
381 Ga0307405_10000041 3300031731 Bacteria 81597
382 Ga0307405_10003738 3300031731 Bacteria 7067
383 Ga0307412_10002912 3300031911 Bacteria 9491
384 Ga0307510_10095588 3300033180 Bacteria 2790
385 Ga0373931_0027539 3300035691 Bacteria 2902
386 Ga0373927_0042026 3300035695 Bacteria 2964
387 Ga0395900_0217043 3300037418 Bacteria 1930
388 Ga0436361_0551392 3300039447 Bacteria 9053
389 Ga0436361_0863053 3300039447 Bacteria 2524
390 Ga0439438_000544 3300041405 Bacteria 17157
391 Ga0439438_000666 3300041405 Bacteria 15441
392 Ga0439447_001030 3300041407 Bacteria 10122
393 Ga0439466_0002734 3300041411 Bacteria 6902
394 Ga0439441_003261 3300042001 Bacteria 2375
395 Ga0439452_000115 3300042010 Bacteria 63101
396 Ga0439456_002535 3300042013 Bacteria 3675
397 Ga0450902_000434 3300042137 Bacteria 5171
398 Ga0466968_0002632 3300044735 Bacteria 6606
399 Ga0466970_0027931 3300044765 Bacteria 2963
400 Ga0495617_000003 3300046452 Bacteria 541914
401 Ga0495617_000044 3300046452 Bacteria 119709
402 Ga0495617_000344 3300046452 Bacteria 25643
403 Ga0495617_001200 3300046452 Bacteria 11655
404 Ga0495617_011875 3300046452 Bacteria 2970
405 Ga0495627_000008 3300046453 Bacteria 572150
406 Ga0495627_000056 3300046453 Bacteria 147012
407 Ga0495627_000084 3300046453 Bacteria 112950
408 Ga0495627_000142 3300046453 Bacteria 85934
409 Ga0495627_000334 3300046453 Bacteria 45155
410 Ga0495627_001885 3300046453 Bacteria 11047
411 Ga0495603_0000009 3300046455 Bacteria 72869
412 Ga0495590_0000698 3300046457 Bacteria 15366
413 Ga0495590_0001721 3300046457 Bacteria 9306
414 Ga0495590_0003169 3300046457 Bacteria 6727
415 Ga0495590_0030594 3300046457 Bacteria 1886
416 Ga0495591_000088 3300046458 Bacteria 102486
417 Ga0495591_000448 3300046458 Bacteria 33571
418 Ga0495591_004529 3300046458 Bacteria 6749
419 Ga0495591_009768 3300046458 Bacteria 3780
420 Ga0495638_0000018 3300046460 Bacteria 389696
421 Ga0495638_0000160 3300046460 Bacteria 105110
422 Ga0495638_0000230 3300046460 Bacteria 76565
423 Ga0495638_0000399 3300046460 Bacteria 53351
424 Ga0495638_0004745 3300046460 Bacteria 10253
425 Ga0495638_0015764 3300046460 Bacteria 5064
426 Ga0495638_0016007 3300046460 Bacteria 5026
427 Ga0495638_0018658 3300046460 Bacteria 4603
428 Ga0495638_0074070 3300046460 Bacteria 2077
429 Ga0495653_0000002 3300046463 Bacteria 507262
430 Ga0495650_0000017 3300046471 Bacteria 542552
431 Ga0495650_0000160 3300046471 Bacteria 152374
432 Ga0495650_0002248 3300046471 Bacteria 16151
433 Ga0495650_0003429 3300046471 Bacteria 11568
434 Ga0495650_0003742 3300046471 Bacteria 10861
435 Ga0495650_0005303 3300046471 Bacteria 8432
436 Ga0495650_0012276 3300046471 Bacteria 4618
437 Ga0495650_0022142 3300046471 Bacteria 3053
438 Ga0495605_0000068 3300046474 Bacteria 137743
439 Ga0495605_0000088 3300046474 Bacteria 119191
440 Ga0495605_0000158 3300046474 Bacteria 86829
441 Ga0495605_0000365 3300046474 Bacteria 43038
442 Ga0495605_0000806 3300046474 Bacteria 22409
443 Ga0495605_0002738 3300046474 Bacteria 10763
444 Ga0495605_0004999 3300046474 Bacteria 7746
445 Ga0495605_0011818 3300046474 Bacteria 4859
446 Ga0495584_0000027 3300046491 Bacteria 112488
447 Ga0495584_0000322 3300046491 Bacteria 33438
448 Ga0495584_0000666 3300046491 Bacteria 22861
449 Ga0495584_0001575 3300046491 Bacteria 13482
450 Ga0495584_0003151 3300046491 Bacteria 9159
451 Ga0495584_0018535 3300046491 Bacteria 3537
452 Ga0495585_0000142 3300046492 Bacteria 79060
453 Ga0495585_0006735 3300046492 Bacteria 7089
454 Ga0495594_0002539 3300046499 Bacteria 9505
455 Ga0495596_0000006 3300046500 Bacteria 161501
456 Ga0495596_0000061 3300046500 Bacteria 79205
457 Ga0495596_0001000 3300046500 Bacteria 16807
458 Ga0495607_0000076 3300046501 Bacteria 99256
459 Ga0495607_0000253 3300046501 Bacteria 57280
460 Ga0495607_0007014 3300046501 Bacteria 7840
461 Ga0495607_0012249 3300046501 Bacteria 5669
462 Ga0495607_0016286 3300046501 Bacteria 4800
463 Ga0495607_0029544 3300046501 Bacteria 3372
464 Ga0495607_0029980 3300046501 Bacteria 3344
465 Ga0495607_0050614 3300046501 Bacteria 2417
466 Ga0495607_0075966 3300046501 Bacteria 1860
467 Ga0495583_0000010 3300046506 Bacteria 353523
468 Ga0495583_0000029 3300046506 Bacteria 255536
469 Ga0495583_0000135 3300046506 Bacteria 123916
470 Ga0495583_0000429 3300046506 Bacteria 63489
471 Ga0495583_0000457 3300046506 Bacteria 60714
472 Ga0495583_0001285 3300046506 Bacteria 26213
473 Ga0495583_0002204 3300046506 Bacteria 17264
474 Ga0495606_0000165 3300046507 Bacteria 116607
475 Ga0495606_0000545 3300046507 Bacteria 60465
476 Ga0495606_0000729 3300046507 Bacteria 50871
477 Ga0495606_0000760 3300046507 Bacteria 49564
478 Ga0495606_0004668 3300046507 Bacteria 13543
479 Ga0495606_0007980 3300046507 Bacteria 9312
480 Ga0495606_0021889 3300046507 Bacteria 4675
481 Ga0495606_0034070 3300046507 Bacteria 3501
482 Ga0495606_0054372 3300046507 Bacteria 2593
483 Ga0495610_0000003 3300046512 Bacteria 1203910
484 Ga0495610_0000058 3300046512 Bacteria 137991
485 Ga0495610_0000107 3300046512 Bacteria 97076
486 Ga0495610_0001222 3300046512 Bacteria 23122
487 Ga0495610_0002403 3300046512 Bacteria 15762
488 Ga0495610_0002821 3300046512 Bacteria 14159
489 Ga0495610_0006938 3300046512 Bacteria 7667
490 Ga0495610_0007561 3300046512 Bacteria 7196
491 Ga0495610_0009414 3300046512 Bacteria 6181
492 Ga0495610_0017959 3300046512 Bacteria 4012
493 Ga0495610_0024504 3300046512 Bacteria 3254
494 Ga0495610_0032252 3300046512 Bacteria 2724
495 Ga0495610_0038584 3300046512 Bacteria 2424
496 Ga0495616_0000054 3300046513 Bacteria 104326
497 Ga0495616_0000082 3300046513 Bacteria 80468
498 Ga0495616_0000372 3300046513 Bacteria 34836
499 Ga0495616_0000429 3300046513 Bacteria 32137
500 Ga0495616_0027272 3300046513 Bacteria 3033
501 Ga0495616_0034791 3300046513 Bacteria 2612
502 Ga0495616_0045309 3300046513 Bacteria 2227
503 Ga0495616_0049385 3300046513 Bacteria 2109
504 Ga0495620_0000034 3300046515 Bacteria 117942
505 Ga0495620_0000207 3300046515 Bacteria 44260
506 Ga0495620_0005130 3300046515 Bacteria 7334
507 Ga0495620_0022451 3300046515 Bacteria 3037
508 Ga0495628_0036011 3300046516 Bacteria 3975
509 Ga0495630_0000058 3300046517 Bacteria 90878
510 Ga0495631_0000372 3300046518 Bacteria 30820
511 Ga0495631_0013640 3300046518 Bacteria 3939
512 Ga0495631_0033461 3300046518 Bacteria 2309
513 Ga0495632_0000076 3300046519 Bacteria 101121
514 Ga0495632_0000113 3300046519 Bacteria 83027
515 Ga0495632_0000207 3300046519 Bacteria 59532
516 Ga0495632_0000495 3300046519 Bacteria 37144
517 Ga0495632_0000748 3300046519 Bacteria 29283
518 Ga0495632_0000997 3300046519 Bacteria 24718
519 Ga0495632_0007697 3300046519 Bacteria 6728
520 Ga0495632_0009443 3300046519 Bacteria 5887
521 Ga0495632_0013021 3300046519 Bacteria 4766
522 Ga0495632_0014750 3300046519 Bacteria 4408
523 Ga0495632_0017003 3300046519 Bacteria 4028
524 Ga0495632_0040616 3300046519 Bacteria 2342
525 Ga0495637_0000214 3300046520 Bacteria 45088
526 Ga0495637_0000219 3300046520 Bacteria 44013
527 Ga0495637_0001357 3300046520 Bacteria 14696
528 Ga0495637_0001450 3300046520 Bacteria 13958
529 Ga0495637_0001481 3300046520 Bacteria 13781
530 Ga0495637_0002671 3300046520 Bacteria 9739
531 Ga0495637_0004462 3300046520 Bacteria 7248
532 Ga0495637_0005690 3300046520 Bacteria 6325
533 Ga0495637_0007700 3300046520 Bacteria 5328
534 Ga0495637_0013726 3300046520 Bacteria 3840
535 Ga0495637_0016057 3300046520 Bacteria 3504
536 Ga0495643_0000009 3300046522 Bacteria 344767
537 Ga0495643_0000321 3300046522 Bacteria 65956
538 Ga0495643_0000454 3300046522 Bacteria 52085
539 Ga0495643_0001232 3300046522 Bacteria 24663
540 Ga0495643_0002236 3300046522 Bacteria 15721
541 Ga0495643_0005329 3300046522 Bacteria 8715
542 Ga0495643_0018408 3300046522 Bacteria 4060
543 Ga0495643_0020490 3300046522 Bacteria 3811
544 Ga0495643_0045383 3300046522 Bacteria 2386
545 Ga0495644_0000119 3300046523 Bacteria 37559
546 Ga0495644_0013543 3300046523 Bacteria 3128
547 Ga0495644_0019907 3300046523 Bacteria 2561
548 Ga0495648_0000018 3300046524 Bacteria 282490
549 Ga0495648_0000239 3300046524 Bacteria 62900
550 Ga0495648_0001250 3300046524 Bacteria 25409
551 Ga0495648_0001378 3300046524 Bacteria 23932
552 Ga0495648_0008114 3300046524 Bacteria 8292
553 Ga0495663_0000023 3300046525 Bacteria 105104
554 Ga0495666_0061405 3300046526 Bacteria 1796
555 Ga0495642_0000114 3300046528 Bacteria 45647
556 Ga0495642_0000187 3300046528 Bacteria 36703
557 Ga0495654_0000012 3300046530 Bacteria 328997
558 Ga0495654_0000292 3300046530 Bacteria 45100
559 Ga0495654_0000414 3300046530 Bacteria 36432
560 Ga0495654_0001637 3300046530 Bacteria 15169
561 Ga0495654_0001701 3300046530 Bacteria 14780
562 Ga0495654_0009671 3300046530 Bacteria 5279
563 Ga0495654_0014271 3300046530 Bacteria 4233
564 Ga0495654_0017905 3300046530 Bacteria 3718
565 Ga0495654_0023808 3300046530 Bacteria 3169
566 Ga0495654_0033864 3300046530 Bacteria 2582
567 Ga0495609_0000111 3300046538 Bacteria 94808
568 Ga0495609_0000147 3300046538 Bacteria 73010
569 Ga0495609_0000340 3300046538 Bacteria 41415
570 Ga0495609_0000477 3300046538 Bacteria 32285
571 Ga0495609_0008130 3300046538 Bacteria 5164
572 Ga0495597_0000050 3300046542 Bacteria 98185
573 Ga0495597_0006237 3300046542 Bacteria 6181
574 Ga0495597_0016843 3300046542 Bacteria 3447
575 Ga0495597_0025967 3300046542 Bacteria 2692
576 Ga0495597_0054533 3300046542 Bacteria 1755
577 Ga0495633_0000190 3300046558 Bacteria 79967
578 Ga0495633_0000316 3300046558 Bacteria 54818
579 Ga0495633_0000397 3300046558 Bacteria 45712
580 Ga0495633_0000446 3300046558 Bacteria 42633
581 Ga0495633_0002823 3300046558 Bacteria 11981
582 Ga0495633_0021779 3300046558 Bacteria 3200
583 Ga0495633_0028857 3300046558 Bacteria 2701
584 Ga0495633_0033108 3300046558 Bacteria 2493
585 Ga0495633_0048981 3300046558 Bacteria 1995
586 Ga0495656_0061486 3300046615 Bacteria 1640
587 Ga0495668_0000512 3300046616 Bacteria 48355
588 Ga0495668_0001601 3300046616 Bacteria 21209
589 Ga0495668_0007940 3300046616 Bacteria 6694
590 Ga0495668_0010946 3300046616 Bacteria 5461
591 Ga0495668_0022182 3300046616 Bacteria 3630
592 Ga0495611_0001119 3300046648 Bacteria 14092
593 Ga0495611_0001477 3300046648 Bacteria 11678
594 Ga0495625_0000162 3300046660 Bacteria 103961
595 Ga0495625_0001294 3300046660 Bacteria 31403
596 Ga0495625_0002544 3300046660 Bacteria 19610
597 Ga0495625_0004436 3300046660 Bacteria 13280
598 Ga0495625_0011232 3300046660 Bacteria 7323
599 Ga0495625_0018010 3300046660 Bacteria 5519
600 Ga0495625_0033878 3300046660 Bacteria 3772
601 Ga0495625_0051682 3300046660 Bacteria 2946
602 Ga0495625_0063521 3300046660 Bacteria 2607
603 Ga0495661_0000078 3300046665 Bacteria 119097
604 Ga0495661_0000138 3300046665 Bacteria 85693
605 Ga0495661_0000513 3300046665 Bacteria 40214
606 Ga0495661_0001164 3300046665 Bacteria 22955
607 Ga0495661_0003700 3300046665 Bacteria 11231
608 Ga0495661_0017049 3300046665 Bacteria 4799
609 Ga0495661_0017264 3300046665 Bacteria 4767
610 Ga0495661_0020353 3300046665 Bacteria 4334
611 Ga0495661_0058967 3300046665 Bacteria 2286
612 Ga0495588_0000391 3300046674 Bacteria 24911
613 Ga0495623_0128494 3300046679 Bacteria 1520
614 Ga0495670_0016537 3300046691 Bacteria 3626
615 Ga0495670_0030426 3300046691 Bacteria 2681
616 Ga0495670_0059391 3300046691 Bacteria 1920
617 Ga0495670_0078325 3300046691 Bacteria 1681
618 Ga0495671_0000010 3300046692 Bacteria 368641
619 Ga0495671_0000011 3300046692 Bacteria 365582
620 Ga0495671_0000013 3300046692 Bacteria 344767
621 Ga0495671_0000052 3300046692 Bacteria 133684
622 Ga0495671_0006188 3300046692 Bacteria 6944
623 Ga0495671_0006726 3300046692 Bacteria 6618
624 Ga0495671_0011811 3300046692 Bacteria 4788
625 Ga0495671_0018251 3300046692 Bacteria 3724
626 Ga0495649_0000091 3300046694 Bacteria 77817
627 Ga0495649_0000106 3300046694 Bacteria 74615
628 Ga0495649_0005407 3300046694 Bacteria 8127
629 Ga0495589_0001063 3300046794 Bacteria 16487
630 Ga0495589_0001115 3300046794 Bacteria 16012
631 Ga0495589_0001135 3300046794 Bacteria 15823
632 Ga0495589_0005638 3300046794 Bacteria 6601
633 Ga0495589_0025245 3300046794 Bacteria 3017
634 Ga0495589_0041889 3300046794 Bacteria 2283
635 Ga0495660_0000118 3300046810 Bacteria 85202
636 Ga0495660_0000920 3300046810 Bacteria 21658
637 Ga0495660_0001366 3300046810 Bacteria 16808
638 Ga0495660_0002313 3300046810 Bacteria 12218
639 Ga0495660_0009066 3300046810 Bacteria 5810
640 Ga0495660_0012438 3300046810 Bacteria 4941
641 Ga0495660_0026044 3300046810 Bacteria 3318
642 Ga0495660_0029529 3300046810 Bacteria 3092
643 Ga0495604_0084815 3300047317 Bacteria 2365
644 Ga0495636_0000127 3300047318 Bacteria 31014
645 Ga0495636_0000221 3300047318 Bacteria 22484
646 Ga0495672_0000868 3300047320 Bacteria 31821
647 Ga0495672_0001535 3300047320 Bacteria 22596
648 Ga0495672_0001946 3300047320 Bacteria 19522
649 Ga0495672_0002724 3300047320 Bacteria 15866
650 Ga0495672_0003990 3300047320 Bacteria 12347
651 Ga0495672_0018611 3300047320 Bacteria 4604
652 Ga0495672_0021254 3300047320 Bacteria 4236
653 Ga0495672_0050139 3300047320 Bacteria 2467
654 Ga0495672_0080428 3300047320 Bacteria 1817
655 Ga0495676_0064662 3300047321 Bacteria 2842
656 Ga0495683_0000108 3300047323 Bacteria 84498
657 Ga0495683_0001247 3300047323 Bacteria 17258
658 Ga0495683_0002624 3300047323 Bacteria 10750
659 Ga0495683_0012170 3300047323 Bacteria 4522
660 Ga0495687_000045 3300047443 Bacteria 211968
661 Ga0495687_000572 3300047443 Bacteria 43367
662 Ga0495687_000642 3300047443 Bacteria 40071
663 Ga0495687_001017 3300047443 Bacteria 27988
664 Ga0495687_001130 3300047443 Bacteria 25900
665 Ga0495687_009882 3300047443 Bacteria 5285
666 Ga0495687_015678 3300047443 Bacteria 3843
667 Ga0495675_0000016 3300047444 Bacteria 129732
668 Ga0495677_0000249 3300047445 Bacteria 23579
669 Ga0495677_0002252 3300047445 Bacteria 7626
670 Ga0495679_000198 3300047446 Bacteria 53238
671 Ga0495679_001113 3300047446 Bacteria 16209
672 Ga0495679_004175 3300047446 Bacteria 6740
673 Ga0495679_004666 3300047446 Bacteria 6244
674 Ga0495673_0000003 3300047469 Bacteria 1491337
675 Ga0495673_0000013 3300047469 Bacteria 612902
676 Ga0495673_0000016 3300047469 Bacteria 580643
677 Ga0495673_0000035 3300047469 Bacteria 316861
678 Ga0495673_0000078 3300047469 Bacteria 203066
679 Ga0495673_0000190 3300047469 Bacteria 97539
680 Ga0495673_0000321 3300047469 Bacteria 61858
681 Ga0495673_0001285 3300047469 Bacteria 20490
682 Ga0495673_0003373 3300047469 Bacteria 10563
683 Ga0495673_0003734 3300047469 Bacteria 9891
684 Ga0495673_0005427 3300047469 Bacteria 7708
685 Ga0495673_0019601 3300047469 Bacteria 3386
686 Ga0495673_0073541 3300047469 Bacteria 1432
687 Ga0495681_0000009 3300047470 Bacteria 205224
688 Ga0495681_0000257 3300047470 Bacteria 43264
689 Ga0495681_0001074 3300047470 Bacteria 20845
690 Ga0495681_0001750 3300047470 Bacteria 16011
691 Ga0495681_0005751 3300047470 Bacteria 8246
692 Ga0495681_0012346 3300047470 Bacteria 5025
693 Ga0495681_0036771 3300047470 Bacteria 2418
694 Ga0495684_0021654 3300047471 Bacteria 4950
695 Ga0495686_0000161 3300047472 Bacteria 126951
696 Ga0495686_0000284 3300047472 Bacteria 89023
697 Ga0495686_0000503 3300047472 Bacteria 57024
698 Ga0495686_0000633 3300047472 Bacteria 48475
699 Ga0495686_0001069 3300047472 Bacteria 32620
700 Ga0495686_0032516 3300047472 Bacteria 3376
701 Ga0495686_0052738 3300047472 Bacteria 2549
702 Ga0495602_0134294 3300048088 Bacteria 1968
703 Ga0495615_0000107 3300048090 Bacteria 22549
704 Ga0495626_0000015 3300048091 Bacteria 232238
705 Ga0495626_0000033 3300048091 Bacteria 184008
706 Ga0495626_0000963 3300048091 Bacteria 24947
707 Ga0495626_0002074 3300048091 Bacteria 14590
708 Ga0495626_0019293 3300048091 Bacteria 3411
709 Ga0495626_0034107 3300048091 Bacteria 2436
710 Ga0496101_0009417 3300048904 Bacteria 6420
711 Ga0496101_0077336 3300048904 Bacteria 2452
712 Ga0496102_0000143 3300048905 Bacteria 96813
713 Ga0496102_0000613 3300048905 Bacteria 36995
714 Ga0496102_0083762 3300048905 Bacteria 2942
715 Ga0496102_0092328 3300048905 Bacteria 2803
716 Ga0496103_0000098 3300048906 Bacteria 96109
717 Ga0496103_0000163 3300048906 Bacteria 70387
718 Ga0496103_0001372 3300048906 Bacteria 16427
719 Ga0496103_0008348 3300048906 Bacteria 6153
720 Ga0496103_0019032 3300048906 Bacteria 4123
721 Ga0496104_0003754 3300048907 Bacteria 13131
722 Ga0496104_0007054 3300048907 Bacteria 9911
723 Ga0496104_0279447 3300048907 Bacteria 1583
724 Ga0496105_0001309 3300048908 Bacteria 17421
725 Ga0496105_0005911 3300048908 Bacteria 9334
726 Ga0496105_0123836 3300048908 Bacteria 2131
727 Ga0496106_0000233 3300048909 Bacteria 38847
728 Ga0496106_0007898 3300048909 Bacteria 7864
729 Ga0496106_0030871 3300048909 Bacteria 3995
730 Ga0496107_0000019 3300048910 Bacteria 150224
731 Ga0496107_0000100 3300048910 Bacteria 41794
732 Ga0496108_0135122 3300048911 Bacteria 2121
733 Ga0496108_0146923 3300048911 Bacteria 2033
734 Ga0496109_0028123 3300048912 Bacteria 5027
735 Ga0496110_0226498 3300048913 Bacteria 1700
736 Ga0496111_0216837 3300048914 Bacteria 1422
737 Ga0496112_0000267 3300048915 Bacteria 33517
738 Ga0496113_0000031 3300048916 Bacteria 59792
739 Ga0496113_0000081 3300048916 Bacteria 42072
740 Ga0496114_0055201 3300048917 Bacteria 3313
741 Ga0496114_0055235 3300048917 Bacteria 3313
742 Ga0496115_0003823 3300048918 Bacteria 10850
743 Ga0496115_0009634 3300048918 Bacteria 7187
744 Ga0496116_0001473 3300048919 Bacteria 26338
745 Ga0496116_0008741 3300048919 Bacteria 8737
746 Ga0496116_0041734 3300048919 Bacteria 3144
747 Ga0496116_0097053 3300048919 Bacteria 1773
748 Ga0496117_0000121 3300048920 Bacteria 171532
749 Ga0496117_0005261 3300048920 Bacteria 13731
750 Ga0496117_0005816 3300048920 Bacteria 12774
751 Ga0496117_0010277 3300048920 Bacteria 8559
752 Ga0496117_0011270 3300048920 Bacteria 8022
753 Ga0496117_0020317 3300048920 Bacteria 5417
754 Ga0496117_0048689 3300048920 Bacteria 3023
755 Ga0496117_0062535 3300048920 Bacteria 2551
756 Ga0496118_0000095 3300048921 Bacteria 164850
757 Ga0496118_0003634 3300048921 Bacteria 19147
758 Ga0496118_0004347 3300048921 Bacteria 16869
759 Ga0496118_0005130 3300048921 Bacteria 15035
760 Ga0496118_0006175 3300048921 Bacteria 13276
761 Ga0496118_0007255 3300048921 Bacteria 11823
762 Ga0496118_0008390 3300048921 Bacteria 10687
763 Ga0496118_0029942 3300048921 Bacteria 4555
764 Ga0496118_0119532 3300048921 Bacteria 1722
765 Ga0496119_0012070 3300048922 Bacteria 7060
766 Ga0496119_0020493 3300048922 Bacteria 4824
767 Ga0496119_0034497 3300048922 Bacteria 3331
768 Ga0496119_0073860 3300048922 Bacteria 1988
769 Ga0496120_0007164 3300048923 Bacteria 8361
770 Ga0496121_0000067 3300048924 Bacteria 261543
771 Ga0496121_0000097 3300048924 Bacteria 201224
772 Ga0496121_0000098 3300048924 Bacteria 200516
773 Ga0496121_0000624 3300048924 Bacteria 65948
774 Ga0496121_0004401 3300048924 Bacteria 18985
775 Ga0496121_0006234 3300048924 Bacteria 14940
776 Ga0496121_0007968 3300048924 Bacteria 12653
777 Ga0496121_0029800 3300048924 Bacteria 5031
778 Ga0496122_0000092 3300048925 Bacteria 204463
779 Ga0496122_0001234 3300048925 Bacteria 43175
780 Ga0496122_0004452 3300048925 Bacteria 17372
781 Ga0496122_0004540 3300048925 Bacteria 17113
782 Ga0496122_0005467 3300048925 Bacteria 15122
783 Ga0496122_0005743 3300048925 Bacteria 14625
784 Ga0496122_0010593 3300048925 Bacteria 9468
785 Ga0496122_0012169 3300048925 Bacteria 8604
786 Ga0496122_0029147 3300048925 Bacteria 4663
787 Ga0496122_0032481 3300048925 Bacteria 4315
788 Ga0496122_0066270 3300048925 Bacteria 2611
789 Ga0496122_0070000 3300048925 Bacteria 2509
790 Ga0496123_0000028 3300048926 Bacteria 306006
791 Ga0496123_0000598 3300048926 Bacteria 61286
792 Ga0496123_0001346 3300048926 Bacteria 34633
793 Ga0496123_0002700 3300048926 Bacteria 21334
794 Ga0496123_0005386 3300048926 Bacteria 12895
795 Ga0496123_0006893 3300048926 Bacteria 10874
796 Ga0496123_0036538 3300048926 Bacteria 3482
797 Ga0496123_0042003 3300048926 Bacteria 3162
798 Ga0496123_0055407 3300048926 Bacteria 2601
799 Ga0496123_0095090 3300048926 Bacteria 1754
800 Ga0496124_0000119 3300048927 Bacteria 163996
801 Ga0496124_0000812 3300048927 Bacteria 50806
802 Ga0496124_0000873 3300048927 Bacteria 49224
803 Ga0496124_0018216 3300048927 Bacteria 6586
804 Ga0496124_0018404 3300048927 Bacteria 6541
805 Ga0496124_0019199 3300048927 Bacteria 6373
806 Ga0496124_0020785 3300048927 Bacteria 6058
807 Ga0496124_0045554 3300048927 Bacteria 3759
808 Ga0496124_0051057 3300048927 Bacteria 3520
809 Ga0496124_0063227 3300048927 Bacteria 3093
810 Ga0496124_0077237 3300048927 Bacteria 2747
811 Ga0496124_0125839 3300048927 Bacteria 2042
812 Ga0496125_0000038 3300048928 Bacteria 328120
813 Ga0496125_0001250 3300048928 Bacteria 37917
814 Ga0496125_0001903 3300048928 Bacteria 28565
815 Ga0496125_0005821 3300048928 Bacteria 13544
816 Ga0496125_0007696 3300048928 Bacteria 11418
817 Ga0496125_0020652 3300048928 Bacteria 6176
818 Ga0496125_0071493 3300048928 Bacteria 2709
819 Ga0496125_0100470 3300048928 Bacteria 2132
820 Ga0496125_0104213 3300048928 Bacteria 2078
821 Ga0496126_0000688 3300048929 Bacteria 61933
822 Ga0496126_0002234 3300048929 Bacteria 26775
823 Ga0496126_0004349 3300048929 Bacteria 16993
824 Ga0496126_0006740 3300048929 Bacteria 12749
825 Ga0496126_0022348 3300048929 Bacteria 6157
826 Ga0496126_0025214 3300048929 Bacteria 5725
827 Ga0496126_0084425 3300048929 Bacteria 2801
828 Ga0496126_0136434 3300048929 Bacteria 2116
829 Ga0495678_000032 3300049459 Bacteria 212537
830 Ga0495678_000081 3300049459 Bacteria 118700
831 Ga0495678_000583 3300049459 Bacteria 34467
832 Ga0495678_001014 3300049459 Bacteria 24007
833 Ga0495678_002176 3300049459 Bacteria 13770
834 Ga0495678_003272 3300049459 Bacteria 10125
835 Ga0495678_007623 3300049459 Bacteria 5585
836 Ga0495678_008247 3300049459 Bacteria 5280
837 Ga0495678_026617 3300049459 Bacteria 2465
838 Ga0495682_0000013 3300049460 Bacteria 259670
839 Ga0495682_0000150 3300049460 Bacteria 59591
840 Ga0495682_0000702 3300049460 Bacteria 21923
841 Ga0495682_0003894 3300049460 Bacteria 6522
842 Ga0495682_0007634 3300049460 Bacteria 4292
843 Ga0501249_000141 3300049679 Bacteria 22514
844 Ga0501249_000857 3300049679 Bacteria 6739
845 Ga0501257_013040 3300049686 Bacteria 1904
846 Ga0501266_000087 3300049763 Bacteria 11514
847 Ga0501269_000169 3300049766 Bacteria 19940
848 nmdc:mga03683_2471_c1 3300050489 Bacteria 3788
849 nmdc:mga03n38_2748_c1 3300050490 Bacteria 5515
850 nmdc:mga0k408_37235_c1 3300050493 Bacteria 2792
851 nmdc:mga06z11_8_c1 3300050494 Bacteria 115826
852 nmdc:mga04h51_8_c1 3300050495 Bacteria 107557
853 nmdc:mga07m45_13206_c1 3300050496 Bacteria 4376
854 nmdc:mga07m45_26754_c1 3300050496 Bacteria 3171
855 nmdc:mga0sz30_1693_c1 3300050516 Bacteria 7833
856 Ga0500578_0000234 3300053086 Bacteria 68455
857 Ga0500643_000503 3300053087 Bacteria 27831
858 Ga0500643_005015 3300053087 Bacteria 5800
859 Ga0500644_0000189 3300053088 Bacteria 38264
860 Ga0500647_0047334 3300053091 Bacteria 2067
861 Ga0500555_000799 3300053103 Bacteria 11353
862 Ga0500556_0001301 3300053104 Bacteria 11228
863 Ga0500594_0000022 3300053118 Bacteria 54062
864 Ga0500607_000035 3300053121 Bacteria 87430
865 Ga0500607_000058 3300053121 Bacteria 77958
866 Ga0500608_000076 3300053122 Bacteria 42438
867 Ga0500608_000400 3300053122 Bacteria 16661
868 Ga0500618_000066 3300053125 Bacteria 89937
869 Ga0500618_000430 3300053125 Bacteria 27901
870 Ga0500658_0013135 3300053134 Bacteria 3057
871 Ga0500559_0000058 3300053136 Bacteria 88268
872 Ga0500559_0001018 3300053136 Bacteria 17198
873 Ga0500559_0001082 3300053136 Bacteria 16527
874 Ga0500559_0002704 3300053136 Bacteria 9010
875 Ga0500559_0003584 3300053136 Bacteria 7594
876 Ga0500559_0005739 3300053136 Bacteria 5670
877 Ga0500559_0024248 3300053136 Bacteria 2580
878 Ga0500564_000059 3300053138 Bacteria 29435
879 Ga0500573_0000053 3300053140 Bacteria 92344
880 Ga0500573_0010835 3300053140 Bacteria 5093
881 Ga0500586_001720 3300053145 Bacteria 4727
882 Ga0500604_0005543 3300053151 Bacteria 3332
883 Ga0500622_0000047 3300053156 Bacteria 149427
884 Ga0500622_0005400 3300053156 Bacteria 7686
885 Ga0500622_0028425 3300053156 Bacteria 2944
886 Ga0500624_000017 3300053157 Bacteria 132088
887 Ga0500627_0001133 3300053158 Bacteria 7295
888 Ga0500627_0008343 3300053158 Bacteria 3674
889 Ga0500634_0022859 3300053161 Bacteria 3395
890 Ga0500567_001470 3300053723 Bacteria 9527
891 Ga0500611_000783 3300053727 Bacteria 3290
892 Ga0500625_000001 3300053729 Bacteria 395993
893 Ga0500645_000001 3300053730 Bacteria 455558
894 Ga0500645_000196 3300053730 Bacteria 47064
895 Ga0500645_001940 3300053730 Bacteria 9809
896 Ga0500645_004520 3300053730 Bacteria 5309
897 Ga0500645_006527 3300053730 Bacteria 4149

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10005639 Ga0207641_100056394 377
2 3300009148 Ga0105243_10000047 Ga0105243_1000004733 403
3 3300009553 Ga0105249_10011862 Ga0105249_100118622 403
4 3300025935 Ga0207709_10000058 Ga0207709_10000058134 403
5 3300025961 Ga0207712_10013582 Ga0207712_100135822 403
6 3300048920 Ga0496117_0010277 Ga0496117_0010277_3119_4447 403
7 3300048924 Ga0496121_0000097 Ga0496121_0000097_169596_170924 403
8 3300048925 Ga0496122_0004540 Ga0496122_0004540_531_1859 403
9 3300048926 Ga0496123_0002700 Ga0496123_0002700_489_1817 403
10 3300002737 JGI25162J39368_1000448 JGI25162J39368_100044811 410
11 3300002771 JGI25163J39215_1000169 JGI25163J39215_10001696 410
12 3300002772 JGI25164J39214_1000306 JGI25164J39214_100030611 410
13 3300003214 JGI25165J46597_1000121 JGI25165J46597_100012118 410
14 3300025207 Ga0209760_100185 Ga0209760_10018518 410
15 3300025231 Ga0207427_100014 Ga0207427_100014147 410
16 3300025233 Ga0209437_100016 Ga0209437_100016490 410
17 3300025261 Ga0209233_1000036 Ga0209233_1000036147 410
18 3300047446 Ga0495679_004175 Ga0495679_004175_3423_4670 415
19 3300003323 rootH1_10266568 rootH1_102665682 417
20 3300028558 Ga0265326_10018769 Ga0265326_100187692 420
21 3300048090 Ga0495615_0000107 Ga0495615_0000107_13560_14894 423
22 3300048925 Ga0496122_0005743 Ga0496122_0005743_2010_3344 423
23 3300048926 Ga0496123_0036538 Ga0496123_0036538_284_1618 423
24 3300039447 Ga0436361_0863053 Ga0436361_0863053_897_2222 425
25 3300046457 Ga0495590_0003169 Ga0495590_0003169_3677_5047 425
26 3300046519 Ga0495632_0000207 Ga0495632_0000207_41495_42865 425
27 3300046520 Ga0495637_0002671 Ga0495637_0002671_3872_5242 425
28 3300046522 Ga0495643_0002236 Ga0495643_0002236_10856_12226 425
29 3300046528 Ga0495642_0000114 Ga0495642_0000114_39350_40720 425
30 3300046538 Ga0495609_0000111 Ga0495609_0000111_65696_67066 425
31 3300046692 Ga0495671_0011811 Ga0495671_0011811_269_1582 425
32 3300046694 Ga0495649_0000091 Ga0495649_0000091_10863_12233 425
33 3300046794 Ga0495589_0041889 Ga0495589_0041889_836_2206 425
34 3300047318 Ga0495636_0000127 Ga0495636_0000127_12960_14330 425
35 3300047320 Ga0495672_0002724 Ga0495672_0002724_1537_2907 425
36 3300047321 Ga0495676_0064662 Ga0495676_0064662_558_1871 425
37 3300047443 Ga0495687_015678 Ga0495687_015678_173_1543 425
38 3300049459 Ga0495678_002176 Ga0495678_002176_1538_2908 425
39 3300049460 Ga0495682_0000702 Ga0495682_0000702_12275_13645 425
40 3300026121 Ga0207683_10058640 Ga0207683_100586403 426
41 3300031507 Ga0307509_10008863 Ga0307509_1000886313 426
42 3300031616 Ga0307508_10000204 Ga0307508_100002043 426
43 3300033180 Ga0307510_10095588 Ga0307510_100955882 426
44 3300046542 Ga0495597_0025967 Ga0495597_0025967_54_1388 426
45 3300047443 Ga0495687_000642 Ga0495687_000642_23564_24898 426
46 3300048927 Ga0496124_0077237 Ga0496124_0077237_967_2289 426
47 3300005841 Ga0068863_100033449 Ga0068863_1000334493 427
48 3300005843 Ga0068860_100178234 Ga0068860_1001782341 427
49 3300013306 Ga0163162_10009185 Ga0163162_100091857 427
50 3300028794 Ga0307515_10068578 Ga0307515_100685785 427
51 3300047320 Ga0495672_0021254 Ga0495672_0021254_2891_4213 427
52 3300048904 Ga0496101_0077336 Ga0496101_0077336_988_2301 427
53 3300048905 Ga0496102_0083762 Ga0496102_0083762_1317_2630 427
54 3300048906 Ga0496103_0019032 Ga0496103_0019032_1153_2466 427
55 3300048907 Ga0496104_0003754 Ga0496104_0003754_5036_6349 427
56 3300048908 Ga0496105_0005911 Ga0496105_0005911_3552_4865 427
57 3300048909 Ga0496106_0000233 Ga0496106_0000233_15702_17015 427
58 3300048910 Ga0496107_0000100 Ga0496107_0000100_25951_27264 427
59 3300048912 Ga0496109_0028123 Ga0496109_0028123_184_1497 427
60 3300048913 Ga0496110_0226498 Ga0496110_0226498_367_1680 427
61 3300048915 Ga0496112_0000267 Ga0496112_0000267_23852_25165 427
62 3300048916 Ga0496113_0000031 Ga0496113_0000031_8448_9761 427
63 iso_pu_bacteria 2511231035 2511433098 427
64 3300002459 JGI24751J29686_10001447 JGI24751J29686_100014472 428
65 3300005295 Ga0065707_10001308 Ga0065707_100013083 428
66 3300005335 Ga0070666_10081034 Ga0070666_100810342 428
67 3300005347 Ga0070668_100000045 Ga0070668_10000004517 428
68 3300005355 Ga0070671_100002400 Ga0070671_1000024007 428
69 3300005367 Ga0070667_100000009 Ga0070667_100000009206 428
70 3300005842 Ga0068858_100001386 Ga0068858_10000138627 428
71 3300005843 Ga0068860_100000193 Ga0068860_10000019342 428
72 3300005844 Ga0068862_100000031 Ga0068862_10000003189 428
73 3300006177 Ga0075362_10023032 Ga0075362_100230323 428
74 3300006186 Ga0075369_10001433 Ga0075369_100014336 428
75 3300006353 Ga0075370_10008619 Ga0075370_100086194 428
76 3300006353 Ga0075370_10081181 Ga0075370_100811812 428
77 3300014968 Ga0157379_10003646 Ga0157379_100036464 428
78 3300025925 Ga0207650_10001354 Ga0207650_1000135412 428
79 3300025931 Ga0207644_10000084 Ga0207644_1000008426 428
80 3300025972 Ga0207668_10000031 Ga0207668_1000003112 428
81 3300025986 Ga0207658_10000009 Ga0207658_1000000960 428
82 3300025986 Ga0207658_10000173 Ga0207658_1000017326 428
83 3300026035 Ga0207703_10005397 Ga0207703_1000539711 428
84 3300026088 Ga0207641_10004419 Ga0207641_100044193 428
85 3300026118 Ga0207675_100063072 Ga0207675_1000630722 428
86 3300028380 Ga0268265_10000118 Ga0268265_1000011864 428
87 3300028381 Ga0268264_10000001 Ga0268264_1000000160 428
88 3300035691 Ga0373931_0027539 Ga0373931_0027539_150_1487 428
89 3300050489 nmdc:mga03683_2471_c1 nmdc:mga03683_2471_c1_1561_2886 428
90 3300050496 nmdc:mga07m45_26754_c1 nmdc:mga07m45_26754_c1_1647_2972 428
91 3300050516 nmdc:mga0sz30_1693_c1 nmdc:mga0sz30_1693_c1_2156_3481 428
92 3300046460 Ga0495638_0000399 Ga0495638_0000399_7862_9202 429
93 iso_pu_bacteria 8054795415 8054797880 429
94 3300005937 Ga0081455_10000872 Ga0081455_1000087211 430
95 3300048917 Ga0496114_0055235 Ga0496114_0055235_1304_2617 430
96 3300048925 Ga0496122_0029147 Ga0496122_0029147_384_1697 430
97 3300048926 Ga0496123_0042003 Ga0496123_0042003_1523_2836 430
98 3300048928 Ga0496125_0001903 Ga0496125_0001903_10962_12275 430
99 3300005355 Ga0070671_100000003 Ga0070671_10000000372 431
100 3300005367 Ga0070667_100000336 Ga0070667_10000033631 431
101 3300005367 Ga0070667_100040423 Ga0070667_1000404231 431
102 3300005841 Ga0068863_100080560 Ga0068863_1000805602 431
103 3300005843 Ga0068860_100011953 Ga0068860_1000119538 431
104 3300009177 Ga0105248_10188965 Ga0105248_101889652 431
105 3300014968 Ga0157379_10053777 Ga0157379_100537772 431
106 3300025903 Ga0207680_10001712 Ga0207680_100017122 431
107 3300025931 Ga0207644_10000004 Ga0207644_10000004394 431
108 3300025986 Ga0207658_10004604 Ga0207658_100046042 431
109 3300026088 Ga0207641_10016352 Ga0207641_100163524 431
110 3300028381 Ga0268264_10059509 Ga0268264_100595092 431
111 3300048904 Ga0496101_0009417 Ga0496101_0009417_439_1785 431
112 3300048905 Ga0496102_0092328 Ga0496102_0092328_182_1528 431
113 3300048907 Ga0496104_0007054 Ga0496104_0007054_3440_4786 431
114 3300048909 Ga0496106_0030871 Ga0496106_0030871_1203_2549 431
115 3300048911 Ga0496108_0135122 Ga0496108_0135122_137_1483 431
116 3300048918 Ga0496115_0003823 Ga0496115_0003823_1161_2507 431
117 3300005937 Ga0081455_10007504 Ga0081455_100075043 432
118 iso_pu_bacteria 2844315083 2844322842 433
119 iso_pu_bacteria 2903727486 2903734642 433
120 iso_pu_bacteria 2906602504 2906605047 433
121 iso_pu_bacteria 3005594810 3005602563 433
122 iso_pu_bacteria 3005718088 3005726033 433
123 iso_pu_bacteria 8056967851 8056976496 433
124 3300046520 Ga0495637_0004462 Ga0495637_0004462_1775_3079 434
125 3300047320 Ga0495672_0001946 Ga0495672_0001946_9366_10721 434
126 3300047323 Ga0495683_0012170 Ga0495683_0012170_2219_3532 434
127 3300053104 Ga0500556_0001301 Ga0500556_0001301_3868_5172 434
128 3300053727 Ga0500611_000783 Ga0500611_000783_801_2105 434
129 3300049763 Ga0501266_000087 Ga0501266_000087_10030_11364 435
130 3300053140 Ga0500573_0000053 Ga0500573_0000053_1489_2808 435
131 iso_pu_bacteria 8056533031 8056536957 435
132 3300048929 Ga0496126_0136434 Ga0496126_0136434_747_2096 436
133 iso_pu_bacteria 2675903420 2677899125 436
134 iso_pu_bacteria 2980182181 2980184152 436
135 3300015262 Ga0182007_10000682 Ga0182007_1000068211 437
136 3300035695 Ga0373927_0042026 Ga0373927_0042026_1065_2495 437
137 3300042013 Ga0439456_002535 Ga0439456_002535_1918_3237 437
138 3300048924 Ga0496121_0029800 Ga0496121_0029800_1383_2699 437
139 3300006195 Ga0075366_10069282 Ga0075366_100692822 438
140 3300025299 Ga0209256_1006602 Ga0209256_10066022 438
141 3300025913 Ga0207695_10165322 Ga0207695_101653221 438
142 3300046452 Ga0495617_011875 Ga0495617_011875_979_2301 438
143 3300046457 Ga0495590_0030594 Ga0495590_0030594_211_1533 438
144 3300046458 Ga0495591_000088 Ga0495591_000088_30828_32150 438
145 3300046471 Ga0495650_0003742 Ga0495650_0003742_7931_9253 438
146 3300046491 Ga0495584_0018535 Ga0495584_0018535_682_2004 438
147 3300046500 Ga0495596_0000061 Ga0495596_0000061_7550_8872 438
148 3300046513 Ga0495616_0034791 Ga0495616_0034791_222_1544 438
149 3300046520 Ga0495637_0001450 Ga0495637_0001450_8067_9386 438
150 3300046520 Ga0495637_0001481 Ga0495637_0001481_951_2273 438
151 3300046522 Ga0495643_0018408 Ga0495643_0018408_2385_3707 438
152 3300046523 Ga0495644_0019907 Ga0495644_0019907_142_1464 438
153 3300046530 Ga0495654_0001637 Ga0495654_0001637_7208_8530 438
154 3300046530 Ga0495654_0014271 Ga0495654_0014271_1554_2873 438
155 3300046542 Ga0495597_0006237 Ga0495597_0006237_682_2004 438
156 3300046616 Ga0495668_0001601 Ga0495668_0001601_7550_8872 438
157 3300046660 Ga0495625_0018010 Ga0495625_0018010_939_2261 438
158 3300046665 Ga0495661_0017264 Ga0495661_0017264_187_1509 438
159 3300046674 Ga0495588_0000391 Ga0495588_0000391_15818_17137 438
160 3300046794 Ga0495589_0005638 Ga0495589_0005638_1919_3241 438
161 3300047320 Ga0495672_0050139 Ga0495672_0050139_614_1936 438
162 3300047469 Ga0495673_0019601 Ga0495673_0019601_1383_2705 438
163 3300047470 Ga0495681_0000257 Ga0495681_0000257_22014_23336 438
164 3300048091 Ga0495626_0000033 Ga0495626_0000033_57638_58960 438
165 3300053156 Ga0500622_0005400 Ga0500622_0005400_6304_7638 438
166 iso_pu_bacteria 2510917020 2511120360 438
167 iso_pu_bacteria 2585428106 2587917624 438
168 iso_pu_bacteria 2643221552 2643778390 438
169 iso_pu_bacteria 2643221583 2643924771 438
170 iso_pu_bacteria 2643221584 2643927350 438
171 iso_pu_bacteria 2738541297 2738829803 438
172 iso_pu_bacteria 2738541357 2739153599 438
173 iso_pu_bacteria 2738543003 2739195519 438
174 iso_pu_bacteria 2738543026 2739321995 438
175 iso_pu_bacteria 2738543029 2739340236 438
176 iso_pu_bacteria 2791355048 2792462396 438
177 iso_pu_bacteria 2821131069 2821131760 438
178 iso_pu_bacteria 2843744320 2843748728 438
179 iso_pu_bacteria 2849560528 2849565298 438
180 iso_pu_bacteria 2851153111 2851156530 438
181 iso_pu_bacteria 2857504554 2857507762 438
182 iso_pu_bacteria 2898329390 2898330200 438
183 iso_pu_bacteria 2904113452 2904115983 438
184 3300005347 Ga0070668_100008385 Ga0070668_1000083854 439
185 3300005347 Ga0070668_100021709 Ga0070668_1000217094 439
186 3300005347 Ga0070668_100022840 Ga0070668_1000228404 439
187 3300005617 Ga0068859_100021404 Ga0068859_1000214043 439
188 3300005618 Ga0068864_100041916 Ga0068864_1000419164 439
189 3300005842 Ga0068858_100050201 Ga0068858_1000502013 439
190 3300005843 Ga0068860_100000051 Ga0068860_10000005173 439
191 3300005843 Ga0068860_100040398 Ga0068860_1000403984 439
192 3300005844 Ga0068862_100011846 Ga0068862_1000118463 439
193 3300006931 Ga0097620_100021404 Ga0097620_1000214045 439
194 3300009098 Ga0105245_10000721 Ga0105245_1000072116 439
195 3300009553 Ga0105249_10113894 Ga0105249_101138942 439
196 3300025927 Ga0207687_10000467 Ga0207687_1000046715 439
197 3300025972 Ga0207668_10003946 Ga0207668_100039464 439
198 3300025972 Ga0207668_10027971 Ga0207668_100279712 439
199 3300025972 Ga0207668_10030627 Ga0207668_100306272 439
200 3300025986 Ga0207658_10006715 Ga0207658_100067155 439
201 3300026118 Ga0207675_100039006 Ga0207675_1000390065 439
202 3300028380 Ga0268265_10002558 Ga0268265_100025588 439
203 3300028381 Ga0268264_10000021 Ga0268264_10000021366 439
204 3300046452 Ga0495617_000003 Ga0495617_000003_165181_166509 439
205 3300046463 Ga0495653_0000002 Ga0495653_0000002_345817_347145 439
206 3300046471 Ga0495650_0002248 Ga0495650_0002248_9290_10618 439
207 3300046471 Ga0495650_0012276 Ga0495650_0012276_2516_3844 439
208 3300046474 Ga0495605_0000068 Ga0495605_0000068_41181_42509 439
209 3300046492 Ga0495585_0006735 Ga0495585_0006735_800_2128 439
210 3300046512 Ga0495610_0000003 Ga0495610_0000003_849979_851307 439
211 3300046517 Ga0495630_0000058 Ga0495630_0000058_6973_8301 439
212 3300046520 Ga0495637_0000214 Ga0495637_0000214_10015_11343 439
213 3300046524 Ga0495648_0001378 Ga0495648_0001378_6215_7543 439
214 3300046524 Ga0495648_0008114 Ga0495648_0008114_839_2167 439
215 3300046530 Ga0495654_0000292 Ga0495654_0000292_33746_35074 439
216 3300046616 Ga0495668_0000512 Ga0495668_0000512_24947_26275 439
217 3300046660 Ga0495625_0051682 Ga0495625_0051682_911_2239 439
218 3300046665 Ga0495661_0001164 Ga0495661_0001164_2274_3602 439
219 3300046665 Ga0495661_0017049 Ga0495661_0017049_2658_3986 439
220 3300046692 Ga0495671_0000010 Ga0495671_0000010_103168_104496 439
221 3300046810 Ga0495660_0009066 Ga0495660_0009066_1561_2889 439
222 3300047446 Ga0495679_004666 Ga0495679_004666_803_2131 439
223 3300047469 Ga0495673_0000003 Ga0495673_0000003_1055551_1056879 439
224 3300047469 Ga0495673_0000016 Ga0495673_0000016_342382_343710 439
225 3300047472 Ga0495686_0000503 Ga0495686_0000503_50217_51584 439
226 3300048088 Ga0495602_0134294 Ga0495602_0134294_145_1473 439
227 3300048924 Ga0496121_0000098 Ga0496121_0000098_119830_121194 439
228 3300048924 Ga0496121_0007968 Ga0496121_0007968_1296_2624 439
229 3300048925 Ga0496122_0004452 Ga0496122_0004452_7982_9310 439
230 3300048926 Ga0496123_0005386 Ga0496123_0005386_957_2285 439
231 3300048929 Ga0496126_0022348 Ga0496126_0022348_871_2199 439
232 3300049686 Ga0501257_013040 Ga0501257_013040_413_1744 439
233 3300053145 Ga0500586_001720 Ga0500586_001720_2398_3726 439
234 iso_pu_bacteria 2599185354 2600200643 439
235 iso_pu_bacteria 2840764183 2840764384 439
236 iso_pu_bacteria 2874168670 2874173005 439
237 iso_pu_bacteria 2904424332 2904425783 439
238 iso_pu_bacteria 2919138771 2919141860 439
239 iso_pu_bacteria 8054302542 8054304600 439
240 iso_pu_bacteria 8057473075 8057473980 439
241 3300003751 Ga0055538_1001047 Ga0055538_10010475 440
242 3300003752 Ga0055539_1000990 Ga0055539_10009905 440
243 3300003756 Ga0055533_1001472 Ga0055533_10014725 440
244 3300003758 Ga0055532_1001544 Ga0055532_10015445 440
245 3300003759 Ga0055525_1001160 Ga0055525_10011605 440
246 3300003781 Ga0055536_1000027 Ga0055536_100002763 440
247 3300003791 Ga0055530_10000079 Ga0055530_1000007963 440
248 3300003841 Ga0055541_1001087 Ga0055541_10010875 440
249 3300005331 Ga0070670_100005599 Ga0070670_1000055994 440
250 3300009036 Ga0105244_10002527 Ga0105244_1000252712 440
251 3300013308 Ga0157375_10000819 Ga0157375_100008195 440
252 3300025206 Ga0209435_101060 Ga0209435_1010603 440
253 3300025224 Ga0209784_100065 Ga0209784_100065103 440
254 3300025225 Ga0209566_100081 Ga0209566_100081103 440
255 3300025226 Ga0209674_100101 Ga0209674_100101103 440
256 3300025229 Ga0209147_100152 Ga0209147_10015248 440
257 3300025230 Ga0209563_100098 Ga0209563_100098103 440
258 3300025233 Ga0209437_104459 Ga0209437_1044591 440
259 3300025242 Ga0209258_101731 Ga0209258_1017315 440
260 3300025246 Ga0209646_1001452 Ga0209646_10014521 440
261 3300025253 Ga0209677_100059 Ga0209677_100059103 440
262 3300025292 Ga0209676_1000087 Ga0209676_1000087159 440
263 3300025298 Ga0209050_1000083 Ga0209050_1000083159 440
264 3300025303 Ga0209051_1008204 Ga0209051_10082042 440
265 3300025304 Ga0209257_1002683 Ga0209257_10026835 440
266 3300025728 Ga0207655_1002757 Ga0207655_10027573 440
267 3300025925 Ga0207650_10000384 Ga0207650_1000038418 440
268 3300046453 Ga0495627_000334 Ga0495627_000334_29051_30382 440
269 3300046507 Ga0495606_0054372 Ga0495606_0054372_1172_2518 440
270 3300046512 Ga0495610_0001222 Ga0495610_0001222_1755_3086 440
271 3300046512 Ga0495610_0009414 Ga0495610_0009414_700_2034 440
272 3300046512 Ga0495610_0032252 Ga0495610_0032252_1143_2486 440
273 3300046513 Ga0495616_0027272 Ga0495616_0027272_1182_2516 440
274 3300046515 Ga0495620_0022451 Ga0495620_0022451_1455_2807 440
275 3300046516 Ga0495628_0036011 Ga0495628_0036011_1406_2737 440
276 3300046518 Ga0495631_0033461 Ga0495631_0033461_623_1957 440
277 3300046524 Ga0495648_0000239 Ga0495648_0000239_27483_28829 440
278 3300046616 Ga0495668_0010946 Ga0495668_0010946_2567_3913 440
279 3300046616 Ga0495668_0022182 Ga0495668_0022182_376_1722 440
280 3300047469 Ga0495673_0000078 Ga0495673_0000078_87870_89201 440
281 3300047469 Ga0495673_0000321 Ga0495673_0000321_27512_28858 440
282 3300047472 Ga0495686_0000284 Ga0495686_0000284_36875_38209 440
283 3300047472 Ga0495686_0032516 Ga0495686_0032516_264_1595 440
284 3300048925 Ga0496122_0012169 Ga0496122_0012169_6100_7578 440
285 3300048927 Ga0496124_0020785 Ga0496124_0020785_4317_5663 440
286 3300048929 Ga0496126_0002234 Ga0496126_0002234_23424_24758 440
287 3300053086 Ga0500578_0000234 Ga0500578_0000234_41759_43093 440
288 3300053088 Ga0500644_0000189 Ga0500644_0000189_27375_28721 440
289 3300053118 Ga0500594_0000022 Ga0500594_0000022_17911_19245 440
290 3300053122 Ga0500608_000076 Ga0500608_000076_17335_18681 440
291 3300053136 Ga0500559_0003584 Ga0500559_0003584_525_1871 440
292 3300053138 Ga0500564_000059 Ga0500564_000059_11765_13111 440
293 3300053156 Ga0500622_0000047 Ga0500622_0000047_119572_120906 440
294 iso_pu_bacteria 2508501114 2509074668 440
295 iso_pu_bacteria 2582581279 2585149462 440
296 iso_pu_bacteria 2585427531 2585563968 440
297 iso_pu_bacteria 2775507049 2776914038 440
298 iso_pu_bacteria 2909399089 2909401126 440
299 iso_pu_bacteria 2919709256 2919710837 440
300 iso_pu_bacteria 2928531327 2928533758 440
301 iso_pu_bacteria 2928959182 2928961966 440
302 iso_pu_bacteria 2937836603 2937838510 440
303 iso_pu_bacteria 3007872151 3007873812 440
304 iso_pu_bacteria 8056137416 8056139505 440
305 3300005339 Ga0070660_100022198 Ga0070660_1000221983 441
306 3300005539 Ga0068853_100000323 Ga0068853_10000032320 441
307 3300009036 Ga0105244_10009145 Ga0105244_100091454 441
308 3300025728 Ga0207655_1032477 Ga0207655_10324772 441
309 3300025919 Ga0207657_10063173 Ga0207657_100631733 441
310 3300026041 Ga0207639_10001573 Ga0207639_1000157314 441
311 3300030500 Ga0268256_1019716 Ga0268256_10197162 441
312 3300030744 Ga0316181_1279899 Ga0316181_12798993 441
313 3300031507 Ga0307509_10185091 Ga0307509_101850912 441
314 3300044765 Ga0466970_0027931 Ga0466970_0027931_446_1780 441
315 3300046452 Ga0495617_000344 Ga0495617_000344_12396_13730 441
316 3300046452 Ga0495617_001200 Ga0495617_001200_2646_3983 441
317 3300046453 Ga0495627_000008 Ga0495627_000008_99795_101144 441
318 3300046453 Ga0495627_000056 Ga0495627_000056_39770_41104 441
319 3300046491 Ga0495584_0000027 Ga0495584_0000027_97176_98510 441
320 3300046500 Ga0495596_0000006 Ga0495596_0000006_128579_129913 441
321 3300046500 Ga0495596_0001000 Ga0495596_0001000_6690_8024 441
322 3300046501 Ga0495607_0029544 Ga0495607_0029544_624_1958 441
323 3300046506 Ga0495583_0001285 Ga0495583_0001285_5922_7256 441
324 3300046507 Ga0495606_0000165 Ga0495606_0000165_4974_6314 441
325 3300046507 Ga0495606_0000545 Ga0495606_0000545_24311_25648 441
326 3300046512 Ga0495610_0000107 Ga0495610_0000107_7360_8694 441
327 3300046512 Ga0495610_0006938 Ga0495610_0006938_4472_5806 441
328 3300046512 Ga0495610_0017959 Ga0495610_0017959_531_1871 441
329 3300046513 Ga0495616_0000372 Ga0495616_0000372_32677_34011 441
330 3300046518 Ga0495631_0000372 Ga0495631_0000372_8502_9836 441
331 3300046519 Ga0495632_0013021 Ga0495632_0013021_1415_2749 441
332 3300046519 Ga0495632_0017003 Ga0495632_0017003_1056_2387 441
333 3300046520 Ga0495637_0007700 Ga0495637_0007700_3633_4970 441
334 3300046522 Ga0495643_0000321 Ga0495643_0000321_9860_11194 441
335 3300046523 Ga0495644_0000119 Ga0495644_0000119_32650_33984 441
336 3300046530 Ga0495654_0023808 Ga0495654_0023808_540_1871 441
337 3300046538 Ga0495609_0000340 Ga0495609_0000340_31005_32354 441
338 3300046538 Ga0495609_0008130 Ga0495609_0008130_3182_4516 441
339 3300046558 Ga0495633_0000446 Ga0495633_0000446_24297_25631 441
340 3300046558 Ga0495633_0028857 Ga0495633_0028857_1242_2582 441
341 3300046615 Ga0495656_0061486 Ga0495656_0061486_232_1566 441
342 3300046648 Ga0495611_0001477 Ga0495611_0001477_6575_7909 441
343 3300046660 Ga0495625_0011232 Ga0495625_0011232_30_1370 441
344 3300046691 Ga0495670_0016537 Ga0495670_0016537_1225_2559 441
345 3300046692 Ga0495671_0006188 Ga0495671_0006188_5281_6615 441
346 3300046692 Ga0495671_0018251 Ga0495671_0018251_1043_2377 441
347 3300046810 Ga0495660_0000118 Ga0495660_0000118_41450_42799 441
348 3300046810 Ga0495660_0001366 Ga0495660_0001366_12403_13752 441
349 3300047320 Ga0495672_0000868 Ga0495672_0000868_21769_23103 441
350 3300047320 Ga0495672_0018611 Ga0495672_0018611_2822_4156 441
351 3300047445 Ga0495677_0000249 Ga0495677_0000249_16377_17711 441
352 3300047469 Ga0495673_0000035 Ga0495673_0000035_295663_297000 441
353 3300047470 Ga0495681_0001750 Ga0495681_0001750_6013_7362 441
354 3300048091 Ga0495626_0000963 Ga0495626_0000963_22007_23341 441
355 3300048906 Ga0496103_0001372 Ga0496103_0001372_13225_14562 441
356 3300048927 Ga0496124_0018404 Ga0496124_0018404_4427_5776 441
357 3300049459 Ga0495678_000032 Ga0495678_000032_184609_185958 441
358 3300049460 Ga0495682_0000013 Ga0495682_0000013_151572_152906 441
359 3300049460 Ga0495682_0007634 Ga0495682_0007634_2930_4264 441
360 3300049679 Ga0501249_000857 Ga0501249_000857_679_2019 441
361 3300049766 Ga0501269_000169 Ga0501269_000169_17633_18973 441
362 3300053091 Ga0500647_0047334 Ga0500647_0047334_456_1790 441
363 3300053122 Ga0500608_000400 Ga0500608_000400_474_1808 441
364 3300053125 Ga0500618_000430 Ga0500618_000430_24077_25411 441
365 3300053723 Ga0500567_001470 Ga0500567_001470_6700_8034 441
366 3300053729 Ga0500625_000001 Ga0500625_000001_247134_248468 441
367 3300053730 Ga0500645_000001 Ga0500645_000001_265211_266542 441
368 iso_pu_bacteria 2512564014 2512642368 441
369 iso_pu_bacteria 2582581280 2585153315 441
370 iso_pu_bacteria 2582581293 2585197004 441
371 iso_pu_bacteria 2643221598 2644001321 441
372 iso_pu_bacteria 2738543012 2739246375 441
373 iso_pu_bacteria 2818991435 2819537359 441
374 iso_pu_bacteria 2818991454 2819646579 441
375 iso_pu_bacteria 2857553236 2857555982 441
376 3300005289 Ga0065704_10082902 Ga0065704_100829023 442
377 3300005289 Ga0065704_10085666 Ga0065704_100856662 442
378 3300005337 Ga0070682_100048039 Ga0070682_1000480392 442
379 3300005347 Ga0070668_100037615 Ga0070668_1000376152 442
380 3300005353 Ga0070669_100005542 Ga0070669_1000055421 442
381 3300005355 Ga0070671_100196385 Ga0070671_1001963851 442
382 3300005543 Ga0070672_100024078 Ga0070672_1000240783 442
383 3300005548 Ga0070665_100005929 Ga0070665_1000059299 442
384 3300005843 Ga0068860_100008197 Ga0068860_1000081972 442
385 3300009177 Ga0105248_10068301 Ga0105248_100683012 442
386 3300009177 Ga0105248_10111527 Ga0105248_101115273 442
387 3300009177 Ga0105248_10150369 Ga0105248_101503692 442
388 3300009545 Ga0105237_10020144 Ga0105237_100201444 442
389 3300009553 Ga0105249_10191623 Ga0105249_101916232 442
390 3300017792 Ga0163161_10102611 Ga0163161_101026111 442
391 3300025711 Ga0207696_1032710 Ga0207696_10327101 442
392 3300025941 Ga0207711_10062163 Ga0207711_100621633 442
393 3300025961 Ga0207712_10165855 Ga0207712_101658552 442
394 3300025972 Ga0207668_10005069 Ga0207668_100050694 442
395 3300028563 Ga0265319_1013333 Ga0265319_10133333 442
396 3300028573 Ga0265334_10010853 Ga0265334_100108533 442
397 3300028577 Ga0265318_10000019 Ga0265318_1000001944 442
398 3300028794 Ga0307515_10136135 Ga0307515_101361352 442
399 3300028794 Ga0307515_10247065 Ga0307515_102470651 442
400 3300028800 Ga0265338_10108050 Ga0265338_101080502 442
401 3300031235 Ga0265330_10000691 Ga0265330_100006917 442
402 3300031238 Ga0265332_10000076 Ga0265332_1000007625 442
403 3300031239 Ga0265328_10038198 Ga0265328_100381981 442
404 3300031240 Ga0265320_10000689 Ga0265320_100006898 442
405 3300031242 Ga0265329_10000634 Ga0265329_100006346 442
406 3300031250 Ga0265331_10000775 Ga0265331_100007751 442
407 3300031344 Ga0265316_10006740 Ga0265316_100067407 442
408 3300031711 Ga0265314_10002160 Ga0265314_1000216012 442
409 3300031712 Ga0265342_10001950 Ga0265342_100019507 442
410 3300037418 Ga0395900_0217043 Ga0395900_0217043_141_1478 442
411 3300046453 Ga0495627_000142 Ga0495627_000142_69146_70480 442
412 3300046458 Ga0495591_000448 Ga0495591_000448_12271_13620 442
413 3300046460 Ga0495638_0018658 Ga0495638_0018658_1605_2942 442
414 3300046471 Ga0495650_0022142 Ga0495650_0022142_987_2375 442
415 3300046474 Ga0495605_0000365 Ga0495605_0000365_31301_32650 442
416 3300046501 Ga0495607_0000253 Ga0495607_0000253_50532_51866 442
417 3300046542 Ga0495597_0000050 Ga0495597_0000050_31705_33054 442
418 3300046558 Ga0495633_0021779 Ga0495633_0021779_187_1524 442
419 3300046558 Ga0495633_0048981 Ga0495633_0048981_177_1514 442
420 3300046810 Ga0495660_0000920 Ga0495660_0000920_3489_4823 442
421 3300047443 Ga0495687_001017 Ga0495687_001017_10753_12090 442
422 3300048091 Ga0495626_0000015 Ga0495626_0000015_89031_90365 442
423 3300048905 Ga0496102_0000613 Ga0496102_0000613_15315_16652 442
424 3300048906 Ga0496103_0000163 Ga0496103_0000163_34275_35612 442
425 3300048908 Ga0496105_0001309 Ga0496105_0001309_15268_16653 442
426 3300048914 Ga0496111_0216837 Ga0496111_0216837_31_1368 442
427 3300048916 Ga0496113_0000081 Ga0496113_0000081_14395_15732 442
428 3300048919 Ga0496116_0041734 Ga0496116_0041734_330_1715 442
429 3300048920 Ga0496117_0048689 Ga0496117_0048689_1410_2795 442
430 3300048920 Ga0496117_0062535 Ga0496117_0062535_1135_2475 442
431 3300048921 Ga0496118_0006175 Ga0496118_0006175_2654_3994 442
432 3300048921 Ga0496118_0007255 Ga0496118_0007255_921_2258 442
433 3300048921 Ga0496118_0029942 Ga0496118_0029942_2244_3629 442
434 3300048922 Ga0496119_0073860 Ga0496119_0073860_386_1726 442
435 3300048924 Ga0496121_0000067 Ga0496121_0000067_49768_51108 442
436 3300048925 Ga0496122_0001234 Ga0496122_0001234_14564_15901 442
437 3300048925 Ga0496122_0010593 Ga0496122_0010593_7743_9128 442
438 3300048926 Ga0496123_0055407 Ga0496123_0055407_341_1726 442
439 3300048928 Ga0496125_0001250 Ga0496125_0001250_11118_12455 442
440 3300048929 Ga0496126_0000688 Ga0496126_0000688_13806_15143 442
441 3300048929 Ga0496126_0004349 Ga0496126_0004349_341_1726 442
442 3300053140 Ga0500573_0010835 Ga0500573_0010835_3234_4568 442
443 iso_pu_bacteria 2597489888 2597864393 442
444 iso_pu_bacteria 2599185189 2599510714 442
445 iso_pu_bacteria 2600255296 2601691541 442
446 iso_pu_bacteria 2623620446 2624491727 442
447 iso_pu_bacteria 2643221609 2644063261 442
448 iso_pu_bacteria 2643221611 2644071744 442
449 iso_pu_bacteria 2643221713 2644620593 442
450 iso_pu_bacteria 2721755607 2723248359 442
451 iso_pu_bacteria 2791355222 2793184147 442
452 iso_pu_bacteria 2816332133 2816475409 442
453 iso_pu_bacteria 2842826826 2842827320 442
454 iso_pu_bacteria 2842837860 2842841734 442
455 iso_pu_bacteria 2860867994 2860870250 442
456 iso_pu_bacteria 2929189879 2929192985 442
457 iso_pu_bacteria 2945961074 2945962994 442
458 iso_pu_bacteria 2946006987 2946010565 442
459 iso_pu_bacteria 2946027586 2946030483 442
460 iso_pu_bacteria 8054347763 8054347907 442
461 3300001979 JGI24740J21852_10000040 JGI24740J21852_100000409 443
462 3300001979 JGI24740J21852_10003601 JGI24740J21852_100036017 443
463 3300001979 JGI24740J21852_10003679 JGI24740J21852_100036797 443
464 3300001979 JGI24740J21852_10005450 JGI24740J21852_100054502 443
465 3300001979 JGI24740J21852_10036090 JGI24740J21852_100360901 443
466 3300001989 JGI24739J22299_10000021 JGI24739J22299_1000002130 443
467 3300001989 JGI24739J22299_10004456 JGI24739J22299_100044562 443
468 3300001989 JGI24739J22299_10005905 JGI24739J22299_100059054 443
469 3300001990 JGI24737J22298_10001269 JGI24737J22298_100012697 443
470 3300001990 JGI24737J22298_10009451 JGI24737J22298_100094514 443
471 3300001990 JGI24737J22298_10019370 JGI24737J22298_100193702 443
472 3300002067 JGI24735J21928_10002422 JGI24735J21928_100024227 443
473 3300002067 JGI24735J21928_10003309 JGI24735J21928_100033092 443
474 3300002075 JGI24738J21930_10000001 JGI24738J21930_1000000165 443
475 3300003215 JGI25153J46596_10000016 JGI25153J46596_10000016187 443
476 3300003215 JGI25153J46596_10031842 JGI25153J46596_100318421 443
477 3300003773 Ga0055537_1003505 Ga0055537_10035055 443
478 3300003794 Ga0055531_10014786 Ga0055531_100147862 443
479 3300005262 Ga0065165_1002059 Ga0065165_10020594 443
480 3300005289 Ga0065704_10006301 Ga0065704_100063011 443
481 3300005289 Ga0065704_10072214 Ga0065704_100722143 443
482 3300005331 Ga0070670_100069781 Ga0070670_1000697811 443
483 3300005335 Ga0070666_10002911 Ga0070666_100029119 443
484 3300005347 Ga0070668_100002438 Ga0070668_1000024388 443
485 3300005347 Ga0070668_100014187 Ga0070668_1000141872 443
486 3300005347 Ga0070668_100033112 Ga0070668_1000331124 443
487 3300005347 Ga0070668_100060798 Ga0070668_1000607983 443
488 3300005353 Ga0070669_100011837 Ga0070669_1000118373 443
489 3300005353 Ga0070669_100043004 Ga0070669_1000430041 443
490 3300005355 Ga0070671_100015086 Ga0070671_1000150864 443
491 3300005366 Ga0070659_100029656 Ga0070659_1000296563 443
492 3300005367 Ga0070667_100003055 Ga0070667_1000030558 443
493 3300005367 Ga0070667_100141689 Ga0070667_1001416892 443
494 3300005455 Ga0070663_100004705 Ga0070663_1000047059 443
495 3300005457 Ga0070662_100004680 Ga0070662_1000046808 443
496 3300005457 Ga0070662_100041202 Ga0070662_1000412022 443
497 3300005518 Ga0070699_100047360 Ga0070699_1000473602 443
498 3300005539 Ga0068853_100006913 Ga0068853_1000069139 443
499 3300005539 Ga0068853_100044233 Ga0068853_1000442331 443
500 3300005539 Ga0068853_100103945 Ga0068853_1001039452 443
501 3300005548 Ga0070665_100000816 Ga0070665_1000008167 443
502 3300005563 Ga0068855_100040101 Ga0068855_1000401014 443
503 3300005577 Ga0068857_100017091 Ga0068857_1000170913 443
504 3300005577 Ga0068857_100035699 Ga0068857_1000356992 443
505 3300005578 Ga0068854_100000370 Ga0068854_10000037031 443
506 3300005578 Ga0068854_100026295 Ga0068854_1000262951 443
507 3300005578 Ga0068854_100040560 Ga0068854_1000405604 443
508 3300005614 Ga0068856_100000374 Ga0068856_10000037436 443
509 3300005616 Ga0068852_100007527 Ga0068852_1000075273 443
510 3300005616 Ga0068852_100015318 Ga0068852_1000153184 443
511 3300005834 Ga0068851_10000147 Ga0068851_1000014730 443
512 3300005841 Ga0068863_100000225 Ga0068863_10000022534 443
513 3300005841 Ga0068863_100070480 Ga0068863_1000704801 443
514 3300005842 Ga0068858_100037216 Ga0068858_1000372165 443
515 3300005843 Ga0068860_100001524 Ga0068860_1000015246 443
516 3300005843 Ga0068860_100004640 Ga0068860_1000046408 443
517 3300005843 Ga0068860_100006123 Ga0068860_1000061237 443
518 3300005844 Ga0068862_100000083 Ga0068862_10000008355 443
519 3300005844 Ga0068862_100004726 Ga0068862_1000047264 443
520 3300005844 Ga0068862_100010282 Ga0068862_1000102828 443
521 3300006042 Ga0075368_10000863 Ga0075368_100008638 443
522 3300006048 Ga0075363_100001725 Ga0075363_1000017251 443
523 3300006178 Ga0075367_10000269 Ga0075367_100002692 443
524 3300006195 Ga0075366_10035008 Ga0075366_100350083 443
525 3300009011 Ga0105251_10001159 Ga0105251_1000115914 443
526 3300009011 Ga0105251_10004188 Ga0105251_1000418810 443
527 3300009036 Ga0105244_10000738 Ga0105244_1000073816 443
528 3300009036 Ga0105244_10019703 Ga0105244_100197033 443
529 3300009036 Ga0105244_10075830 Ga0105244_100758301 443
530 3300009092 Ga0105250_10015604 Ga0105250_100156042 443
531 3300009093 Ga0105240_10000220 Ga0105240_1000022090 443
532 3300009093 Ga0105240_10006254 Ga0105240_100062549 443
533 3300009093 Ga0105240_10228184 Ga0105240_102281842 443
534 3300009148 Ga0105243_10017725 Ga0105243_100177252 443
535 3300009174 Ga0105241_10022859 Ga0105241_100228593 443
536 3300009177 Ga0105248_10003730 Ga0105248_1000373010 443
537 3300009177 Ga0105248_10031570 Ga0105248_100315703 443
538 3300009545 Ga0105237_10000099 Ga0105237_1000009922 443
539 3300009551 Ga0105238_10091370 Ga0105238_100913702 443
540 3300009553 Ga0105249_10000102 Ga0105249_10000102125 443
541 3300009553 Ga0105249_10002432 Ga0105249_1000243215 443
542 3300009553 Ga0105249_10016242 Ga0105249_100162424 443
543 3300010375 Ga0105239_10000111 Ga0105239_1000011191 443
544 3300010375 Ga0105239_10014227 Ga0105239_100142273 443
545 3300010375 Ga0105239_10048852 Ga0105239_100488524 443
546 3300010375 Ga0105239_10179715 Ga0105239_101797152 443
547 3300013100 Ga0157373_10008703 Ga0157373_100087032 443
548 3300013102 Ga0157371_10001152 Ga0157371_1000115229 443
549 3300013102 Ga0157371_10005656 Ga0157371_100056566 443
550 3300013102 Ga0157371_10034266 Ga0157371_100342665 443
551 3300013104 Ga0157370_10001082 Ga0157370_100010822 443
552 3300013105 Ga0157369_10005493 Ga0157369_1000549311 443
553 3300013307 Ga0157372_10000411 Ga0157372_1000041115 443
554 3300013307 Ga0157372_10011852 Ga0157372_100118522 443
555 3300013307 Ga0157372_10043888 Ga0157372_100438882 443
556 3300025229 Ga0209147_100919 Ga0209147_1009192 443
557 3300025263 Ga0209565_1000281 Ga0209565_100028142 443
558 3300025273 Ga0209673_1001574 Ga0209673_10015746 443
559 3300025291 Ga0209675_1006260 Ga0209675_10062603 443
560 3300025295 Ga0209564_1005483 Ga0209564_10054834 443
561 3300025297 Ga0209758_1000035 Ga0209758_1000035258 443
562 3300025297 Ga0209758_1000608 Ga0209758_100060810 443
563 3300025297 Ga0209758_1015026 Ga0209758_10150262 443
564 3300025304 Ga0209257_1000036 Ga0209257_1000036456 443
565 3300025304 Ga0209257_1001043 Ga0209257_100104315 443
566 3300025321 Ga0207656_10000077 Ga0207656_1000007717 443
567 3300025728 Ga0207655_1001691 Ga0207655_10016912 443
568 3300025735 Ga0207713_1001737 Ga0207713_100173712 443
569 3300025735 Ga0207713_1003330 Ga0207713_10033308 443
570 3300025735 Ga0207713_1006178 Ga0207713_10061784 443
571 3300025903 Ga0207680_10007735 Ga0207680_100077353 443
572 3300025904 Ga0207647_10024637 Ga0207647_100246372 443
573 3300025911 Ga0207654_10020477 Ga0207654_100204773 443
574 3300025913 Ga0207695_10000213 Ga0207695_1000021364 443
575 3300025913 Ga0207695_10011595 Ga0207695_100115953 443
576 3300025913 Ga0207695_10062012 Ga0207695_100620122 443
577 3300025914 Ga0207671_10000788 Ga0207671_1000078821 443
578 3300025923 Ga0207681_10000843 Ga0207681_100008435 443
579 3300025923 Ga0207681_10005690 Ga0207681_100056905 443
580 3300025924 Ga0207694_10116550 Ga0207694_101165502 443
581 3300025925 Ga0207650_10011260 Ga0207650_100112607 443
582 3300025932 Ga0207690_10011096 Ga0207690_100110967 443
583 3300025932 Ga0207690_10025423 Ga0207690_100254232 443
584 3300025933 Ga0207706_10000383 Ga0207706_1000038346 443
585 3300025933 Ga0207706_10003643 Ga0207706_1000364310 443
586 3300025935 Ga0207709_10007500 Ga0207709_100075003 443
587 3300025941 Ga0207711_10001289 Ga0207711_1000128911 443
588 3300025949 Ga0207667_10048200 Ga0207667_100482002 443
589 3300025961 Ga0207712_10000026 Ga0207712_10000026256 443
590 3300025961 Ga0207712_10012258 Ga0207712_100122584 443
591 3300025972 Ga0207668_10000384 Ga0207668_1000038413 443
592 3300025972 Ga0207668_10000837 Ga0207668_1000083711 443
593 3300025972 Ga0207668_10005145 Ga0207668_100051455 443
594 3300025972 Ga0207668_10054835 Ga0207668_100548353 443
595 3300025981 Ga0207640_10000172 Ga0207640_1000017215 443
596 3300025981 Ga0207640_10010921 Ga0207640_100109212 443
597 3300025981 Ga0207640_10021468 Ga0207640_100214682 443
598 3300025981 Ga0207640_10032428 Ga0207640_100324284 443
599 3300025986 Ga0207658_10002222 Ga0207658_100022228 443
600 3300025986 Ga0207658_10114975 Ga0207658_101149752 443
601 3300026041 Ga0207639_10001228 Ga0207639_1000122816 443
602 3300026041 Ga0207639_10010029 Ga0207639_100100292 443
603 3300026041 Ga0207639_10071057 Ga0207639_100710572 443
604 3300026067 Ga0207678_10012629 Ga0207678_100126292 443
605 3300026078 Ga0207702_10001025 Ga0207702_1000102524 443
606 3300026088 Ga0207641_10000367 Ga0207641_1000036734 443
607 3300026088 Ga0207641_10023406 Ga0207641_100234066 443
608 3300026088 Ga0207641_10054906 Ga0207641_100549064 443
609 3300026116 Ga0207674_10025702 Ga0207674_100257023 443
610 3300026116 Ga0207674_10047138 Ga0207674_100471385 443
611 3300026142 Ga0207698_10018166 Ga0207698_100181662 443
612 3300027866 Ga0209813_10000074 Ga0209813_1000007418 443
613 3300028379 Ga0268266_10000387 Ga0268266_1000038731 443
614 3300028380 Ga0268265_10000094 Ga0268265_1000009481 443
615 3300028381 Ga0268264_10000367 Ga0268264_1000036713 443
616 3300028381 Ga0268264_10002410 Ga0268264_100024108 443
617 3300028381 Ga0268264_10008727 Ga0268264_100087276 443
618 3300028794 Ga0307515_10091706 Ga0307515_100917062 443
619 3300031251 Ga0265327_10007444 Ga0265327_100074443 443
620 3300031548 Ga0307408_100051934 Ga0307408_1000519342 443
621 3300031731 Ga0307405_10003738 Ga0307405_100037386 443
622 3300031911 Ga0307412_10002912 Ga0307412_100029122 443
623 3300041405 Ga0439438_000544 Ga0439438_000544_12641_13975 443
624 3300042001 Ga0439441_003261 Ga0439441_003261_272_1609 443
625 3300044735 Ga0466968_0002632 Ga0466968_0002632_3425_4768 443
626 3300046453 Ga0495627_000084 Ga0495627_000084_64604_65941 443
627 3300046460 Ga0495638_0000018 Ga0495638_0000018_219202_220539 443
628 3300046460 Ga0495638_0000230 Ga0495638_0000230_5460_6830 443
629 3300046460 Ga0495638_0004745 Ga0495638_0004745_1864_3201 443
630 3300046460 Ga0495638_0016007 Ga0495638_0016007_824_2254 443
631 3300046471 Ga0495650_0000017 Ga0495650_0000017_422082_423419 443
632 3300046471 Ga0495650_0000160 Ga0495650_0000160_5906_7243 443
633 3300046471 Ga0495650_0003429 Ga0495650_0003429_1498_2835 443
634 3300046474 Ga0495605_0011818 Ga0495605_0011818_13_1350 443
635 3300046501 Ga0495607_0000076 Ga0495607_0000076_35962_37314 443
636 3300046501 Ga0495607_0016286 Ga0495607_0016286_1043_2380 443
637 3300046501 Ga0495607_0075966 Ga0495607_0075966_467_1804 443
638 3300046506 Ga0495583_0000010 Ga0495583_0000010_138989_140326 443
639 3300046506 Ga0495583_0000029 Ga0495583_0000029_221276_222652 443
640 3300046506 Ga0495583_0000429 Ga0495583_0000429_37186_38523 443
641 3300046507 Ga0495606_0007980 Ga0495606_0007980_6479_7816 443
642 3300046507 Ga0495606_0034070 Ga0495606_0034070_18_1355 443
643 3300046512 Ga0495610_0000058 Ga0495610_0000058_51451_52788 443
644 3300046513 Ga0495616_0000054 Ga0495616_0000054_89736_91166 443
645 3300046513 Ga0495616_0000082 Ga0495616_0000082_11569_12906 443
646 3300046513 Ga0495616_0049385 Ga0495616_0049385_148_1485 443
647 3300046519 Ga0495632_0000076 Ga0495632_0000076_48116_49453 443
648 3300046519 Ga0495632_0000113 Ga0495632_0000113_26484_27821 443
649 3300046519 Ga0495632_0000997 Ga0495632_0000997_1275_2672 443
650 3300046520 Ga0495637_0000219 Ga0495637_0000219_18735_20072 443
651 3300046522 Ga0495643_0000009 Ga0495643_0000009_77824_79161 443
652 3300046522 Ga0495643_0000454 Ga0495643_0000454_17838_19172 443
653 3300046522 Ga0495643_0001232 Ga0495643_0001232_21090_22427 443
654 3300046522 Ga0495643_0020490 Ga0495643_0020490_1722_3059 443
655 3300046524 Ga0495648_0000018 Ga0495648_0000018_61952_63289 443
656 3300046525 Ga0495663_0000023 Ga0495663_0000023_51669_53006 443
657 3300046530 Ga0495654_0000012 Ga0495654_0000012_110251_111588 443
658 3300046558 Ga0495633_0000190 Ga0495633_0000190_66524_67861 443
659 3300046558 Ga0495633_0000397 Ga0495633_0000397_7092_8429 443
660 3300046616 Ga0495668_0007940 Ga0495668_0007940_1739_3076 443
661 3300046660 Ga0495625_0000162 Ga0495625_0000162_77609_78946 443
662 3300046660 Ga0495625_0001294 Ga0495625_0001294_17847_19184 443
663 3300046660 Ga0495625_0002544 Ga0495625_0002544_620_1957 443
664 3300046660 Ga0495625_0063521 Ga0495625_0063521_164_1516 443
665 3300046665 Ga0495661_0020353 Ga0495661_0020353_2699_4036 443
666 3300046691 Ga0495670_0059391 Ga0495670_0059391_208_1545 443
667 3300046691 Ga0495670_0078325 Ga0495670_0078325_242_1579 443
668 3300046692 Ga0495671_0000011 Ga0495671_0000011_281929_283266 443
669 3300046692 Ga0495671_0000013 Ga0495671_0000013_77824_79161 443
670 3300046810 Ga0495660_0012438 Ga0495660_0012438_2290_3627 443
671 3300046810 Ga0495660_0026044 Ga0495660_0026044_1128_2471 443
672 3300047320 Ga0495672_0003990 Ga0495672_0003990_10849_12186 443
673 3300047443 Ga0495687_000045 Ga0495687_000045_62972_64435 443
674 3300047445 Ga0495677_0002252 Ga0495677_0002252_3705_5042 443
675 3300047446 Ga0495679_001113 Ga0495679_001113_1217_2560 443
676 3300047469 Ga0495673_0000013 Ga0495673_0000013_549993_551330 443
677 3300047469 Ga0495673_0003734 Ga0495673_0003734_3142_4479 443
678 3300047469 Ga0495673_0073541 Ga0495673_0073541_83_1420 443
679 3300047470 Ga0495681_0005751 Ga0495681_0005751_5628_6965 443
680 3300047472 Ga0495686_0000161 Ga0495686_0000161_47287_48624 443
681 3300047472 Ga0495686_0001069 Ga0495686_0001069_31043_32380 443
682 3300047472 Ga0495686_0052738 Ga0495686_0052738_923_2260 443
683 3300048905 Ga0496102_0000143 Ga0496102_0000143_77729_79066 443
684 3300048906 Ga0496103_0000098 Ga0496103_0000098_77713_79050 443
685 3300048906 Ga0496103_0008348 Ga0496103_0008348_71_1408 443
686 3300048907 Ga0496104_0279447 Ga0496104_0279447_194_1531 443
687 3300048908 Ga0496105_0123836 Ga0496105_0123836_384_1721 443
688 3300048909 Ga0496106_0007898 Ga0496106_0007898_4366_5703 443
689 3300048910 Ga0496107_0000019 Ga0496107_0000019_39266_40603 443
690 3300048911 Ga0496108_0146923 Ga0496108_0146923_504_1841 443
691 3300048917 Ga0496114_0055201 Ga0496114_0055201_325_1659 443
692 3300048918 Ga0496115_0009634 Ga0496115_0009634_952_2289 443
693 3300048919 Ga0496116_0001473 Ga0496116_0001473_24608_25945 443
694 3300048919 Ga0496116_0097053 Ga0496116_0097053_98_1435 443
695 3300048920 Ga0496117_0000121 Ga0496117_0000121_24596_25933 443
696 3300048920 Ga0496117_0005261 Ga0496117_0005261_7370_8704 443
697 3300048920 Ga0496117_0005816 Ga0496117_0005816_2689_4026 443
698 3300048920 Ga0496117_0011270 Ga0496117_0011270_1194_2528 443
699 3300048920 Ga0496117_0020317 Ga0496117_0020317_1432_2769 443
700 3300048921 Ga0496118_0000095 Ga0496118_0000095_145600_146937 443
701 3300048921 Ga0496118_0003634 Ga0496118_0003634_16549_17883 443
702 3300048921 Ga0496118_0004347 Ga0496118_0004347_8611_9945 443
703 3300048921 Ga0496118_0005130 Ga0496118_0005130_10730_12067 443
704 3300048921 Ga0496118_0008390 Ga0496118_0008390_4995_6332 443
705 3300048921 Ga0496118_0119532 Ga0496118_0119532_225_1592 443
706 3300048922 Ga0496119_0012070 Ga0496119_0012070_1803_3140 443
707 3300048922 Ga0496119_0034497 Ga0496119_0034497_1532_2869 443
708 3300048924 Ga0496121_0000624 Ga0496121_0000624_37432_38769 443
709 3300048924 Ga0496121_0004401 Ga0496121_0004401_13800_15137 443
710 3300048924 Ga0496121_0006234 Ga0496121_0006234_7507_8844 443
711 3300048925 Ga0496122_0000092 Ga0496122_0000092_165590_166972 443
712 3300048925 Ga0496122_0032481 Ga0496122_0032481_1538_2875 443
713 3300048925 Ga0496122_0066270 Ga0496122_0066270_74_1411 443
714 3300048926 Ga0496123_0000028 Ga0496123_0000028_37150_38484 443
715 3300048926 Ga0496123_0000598 Ga0496123_0000598_37474_38856 443
716 3300048926 Ga0496123_0095090 Ga0496123_0095090_13_1350 443
717 3300048927 Ga0496124_0000119 Ga0496124_0000119_145600_146937 443
718 3300048927 Ga0496124_0018216 Ga0496124_0018216_2000_3337 443
719 3300048927 Ga0496124_0019199 Ga0496124_0019199_386_1720 443
720 3300048927 Ga0496124_0045554 Ga0496124_0045554_1110_2489 443
721 3300048927 Ga0496124_0051057 Ga0496124_0051057_675_2012 443
722 3300048927 Ga0496124_0063227 Ga0496124_0063227_194_1531 443
723 3300048927 Ga0496124_0125839 Ga0496124_0125839_258_1595 443
724 3300048928 Ga0496125_0000038 Ga0496125_0000038_13537_14871 443
725 3300048928 Ga0496125_0007696 Ga0496125_0007696_2695_4032 443
726 3300048928 Ga0496125_0071493 Ga0496125_0071493_1085_2422 443
727 3300048928 Ga0496125_0104213 Ga0496125_0104213_564_1901 443
728 3300048929 Ga0496126_0006740 Ga0496126_0006740_6505_7842 443
729 3300048929 Ga0496126_0084425 Ga0496126_0084425_285_1622 443
730 3300049679 Ga0501249_000141 Ga0501249_000141_7893_9230 443
731 3300050490 nmdc:mga03n38_2748_c1 nmdc:mga03n38_2748_c1_1470_2849 443
732 3300050493 nmdc:mga0k408_37235_c1 nmdc:mga0k408_37235_c1_84_1451 443
733 3300050494 nmdc:mga06z11_8_c1 nmdc:mga06z11_8_c1_72064_73443 443
734 3300050495 nmdc:mga04h51_8_c1 nmdc:mga04h51_8_c1_86641_88020 443
735 3300050496 nmdc:mga07m45_13206_c1 nmdc:mga07m45_13206_c1_2802_4181 443
736 3300053087 Ga0500643_000503 Ga0500643_000503_1206_2543 443
737 3300053087 Ga0500643_005015 Ga0500643_005015_2005_3342 443
738 3300053103 Ga0500555_000799 Ga0500555_000799_1274_2611 443
739 3300053121 Ga0500607_000035 Ga0500607_000035_41811_43148 443
740 3300053121 Ga0500607_000058 Ga0500607_000058_43079_44416 443
741 3300053125 Ga0500618_000066 Ga0500618_000066_54923_56260 443
742 3300053134 Ga0500658_0013135 Ga0500658_0013135_1087_2424 443
743 3300053136 Ga0500559_0000058 Ga0500559_0000058_9138_10475 443
744 3300053136 Ga0500559_0001018 Ga0500559_0001018_5597_6934 443
745 3300053136 Ga0500559_0001082 Ga0500559_0001082_4547_5884 443
746 3300053136 Ga0500559_0002704 Ga0500559_0002704_6466_7803 443
747 3300053136 Ga0500559_0005739 Ga0500559_0005739_2733_4070 443
748 3300053136 Ga0500559_0024248 Ga0500559_0024248_415_1755 443
749 3300053151 Ga0500604_0005543 Ga0500604_0005543_939_2276 443
750 3300053156 Ga0500622_0028425 Ga0500622_0028425_498_1835 443
751 3300053158 Ga0500627_0001133 Ga0500627_0001133_5327_6664 443
752 3300053158 Ga0500627_0008343 Ga0500627_0008343_818_2155 443
753 3300053730 Ga0500645_000196 Ga0500645_000196_39820_41157 443
754 3300053730 Ga0500645_001940 Ga0500645_001940_5730_7067 443
755 3300053730 Ga0500645_004520 Ga0500645_004520_1712_3049 443
756 3300053730 Ga0500645_006527 Ga0500645_006527_2699_4036 443
757 iso_pu_bacteria 2599185316 2600021791 443
758 iso_pu_bacteria 2599185317 2600030839 443
759 iso_pu_bacteria 2599185325 2600075064 443
760 iso_pu_bacteria 2600254930 2600360644 443
761 iso_pu_bacteria 2667528176 2671126875 443
762 iso_pu_bacteria 2980182181 2980185828 443
763 iso_pu_bacteria 3007395558 3007396554 443
764 3300031241 Ga0265325_10000250 Ga0265325_1000025021 444
765 3300031344 Ga0265316_10000893 Ga0265316_1000089329 444
766 3300046507 Ga0495606_0000760 Ga0495606_0000760_30298_31641 444
767 3300048919 Ga0496116_0008741 Ga0496116_0008741_6961_8307 444
768 3300048925 Ga0496122_0070000 Ga0496122_0070000_885_2231 444
769 3300048926 Ga0496123_0001346 Ga0496123_0001346_10886_12232 444
770 3300048927 Ga0496124_0000873 Ga0496124_0000873_36042_37388 444
771 3300048928 Ga0496125_0005821 Ga0496125_0005821_11966_13312 444
772 3300049459 Ga0495678_008247 Ga0495678_008247_585_1928 444
773 iso_pu_bacteria 2511231004 2511253368 444
774 iso_pu_bacteria 2511231007 2511269615 444
775 iso_pu_bacteria 2511231008 2511280838 444
776 iso_pu_bacteria 2511231016 2511324219 444
777 iso_pu_bacteria 2511231021 2511359945 444
778 iso_pu_bacteria 2512047018 2512326218 444
779 iso_pu_bacteria 2582580891 2583792561 444
780 iso_pu_bacteria 2599185167 2599399280 444
781 iso_pu_bacteria 2599185179 2599453618 444
782 iso_pu_bacteria 2599185190 2599513773 444
783 iso_pu_bacteria 2599185191 2599518953 444
784 iso_pu_bacteria 2599185290 2599892830 444
785 iso_pu_bacteria 2600255283 2601625367 444
786 iso_pu_bacteria 2619619299 2621300365 444
787 iso_pu_bacteria 2651869719 2652543960 444
788 iso_pu_bacteria 2738541265 2738675425 444
789 iso_pu_bacteria 2738541282 2738753828 444
790 iso_pu_bacteria 2738541303 2738862877 444
791 iso_pu_bacteria 2740892503 2743737698 444
792 iso_pu_bacteria 2816332298 2817490563 444
793 iso_pu_bacteria 2826581358 2826585021 444
794 iso_pu_bacteria 2842849001 2842850998 444
795 iso_pu_bacteria 2923153595 2923156743 444
796 iso_pu_bacteria 2923586266 2923588020 444
797 iso_pu_bacteria 2931369376 2931374713 444
798 iso_pu_bacteria 2931390751 2931394402 444
799 iso_pu_bacteria 2931396565 2931401295 444
800 iso_pu_bacteria 8015687852 8015690963 444
801 iso_pu_bacteria 8055770955 8055774103 444
802 iso_pu_bacteria 8056131705 8056134352 444
803 iso_pu_bacteria 8056177738 8056179005 444
804 3300021361 Ga0213872_10005680 Ga0213872_100056803 445
805 3300039447 Ga0436361_0551392 Ga0436361_0551392_1149_2531 445
806 3300046453 Ga0495627_001885 Ga0495627_001885_1806_3149 445
807 3300046458 Ga0495591_004529 Ga0495591_004529_3561_4904 445
808 3300046501 Ga0495607_0012249 Ga0495607_0012249_2003_3346 445
809 3300046507 Ga0495606_0000729 Ga0495606_0000729_46158_47501 445
810 3300046512 Ga0495610_0007561 Ga0495610_0007561_5615_6958 445
811 3300046515 Ga0495620_0000207 Ga0495620_0000207_1720_3063 445
812 3300046519 Ga0495632_0007697 Ga0495632_0007697_1719_3062 445
813 3300046522 Ga0495643_0045383 Ga0495643_0045383_506_1849 445
814 3300046530 Ga0495654_0009671 Ga0495654_0009671_1144_2487 445
815 3300046558 Ga0495633_0033108 Ga0495633_0033108_483_2027 445
816 3300046665 Ga0495661_0000138 Ga0495661_0000138_34390_35733 445
817 3300046794 Ga0495589_0001115 Ga0495589_0001115_11170_12513 445
818 3300047470 Ga0495681_0012346 Ga0495681_0012346_1936_3279 445
819 3300053157 Ga0500624_000017 Ga0500624_000017_28476_29849 445
820 iso_pu_bacteria 8054503363 8054506715 445
821 3300005344 Ga0070661_100000163 Ga0070661_10000016321 446
822 3300005564 Ga0070664_100000101 Ga0070664_10000010122 446
823 3300009011 Ga0105251_10000612 Ga0105251_1000061218 446
824 3300009036 Ga0105244_10005252 Ga0105244_100052523 446
825 3300009092 Ga0105250_10000089 Ga0105250_1000008968 446
826 3300009092 Ga0105250_10000109 Ga0105250_100001098 446
827 3300009176 Ga0105242_10013185 Ga0105242_100131853 446
828 3300009545 Ga0105237_10000096 Ga0105237_1000009667 446
829 3300011119 Ga0105246_10011380 Ga0105246_100113803 446
830 3300013104 Ga0157370_10032814 Ga0157370_100328142 446
831 3300013105 Ga0157369_10003418 Ga0157369_100034186 446
832 3300013308 Ga0157375_10036562 Ga0157375_100365623 446
833 3300025711 Ga0207696_1000115 Ga0207696_100011556 446
834 3300025711 Ga0207696_1000163 Ga0207696_10001638 446
835 3300025728 Ga0207655_1000734 Ga0207655_100073424 446
836 3300025735 Ga0207713_1000020 Ga0207713_10000209 446
837 3300025914 Ga0207671_10000747 Ga0207671_1000074726 446
838 3300025920 Ga0207649_10000010 Ga0207649_1000001029 446
839 3300025945 Ga0207679_10000037 Ga0207679_10000037112 446
840 3300046457 Ga0495590_0001721 Ga0495590_0001721_2541_3920 446
841 3300046474 Ga0495605_0004999 Ga0495605_0004999_4454_5824 446
842 3300046507 Ga0495606_0021889 Ga0495606_0021889_2748_4103 446
843 iso_pu_bacteria 2599185288 2599880105 446
844 iso_pu_bacteria 2599185303 2599947185 446
845 iso_pu_bacteria 2738541294 2738806326 446
846 iso_pu_bacteria 2738541309 2738893686 446
847 iso_pu_bacteria 8054285046 8054286676 446
848 iso_pu_bacteria 8055817908 8055820344 446
849 3300005290 Ga0065712_10094642 Ga0065712_100946422 447
850 3300013308 Ga0157375_10047654 Ga0157375_100476542 447
851 3300046506 Ga0495583_0000457 Ga0495583_0000457_29416_30804 447
852 3300046519 Ga0495632_0000748 Ga0495632_0000748_19270_20658 447
853 3300046520 Ga0495637_0005690 Ga0495637_0005690_4153_5541 447
854 3300046530 Ga0495654_0001701 Ga0495654_0001701_6128_7558 447
855 3300046665 Ga0495661_0000513 Ga0495661_0000513_29845_31233 447
856 3300046665 Ga0495661_0003700 Ga0495661_0003700_9338_10696 447
857 3300053161 Ga0500634_0022859 Ga0500634_0022859_1582_2940 447
858 2162886011 MRS1b_contig_4057571 MRS1b_0510.00002240 448
859 3300003781 Ga0055536_1000005 Ga0055536_1000005301 448
860 3300003791 Ga0055530_10000001 Ga0055530_1000000130 448
861 3300003791 Ga0055530_10000165 Ga0055530_1000016525 448
862 3300003792 Ga0055540_1000186 Ga0055540_100018625 448
863 3300003792 Ga0055540_1000258 Ga0055540_100025821 448
864 3300005288 Ga0065714_10005985 Ga0065714_100059854 448
865 3300005288 Ga0065714_10008360 Ga0065714_100083604 448
866 3300005288 Ga0065714_10064839 Ga0065714_100648394 448
867 3300005288 Ga0065714_10077303 Ga0065714_100773032 448
868 3300005288 Ga0065714_10085296 Ga0065714_100852961 448
869 3300005290 Ga0065712_10068364 Ga0065712_100683642 448
870 3300005331 Ga0070670_100002244 Ga0070670_10000224412 448
871 3300005457 Ga0070662_100103589 Ga0070662_1001035892 448
872 3300005539 Ga0068853_100012273 Ga0068853_1000122734 448
873 3300005578 Ga0068854_100080545 Ga0068854_1000805452 448
874 3300005834 Ga0068851_10000045 Ga0068851_1000004537 448
875 3300006058 Ga0075432_10018313 Ga0075432_100183132 448
876 3300006946 Ga0079104_1000006 Ga0079104_1000006297 448
877 3300009011 Ga0105251_10001293 Ga0105251_1000129316 448
878 3300009177 Ga0105248_10096387 Ga0105248_100963872 448
879 3300013102 Ga0157371_10000925 Ga0157371_1000092515 448
880 3300013104 Ga0157370_10094246 Ga0157370_100942462 448
881 3300013105 Ga0157369_10014781 Ga0157369_100147819 448
882 3300013306 Ga0163162_10000551 Ga0163162_1000055120 448
883 3300015261 Ga0182006_1002424 Ga0182006_10024247 448
884 3300015261 Ga0182006_1003647 Ga0182006_10036475 448
885 3300015265 Ga0182005_1004741 Ga0182005_10047413 448
886 3300017792 Ga0163161_10008403 Ga0163161_100084032 448
887 3300025292 Ga0209676_1000003 Ga0209676_1000003513 448
888 3300025292 Ga0209676_1001866 Ga0209676_100186610 448
889 3300025298 Ga0209050_1000004 Ga0209050_1000004495 448
890 3300025298 Ga0209050_1000037 Ga0209050_1000037228 448
891 3300025303 Ga0209051_1000006 Ga0209051_1000006480 448
892 3300025303 Ga0209051_1000040 Ga0209051_1000040229 448
893 3300025321 Ga0207656_10000163 Ga0207656_100001638 448
894 3300025735 Ga0207713_1000318 Ga0207713_100031849 448
895 3300025735 Ga0207713_1003208 Ga0207713_10032083 448
896 3300025923 Ga0207681_10003360 Ga0207681_100033605 448
897 3300025925 Ga0207650_10023412 Ga0207650_100234123 448
898 3300025933 Ga0207706_10059424 Ga0207706_100594242 448
899 3300027111 Ga0209281_1000011 Ga0209281_1000011484 448
900 3300031731 Ga0307405_10000041 Ga0307405_100000414 448
901 3300041405 Ga0439438_000666 Ga0439438_000666_4523_5869 448
902 3300041407 Ga0439447_001030 Ga0439447_001030_7238_8584 448
903 3300041411 Ga0439466_0002734 Ga0439466_0002734_2643_3989 448
904 3300042010 Ga0439452_000115 Ga0439452_000115_9929_11275 448
905 3300042137 Ga0450902_000434 Ga0450902_000434_1460_2806 448
906 3300046452 Ga0495617_000044 Ga0495617_000044_29569_30921 448
907 3300046455 Ga0495603_0000009 Ga0495603_0000009_47519_48865 448
908 3300046457 Ga0495590_0000698 Ga0495590_0000698_13657_15003 448
909 3300046458 Ga0495591_009768 Ga0495591_009768_991_2343 448
910 3300046460 Ga0495638_0000160 Ga0495638_0000160_49824_51176 448
911 3300046460 Ga0495638_0015764 Ga0495638_0015764_1098_2450 448
912 3300046460 Ga0495638_0074070 Ga0495638_0074070_456_1802 448
913 3300046471 Ga0495650_0005303 Ga0495650_0005303_3656_5008 448
914 3300046474 Ga0495605_0000088 Ga0495605_0000088_57461_58813 448
915 3300046474 Ga0495605_0000158 Ga0495605_0000158_39093_40439 448
916 3300046474 Ga0495605_0000806 Ga0495605_0000806_17645_18991 448
917 3300046474 Ga0495605_0002738 Ga0495605_0002738_2290_3642 448
918 3300046491 Ga0495584_0000322 Ga0495584_0000322_3641_4987 448
919 3300046491 Ga0495584_0000666 Ga0495584_0000666_5882_7234 448
920 3300046491 Ga0495584_0001575 Ga0495584_0001575_9747_11093 448
921 3300046491 Ga0495584_0003151 Ga0495584_0003151_2824_4173 448
922 3300046492 Ga0495585_0000142 Ga0495585_0000142_45215_46564 448
923 3300046499 Ga0495594_0002539 Ga0495594_0002539_535_1887 448
924 3300046501 Ga0495607_0007014 Ga0495607_0007014_3417_4763 448
925 3300046501 Ga0495607_0029980 Ga0495607_0029980_582_1970 448
926 3300046501 Ga0495607_0050614 Ga0495607_0050614_677_2044 448
927 3300046506 Ga0495583_0000135 Ga0495583_0000135_62263_63615 448
928 3300046506 Ga0495583_0002204 Ga0495583_0002204_8064_9428 448
929 3300046507 Ga0495606_0004668 Ga0495606_0004668_9419_10786 448
930 3300046512 Ga0495610_0002403 Ga0495610_0002403_8802_10154 448
931 3300046512 Ga0495610_0002821 Ga0495610_0002821_2257_3606 448
932 3300046512 Ga0495610_0024504 Ga0495610_0024504_534_1886 448
933 3300046512 Ga0495610_0038584 Ga0495610_0038584_896_2284 448
934 3300046513 Ga0495616_0000429 Ga0495616_0000429_15779_17125 448
935 3300046513 Ga0495616_0045309 Ga0495616_0045309_398_1750 448
936 3300046515 Ga0495620_0000034 Ga0495620_0000034_59241_60593 448
937 3300046515 Ga0495620_0005130 Ga0495620_0005130_1689_3041 448
938 3300046518 Ga0495631_0013640 Ga0495631_0013640_511_1857 448
939 3300046519 Ga0495632_0000495 Ga0495632_0000495_20026_21372 448
940 3300046519 Ga0495632_0009443 Ga0495632_0009443_2249_3595 448
941 3300046519 Ga0495632_0014750 Ga0495632_0014750_2875_4224 448
942 3300046519 Ga0495632_0040616 Ga0495632_0040616_721_2091 448
943 3300046520 Ga0495637_0001357 Ga0495637_0001357_12082_13434 448
944 3300046520 Ga0495637_0013726 Ga0495637_0013726_873_2219 448
945 3300046520 Ga0495637_0016057 Ga0495637_0016057_1891_3240 448
946 3300046522 Ga0495643_0005329 Ga0495643_0005329_3784_5130 448
947 3300046523 Ga0495644_0013543 Ga0495644_0013543_1055_2407 448
948 3300046524 Ga0495648_0001250 Ga0495648_0001250_16315_17667 448
949 3300046526 Ga0495666_0061405 Ga0495666_0061405_382_1728 448
950 3300046528 Ga0495642_0000187 Ga0495642_0000187_19582_20928 448
951 3300046530 Ga0495654_0000414 Ga0495654_0000414_8181_9545 448
952 3300046530 Ga0495654_0017905 Ga0495654_0017905_1223_2569 448
953 3300046530 Ga0495654_0033864 Ga0495654_0033864_966_2318 448
954 3300046538 Ga0495609_0000147 Ga0495609_0000147_60447_61799 448
955 3300046538 Ga0495609_0000477 Ga0495609_0000477_13195_14541 448
956 3300046542 Ga0495597_0016843 Ga0495597_0016843_857_2206 448
957 3300046542 Ga0495597_0054533 Ga0495597_0054533_92_1438 448
958 3300046558 Ga0495633_0000316 Ga0495633_0000316_15983_17335 448
959 3300046558 Ga0495633_0002823 Ga0495633_0002823_4038_5384 448
960 3300046648 Ga0495611_0001119 Ga0495611_0001119_5094_6446 448
961 3300046660 Ga0495625_0004436 Ga0495625_0004436_2660_4012 448
962 3300046660 Ga0495625_0033878 Ga0495625_0033878_1345_2691 448
963 3300046665 Ga0495661_0000078 Ga0495661_0000078_57360_58712 448
964 3300046665 Ga0495661_0058967 Ga0495661_0058967_13_1362 448
965 3300046679 Ga0495623_0128494 Ga0495623_0128494_82_1434 448
966 3300046691 Ga0495670_0030426 Ga0495670_0030426_386_1738 448
967 3300046692 Ga0495671_0000052 Ga0495671_0000052_21765_23111 448
968 3300046692 Ga0495671_0006726 Ga0495671_0006726_783_2135 448
969 3300046694 Ga0495649_0000106 Ga0495649_0000106_51067_52413 448
970 3300046694 Ga0495649_0005407 Ga0495649_0005407_6285_7637 448
971 3300046794 Ga0495589_0001063 Ga0495589_0001063_11158_12504 448
972 3300046794 Ga0495589_0001135 Ga0495589_0001135_13452_14804 448
973 3300046794 Ga0495589_0025245 Ga0495589_0025245_1345_2691 448
974 3300046810 Ga0495660_0002313 Ga0495660_0002313_147_1499 448
975 3300046810 Ga0495660_0029529 Ga0495660_0029529_1207_2571 448
976 3300047317 Ga0495604_0084815 Ga0495604_0084815_273_1625 448
977 3300047318 Ga0495636_0000221 Ga0495636_0000221_3394_4740 448
978 3300047320 Ga0495672_0001535 Ga0495672_0001535_11331_12677 448
979 3300047320 Ga0495672_0080428 Ga0495672_0080428_197_1549 448
980 3300047323 Ga0495683_0000108 Ga0495683_0000108_60353_61705 448
981 3300047323 Ga0495683_0001247 Ga0495683_0001247_3519_4865 448
982 3300047323 Ga0495683_0002624 Ga0495683_0002624_8906_10258 448
983 3300047443 Ga0495687_000572 Ga0495687_000572_36940_38286 448
984 3300047443 Ga0495687_001130 Ga0495687_001130_4520_5866 448
985 3300047443 Ga0495687_009882 Ga0495687_009882_3456_4808 448
986 3300047444 Ga0495675_0000016 Ga0495675_0000016_115403_116755 448
987 3300047446 Ga0495679_000198 Ga0495679_000198_2657_4009 448
988 3300047469 Ga0495673_0000190 Ga0495673_0000190_79624_80970 448
989 3300047469 Ga0495673_0001285 Ga0495673_0001285_5622_6989 448
990 3300047469 Ga0495673_0003373 Ga0495673_0003373_8852_10207 448
991 3300047469 Ga0495673_0005427 Ga0495673_0005427_2899_4245 448
992 3300047470 Ga0495681_0000009 Ga0495681_0000009_115305_116657 448
993 3300047470 Ga0495681_0001074 Ga0495681_0001074_11034_12386 448
994 3300047470 Ga0495681_0036771 Ga0495681_0036771_887_2239 448
995 3300047471 Ga0495684_0021654 Ga0495684_0021654_1263_2615 448
996 3300047472 Ga0495686_0000633 Ga0495686_0000633_45349_46698 448
997 3300048091 Ga0495626_0002074 Ga0495626_0002074_8510_9856 448
998 3300048091 Ga0495626_0019293 Ga0495626_0019293_691_2037 448
999 3300048091 Ga0495626_0034107 Ga0495626_0034107_400_1746 448
1000 3300048922 Ga0496119_0020493 Ga0496119_0020493_2785_4134 448
1001 3300048923 Ga0496120_0007164 Ga0496120_0007164_3245_4594 448
1002 3300048925 Ga0496122_0005467 Ga0496122_0005467_913_2265 448
1003 3300048926 Ga0496123_0006893 Ga0496123_0006893_8532_9884 448
1004 3300048927 Ga0496124_0000812 Ga0496124_0000812_26677_28023 448
1005 3300048928 Ga0496125_0020652 Ga0496125_0020652_1960_3324 448
1006 3300048928 Ga0496125_0100470 Ga0496125_0100470_457_1806 448
1007 3300048929 Ga0496126_0025214 Ga0496126_0025214_766_2115 448
1008 3300049459 Ga0495678_000081 Ga0495678_000081_57180_58532 448
1009 3300049459 Ga0495678_000583 Ga0495678_000583_13886_15238 448
1010 3300049459 Ga0495678_001014 Ga0495678_001014_2794_4140 448
1011 3300049459 Ga0495678_003272 Ga0495678_003272_2769_4115 448
1012 3300049459 Ga0495678_007623 Ga0495678_007623_443_1792 448
1013 3300049459 Ga0495678_026617 Ga0495678_026617_597_1943 448
1014 3300049460 Ga0495682_0000150 Ga0495682_0000150_16276_17622 448
1015 3300049460 Ga0495682_0003894 Ga0495682_0003894_2419_3765 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

88

453

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yw1-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis in complex with fmn 0.9596 3 431
1tvl-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis 0.9591 3 431
1yw1-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis in complex with fmn 0.9572 3 431
1tvl-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis 0.9543 3 431
3sdo-assembly1.cif.gz_B structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei 0.9492 4 436
ID Description Score Start End Superfamily
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9492 4 436 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9469 4 436 3.20.20.30
6aslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9313 3 431 3.20.20.30
6aslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9272 3 431 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8965 6 428 3.20.20.30
ID Description Score Start End GO Terms
AF-F0FZG7-F1-model_v4 Flavin-dependent oxidoreductase 0.9929 12 159 GO:0016705
AF-W1DL73-F1-model_v4 Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) 0.9869 22 231 GO:0004497
GO:0016705
AF-A0A7G2IVK8-F1-model_v4 Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) 0.9868 23 181 GO:0004497
GO:0016705
AF-W7YU60-F1-model_v4 Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase 0.9844 1 195 GO:0004497
GO:0016705
AF-A0A529XC09-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9835 75 220 GO:0016705

Feature Viewer

pLDDT pTM Quality
91.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map