F488235
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 327 | 2030 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100461979|Ga0070698_1004619792 |
| Length | 242 |
| Sequence | VITLAALVTRIPIAFVAGLASVITPCVLPLVPGYLSAVSAVETTRLGERGVARRIALATLPFILGFTVVFVVLGAAAAAIGGVVDPNRRIEIAGFVLVVLGLAFMGLLPWPERVVAPGLLTGARRRGSSVLLGGAFAVCAAPCIGTVLASILVLAGNSSTVWRGSLLLTAYSIGLGLAFLLAGVAFSRAMGAFRWLRDHYTVIRVASGATLVALGLLLFFHRDWWLRVLLNRLLEAIGLGNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 8.18 |
| Rhizosphere | 91.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070698_100461979 | 3300005471 | Bacteria | 1205 |
| 2 | Ga0070658_10001317 | 3300005327 | Bacteria | 21168 |
| 3 | Ga0070658_10022933 | 3300005327 | Bacteria | 5011 |
| 4 | Ga0070683_100001088 | 3300005329 | Bacteria | 20441 |
| 5 | Ga0070683_100001951 | 3300005329 | Bacteria | 16161 |
| 6 | Ga0070683_100255007 | 3300005329 | Unclassified | 1668 |
| 7 | Ga0070683_100272179 | 3300005329 | Bacteria | 1611 |
| 8 | Ga0070680_100007887 | 3300005336 | Bacteria | 8120 |
| 9 | Ga0070680_100083768 | 3300005336 | Bacteria | 2633 |
| 10 | Ga0070680_100089388 | 3300005336 | Bacteria | 2548 |
| 11 | Ga0070680_100411739 | 3300005336 | Bacteria | 1153 |
| 12 | Ga0070682_100000829 | 3300005337 | Bacteria | 18032 |
| 13 | Ga0070682_100090423 | 3300005337 | Bacteria | 2002 |
| 14 | Ga0070682_100164403 | 3300005337 | Bacteria | 1536 |
| 15 | Ga0068868_100016781 | 3300005338 | Bacteria | 5445 |
| 16 | Ga0068868_100864109 | 3300005338 | Bacteria | 820 |
| 17 | Ga0070660_100001059 | 3300005339 | Bacteria | 18513 |
| 18 | Ga0070660_100008244 | 3300005339 | Bacteria | 7283 |
| 19 | Ga0070660_100021867 | 3300005339 | Bacteria | 4723 |
| 20 | Ga0070660_100033201 | 3300005339 | Bacteria | 3888 |
| 21 | Ga0070660_100152063 | 3300005339 | Bacteria | 1861 |
| 22 | Ga0070661_100019788 | 3300005344 | Bacteria | 4798 |
| 23 | Ga0070661_100094101 | 3300005344 | Bacteria | 2220 |
| 24 | Ga0070668_100097080 | 3300005347 | Bacteria | 2330 |
| 25 | Ga0070669_100487942 | 3300005353 | Bacteria | 1020 |
| 26 | Ga0070671_100113812 | 3300005355 | Bacteria | 2274 |
| 27 | Ga0070674_100001923 | 3300005356 | Bacteria | 11314 |
| 28 | Ga0070674_100131110 | 3300005356 | Bacteria | 1869 |
| 29 | Ga0070688_100011954 | 3300005365 | Bacteria | 4848 |
| 30 | Ga0070659_100009404 | 3300005366 | Bacteria | 7180 |
| 31 | Ga0070659_100092639 | 3300005366 | Bacteria | 2423 |
| 32 | Ga0070659_100194269 | 3300005366 | Bacteria | 1669 |
| 33 | Ga0070709_10115489 | 3300005434 | Bacteria | 1810 |
| 34 | Ga0070709_10338949 | 3300005434 | Bacteria | 1108 |
| 35 | Ga0070714_100004653 | 3300005435 | Bacteria | 10359 |
| 36 | Ga0070714_100303496 | 3300005435 | Bacteria | 1489 |
| 37 | Ga0070714_100466897 | 3300005435 | Bacteria | 1200 |
| 38 | Ga0070714_100501313 | 3300005435 | Bacteria | 1158 |
| 39 | Ga0070713_100075434 | 3300005436 | Bacteria | 2860 |
| 40 | Ga0070710_10037223 | 3300005437 | Bacteria | 2665 |
| 41 | Ga0070711_100006191 | 3300005439 | Bacteria | 7198 |
| 42 | Ga0070711_100033061 | 3300005439 | Bacteria | 3443 |
| 43 | Ga0070700_100038025 | 3300005441 | Bacteria | 2931 |
| 44 | Ga0070694_100014705 | 3300005444 | Bacteria | 4903 |
| 45 | Ga0070694_100101036 | 3300005444 | Bacteria | 2040 |
| 46 | Ga0070708_100081955 | 3300005445 | Bacteria | 2922 |
| 47 | Ga0070678_100004589 | 3300005456 | Bacteria | 7848 |
| 48 | Ga0070678_100324901 | 3300005456 | Bacteria | 1315 |
| 49 | Ga0070681_10002352 | 3300005458 | Bacteria | 17268 |
| 50 | Ga0070681_10003595 | 3300005458 | Bacteria | 14536 |
| 51 | Ga0070681_10010574 | 3300005458 | Bacteria | 9115 |
| 52 | Ga0070681_10013434 | 3300005458 | Bacteria | 8136 |
| 53 | Ga0070681_10037244 | 3300005458 | Bacteria | 4882 |
| 54 | Ga0070681_10037651 | 3300005458 | Bacteria | 4853 |
| 55 | Ga0070681_10080413 | 3300005458 | Bacteria | 3215 |
| 56 | Ga0070681_10085889 | 3300005458 | Bacteria | 3099 |
| 57 | Ga0070681_10103037 | 3300005458 | Bacteria | 2798 |
| 58 | Ga0070681_10905078 | 3300005458 | Bacteria | 801 |
| 59 | Ga0068867_100002148 | 3300005459 | Bacteria | 13831 |
| 60 | Ga0070685_10024215 | 3300005466 | Bacteria | 3332 |
| 61 | Ga0070706_100234109 | 3300005467 | Bacteria | 1715 |
| 62 | Ga0070706_100309288 | 3300005467 | Unclassified | 1474 |
| 63 | Ga0070707_100592316 | 3300005468 | Unclassified | 1071 |
| 64 | Ga0070698_100068513 | 3300005471 | Bacteria | 3565 |
| 65 | Ga0070698_100403972 | 3300005471 | Bacteria | 1299 |
| 66 | Ga0070679_100007912 | 3300005530 | Bacteria | 9974 |
| 67 | Ga0070679_100020102 | 3300005530 | Bacteria | 6506 |
| 68 | Ga0070679_100058729 | 3300005530 | Bacteria | 3833 |
| 69 | Ga0070679_100144831 | 3300005530 | Unclassified | 2354 |
| 70 | Ga0070679_100164593 | 3300005530 | Bacteria | 2192 |
| 71 | Ga0070679_100167130 | 3300005530 | Bacteria | 2173 |
| 72 | Ga0070679_100174091 | 3300005530 | Bacteria | 2125 |
| 73 | Ga0070679_100258005 | 3300005530 | Bacteria | 1698 |
| 74 | Ga0070679_100320406 | 3300005530 | Bacteria | 1499 |
| 75 | Ga0070679_100343975 | 3300005530 | Bacteria | 1439 |
| 76 | Ga0070679_100445843 | 3300005530 | Bacteria | 1239 |
| 77 | Ga0070679_100685161 | 3300005530 | Bacteria | 968 |
| 78 | Ga0070684_100024020 | 3300005535 | Bacteria | 5109 |
| 79 | Ga0070684_100027971 | 3300005535 | Bacteria | 4765 |
| 80 | Ga0070684_100036184 | 3300005535 | Bacteria | 4230 |
| 81 | Ga0070684_100078135 | 3300005535 | Bacteria | 2923 |
| 82 | Ga0070684_100178767 | 3300005535 | Bacteria | 1929 |
| 83 | Ga0070684_100179445 | 3300005535 | Bacteria | 1925 |
| 84 | Ga0070684_100206830 | 3300005535 | Bacteria | 1789 |
| 85 | Ga0070684_100286270 | 3300005535 | Bacteria | 1510 |
| 86 | Ga0070684_100353010 | 3300005535 | Bacteria | 1353 |
| 87 | Ga0068853_100056394 | 3300005539 | Bacteria | 3387 |
| 88 | Ga0068853_100211232 | 3300005539 | Bacteria | 1769 |
| 89 | Ga0068853_100759342 | 3300005539 | Bacteria | 927 |
| 90 | Ga0070672_100056701 | 3300005543 | Bacteria | 3073 |
| 91 | Ga0070686_100004436 | 3300005544 | Bacteria | 7741 |
| 92 | Ga0070695_100000007 | 3300005545 | Bacteria | 89343 |
| 93 | Ga0070696_100007993 | 3300005546 | Bacteria | 7062 |
| 94 | Ga0070693_100059312 | 3300005547 | Bacteria | 2218 |
| 95 | Ga0070693_100061905 | 3300005547 | Bacteria | 2177 |
| 96 | Ga0070693_100291123 | 3300005547 | Bacteria | 1097 |
| 97 | Ga0070665_100011488 | 3300005548 | Bacteria | 8956 |
| 98 | Ga0070665_100036558 | 3300005548 | Bacteria | 4940 |
| 99 | Ga0068855_100007604 | 3300005563 | Bacteria | 13111 |
| 100 | Ga0068855_100030809 | 3300005563 | Bacteria | 6413 |
| 101 | Ga0068855_100085789 | 3300005563 | Bacteria | 3642 |
| 102 | Ga0068855_100136965 | 3300005563 | Bacteria | 2792 |
| 103 | Ga0068855_100142801 | 3300005563 | Bacteria | 2727 |
| 104 | Ga0068855_100143099 | 3300005563 | Bacteria | 2724 |
| 105 | Ga0070664_100183221 | 3300005564 | Bacteria | 1862 |
| 106 | Ga0070664_100557813 | 3300005564 | Unclassified | 1059 |
| 107 | Ga0068857_100019412 | 3300005577 | Bacteria | 5968 |
| 108 | Ga0068857_100030217 | 3300005577 | Bacteria | 4782 |
| 109 | Ga0068857_100030773 | 3300005577 | Bacteria | 4741 |
| 110 | Ga0068854_100072256 | 3300005578 | Bacteria | 2526 |
| 111 | Ga0068856_100018376 | 3300005614 | Bacteria | 6775 |
| 112 | Ga0068856_100033958 | 3300005614 | Bacteria | 4995 |
| 113 | Ga0068856_100045426 | 3300005614 | Bacteria | 4325 |
| 114 | Ga0068856_100477282 | 3300005614 | Bacteria | 1268 |
| 115 | Ga0068856_100682329 | 3300005614 | Bacteria | 1048 |
| 116 | Ga0070702_100034424 | 3300005615 | Bacteria | 2792 |
| 117 | Ga0068852_100027164 | 3300005616 | Bacteria | 4662 |
| 118 | Ga0068852_100210811 | 3300005616 | Bacteria | 1843 |
| 119 | Ga0068859_100014318 | 3300005617 | Bacteria | 7956 |
| 120 | Ga0068859_100723792 | 3300005617 | Bacteria | 1085 |
| 121 | Ga0068859_100891993 | 3300005617 | Bacteria | 974 |
| 122 | Ga0068864_100442979 | 3300005618 | Bacteria | 1241 |
| 123 | Ga0068866_10002212 | 3300005718 | Bacteria | 8077 |
| 124 | Ga0068861_100007529 | 3300005719 | Bacteria | 7466 |
| 125 | Ga0068861_100357831 | 3300005719 | Bacteria | 1283 |
| 126 | Ga0068861_100385297 | 3300005719 | Bacteria | 1240 |
| 127 | Ga0068863_100724928 | 3300005841 | Bacteria | 989 |
| 128 | Ga0068858_100364670 | 3300005842 | Bacteria | 1385 |
| 129 | Ga0081455_10001912 | 3300005937 | Bacteria | 25017 |
| 130 | Ga0081455_10005929 | 3300005937 | Bacteria | 13262 |
| 131 | Ga0081455_10031254 | 3300005937 | Bacteria | 4821 |
| 132 | Ga0081455_10053919 | 3300005937 | Bacteria | 3431 |
| 133 | Ga0081455_10201927 | 3300005937 | Bacteria | 1488 |
| 134 | Ga0081538_10000238 | 3300005981 | Bacteria | 62256 |
| 135 | Ga0081538_10000732 | 3300005981 | Bacteria | 35860 |
| 136 | Ga0070717_10014842 | 3300006028 | Bacteria | 5994 |
| 137 | Ga0070717_10307849 | 3300006028 | Bacteria | 1409 |
| 138 | Ga0075365_10015502 | 3300006038 | Bacteria | 4613 |
| 139 | Ga0070712_100004041 | 3300006175 | Bacteria | 9005 |
| 140 | Ga0070712_100031937 | 3300006175 | Bacteria | 3552 |
| 141 | Ga0070712_100443186 | 3300006175 | Bacteria | 1080 |
| 142 | Ga0068871_100012365 | 3300006358 | Bacteria | 6288 |
| 143 | Ga0068871_100249723 | 3300006358 | Bacteria | 1545 |
| 144 | Ga0075428_100002031 | 3300006844 | Bacteria | 21804 |
| 145 | Ga0075430_100017348 | 3300006846 | Bacteria | 6131 |
| 146 | Ga0075431_100144540 | 3300006847 | Bacteria | 2451 |
| 147 | Ga0075433_10018360 | 3300006852 | Bacteria | 5813 |
| 148 | Ga0075433_10509230 | 3300006852 | Bacteria | 1059 |
| 149 | Ga0075434_100009519 | 3300006871 | Bacteria | 9066 |
| 150 | Ga0075434_100054617 | 3300006871 | Bacteria | 3968 |
| 151 | Ga0075434_100067001 | 3300006871 | Bacteria | 3577 |
| 152 | Ga0075434_100363118 | 3300006871 | Bacteria | 1469 |
| 153 | Ga0075434_100872878 | 3300006871 | Bacteria | 915 |
| 154 | Ga0075434_100883439 | 3300006871 | Bacteria | 909 |
| 155 | Ga0075429_100016785 | 3300006880 | Bacteria | 6338 |
| 156 | Ga0075429_100791609 | 3300006880 | Bacteria | 830 |
| 157 | Ga0068865_100000598 | 3300006881 | Bacteria | 20240 |
| 158 | Ga0068865_100188777 | 3300006881 | Bacteria | 1592 |
| 159 | Ga0075436_100097594 | 3300006914 | Bacteria | 2044 |
| 160 | Ga0097620_100014318 | 3300006931 | Bacteria | 7956 |
| 161 | Ga0097620_100723681 | 3300006931 | Bacteria | 1085 |
| 162 | Ga0097620_100892016 | 3300006931 | Bacteria | 974 |
| 163 | Ga0075435_100003270 | 3300007076 | Bacteria | 10981 |
| 164 | Ga0105240_10020317 | 3300009093 | Bacteria | 8862 |
| 165 | Ga0105240_10030751 | 3300009093 | Bacteria | 6974 |
| 166 | Ga0105240_10034249 | 3300009093 | Bacteria | 6553 |
| 167 | Ga0105240_10045838 | 3300009093 | Bacteria | 5545 |
| 168 | Ga0105240_10097231 | 3300009093 | Bacteria | 3588 |
| 169 | Ga0105240_10261758 | 3300009093 | Bacteria | 1995 |
| 170 | Ga0105240_10361728 | 3300009093 | Bacteria | 1643 |
| 171 | Ga0105240_10394808 | 3300009093 | Bacteria | 1559 |
| 172 | Ga0105240_10534683 | 3300009093 | Bacteria | 1299 |
| 173 | Ga0111539_10007774 | 3300009094 | Bacteria | 13687 |
| 174 | Ga0111539_10085758 | 3300009094 | Bacteria | 3701 |
| 175 | Ga0111539_10232834 | 3300009094 | Bacteria | 2145 |
| 176 | Ga0111539_10478988 | 3300009094 | Unclassified | 1449 |
| 177 | Ga0111539_10566682 | 3300009094 | Bacteria | 1323 |
| 178 | Ga0111539_11428249 | 3300009094 | Bacteria | 803 |
| 179 | Ga0105245_10037476 | 3300009098 | Bacteria | 4311 |
| 180 | Ga0105245_10042907 | 3300009098 | Bacteria | 4034 |
| 181 | Ga0105245_10314189 | 3300009098 | Bacteria | 1542 |
| 182 | Ga0105245_10386361 | 3300009098 | Bacteria | 1395 |
| 183 | Ga0105245_10563244 | 3300009098 | Bacteria | 1162 |
| 184 | Ga0105245_10832763 | 3300009098 | Bacteria | 962 |
| 185 | Ga0105247_10019067 | 3300009101 | Bacteria | 4119 |
| 186 | Ga0114129_10000663 | 3300009147 | Bacteria | 43174 |
| 187 | Ga0114129_10019250 | 3300009147 | Bacteria | 9724 |
| 188 | Ga0114129_10072699 | 3300009147 | Bacteria | 4794 |
| 189 | Ga0114129_10154752 | 3300009147 | Bacteria | 3136 |
| 190 | Ga0114129_10533366 | 3300009147 | Bacteria | 1529 |
| 191 | Ga0114129_11463354 | 3300009147 | Bacteria | 841 |
| 192 | Ga0105243_10001070 | 3300009148 | Bacteria | 25043 |
| 193 | Ga0105243_10306972 | 3300009148 | Bacteria | 1440 |
| 194 | Ga0105241_10006225 | 3300009174 | Bacteria | 8799 |
| 195 | Ga0105241_10442831 | 3300009174 | Bacteria | 1148 |
| 196 | Ga0105242_10264266 | 3300009176 | Bacteria | 1556 |
| 197 | Ga0105242_10617391 | 3300009176 | Bacteria | 1050 |
| 198 | Ga0105248_10338602 | 3300009177 | Unclassified | 1694 |
| 199 | Ga0105237_10189511 | 3300009545 | Bacteria | 2057 |
| 200 | Ga0105238_10090084 | 3300009551 | Bacteria | 3055 |
| 201 | Ga0105238_10365572 | 3300009551 | Bacteria | 1433 |
| 202 | Ga0105249_10000462 | 3300009553 | Bacteria | 37859 |
| 203 | Ga0105239_10008937 | 3300010375 | Bacteria | 11336 |
| 204 | Ga0105239_10459399 | 3300010375 | Bacteria | 1445 |
| 205 | Ga0105239_10721398 | 3300010375 | Bacteria | 1140 |
| 206 | Ga0105246_10031802 | 3300011119 | Bacteria | 3494 |
| 207 | Ga0157371_10193305 | 3300013102 | Bacteria | 1457 |
| 208 | Ga0157371_10390704 | 3300013102 | Bacteria | 1017 |
| 209 | Ga0157370_10011210 | 3300013104 | Bacteria | 9401 |
| 210 | Ga0157370_10018219 | 3300013104 | Bacteria | 7066 |
| 211 | Ga0157370_10031630 | 3300013104 | Bacteria | 5175 |
| 212 | Ga0157370_10115006 | 3300013104 | Bacteria | 2513 |
| 213 | Ga0157369_10002883 | 3300013105 | Bacteria | 20540 |
| 214 | Ga0157369_10005196 | 3300013105 | Bacteria | 15209 |
| 215 | Ga0157369_10031406 | 3300013105 | Bacteria | 5849 |
| 216 | Ga0157369_10049518 | 3300013105 | Bacteria | 4554 |
| 217 | Ga0157369_10122807 | 3300013105 | Bacteria | 2755 |
| 218 | Ga0157369_10182179 | 3300013105 | Bacteria | 2210 |
| 219 | Ga0157369_10713978 | 3300013105 | Unclassified | 1032 |
| 220 | Ga0157369_10799654 | 3300013105 | Bacteria | 969 |
| 221 | Ga0157374_10088070 | 3300013296 | Bacteria | 2956 |
| 222 | Ga0157374_10091638 | 3300013296 | Bacteria | 2899 |
| 223 | Ga0157374_10195999 | 3300013296 | Bacteria | 1977 |
| 224 | Ga0157374_10607440 | 3300013296 | Bacteria | 1104 |
| 225 | Ga0157378_10003364 | 3300013297 | Bacteria | 14227 |
| 226 | Ga0157378_10015883 | 3300013297 | Bacteria | 6592 |
| 227 | Ga0163162_10006948 | 3300013306 | Bacteria | 10974 |
| 228 | Ga0163162_10280169 | 3300013306 | Bacteria | 1799 |
| 229 | Ga0157372_10014938 | 3300013307 | Bacteria | 8314 |
| 230 | Ga0157372_10082283 | 3300013307 | Bacteria | 3644 |
| 231 | Ga0157372_10179700 | 3300013307 | Bacteria | 2449 |
| 232 | Ga0157372_10225425 | 3300013307 | Bacteria | 2173 |
| 233 | Ga0157372_10394134 | 3300013307 | Bacteria | 1614 |
| 234 | Ga0163163_10074767 | 3300014325 | Bacteria | 3381 |
| 235 | Ga0157380_10006721 | 3300014326 | Bacteria | 8127 |
| 236 | Ga0182008_10002753 | 3300014497 | Bacteria | 10904 |
| 237 | Ga0157376_10030962 | 3300014969 | Bacteria | 4279 |
| 238 | Ga0157376_10302804 | 3300014969 | Bacteria | 1514 |
| 239 | Ga0197907_10486216 | 3300020069 | Bacteria | 4233 |
| 240 | Ga0197907_10946547 | 3300020069 | Bacteria | 3017 |
| 241 | Ga0206356_10571689 | 3300020070 | Unclassified | 1041 |
| 242 | Ga0206356_11388465 | 3300020070 | Bacteria | 1437 |
| 243 | Ga0206354_10168775 | 3300020081 | Bacteria | 1349 |
| 244 | Ga0206354_10809368 | 3300020081 | Bacteria | 1258 |
| 245 | Ga0206354_11438060 | 3300020081 | Bacteria | 2866 |
| 246 | Ga0206353_10004980 | 3300020082 | Bacteria | 12482 |
| 247 | Ga0206353_10855307 | 3300020082 | Bacteria | 1266 |
| 248 | Ga0206353_10866168 | 3300020082 | Bacteria | 6983 |
| 249 | Ga0206353_11560650 | 3300020082 | Bacteria | 1721 |
| 250 | Ga0213874_10071456 | 3300021377 | Bacteria | 1108 |
| 251 | Ga0207692_10048265 | 3300025898 | Bacteria | 2142 |
| 252 | Ga0207642_10007289 | 3300025899 | Bacteria | 3726 |
| 253 | Ga0207710_10039609 | 3300025900 | Bacteria | 2086 |
| 254 | Ga0207688_10288445 | 3300025901 | Bacteria | 1001 |
| 255 | Ga0207647_10020804 | 3300025904 | Bacteria | 4393 |
| 256 | Ga0207685_10023373 | 3300025905 | Bacteria | 2103 |
| 257 | Ga0207699_10007942 | 3300025906 | Bacteria | 5207 |
| 258 | Ga0207699_10107165 | 3300025906 | Bacteria | 1785 |
| 259 | Ga0207705_10003887 | 3300025909 | Bacteria | 11365 |
| 260 | Ga0207705_10017397 | 3300025909 | Bacteria | 5148 |
| 261 | Ga0207705_10050591 | 3300025909 | Bacteria | 2991 |
| 262 | Ga0207705_10516960 | 3300025909 | Bacteria | 927 |
| 263 | Ga0207684_10435422 | 3300025910 | Bacteria | 1126 |
| 264 | Ga0207654_10033192 | 3300025911 | Bacteria | 2859 |
| 265 | Ga0207654_10455564 | 3300025911 | Bacteria | 897 |
| 266 | Ga0207707_10004063 | 3300025912 | Bacteria | 12958 |
| 267 | Ga0207707_10008618 | 3300025912 | Bacteria | 8845 |
| 268 | Ga0207707_10032326 | 3300025912 | Bacteria | 4579 |
| 269 | Ga0207707_10054937 | 3300025912 | Unclassified | 3465 |
| 270 | Ga0207707_10055614 | 3300025912 | Bacteria | 3442 |
| 271 | Ga0207707_10064290 | 3300025912 | Bacteria | 3193 |
| 272 | Ga0207707_10082866 | 3300025912 | Bacteria | 2800 |
| 273 | Ga0207707_10151769 | 3300025912 | Bacteria | 2025 |
| 274 | Ga0207707_10687163 | 3300025912 | Bacteria | 860 |
| 275 | Ga0207695_10130596 | 3300025913 | Bacteria | 2470 |
| 276 | Ga0207695_10173651 | 3300025913 | Unclassified | 2079 |
| 277 | Ga0207695_10190224 | 3300025913 | Bacteria | 1970 |
| 278 | Ga0207695_10256295 | 3300025913 | Bacteria | 1648 |
| 279 | Ga0207695_10326251 | 3300025913 | Bacteria | 1424 |
| 280 | Ga0207671_10531418 | 3300025914 | Bacteria | 938 |
| 281 | Ga0207693_10000175 | 3300025915 | Bacteria | 58611 |
| 282 | Ga0207693_10004462 | 3300025915 | Bacteria | 11827 |
| 283 | Ga0207693_10024538 | 3300025915 | Bacteria | 4783 |
| 284 | Ga0207693_10026443 | 3300025915 | Bacteria | 4593 |
| 285 | Ga0207693_10214943 | 3300025915 | Bacteria | 1511 |
| 286 | Ga0207693_10319788 | 3300025915 | Bacteria | 1215 |
| 287 | Ga0207663_10006653 | 3300025916 | Bacteria | 5942 |
| 288 | Ga0207663_10045032 | 3300025916 | Bacteria | 2712 |
| 289 | Ga0207663_10187359 | 3300025916 | Bacteria | 1483 |
| 290 | Ga0207663_10262673 | 3300025916 | Bacteria | 1275 |
| 291 | Ga0207660_10044303 | 3300025917 | Bacteria | 3130 |
| 292 | Ga0207660_10061836 | 3300025917 | Bacteria | 2696 |
| 293 | Ga0207660_10118472 | 3300025917 | Bacteria | 2003 |
| 294 | Ga0207660_10154121 | 3300025917 | Bacteria | 1768 |
| 295 | Ga0207660_10207811 | 3300025917 | Unclassified | 1532 |
| 296 | Ga0207660_10309457 | 3300025917 | Bacteria | 1259 |
| 297 | Ga0207660_10342577 | 3300025917 | Bacteria | 1197 |
| 298 | Ga0207660_10343859 | 3300025917 | Bacteria | 1195 |
| 299 | Ga0207662_10224818 | 3300025918 | Bacteria | 1224 |
| 300 | Ga0207657_10001687 | 3300025919 | Bacteria | 23810 |
| 301 | Ga0207657_10001863 | 3300025919 | Bacteria | 22803 |
| 302 | Ga0207657_10002690 | 3300025919 | Bacteria | 19155 |
| 303 | Ga0207657_10003855 | 3300025919 | Bacteria | 15925 |
| 304 | Ga0207657_10009516 | 3300025919 | Bacteria | 9758 |
| 305 | Ga0207657_10028420 | 3300025919 | Bacteria | 5101 |
| 306 | Ga0207657_10121615 | 3300025919 | Bacteria | 2148 |
| 307 | Ga0207649_10063761 | 3300025920 | Bacteria | 2328 |
| 308 | Ga0207649_10111534 | 3300025920 | Bacteria | 1828 |
| 309 | Ga0207652_10019328 | 3300025921 | Bacteria | 5602 |
| 310 | Ga0207652_10021781 | 3300025921 | Bacteria | 5293 |
| 311 | Ga0207652_10022742 | 3300025921 | Bacteria | 5191 |
| 312 | Ga0207652_10042448 | 3300025921 | Bacteria | 3871 |
| 313 | Ga0207652_10047416 | 3300025921 | Bacteria | 3670 |
| 314 | Ga0207652_10077647 | 3300025921 | Unclassified | 2898 |
| 315 | Ga0207652_10088728 | 3300025921 | Bacteria | 2714 |
| 316 | Ga0207652_10317154 | 3300025921 | Bacteria | 1407 |
| 317 | Ga0207652_10319411 | 3300025921 | Bacteria | 1402 |
| 318 | Ga0207652_10450201 | 3300025921 | Bacteria | 1161 |
| 319 | Ga0207652_10603042 | 3300025921 | Bacteria | 984 |
| 320 | Ga0207652_10702635 | 3300025921 | Bacteria | 902 |
| 321 | Ga0207646_10899964 | 3300025922 | Bacteria | 785 |
| 322 | Ga0207681_10379228 | 3300025923 | Bacteria | 1138 |
| 323 | Ga0207659_10128811 | 3300025926 | Bacteria | 1950 |
| 324 | Ga0207687_10022442 | 3300025927 | Bacteria | 4201 |
| 325 | Ga0207687_10126995 | 3300025927 | Bacteria | 1916 |
| 326 | Ga0207687_10474638 | 3300025927 | Bacteria | 1041 |
| 327 | Ga0207700_10062639 | 3300025928 | Bacteria | 2825 |
| 328 | Ga0207700_10081972 | 3300025928 | Bacteria | 2521 |
| 329 | Ga0207700_10182276 | 3300025928 | Bacteria | 1759 |
| 330 | Ga0207664_10018495 | 3300025929 | Bacteria | 5132 |
| 331 | Ga0207664_10031085 | 3300025929 | Bacteria | 4082 |
| 332 | Ga0207664_10043381 | 3300025929 | Bacteria | 3517 |
| 333 | Ga0207664_10112838 | 3300025929 | Bacteria | 2263 |
| 334 | Ga0207664_10413711 | 3300025929 | Unclassified | 1200 |
| 335 | Ga0207644_10086235 | 3300025931 | Bacteria | 2331 |
| 336 | Ga0207690_10031594 | 3300025932 | Bacteria | 3390 |
| 337 | Ga0207690_10088778 | 3300025932 | Bacteria | 2178 |
| 338 | Ga0207690_10100819 | 3300025932 | Bacteria | 2061 |
| 339 | Ga0207669_10035577 | 3300025937 | Bacteria | 2835 |
| 340 | Ga0207704_10004196 | 3300025938 | Bacteria | 6582 |
| 341 | Ga0207704_10150010 | 3300025938 | Bacteria | 1644 |
| 342 | Ga0207665_10308452 | 3300025939 | Bacteria | 1185 |
| 343 | Ga0207691_10022282 | 3300025940 | Bacteria | 5976 |
| 344 | Ga0207711_10294197 | 3300025941 | Unclassified | 1497 |
| 345 | Ga0207689_10053421 | 3300025942 | Bacteria | 3329 |
| 346 | Ga0207661_10002819 | 3300025944 | Bacteria | 12007 |
| 347 | Ga0207661_10079555 | 3300025944 | Bacteria | 2702 |
| 348 | Ga0207661_10102395 | 3300025944 | Bacteria | 2407 |
| 349 | Ga0207661_10171651 | 3300025944 | Bacteria | 1888 |
| 350 | Ga0207661_10537311 | 3300025944 | Bacteria | 1070 |
| 351 | Ga0207679_10035002 | 3300025945 | Bacteria | 3549 |
| 352 | Ga0207667_10050181 | 3300025949 | Bacteria | 4403 |
| 353 | Ga0207667_10151083 | 3300025949 | Bacteria | 2390 |
| 354 | Ga0207667_10168935 | 3300025949 | Bacteria | 2248 |
| 355 | Ga0207667_10182809 | 3300025949 | Bacteria | 2152 |
| 356 | Ga0207667_10451502 | 3300025949 | Bacteria | 1306 |
| 357 | Ga0207668_10152155 | 3300025972 | Bacteria | 1792 |
| 358 | Ga0207640_10278293 | 3300025981 | Bacteria | 1313 |
| 359 | Ga0207640_10278957 | 3300025981 | Bacteria | 1312 |
| 360 | Ga0207677_10091618 | 3300026023 | Bacteria | 2212 |
| 361 | Ga0207703_10313939 | 3300026035 | Bacteria | 1433 |
| 362 | Ga0207639_10364076 | 3300026041 | Bacteria | 1295 |
| 363 | Ga0207639_10594973 | 3300026041 | Bacteria | 1019 |
| 364 | Ga0207678_10296634 | 3300026067 | Bacteria | 1389 |
| 365 | Ga0207708_10000614 | 3300026075 | Bacteria | 27403 |
| 366 | Ga0207702_10031510 | 3300026078 | Bacteria | 4419 |
| 367 | Ga0207702_10192099 | 3300026078 | Bacteria | 1887 |
| 368 | Ga0207702_10803164 | 3300026078 | Bacteria | 930 |
| 369 | Ga0207641_10488768 | 3300026088 | Bacteria | 1194 |
| 370 | Ga0207648_10000312 | 3300026089 | Bacteria | 53245 |
| 371 | Ga0207674_10001702 | 3300026116 | Bacteria | 28143 |
| 372 | Ga0207674_10043773 | 3300026116 | Bacteria | 4615 |
| 373 | Ga0207674_10135533 | 3300026116 | Bacteria | 2424 |
| 374 | Ga0207675_100016684 | 3300026118 | Bacteria | 6857 |
| 375 | Ga0207675_100289845 | 3300026118 | Bacteria | 1592 |
| 376 | Ga0207675_100645692 | 3300026118 | Bacteria | 1064 |
| 377 | Ga0207683_10000447 | 3300026121 | Bacteria | 38155 |
| 378 | Ga0207698_10070332 | 3300026142 | Bacteria | 2772 |
| 379 | Ga0207698_10174902 | 3300026142 | Bacteria | 1895 |
| 380 | Ga0207698_10317733 | 3300026142 | Bacteria | 1457 |
| 381 | Ga0207698_10373060 | 3300026142 | Bacteria | 1355 |
| 382 | Ga0207698_11094741 | 3300026142 | Bacteria | 809 |
| 383 | Ga0207428_10010564 | 3300027907 | Bacteria | 8238 |
| 384 | Ga0207428_10111771 | 3300027907 | Bacteria | 2102 |
| 385 | Ga0268266_10480404 | 3300028379 | Bacteria | 1184 |
| 386 | Ga0268265_10162983 | 3300028380 | Bacteria | 1897 |
| 387 | Ga0265337_1037716 | 3300028556 | Bacteria | 1405 |
| 388 | Ga0265319_1002232 | 3300028563 | Bacteria | 10758 |
| 389 | Ga0265319_1005903 | 3300028563 | Bacteria | 5758 |
| 390 | Ga0265319_1034276 | 3300028563 | Bacteria | 1748 |
| 391 | Ga0265334_10005171 | 3300028573 | Bacteria | 5718 |
| 392 | Ga0265334_10006308 | 3300028573 | Bacteria | 5119 |
| 393 | Ga0265334_10057443 | 3300028573 | Bacteria | 1474 |
| 394 | Ga0265318_10001217 | 3300028577 | Bacteria | 15646 |
| 395 | Ga0265318_10004976 | 3300028577 | Bacteria | 6328 |
| 396 | Ga0265318_10017733 | 3300028577 | Bacteria | 2918 |
| 397 | Ga0265318_10033223 | 3300028577 | Bacteria | 1993 |
| 398 | Ga0265322_10005028 | 3300028654 | Bacteria | 3921 |
| 399 | Ga0265336_10019242 | 3300028666 | Bacteria | 2204 |
| 400 | Ga0265338_10002936 | 3300028800 | Bacteria | 24729 |
| 401 | Ga0265338_10004663 | 3300028800 | Bacteria | 18409 |
| 402 | Ga0265338_10005415 | 3300028800 | Bacteria | 16665 |
| 403 | Ga0265338_10006096 | 3300028800 | Bacteria | 15479 |
| 404 | Ga0265338_10011028 | 3300028800 | Bacteria | 10493 |
| 405 | Ga0265338_10022169 | 3300028800 | Bacteria | 6588 |
| 406 | Ga0265338_10023362 | 3300028800 | Bacteria | 6360 |
| 407 | Ga0265338_10032851 | 3300028800 | Bacteria | 5051 |
| 408 | Ga0265338_10103090 | 3300028800 | Bacteria | 2318 |
| 409 | Ga0265338_10115354 | 3300028800 | Bacteria | 2153 |
| 410 | Ga0265338_10135654 | 3300028800 | Unclassified | 1935 |
| 411 | Ga0265324_10010089 | 3300029957 | Bacteria | 3658 |
| 412 | Ga0265330_10001984 | 3300031235 | Bacteria | 11353 |
| 413 | Ga0265330_10021882 | 3300031235 | Bacteria | 2913 |
| 414 | Ga0265332_10001963 | 3300031238 | Bacteria | 10846 |
| 415 | Ga0265320_10010508 | 3300031240 | Bacteria | 5511 |
| 416 | Ga0265320_10116265 | 3300031240 | Bacteria | 1222 |
| 417 | Ga0265325_10001625 | 3300031241 | Bacteria | 15662 |
| 418 | Ga0265325_10074785 | 3300031241 | Bacteria | 1693 |
| 419 | Ga0265329_10004462 | 3300031242 | Bacteria | 5809 |
| 420 | Ga0265340_10013617 | 3300031247 | Bacteria | 4269 |
| 421 | Ga0265339_10015659 | 3300031249 | Bacteria | 4539 |
| 422 | Ga0265339_10047254 | 3300031249 | Bacteria | 2364 |
| 423 | Ga0265331_10004771 | 3300031250 | Bacteria | 8354 |
| 424 | Ga0265331_10128843 | 3300031250 | Bacteria | 1155 |
| 425 | Ga0265327_10010871 | 3300031251 | Bacteria | 6339 |
| 426 | Ga0265327_10015346 | 3300031251 | Bacteria | 4949 |
| 427 | Ga0265327_10020771 | 3300031251 | Bacteria | 3988 |
| 428 | Ga0265327_10035186 | 3300031251 | Bacteria | 2772 |
| 429 | Ga0265327_10039611 | 3300031251 | Bacteria | 2557 |
| 430 | Ga0265316_10010353 | 3300031344 | Bacteria | 8504 |
| 431 | Ga0265316_10031951 | 3300031344 | Bacteria | 4300 |
| 432 | Ga0265313_10009457 | 3300031595 | Bacteria | 6328 |
| 433 | Ga0265342_10007562 | 3300031712 | Bacteria | 7934 |
| 434 | Ga0265342_10012474 | 3300031712 | Bacteria | 5753 |
| 435 | Ga0265342_10035915 | 3300031712 | Bacteria | 3030 |
| 436 | Ga0265342_10039995 | 3300031712 | Bacteria | 2846 |
| 437 | Ga0265342_10068449 | 3300031712 | Bacteria | 2075 |
| 438 | Ga0307409_100106171 | 3300031995 | Bacteria | 2343 |
| 439 | Ga0307415_100008712 | 3300032126 | Bacteria | 5642 |
| 440 | Ga0373926_0014617 | 3300035083 | Bacteria | 2670 |
| 441 | Ga0373926_0016492 | 3300035083 | Bacteria | 2528 |
| 442 | Ga0373926_0066166 | 3300035083 | Bacteria | 1323 |
| 443 | Ga0373944_0011024 | 3300035089 | Bacteria | 2472 |
| 444 | Ga0373944_0054386 | 3300035089 | Bacteria | 1269 |
| 445 | Ga0373923_0075325 | 3300035111 | Bacteria | 1456 |
| 446 | Ga0373945_0006065 | 3300035116 | Bacteria | 3886 |
| 447 | Ga0373945_0036752 | 3300035116 | Bacteria | 1756 |
| 448 | Ga0373943_0000202 | 3300035170 | Bacteria | 24347 |
| 449 | Ga0373943_0000628 | 3300035170 | Bacteria | 15270 |
| 450 | Ga0373943_0024122 | 3300035170 | Bacteria | 2834 |
| 451 | Ga0373943_0098383 | 3300035170 | Unclassified | 1526 |
| 452 | Ga0373943_0387907 | 3300035170 | Bacteria | 805 |
| 453 | Ga0373946_0048003 | 3300035171 | Bacteria | 1775 |
| 454 | Ga0373935_0021166 | 3300035692 | Bacteria | 3980 |
| 455 | Ga0373935_0080510 | 3300035692 | Bacteria | 2116 |
| 456 | Ga0373927_0022200 | 3300035695 | Bacteria | 4158 |
| 457 | Ga0373927_0049940 | 3300035695 | Bacteria | 2704 |
| 458 | Ga0373927_0069551 | 3300035695 | Unclassified | 2278 |
| 459 | Ga0373933_0118690 | 3300035724 | Unclassified | 1655 |
| 460 | Ga0373947_0001859 | 3300035725 | Bacteria | 12872 |
| 461 | Ga0373947_0004063 | 3300035725 | Bacteria | 8608 |
| 462 | Ga0373947_0007481 | 3300035725 | Bacteria | 6321 |
| 463 | Ga0373947_0110729 | 3300035725 | Bacteria | 1735 |
| 464 | Ga0373925_0002950 | 3300037068 | Bacteria | 13427 |
| 465 | Ga0373925_0004197 | 3300037068 | Bacteria | 10934 |
| 466 | Ga0373925_0207685 | 3300037068 | Bacteria | 1559 |
| 467 | Ga0395899_0003838 | 3300037312 | Bacteria | 11850 |
| 468 | Ga0395899_0006929 | 3300037312 | Bacteria | 8778 |
| 469 | Ga0395899_0013646 | 3300037312 | Bacteria | 6210 |
| 470 | Ga0395899_0028021 | 3300037312 | Bacteria | 4242 |
| 471 | Ga0395899_0028559 | 3300037312 | Bacteria | 4199 |
| 472 | Ga0395899_0035495 | 3300037312 | Bacteria | 3743 |
| 473 | Ga0395899_0042470 | 3300037312 | Bacteria | 3394 |
| 474 | Ga0395899_0044960 | 3300037312 | Bacteria | 3289 |
| 475 | Ga0395899_0182628 | 3300037312 | Bacteria | 1472 |
| 476 | Ga0395900_0001305 | 3300037418 | Bacteria | 30343 |
| 477 | Ga0395900_0001795 | 3300037418 | Bacteria | 24607 |
| 478 | Ga0395900_0004382 | 3300037418 | Bacteria | 14980 |
| 479 | Ga0395900_0008431 | 3300037418 | Bacteria | 10602 |
| 480 | Ga0395900_0009973 | 3300037418 | Bacteria | 9723 |
| 481 | Ga0395900_0019920 | 3300037418 | Bacteria | 6839 |
| 482 | Ga0395900_0044983 | 3300037418 | Bacteria | 4546 |
| 483 | Ga0395900_0051108 | 3300037418 | Bacteria | 4258 |
| 484 | Ga0395900_0065587 | 3300037418 | Bacteria | 3730 |
| 485 | Ga0395900_0101801 | 3300037418 | Bacteria | 2950 |
| 486 | Ga0395900_0125629 | 3300037418 | Bacteria | 2631 |
| 487 | Ga0395900_0451995 | 3300037418 | Bacteria | 1241 |
| 488 | Ga0395900_0478995 | 3300037418 | Bacteria | 1197 |
| 489 | Ga0395900_0856309 | 3300037418 | Bacteria | 834 |
| 490 | Ga0395898_0001041 | 3300037466 | Bacteria | 43245 |
| 491 | Ga0395898_0005552 | 3300037466 | Bacteria | 13601 |
| 492 | Ga0395898_0008130 | 3300037466 | Bacteria | 11106 |
| 493 | Ga0395898_0014237 | 3300037466 | Bacteria | 8176 |
| 494 | Ga0395898_0030154 | 3300037466 | Bacteria | 5429 |
| 495 | Ga0395898_0049386 | 3300037466 | Bacteria | 4122 |
| 496 | Ga0395898_0074819 | 3300037466 | Bacteria | 3271 |
| 497 | Ga0395898_0132228 | 3300037466 | Bacteria | 2389 |
| 498 | Ga0395898_0167725 | 3300037466 | Bacteria | 2099 |
| 499 | Ga0395898_0230872 | 3300037466 | Unclassified | 1765 |
| 500 | Ga0395898_0506764 | 3300037466 | Bacteria | 1148 |
| 501 | Ga0395898_0511602 | 3300037466 | Bacteria | 1142 |
| 502 | Ga0395898_0967131 | 3300037466 | Bacteria | 788 |
| 503 | Ga0395905_0003322 | 3300037471 | Bacteria | 17265 |
| 504 | Ga0395905_0004844 | 3300037471 | Bacteria | 13879 |
| 505 | Ga0395905_0007518 | 3300037471 | Bacteria | 10838 |
| 506 | Ga0395905_0033772 | 3300037471 | Bacteria | 4805 |
| 507 | Ga0395905_0062361 | 3300037471 | Bacteria | 3487 |
| 508 | Ga0395905_0102848 | 3300037471 | Bacteria | 2682 |
| 509 | Ga0395905_0187841 | 3300037471 | Bacteria | 1939 |
| 510 | Ga0395905_0195282 | 3300037471 | Bacteria | 1897 |
| 511 | Ga0395905_0220218 | 3300037471 | Bacteria | 1776 |
| 512 | Ga0395905_0265085 | 3300037471 | Bacteria | 1603 |
| 513 | Ga0395905_0407003 | 3300037471 | Bacteria | 1256 |
| 514 | Ga0395905_0627517 | 3300037471 | Bacteria | 977 |
| 515 | Ga0395901_0002535 | 3300038443 | Bacteria | 18515 |
| 516 | Ga0395901_0004613 | 3300038443 | Bacteria | 13905 |
| 517 | Ga0395901_0012470 | 3300038443 | Bacteria | 8625 |
| 518 | Ga0395901_0016459 | 3300038443 | Bacteria | 7532 |
| 519 | Ga0395901_0021482 | 3300038443 | Bacteria | 6614 |
| 520 | Ga0395901_0024699 | 3300038443 | Bacteria | 6170 |
| 521 | Ga0395901_0028470 | 3300038443 | Bacteria | 5745 |
| 522 | Ga0395901_0037776 | 3300038443 | Bacteria | 4994 |
| 523 | Ga0395901_0043740 | 3300038443 | Bacteria | 4645 |
| 524 | Ga0395901_0044798 | 3300038443 | Bacteria | 4588 |
| 525 | Ga0395901_0068108 | 3300038443 | Bacteria | 3708 |
| 526 | Ga0395901_0096495 | 3300038443 | Bacteria | 3098 |
| 527 | Ga0395901_0118097 | 3300038443 | Bacteria | 2786 |
| 528 | Ga0395901_0222416 | 3300038443 | Bacteria | 1973 |
| 529 | Ga0395901_0230403 | 3300038443 | Bacteria | 1934 |
| 530 | Ga0395901_0260587 | 3300038443 | Bacteria | 1805 |
| 531 | Ga0395901_0319212 | 3300038443 | Bacteria | 1607 |
| 532 | Ga0395901_0434127 | 3300038443 | Bacteria | 1345 |
| 533 | Ga0395901_0643692 | 3300038443 | Bacteria | 1064 |
| 534 | Ga0395901_0747391 | 3300038443 | Bacteria | 971 |
| 535 | Ga0395901_0802311 | 3300038443 | Unclassified | 930 |
| 536 | Ga0395901_1163899 | 3300038443 | Bacteria | 739 |
| 537 | Ga0436365_0668709 | 3300039437 | Bacteria | 1268 |
| 538 | Ga0436365_1318472 | 3300039437 | Bacteria | 1476 |
| 539 | Ga0436360_0831043 | 3300039438 | Bacteria | 12975 |
| 540 | Ga0436360_0901858 | 3300039438 | Bacteria | 4491 |
| 541 | Ga0436363_1243768 | 3300039450 | Bacteria | 2022 |
| 542 | Ga0436362_0236793 | 3300039453 | Bacteria | 2518 |
| 543 | Ga0436362_0621431 | 3300039453 | Bacteria | 861 |
| 544 | Ga0439466_0036859 | 3300041411 | Bacteria | 1649 |
| 545 | Ga0439465_0036990 | 3300041413 | Bacteria | 1569 |
| 546 | Ga0450912_003824 | 3300042116 | Bacteria | 1092 |
| 547 | Ga0466969_0003769 | 3300044656 | Bacteria | 8058 |
| 548 | Ga0466969_0059450 | 3300044656 | Bacteria | 1859 |
| 549 | Ga0466969_0094108 | 3300044656 | Bacteria | 1417 |
| 550 | Ga0466969_0171947 | 3300044656 | Bacteria | 993 |
| 551 | Ga0466972_0004423 | 3300044658 | Bacteria | 7027 |
| 552 | Ga0466965_0026668 | 3300044683 | Bacteria | 2801 |
| 553 | Ga0466965_0030986 | 3300044683 | Bacteria | 2607 |
| 554 | Ga0466965_0185366 | 3300044683 | Unclassified | 1099 |
| 555 | Ga0466966_0028895 | 3300044684 | Bacteria | 3610 |
| 556 | Ga0466966_0036603 | 3300044684 | Bacteria | 3168 |
| 557 | Ga0466966_0060326 | 3300044684 | Bacteria | 2394 |
| 558 | Ga0466966_0382197 | 3300044684 | Bacteria | 846 |
| 559 | Ga0466961_0003294 | 3300044693 | Bacteria | 10063 |
| 560 | Ga0466961_0004522 | 3300044693 | Bacteria | 8722 |
| 561 | Ga0466961_0041467 | 3300044693 | Bacteria | 2951 |
| 562 | Ga0466961_0041602 | 3300044693 | Bacteria | 2946 |
| 563 | Ga0466961_0119588 | 3300044693 | Bacteria | 1654 |
| 564 | Ga0466961_0250017 | 3300044693 | Bacteria | 1089 |
| 565 | Ga0466961_0253003 | 3300044693 | Bacteria | 1081 |
| 566 | Ga0466963_0000164 | 3300044694 | Bacteria | 26985 |
| 567 | Ga0466963_0000276 | 3300044694 | Bacteria | 22861 |
| 568 | Ga0466963_0000438 | 3300044694 | Bacteria | 19248 |
| 569 | Ga0466963_0000517 | 3300044694 | Bacteria | 18034 |
| 570 | Ga0466963_0000632 | 3300044694 | Bacteria | 16887 |
| 571 | Ga0466963_0000673 | 3300044694 | Bacteria | 16556 |
| 572 | Ga0466963_0000741 | 3300044694 | Bacteria | 16079 |
| 573 | Ga0466963_0002101 | 3300044694 | Bacteria | 11006 |
| 574 | Ga0466963_0002688 | 3300044694 | Bacteria | 10010 |
| 575 | Ga0466963_0017815 | 3300044694 | Bacteria | 4432 |
| 576 | Ga0466963_0029658 | 3300044694 | Bacteria | 3523 |
| 577 | Ga0466963_0035834 | 3300044694 | Bacteria | 3233 |
| 578 | Ga0466963_0038983 | 3300044694 | Bacteria | 3109 |
| 579 | Ga0466963_0068247 | 3300044694 | Bacteria | 2388 |
| 580 | Ga0466963_0110817 | 3300044694 | Bacteria | 1884 |
| 581 | Ga0466963_0187657 | 3300044694 | Bacteria | 1444 |
| 582 | Ga0466963_0192667 | 3300044694 | Bacteria | 1424 |
| 583 | Ga0466963_0279434 | 3300044694 | Bacteria | 1173 |
| 584 | Ga0466964_0003262 | 3300044706 | Bacteria | 5904 |
| 585 | Ga0466964_0006725 | 3300044706 | Bacteria | 4286 |
| 586 | Ga0466964_0013420 | 3300044706 | Bacteria | 3109 |
| 587 | Ga0466964_0112453 | 3300044706 | Bacteria | 1216 |
| 588 | Ga0466964_0115553 | 3300044706 | Bacteria | 1202 |
| 589 | Ga0466964_0156853 | 3300044706 | Bacteria | 1060 |
| 590 | Ga0466964_0182272 | 3300044706 | Bacteria | 997 |
| 591 | Ga0466971_0000481 | 3300044719 | Bacteria | 15690 |
| 592 | Ga0466971_0001552 | 3300044719 | Bacteria | 9688 |
| 593 | Ga0466971_0001914 | 3300044719 | Bacteria | 8834 |
| 594 | Ga0466971_0019901 | 3300044719 | Bacteria | 2982 |
| 595 | Ga0466971_0072725 | 3300044719 | Unclassified | 1562 |
| 596 | Ga0466971_0124840 | 3300044719 | Bacteria | 1193 |
| 597 | Ga0466968_0004224 | 3300044735 | Bacteria | 5355 |
| 598 | Ga0466968_0006450 | 3300044735 | Bacteria | 4423 |
| 599 | Ga0466968_0008503 | 3300044735 | Bacteria | 3931 |
| 600 | Ga0466968_0091729 | 3300044735 | Bacteria | 1347 |
| 601 | Ga0466968_0138655 | 3300044735 | Bacteria | 1111 |
| 602 | Ga0466970_0050071 | 3300044765 | Bacteria | 2228 |
| 603 | Ga0466970_0051273 | 3300044765 | Bacteria | 2202 |
| 604 | Ga0466970_0116154 | 3300044765 | Unclassified | 1463 |
| 605 | Ga0466957_0000468 | 3300044842 | Bacteria | 20063 |
| 606 | Ga0466957_0001689 | 3300044842 | Bacteria | 11606 |
| 607 | Ga0466957_0003049 | 3300044842 | Bacteria | 9108 |
| 608 | Ga0466957_0003662 | 3300044842 | Bacteria | 8480 |
| 609 | Ga0466957_0019150 | 3300044842 | Bacteria | 4025 |
| 610 | Ga0466957_0039136 | 3300044842 | Bacteria | 2860 |
| 611 | Ga0466957_0061801 | 3300044842 | Bacteria | 2300 |
| 612 | Ga0466957_0066675 | 3300044842 | Bacteria | 2220 |
| 613 | Ga0466957_0150446 | 3300044842 | Bacteria | 1505 |
| 614 | Ga0466957_0435564 | 3300044842 | Bacteria | 901 |
| 615 | Ga0466960_0010750 | 3300044901 | Bacteria | 3809 |
| 616 | Ga0466960_0011479 | 3300044901 | Bacteria | 3709 |
| 617 | Ga0466959_0001767 | 3300045049 | Bacteria | 13474 |
| 618 | Ga0466959_0010806 | 3300045049 | Bacteria | 6543 |
| 619 | Ga0466959_0019080 | 3300045049 | Bacteria | 5040 |
| 620 | Ga0466959_0028028 | 3300045049 | Bacteria | 4176 |
| 621 | Ga0466959_0081124 | 3300045049 | Bacteria | 2338 |
| 622 | Ga0466959_0128124 | 3300045049 | Bacteria | 1800 |
| 623 | Ga0451576_0257673 | 3300045051 | Bacteria | 1823 |
| 624 | Ga0466958_0002075 | 3300045836 | Bacteria | 9910 |
| 625 | Ga0466958_0005483 | 3300045836 | Bacteria | 6838 |
| 626 | Ga0466958_0007875 | 3300045836 | Bacteria | 5888 |
| 627 | Ga0466958_0010034 | 3300045836 | Bacteria | 5292 |
| 628 | Ga0466958_0032583 | 3300045836 | Bacteria | 3101 |
| 629 | Ga0466958_0038614 | 3300045836 | Bacteria | 2865 |
| 630 | Ga0466958_0084717 | 3300045836 | Bacteria | 1955 |
| 631 | Ga0466958_0106467 | 3300045836 | Bacteria | 1748 |
| 632 | Ga0466958_0151020 | 3300045836 | Bacteria | 1465 |
| 633 | Ga0466967_0000047 | 3300045976 | Bacteria | 43648 |
| 634 | Ga0466967_0002201 | 3300045976 | Bacteria | 11993 |
| 635 | Ga0466967_0003956 | 3300045976 | Bacteria | 9857 |
| 636 | Ga0466967_0005125 | 3300045976 | Bacteria | 9006 |
| 637 | Ga0466967_0007722 | 3300045976 | Bacteria | 7796 |
| 638 | Ga0466967_0011353 | 3300045976 | Bacteria | 6740 |
| 639 | Ga0466967_0015887 | 3300045976 | Bacteria | 5916 |
| 640 | Ga0466967_0016795 | 3300045976 | Bacteria | 5785 |
| 641 | Ga0466967_0029149 | 3300045976 | Bacteria | 4616 |
| 642 | Ga0466967_0037497 | 3300045976 | Bacteria | 4149 |
| 643 | Ga0466967_0048736 | 3300045976 | Bacteria | 3701 |
| 644 | Ga0466967_0058888 | 3300045976 | Bacteria | 3397 |
| 645 | Ga0466967_0059909 | 3300045976 | Bacteria | 3371 |
| 646 | Ga0466967_0059987 | 3300045976 | Bacteria | 3369 |
| 647 | Ga0466967_0062637 | 3300045976 | Bacteria | 3302 |
| 648 | Ga0466967_0090251 | 3300045976 | Bacteria | 2783 |
| 649 | Ga0466967_0104505 | 3300045976 | Bacteria | 2593 |
| 650 | Ga0466967_0185980 | 3300045976 | Bacteria | 1961 |
| 651 | Ga0466967_0260828 | 3300045976 | Bacteria | 1658 |
| 652 | Ga0466967_0271803 | 3300045976 | Bacteria | 1624 |
| 653 | Ga0466967_0668370 | 3300045976 | Bacteria | 1028 |
| 654 | Ga0466967_0715446 | 3300045976 | Bacteria | 992 |
| 655 | Ga0466967_0767658 | 3300045976 | Bacteria | 956 |
| 656 | Ga0495592_0002732 | 3300046454 | Bacteria | 12499 |
| 657 | Ga0495592_0138274 | 3300046454 | Bacteria | 1697 |
| 658 | Ga0495592_0462157 | 3300046454 | Bacteria | 793 |
| 659 | Ga0495603_0007242 | 3300046455 | Bacteria | 6660 |
| 660 | Ga0495603_0007937 | 3300046455 | Bacteria | 6405 |
| 661 | Ga0495603_0095717 | 3300046455 | Bacteria | 1735 |
| 662 | Ga0495629_0001934 | 3300046459 | Bacteria | 16136 |
| 663 | Ga0495629_0014311 | 3300046459 | Bacteria | 5709 |
| 664 | Ga0495629_0014949 | 3300046459 | Bacteria | 5576 |
| 665 | Ga0495629_0018947 | 3300046459 | Bacteria | 4922 |
| 666 | Ga0495629_0209154 | 3300046459 | Bacteria | 1348 |
| 667 | Ga0495629_0267095 | 3300046459 | Unclassified | 1176 |
| 668 | Ga0495641_0002017 | 3300046461 | Bacteria | 16488 |
| 669 | Ga0495641_0003398 | 3300046461 | Bacteria | 11936 |
| 670 | Ga0495641_0009544 | 3300046461 | Bacteria | 5753 |
| 671 | Ga0495641_0014182 | 3300046461 | Bacteria | 4325 |
| 672 | Ga0495651_0054488 | 3300046462 | Bacteria | 3075 |
| 673 | Ga0495651_0090009 | 3300046462 | Bacteria | 2302 |
| 674 | Ga0495653_0005518 | 3300046463 | Bacteria | 10305 |
| 675 | Ga0495653_0032590 | 3300046463 | Bacteria | 4135 |
| 676 | Ga0495653_0048893 | 3300046463 | Bacteria | 3261 |
| 677 | Ga0495653_0062456 | 3300046463 | Bacteria | 2815 |
| 678 | Ga0495653_0068600 | 3300046463 | Bacteria | 2659 |
| 679 | Ga0495653_0118801 | 3300046463 | Unclassified | 1888 |
| 680 | Ga0495653_0457158 | 3300046463 | Bacteria | 802 |
| 681 | Ga0495580_0006348 | 3300046472 | Bacteria | 9644 |
| 682 | Ga0495582_0005349 | 3300046473 | Bacteria | 7166 |
| 683 | Ga0495582_0007435 | 3300046473 | Bacteria | 6064 |
| 684 | Ga0495582_0013497 | 3300046473 | Bacteria | 4498 |
| 685 | Ga0495582_0015744 | 3300046473 | Bacteria | 4148 |
| 686 | Ga0495582_0017838 | 3300046473 | Bacteria | 3880 |
| 687 | Ga0495605_0056138 | 3300046474 | Bacteria | 1900 |
| 688 | Ga0495605_0160539 | 3300046474 | Unclassified | 998 |
| 689 | Ga0495639_0000291 | 3300046475 | Bacteria | 24492 |
| 690 | Ga0495639_0002764 | 3300046475 | Bacteria | 7626 |
| 691 | Ga0495662_0000267 | 3300046476 | Bacteria | 22132 |
| 692 | Ga0495662_0006357 | 3300046476 | Bacteria | 5903 |
| 693 | Ga0495662_0123477 | 3300046476 | Bacteria | 1271 |
| 694 | Ga0495664_0007586 | 3300046477 | Bacteria | 6031 |
| 695 | Ga0495664_0112373 | 3300046477 | Bacteria | 1644 |
| 696 | Ga0495584_0159356 | 3300046491 | Bacteria | 1147 |
| 697 | Ga0495585_0138335 | 3300046492 | Bacteria | 1277 |
| 698 | Ga0495594_0161208 | 3300046499 | Bacteria | 1275 |
| 699 | Ga0495594_0262739 | 3300046499 | Bacteria | 983 |
| 700 | Ga0495594_0275701 | 3300046499 | Bacteria | 958 |
| 701 | Ga0495594_0286919 | 3300046499 | Bacteria | 938 |
| 702 | Ga0495596_0036892 | 3300046500 | Bacteria | 1935 |
| 703 | Ga0495607_0036467 | 3300046501 | Bacteria | 2962 |
| 704 | Ga0495607_0062898 | 3300046501 | Bacteria | 2102 |
| 705 | Ga0495608_0018741 | 3300046511 | Bacteria | 4769 |
| 706 | Ga0495608_0066473 | 3300046511 | Bacteria | 2360 |
| 707 | Ga0495618_0006267 | 3300046514 | Bacteria | 7219 |
| 708 | Ga0495618_0052983 | 3300046514 | Bacteria | 2566 |
| 709 | Ga0495628_0053021 | 3300046516 | Bacteria | 3202 |
| 710 | Ga0495628_0056803 | 3300046516 | Bacteria | 3080 |
| 711 | Ga0495628_0166266 | 3300046516 | Bacteria | 1674 |
| 712 | Ga0495628_0332263 | 3300046516 | Bacteria | 1120 |
| 713 | Ga0495630_0000631 | 3300046517 | Bacteria | 25489 |
| 714 | Ga0495630_0001460 | 3300046517 | Bacteria | 16372 |
| 715 | Ga0495630_0021106 | 3300046517 | Bacteria | 4808 |
| 716 | Ga0495630_0029216 | 3300046517 | Bacteria | 4097 |
| 717 | Ga0495630_0049495 | 3300046517 | Bacteria | 3145 |
| 718 | Ga0495630_0271962 | 3300046517 | Bacteria | 1294 |
| 719 | Ga0495630_0403736 | 3300046517 | Bacteria | 1047 |
| 720 | Ga0495631_0188582 | 3300046518 | Bacteria | 883 |
| 721 | Ga0495631_0194473 | 3300046518 | Bacteria | 868 |
| 722 | Ga0495644_0020786 | 3300046523 | Bacteria | 2504 |
| 723 | Ga0495644_0116957 | 3300046523 | Bacteria | 1013 |
| 724 | Ga0495663_0025528 | 3300046525 | Bacteria | 1723 |
| 725 | Ga0495666_0000270 | 3300046526 | Bacteria | 22402 |
| 726 | Ga0495652_0004378 | 3300046529 | Bacteria | 13510 |
| 727 | Ga0495652_0081678 | 3300046529 | Bacteria | 2665 |
| 728 | Ga0495652_0160873 | 3300046529 | Bacteria | 1743 |
| 729 | Ga0495652_0282418 | 3300046529 | Bacteria | 1215 |
| 730 | Ga0495665_0000537 | 3300046531 | Bacteria | 19212 |
| 731 | Ga0495665_0001487 | 3300046531 | Bacteria | 12555 |
| 732 | Ga0495665_0116306 | 3300046531 | Unclassified | 1401 |
| 733 | Ga0495640_0018801 | 3300046533 | Bacteria | 5113 |
| 734 | Ga0495640_0019213 | 3300046533 | Bacteria | 5047 |
| 735 | Ga0495640_0048828 | 3300046533 | Bacteria | 2921 |
| 736 | Ga0495640_0077885 | 3300046533 | Bacteria | 2209 |
| 737 | Ga0495640_0222989 | 3300046533 | Bacteria | 1188 |
| 738 | Ga0495586_0004266 | 3300046535 | Bacteria | 7645 |
| 739 | Ga0495586_0004990 | 3300046535 | Bacteria | 7099 |
| 740 | Ga0495586_0040895 | 3300046535 | Bacteria | 2495 |
| 741 | Ga0495586_0047008 | 3300046535 | Bacteria | 2328 |
| 742 | Ga0495586_0145303 | 3300046535 | Bacteria | 1333 |
| 743 | Ga0495587_0017090 | 3300046536 | Bacteria | 4510 |
| 744 | Ga0495587_0024497 | 3300046536 | Bacteria | 3697 |
| 745 | Ga0495587_0065614 | 3300046536 | Bacteria | 2119 |
| 746 | Ga0495645_0009287 | 3300046543 | Bacteria | 6879 |
| 747 | Ga0495645_0035797 | 3300046543 | Bacteria | 3619 |
| 748 | Ga0495645_0138328 | 3300046543 | Bacteria | 1701 |
| 749 | Ga0495645_0189408 | 3300046543 | Bacteria | 1403 |
| 750 | Ga0495667_0005824 | 3300046559 | Bacteria | 8353 |
| 751 | Ga0495667_0015940 | 3300046559 | Bacteria | 5080 |
| 752 | Ga0495667_0016704 | 3300046559 | Bacteria | 4956 |
| 753 | Ga0495667_0041279 | 3300046559 | Bacteria | 3060 |
| 754 | Ga0495667_0189470 | 3300046559 | Bacteria | 1318 |
| 755 | Ga0495667_0259366 | 3300046559 | Bacteria | 1106 |
| 756 | Ga0495656_0009318 | 3300046615 | Bacteria | 3527 |
| 757 | Ga0495656_0102958 | 3300046615 | Bacteria | 1323 |
| 758 | Ga0495656_0166620 | 3300046615 | Bacteria | 1074 |
| 759 | Ga0495634_0004560 | 3300046642 | Bacteria | 10823 |
| 760 | Ga0495634_0016205 | 3300046642 | Bacteria | 5333 |
| 761 | Ga0495634_0081971 | 3300046642 | Bacteria | 2109 |
| 762 | Ga0495625_0067861 | 3300046660 | Bacteria | 2509 |
| 763 | Ga0495635_0006305 | 3300046663 | Bacteria | 8263 |
| 764 | Ga0495635_0013922 | 3300046663 | Bacteria | 5627 |
| 765 | Ga0495635_0016213 | 3300046663 | Bacteria | 5201 |
| 766 | Ga0495635_0056961 | 3300046663 | Bacteria | 2690 |
| 767 | Ga0495635_0128028 | 3300046663 | Unclassified | 1731 |
| 768 | Ga0495659_0048569 | 3300046664 | Bacteria | 1538 |
| 769 | Ga0495657_0038051 | 3300046675 | Bacteria | 3312 |
| 770 | Ga0495657_0076186 | 3300046675 | Bacteria | 2179 |
| 771 | Ga0495657_0350915 | 3300046675 | Bacteria | 873 |
| 772 | Ga0495599_0061122 | 3300046678 | Bacteria | 2354 |
| 773 | Ga0495599_0229952 | 3300046678 | Bacteria | 1132 |
| 774 | Ga0495599_0247561 | 3300046678 | Bacteria | 1085 |
| 775 | Ga0495623_0042995 | 3300046679 | Bacteria | 2876 |
| 776 | Ga0495646_0041198 | 3300046680 | Bacteria | 2839 |
| 777 | Ga0495646_0128671 | 3300046680 | Bacteria | 1427 |
| 778 | Ga0495646_0151695 | 3300046680 | Bacteria | 1288 |
| 779 | Ga0495647_0000243 | 3300046681 | Bacteria | 14906 |
| 780 | Ga0495647_0004123 | 3300046681 | Bacteria | 4700 |
| 781 | Ga0495647_0011761 | 3300046681 | Bacteria | 3003 |
| 782 | Ga0495647_0023141 | 3300046681 | Unclassified | 2251 |
| 783 | Ga0495658_0000462 | 3300046683 | Bacteria | 22553 |
| 784 | Ga0495658_0000970 | 3300046683 | Bacteria | 15222 |
| 785 | Ga0495658_0019086 | 3300046683 | Bacteria | 3575 |
| 786 | Ga0495658_0083106 | 3300046683 | Bacteria | 1883 |
| 787 | Ga0495658_0306790 | 3300046683 | Unclassified | 1004 |
| 788 | Ga0495669_0014044 | 3300046684 | Bacteria | 3422 |
| 789 | Ga0495613_0008628 | 3300046689 | Bacteria | 7561 |
| 790 | Ga0495613_0027568 | 3300046689 | Bacteria | 4228 |
| 791 | Ga0495613_0029268 | 3300046689 | Bacteria | 4096 |
| 792 | Ga0495613_0163261 | 3300046689 | Bacteria | 1584 |
| 793 | Ga0495624_0001273 | 3300046690 | Bacteria | 19870 |
| 794 | Ga0495624_0033222 | 3300046690 | Bacteria | 3342 |
| 795 | Ga0495624_0104906 | 3300046690 | Bacteria | 1739 |
| 796 | Ga0495624_0378131 | 3300046690 | Bacteria | 851 |
| 797 | Ga0495671_0113464 | 3300046692 | Bacteria | 1324 |
| 798 | Ga0495671_0114805 | 3300046692 | Bacteria | 1315 |
| 799 | Ga0495600_0167237 | 3300046809 | Bacteria | 1420 |
| 800 | Ga0495581_0000258 | 3300047315 | Bacteria | 25364 |
| 801 | Ga0495581_0000746 | 3300047315 | Bacteria | 17248 |
| 802 | Ga0495581_0001092 | 3300047315 | Bacteria | 14774 |
| 803 | Ga0495581_0004100 | 3300047315 | Bacteria | 8384 |
| 804 | Ga0495581_0008336 | 3300047315 | Bacteria | 6007 |
| 805 | Ga0495604_0030056 | 3300047317 | Bacteria | 4319 |
| 806 | Ga0495604_0076244 | 3300047317 | Bacteria | 2522 |
| 807 | Ga0495604_0197932 | 3300047317 | Unclassified | 1396 |
| 808 | Ga0495604_0286391 | 3300047317 | Bacteria | 1111 |
| 809 | Ga0495604_0324458 | 3300047317 | Bacteria | 1028 |
| 810 | Ga0495674_0004337 | 3300047319 | Bacteria | 13635 |
| 811 | Ga0495674_0036575 | 3300047319 | Bacteria | 4418 |
| 812 | Ga0495674_0064359 | 3300047319 | Bacteria | 3188 |
| 813 | Ga0495674_0168556 | 3300047319 | Bacteria | 1828 |
| 814 | Ga0495674_0387709 | 3300047319 | Bacteria | 1129 |
| 815 | Ga0495676_0001520 | 3300047321 | Bacteria | 20077 |
| 816 | Ga0495676_0004766 | 3300047321 | Bacteria | 12422 |
| 817 | Ga0495676_0007780 | 3300047321 | Bacteria | 9832 |
| 818 | Ga0495676_0024105 | 3300047321 | Bacteria | 5272 |
| 819 | Ga0495676_0058823 | 3300047321 | Bacteria | 3022 |
| 820 | Ga0495676_0418289 | 3300047321 | Bacteria | 887 |
| 821 | Ga0495676_0450820 | 3300047321 | Bacteria | 849 |
| 822 | Ga0495680_0001263 | 3300047322 | Bacteria | 27605 |
| 823 | Ga0495680_0002837 | 3300047322 | Bacteria | 17416 |
| 824 | Ga0495680_0017856 | 3300047322 | Bacteria | 6038 |
| 825 | Ga0495680_0028617 | 3300047322 | Bacteria | 4568 |
| 826 | Ga0495680_0349417 | 3300047322 | Bacteria | 1030 |
| 827 | Ga0495680_0385136 | 3300047322 | Unclassified | 971 |
| 828 | Ga0495675_0176563 | 3300047444 | Bacteria | 1310 |
| 829 | Ga0495677_0023071 | 3300047445 | Bacteria | 2259 |
| 830 | Ga0495684_0007604 | 3300047471 | Bacteria | 8385 |
| 831 | Ga0495684_0012663 | 3300047471 | Bacteria | 6509 |
| 832 | Ga0495684_0014916 | 3300047471 | Bacteria | 5985 |
| 833 | Ga0495684_0021053 | 3300047471 | Bacteria | 5023 |
| 834 | Ga0495684_0030087 | 3300047471 | Bacteria | 4168 |
| 835 | Ga0495684_0061022 | 3300047471 | Bacteria | 2869 |
| 836 | Ga0495684_0169027 | 3300047471 | Bacteria | 1627 |
| 837 | Ga0495593_0000732 | 3300047673 | Bacteria | 19043 |
| 838 | Ga0495593_0002644 | 3300047673 | Bacteria | 10772 |
| 839 | Ga0495602_0085890 | 3300048088 | Bacteria | 2628 |
| 840 | Ga0495614_0000557 | 3300048089 | Bacteria | 15456 |
| 841 | Ga0495614_0023684 | 3300048089 | Bacteria | 2650 |
| 842 | Ga0495614_0060543 | 3300048089 | Bacteria | 1627 |
| 843 | Ga0496100_0008150 | 3300048903 | Bacteria | 5832 |
| 844 | Ga0496100_0040408 | 3300048903 | Bacteria | 2967 |
| 845 | Ga0496100_0113576 | 3300048903 | Bacteria | 1885 |
| 846 | Ga0496100_0228238 | 3300048903 | Bacteria | 1369 |
| 847 | Ga0496101_0003811 | 3300048904 | Bacteria | 9420 |
| 848 | Ga0496101_0010832 | 3300048904 | Bacteria | 6031 |
| 849 | Ga0496101_0026134 | 3300048904 | Bacteria | 4058 |
| 850 | Ga0496101_0146782 | 3300048904 | Bacteria | 1802 |
| 851 | Ga0496101_0174525 | 3300048904 | Bacteria | 1653 |
| 852 | Ga0496101_0262186 | 3300048904 | Bacteria | 1348 |
| 853 | Ga0496101_0415623 | 3300048904 | Bacteria | 1060 |
| 854 | Ga0496101_0630784 | 3300048904 | Bacteria | 847 |
| 855 | Ga0496102_0010626 | 3300048905 | Bacteria | 7930 |
| 856 | Ga0496102_0070452 | 3300048905 | Bacteria | 3210 |
| 857 | Ga0496102_0206464 | 3300048905 | Bacteria | 1852 |
| 858 | Ga0496103_0006753 | 3300048906 | Bacteria | 6848 |
| 859 | Ga0496103_0036752 | 3300048906 | Bacteria | 3000 |
| 860 | Ga0496103_0093067 | 3300048906 | Bacteria | 1903 |
| 861 | Ga0496103_0243429 | 3300048906 | Bacteria | 1157 |
| 862 | Ga0496104_0022353 | 3300048907 | Bacteria | 5808 |
| 863 | Ga0496104_0149671 | 3300048907 | Bacteria | 2241 |
| 864 | Ga0496104_0156900 | 3300048907 | Bacteria | 2184 |
| 865 | Ga0496104_0232231 | 3300048907 | Bacteria | 1756 |
| 866 | Ga0496104_0251265 | 3300048907 | Bacteria | 1681 |
| 867 | Ga0496104_0351028 | 3300048907 | Bacteria | 1388 |
| 868 | Ga0496105_0001611 | 3300048908 | Bacteria | 16018 |
| 869 | Ga0496105_0004708 | 3300048908 | Bacteria | 10291 |
| 870 | Ga0496105_0057116 | 3300048908 | Bacteria | 3223 |
| 871 | Ga0496105_0061507 | 3300048908 | Bacteria | 3099 |
| 872 | Ga0496105_0175887 | 3300048908 | Bacteria | 1753 |
| 873 | Ga0496106_0002200 | 3300048909 | Bacteria | 14565 |
| 874 | Ga0496106_0004174 | 3300048909 | Bacteria | 10769 |
| 875 | Ga0496106_0011451 | 3300048909 | Bacteria | 6561 |
| 876 | Ga0496106_0022792 | 3300048909 | Bacteria | 4651 |
| 877 | Ga0496106_0404585 | 3300048909 | Bacteria | 1097 |
| 878 | Ga0496107_0001150 | 3300048910 | Bacteria | 16019 |
| 879 | Ga0496107_0002928 | 3300048910 | Bacteria | 11284 |
| 880 | Ga0496107_0014064 | 3300048910 | Bacteria | 5602 |
| 881 | Ga0496107_0201854 | 3300048910 | Bacteria | 1478 |
| 882 | Ga0496107_0451569 | 3300048910 | Unclassified | 955 |
| 883 | Ga0496108_0006645 | 3300048911 | Bacteria | 9367 |
| 884 | Ga0496108_0010152 | 3300048911 | Bacteria | 7643 |
| 885 | Ga0496108_0024322 | 3300048911 | Bacteria | 4985 |
| 886 | Ga0496108_0409701 | 3300048911 | Bacteria | 1184 |
| 887 | Ga0496109_0196856 | 3300048912 | Bacteria | 1894 |
| 888 | Ga0496109_0235827 | 3300048912 | Bacteria | 1721 |
| 889 | Ga0496109_0254992 | 3300048912 | Bacteria | 1652 |
| 890 | Ga0496109_0366729 | 3300048912 | Bacteria | 1360 |
| 891 | Ga0496109_0462015 | 3300048912 | Unclassified | 1199 |
| 892 | Ga0496109_0496490 | 3300048912 | Bacteria | 1152 |
| 893 | Ga0496109_0562687 | 3300048912 | Bacteria | 1075 |
| 894 | Ga0496109_0751432 | 3300048912 | Bacteria | 913 |
| 895 | Ga0496109_1030744 | 3300048912 | Bacteria | 760 |
| 896 | Ga0496110_0002690 | 3300048913 | Bacteria | 13429 |
| 897 | Ga0496110_0047839 | 3300048913 | Bacteria | 3747 |
| 898 | Ga0496110_0343324 | 3300048913 | Bacteria | 1360 |
| 899 | Ga0496110_0686612 | 3300048913 | Bacteria | 925 |
| 900 | Ga0496111_0014287 | 3300048914 | Bacteria | 5420 |
| 901 | Ga0496111_0059759 | 3300048914 | Bacteria | 2762 |
| 902 | Ga0496111_0160686 | 3300048914 | Bacteria | 1668 |
| 903 | Ga0496111_0187939 | 3300048914 | Bacteria | 1536 |
| 904 | Ga0496112_0007079 | 3300048915 | Bacteria | 9912 |
| 905 | Ga0496112_0034788 | 3300048915 | Bacteria | 4903 |
| 906 | Ga0496112_0056291 | 3300048915 | Bacteria | 3870 |
| 907 | Ga0496112_0079720 | 3300048915 | Bacteria | 3239 |
| 908 | Ga0496112_0108744 | 3300048915 | Bacteria | 2743 |
| 909 | Ga0496112_0117198 | 3300048915 | Bacteria | 2633 |
| 910 | Ga0496112_0131927 | 3300048915 | Bacteria | 2469 |
| 911 | Ga0496112_0263658 | 3300048915 | Bacteria | 1672 |
| 912 | Ga0496112_0299881 | 3300048915 | Bacteria | 1552 |
| 913 | Ga0496113_0044850 | 3300048916 | Bacteria | 3276 |
| 914 | Ga0496113_0126351 | 3300048916 | Bacteria | 2003 |
| 915 | Ga0496113_0219291 | 3300048916 | Bacteria | 1516 |
| 916 | Ga0496113_0346180 | 3300048916 | Bacteria | 1192 |
| 917 | Ga0496113_0502337 | 3300048916 | Bacteria | 974 |
| 918 | Ga0496114_0002086 | 3300048917 | Bacteria | 15206 |
| 919 | Ga0496114_0503008 | 3300048917 | Bacteria | 1072 |
| 920 | Ga0496115_0001353 | 3300048918 | Bacteria | 17501 |
| 921 | Ga0496115_0024962 | 3300048918 | Bacteria | 4650 |
| 922 | Ga0496115_0056885 | 3300048918 | Bacteria | 3144 |
| 923 | Ga0496115_0099828 | 3300048918 | Bacteria | 2379 |
| 924 | Ga0496115_0256105 | 3300048918 | Bacteria | 1440 |
| 925 | Ga0496115_0525401 | 3300048918 | Bacteria | 948 |
| 926 | Ga0501031_0256286 | 3300049568 | Bacteria | 1137 |
| 927 | Ga0501034_0028414 | 3300049571 | Bacteria | 5691 |
| 928 | Ga0501037_0006204 | 3300049573 | Bacteria | 8742 |
| 929 | Ga0501038_0003135 | 3300049574 | Bacteria | 15422 |
| 930 | Ga0501039_0094740 | 3300049575 | Bacteria | 2327 |
| 931 | Ga0501040_0080921 | 3300049576 | Bacteria | 2250 |
| 932 | Ga0501041_0036654 | 3300049577 | Bacteria | 2970 |
| 933 | Ga0501041_0214000 | 3300049577 | Bacteria | 1209 |
| 934 | Ga0501043_0063171 | 3300049579 | Bacteria | 2908 |
| 935 | Ga0501046_0017653 | 3300049580 | Bacteria | 5951 |
| 936 | Ga0501047_0021100 | 3300049581 | Bacteria | 6254 |
| 937 | Ga0501047_0027663 | 3300049581 | Bacteria | 5463 |
| 938 | Ga0501067_0061749 | 3300049583 | Bacteria | 2074 |
| 939 | Ga0501067_0074663 | 3300049583 | Bacteria | 1879 |
| 940 | Ga0501067_0172406 | 3300049583 | Bacteria | 1205 |
| 941 | Ga0501068_0007889 | 3300049584 | Bacteria | 5898 |
| 942 | Ga0501068_0403193 | 3300049584 | Bacteria | 882 |
| 943 | Ga0501070_0007708 | 3300049586 | Bacteria | 9126 |
| 944 | Ga0501070_0010356 | 3300049586 | Bacteria | 7881 |
| 945 | Ga0501070_0019327 | 3300049586 | Bacteria | 5714 |
| 946 | Ga0501070_0084114 | 3300049586 | Bacteria | 2634 |
| 947 | Ga0501071_0138067 | 3300049587 | Bacteria | 1814 |
| 948 | Ga0501072_0012822 | 3300049588 | Bacteria | 6408 |
| 949 | Ga0501072_0070333 | 3300049588 | Bacteria | 2763 |
| 950 | Ga0501072_0144634 | 3300049588 | Bacteria | 1896 |
| 951 | Ga0501072_0502649 | 3300049588 | Bacteria | 959 |
| 952 | Ga0501074_0034735 | 3300049590 | Bacteria | 3654 |
| 953 | Ga0501074_0055240 | 3300049590 | Bacteria | 2862 |
| 954 | Ga0501074_0057521 | 3300049590 | Bacteria | 2801 |
| 955 | Ga0501074_0153948 | 3300049590 | Bacteria | 1643 |
| 956 | Ga0501075_0470424 | 3300049591 | Bacteria | 959 |
| 957 | Ga0501076_0022308 | 3300049592 | Bacteria | 4865 |
| 958 | Ga0501077_0004569 | 3300049593 | Bacteria | 8414 |
| 959 | Ga0501079_0009230 | 3300049741 | Bacteria | 7471 |
| 960 | Ga0501079_0270797 | 3300049741 | Bacteria | 1327 |
| 961 | Ga0501079_0461466 | 3300049741 | Bacteria | 998 |
| 962 | Ga0501080_0036085 | 3300049742 | Bacteria | 4615 |
| 963 | Ga0501080_0084403 | 3300049742 | Bacteria | 2951 |
| 964 | Ga0501080_0176029 | 3300049742 | Bacteria | 1970 |
| 965 | Ga0501083_0001297 | 3300049744 | Bacteria | 16900 |
| 966 | Ga0501083_0007338 | 3300049744 | Bacteria | 7819 |
| 967 | Ga0501035_0282180 | 3300049822 | Bacteria | 1403 |
| 968 | Ga0501044_0033528 | 3300049823 | Bacteria | 5396 |
| 969 | Ga0501045_0214998 | 3300049824 | Bacteria | 1431 |
| 970 | Ga0501045_0529036 | 3300049824 | Bacteria | 875 |
| 971 | nmdc:mga0yw44_13762_c2 | 3300050492 | Bacteria | 943 |
| 972 | nmdc:mga05p37_25009_c1 | 3300050507 | Bacteria | 7259 |
| 973 | nmdc:mga05p37_258217_c1 | 3300050507 | Bacteria | 2087 |
| 974 | nmdc:mga05p37_26949_c1 | 3300050507 | Bacteria | 6992 |
| 975 | nmdc:mga05p37_39439_c1 | 3300050507 | Bacteria | 5799 |
| 976 | nmdc:mga09592_361372_c1 | 3300050508 | Bacteria | 1256 |
| 977 | nmdc:mga09592_6807_c1 | 3300050508 | Bacteria | 9303 |
| 978 | nmdc:mga0qj67_6100_c1 | 3300050509 | Bacteria | 8833 |
| 979 | nmdc:mga06r32_471371_c1 | 3300050510 | Bacteria | 1234 |
| 980 | nmdc:mga06r32_575595_c1 | 3300050510 | Bacteria | 1099 |
| 981 | nmdc:mga08y16_144747_c1 | 3300050511 | Bacteria | 2470 |
| 982 | nmdc:mga08y16_155070_c1 | 3300050511 | Bacteria | 2380 |
| 983 | nmdc:mga08y16_218293_c1 | 3300050511 | Bacteria | 1974 |
| 984 | nmdc:mga0n895_267183_c1 | 3300050512 | Bacteria | 1735 |
| 985 | nmdc:mga0n895_349346_c1 | 3300050512 | Bacteria | 1498 |
| 986 | nmdc:mga0n895_47778_c1 | 3300050512 | Bacteria | 4186 |
| 987 | nmdc:mga0n895_795491_c1 | 3300050512 | Bacteria | 936 |
| 988 | nmdc:mga0n895_801903_c1 | 3300050512 | Bacteria | 932 |
| 989 | nmdc:mga0a205_598928_c1 | 3300050515 | Bacteria | 955 |
| 990 | Ga0495601_0005063 | 3300053077 | Bacteria | 7649 |
| 991 | Ga0495601_0006407 | 3300053077 | Bacteria | 6882 |
| 992 | Ga0495601_0034968 | 3300053077 | Bacteria | 3135 |
| 993 | Ga0495601_0040071 | 3300053077 | Bacteria | 2933 |
| 994 | Ga0495601_0141329 | 3300053077 | Bacteria | 1570 |
| 995 | Ga0495612_0007992 | 3300053078 | Bacteria | 4307 |
| 996 | Ga0495612_0014189 | 3300053078 | Bacteria | 3206 |
| 997 | Ga0495595_0015153 | 3300053084 | Bacteria | 3284 |
| 998 | Ga0495595_0024174 | 3300053084 | Bacteria | 2682 |
| 999 | Ga0495595_0109074 | 3300053084 | Bacteria | 1341 |
| 1000 | Ga0495595_0117721 | 3300053084 | Bacteria | 1292 |
| 1001 | Ga0495619_0001368 | 3300053085 | Bacteria | 16040 |
| 1002 | Ga0495619_0006387 | 3300053085 | Bacteria | 7469 |
| 1003 | Ga0495619_0017193 | 3300053085 | Bacteria | 4581 |
| 1004 | Ga0495619_0036593 | 3300053085 | Bacteria | 3197 |
| 1005 | Ga0495619_0063403 | 3300053085 | Bacteria | 2462 |
| 1006 | Ga0495619_0082410 | 3300053085 | Unclassified | 2168 |
| 1007 | Ga0495619_0082549 | 3300053085 | Bacteria | 2166 |
| 1008 | Ga0500566_0004146 | 3300053094 | Bacteria | 8645 |
| 1009 | Ga0501082_0209501 | 3300060353 | Bacteria | 1696 |
| 1010 | Ga0466962_0000435 | 3300061719 | Bacteria | 18150 |
| 1011 | Ga0466962_0010761 | 3300061719 | Bacteria | 4396 |
| 1012 | Ga0466962_0042916 | 3300061719 | Bacteria | 2165 |
| 1013 | Ga0466962_0101008 | 3300061719 | Bacteria | 1385 |
| 1014 | Ga0466962_0284063 | 3300061719 | Bacteria | 817 |
| 1015 | Ga0530510_0316201 | 3300061734 | Bacteria | 1170 |
| 1016 | Ga0070698_100461979 | |||
| 1017 | Ga0070658_10001317 | |||
| 1018 | Ga0070658_10022933 | |||
| 1019 | Ga0070683_100001088 | |||
| 1020 | Ga0070683_100001951 | |||
| 1021 | Ga0070683_100255007 | |||
| 1022 | Ga0070683_100272179 | |||
| 1023 | Ga0070680_100007887 | |||
| 1024 | Ga0070680_100083768 | |||
| 1025 | Ga0070680_100089388 | |||
| 1026 | Ga0070680_100411739 | |||
| 1027 | Ga0070682_100000829 | |||
| 1028 | Ga0070682_100090423 | |||
| 1029 | Ga0070682_100164403 | |||
| 1030 | Ga0068868_100016781 | |||
| 1031 | Ga0068868_100864109 | |||
| 1032 | Ga0070660_100001059 | |||
| 1033 | Ga0070660_100008244 | |||
| 1034 | Ga0070660_100021867 | |||
| 1035 | Ga0070660_100033201 | |||
| 1036 | Ga0070660_100152063 | |||
| 1037 | Ga0070661_100019788 | |||
| 1038 | Ga0070661_100094101 | |||
| 1039 | Ga0070668_100097080 | |||
| 1040 | Ga0070669_100487942 | |||
| 1041 | Ga0070671_100113812 | |||
| 1042 | Ga0070674_100001923 | |||
| 1043 | Ga0070674_100131110 | |||
| 1044 | Ga0070688_100011954 | |||
| 1045 | Ga0070659_100009404 | |||
| 1046 | Ga0070659_100092639 | |||
| 1047 | Ga0070659_100194269 | |||
| 1048 | Ga0070709_10115489 | |||
| 1049 | Ga0070709_10338949 | |||
| 1050 | Ga0070714_100004653 | |||
| 1051 | Ga0070714_100303496 | |||
| 1052 | Ga0070714_100466897 | |||
| 1053 | Ga0070714_100501313 | |||
| 1054 | Ga0070713_100075434 | |||
| 1055 | Ga0070710_10037223 | |||
| 1056 | Ga0070711_100006191 | |||
| 1057 | Ga0070711_100033061 | |||
| 1058 | Ga0070700_100038025 | |||
| 1059 | Ga0070694_100014705 | |||
| 1060 | Ga0070694_100101036 | |||
| 1061 | Ga0070708_100081955 | |||
| 1062 | Ga0070678_100004589 | |||
| 1063 | Ga0070678_100324901 | |||
| 1064 | Ga0070681_10002352 | |||
| 1065 | Ga0070681_10003595 | |||
| 1066 | Ga0070681_10010574 | |||
| 1067 | Ga0070681_10013434 | |||
| 1068 | Ga0070681_10037244 | |||
| 1069 | Ga0070681_10037651 | |||
| 1070 | Ga0070681_10080413 | |||
| 1071 | Ga0070681_10085889 | |||
| 1072 | Ga0070681_10103037 | |||
| 1073 | Ga0070681_10905078 | |||
| 1074 | Ga0068867_100002148 | |||
| 1075 | Ga0070685_10024215 | |||
| 1076 | Ga0070706_100234109 | |||
| 1077 | Ga0070706_100309288 | |||
| 1078 | Ga0070707_100592316 | |||
| 1079 | Ga0070698_100068513 | |||
| 1080 | Ga0070698_100403972 | |||
| 1081 | Ga0070679_100007912 | |||
| 1082 | Ga0070679_100020102 | |||
| 1083 | Ga0070679_100058729 | |||
| 1084 | Ga0070679_100144831 | |||
| 1085 | Ga0070679_100164593 | |||
| 1086 | Ga0070679_100167130 | |||
| 1087 | Ga0070679_100174091 | |||
| 1088 | Ga0070679_100258005 | |||
| 1089 | Ga0070679_100320406 | |||
| 1090 | Ga0070679_100343975 | |||
| 1091 | Ga0070679_100445843 | |||
| 1092 | Ga0070679_100685161 | |||
| 1093 | Ga0070684_100024020 | |||
| 1094 | Ga0070684_100027971 | |||
| 1095 | Ga0070684_100036184 | |||
| 1096 | Ga0070684_100078135 | |||
| 1097 | Ga0070684_100178767 | |||
| 1098 | Ga0070684_100179445 | |||
| 1099 | Ga0070684_100206830 | |||
| 1100 | Ga0070684_100286270 | |||
| 1101 | Ga0070684_100353010 | |||
| 1102 | Ga0068853_100056394 | |||
| 1103 | Ga0068853_100211232 | |||
| 1104 | Ga0068853_100759342 | |||
| 1105 | Ga0070672_100056701 | |||
| 1106 | Ga0070686_100004436 | |||
| 1107 | Ga0070695_100000007 | |||
| 1108 | Ga0070696_100007993 | |||
| 1109 | Ga0070693_100059312 | |||
| 1110 | Ga0070693_100061905 | |||
| 1111 | Ga0070693_100291123 | |||
| 1112 | Ga0070665_100011488 | |||
| 1113 | Ga0070665_100036558 | |||
| 1114 | Ga0068855_100007604 | |||
| 1115 | Ga0068855_100030809 | |||
| 1116 | Ga0068855_100085789 | |||
| 1117 | Ga0068855_100136965 | |||
| 1118 | Ga0068855_100142801 | |||
| 1119 | Ga0068855_100143099 | |||
| 1120 | Ga0070664_100183221 | |||
| 1121 | Ga0070664_100557813 | |||
| 1122 | Ga0068857_100019412 | |||
| 1123 | Ga0068857_100030217 | |||
| 1124 | Ga0068857_100030773 | |||
| 1125 | Ga0068854_100072256 | |||
| 1126 | Ga0068856_100018376 | |||
| 1127 | Ga0068856_100033958 | |||
| 1128 | Ga0068856_100045426 | |||
| 1129 | Ga0068856_100477282 | |||
| 1130 | Ga0068856_100682329 | |||
| 1131 | Ga0070702_100034424 | |||
| 1132 | Ga0068852_100027164 | |||
| 1133 | Ga0068852_100210811 | |||
| 1134 | Ga0068859_100014318 | |||
| 1135 | Ga0068859_100723792 | |||
| 1136 | Ga0068859_100891993 | |||
| 1137 | Ga0068864_100442979 | |||
| 1138 | Ga0068866_10002212 | |||
| 1139 | Ga0068861_100007529 | |||
| 1140 | Ga0068861_100357831 | |||
| 1141 | Ga0068861_100385297 | |||
| 1142 | Ga0068863_100724928 | |||
| 1143 | Ga0068858_100364670 | |||
| 1144 | Ga0081455_10001912 | |||
| 1145 | Ga0081455_10005929 | |||
| 1146 | Ga0081455_10031254 | |||
| 1147 | Ga0081455_10053919 | |||
| 1148 | Ga0081455_10201927 | |||
| 1149 | Ga0081538_10000238 | |||
| 1150 | Ga0081538_10000732 | |||
| 1151 | Ga0070717_10014842 | |||
| 1152 | Ga0070717_10307849 | |||
| 1153 | Ga0075365_10015502 | |||
| 1154 | Ga0070712_100004041 | |||
| 1155 | Ga0070712_100031937 | |||
| 1156 | Ga0070712_100443186 | |||
| 1157 | Ga0068871_100012365 | |||
| 1158 | Ga0068871_100249723 | |||
| 1159 | Ga0075428_100002031 | |||
| 1160 | Ga0075430_100017348 | |||
| 1161 | Ga0075431_100144540 | |||
| 1162 | Ga0075433_10018360 | |||
| 1163 | Ga0075433_10509230 | |||
| 1164 | Ga0075434_100009519 | |||
| 1165 | Ga0075434_100054617 | |||
| 1166 | Ga0075434_100067001 | |||
| 1167 | Ga0075434_100363118 | |||
| 1168 | Ga0075434_100872878 | |||
| 1169 | Ga0075434_100883439 | |||
| 1170 | Ga0075429_100016785 | |||
| 1171 | Ga0075429_100791609 | |||
| 1172 | Ga0068865_100000598 | |||
| 1173 | Ga0068865_100188777 | |||
| 1174 | Ga0075436_100097594 | |||
| 1175 | Ga0097620_100014318 | |||
| 1176 | Ga0097620_100723681 | |||
| 1177 | Ga0097620_100892016 | |||
| 1178 | Ga0075435_100003270 | |||
| 1179 | Ga0105240_10020317 | |||
| 1180 | Ga0105240_10030751 | |||
| 1181 | Ga0105240_10034249 | |||
| 1182 | Ga0105240_10045838 | |||
| 1183 | Ga0105240_10097231 | |||
| 1184 | Ga0105240_10261758 | |||
| 1185 | Ga0105240_10361728 | |||
| 1186 | Ga0105240_10394808 | |||
| 1187 | Ga0105240_10534683 | |||
| 1188 | Ga0111539_10007774 | |||
| 1189 | Ga0111539_10085758 | |||
| 1190 | Ga0111539_10232834 | |||
| 1191 | Ga0111539_10478988 | |||
| 1192 | Ga0111539_10566682 | |||
| 1193 | Ga0111539_11428249 | |||
| 1194 | Ga0105245_10037476 | |||
| 1195 | Ga0105245_10042907 | |||
| 1196 | Ga0105245_10314189 | |||
| 1197 | Ga0105245_10386361 | |||
| 1198 | Ga0105245_10563244 | |||
| 1199 | Ga0105245_10832763 | |||
| 1200 | Ga0105247_10019067 | |||
| 1201 | Ga0114129_10000663 | |||
| 1202 | Ga0114129_10019250 | |||
| 1203 | Ga0114129_10072699 | |||
| 1204 | Ga0114129_10154752 | |||
| 1205 | Ga0114129_10533366 | |||
| 1206 | Ga0114129_11463354 | |||
| 1207 | Ga0105243_10001070 | |||
| 1208 | Ga0105243_10306972 | |||
| 1209 | Ga0105241_10006225 | |||
| 1210 | Ga0105241_10442831 | |||
| 1211 | Ga0105242_10264266 | |||
| 1212 | Ga0105242_10617391 | |||
| 1213 | Ga0105248_10338602 | |||
| 1214 | Ga0105237_10189511 | |||
| 1215 | Ga0105238_10090084 | |||
| 1216 | Ga0105238_10365572 | |||
| 1217 | Ga0105249_10000462 | |||
| 1218 | Ga0105239_10008937 | |||
| 1219 | Ga0105239_10459399 | |||
| 1220 | Ga0105239_10721398 | |||
| 1221 | Ga0105246_10031802 | |||
| 1222 | Ga0157371_10193305 | |||
| 1223 | Ga0157371_10390704 | |||
| 1224 | Ga0157370_10011210 | |||
| 1225 | Ga0157370_10018219 | |||
| 1226 | Ga0157370_10031630 | |||
| 1227 | Ga0157370_10115006 | |||
| 1228 | Ga0157369_10002883 | |||
| 1229 | Ga0157369_10005196 | |||
| 1230 | Ga0157369_10031406 | |||
| 1231 | Ga0157369_10049518 | |||
| 1232 | Ga0157369_10122807 | |||
| 1233 | Ga0157369_10182179 | |||
| 1234 | Ga0157369_10713978 | |||
| 1235 | Ga0157369_10799654 | |||
| 1236 | Ga0157374_10088070 | |||
| 1237 | Ga0157374_10091638 | |||
| 1238 | Ga0157374_10195999 | |||
| 1239 | Ga0157374_10607440 | |||
| 1240 | Ga0157378_10003364 | |||
| 1241 | Ga0157378_10015883 | |||
| 1242 | Ga0163162_10006948 | |||
| 1243 | Ga0163162_10280169 | |||
| 1244 | Ga0157372_10014938 | |||
| 1245 | Ga0157372_10082283 | |||
| 1246 | Ga0157372_10179700 | |||
| 1247 | Ga0157372_10225425 | |||
| 1248 | Ga0157372_10394134 | |||
| 1249 | Ga0163163_10074767 | |||
| 1250 | Ga0157380_10006721 | |||
| 1251 | Ga0182008_10002753 | |||
| 1252 | Ga0157376_10030962 | |||
| 1253 | Ga0157376_10302804 | |||
| 1254 | Ga0197907_10486216 | |||
| 1255 | Ga0197907_10946547 | |||
| 1256 | Ga0206356_10571689 | |||
| 1257 | Ga0206356_11388465 | |||
| 1258 | Ga0206354_10168775 | |||
| 1259 | Ga0206354_10809368 | |||
| 1260 | Ga0206354_11438060 | |||
| 1261 | Ga0206353_10004980 | |||
| 1262 | Ga0206353_10855307 | |||
| 1263 | Ga0206353_10866168 | |||
| 1264 | Ga0206353_11560650 | |||
| 1265 | Ga0213874_10071456 | |||
| 1266 | Ga0207692_10048265 | |||
| 1267 | Ga0207642_10007289 | |||
| 1268 | Ga0207710_10039609 | |||
| 1269 | Ga0207688_10288445 | |||
| 1270 | Ga0207647_10020804 | |||
| 1271 | Ga0207685_10023373 | |||
| 1272 | Ga0207699_10007942 | |||
| 1273 | Ga0207699_10107165 | |||
| 1274 | Ga0207705_10003887 | |||
| 1275 | Ga0207705_10017397 | |||
| 1276 | Ga0207705_10050591 | |||
| 1277 | Ga0207705_10516960 | |||
| 1278 | Ga0207684_10435422 | |||
| 1279 | Ga0207654_10033192 | |||
| 1280 | Ga0207654_10455564 | |||
| 1281 | Ga0207707_10004063 | |||
| 1282 | Ga0207707_10008618 | |||
| 1283 | Ga0207707_10032326 | |||
| 1284 | Ga0207707_10054937 | |||
| 1285 | Ga0207707_10055614 | |||
| 1286 | Ga0207707_10064290 | |||
| 1287 | Ga0207707_10082866 | |||
| 1288 | Ga0207707_10151769 | |||
| 1289 | Ga0207707_10687163 | |||
| 1290 | Ga0207695_10130596 | |||
| 1291 | Ga0207695_10173651 | |||
| 1292 | Ga0207695_10190224 | |||
| 1293 | Ga0207695_10256295 | |||
| 1294 | Ga0207695_10326251 | |||
| 1295 | Ga0207671_10531418 | |||
| 1296 | Ga0207693_10000175 | |||
| 1297 | Ga0207693_10004462 | |||
| 1298 | Ga0207693_10024538 | |||
| 1299 | Ga0207693_10026443 | |||
| 1300 | Ga0207693_10214943 | |||
| 1301 | Ga0207693_10319788 | |||
| 1302 | Ga0207663_10006653 | |||
| 1303 | Ga0207663_10045032 | |||
| 1304 | Ga0207663_10187359 | |||
| 1305 | Ga0207663_10262673 | |||
| 1306 | Ga0207660_10044303 | |||
| 1307 | Ga0207660_10061836 | |||
| 1308 | Ga0207660_10118472 | |||
| 1309 | Ga0207660_10154121 | |||
| 1310 | Ga0207660_10207811 | |||
| 1311 | Ga0207660_10309457 | |||
| 1312 | Ga0207660_10342577 | |||
| 1313 | Ga0207660_10343859 | |||
| 1314 | Ga0207662_10224818 | |||
| 1315 | Ga0207657_10001687 | |||
| 1316 | Ga0207657_10001863 | |||
| 1317 | Ga0207657_10002690 | |||
| 1318 | Ga0207657_10003855 | |||
| 1319 | Ga0207657_10009516 | |||
| 1320 | Ga0207657_10028420 | |||
| 1321 | Ga0207657_10121615 | |||
| 1322 | Ga0207649_10063761 | |||
| 1323 | Ga0207649_10111534 | |||
| 1324 | Ga0207652_10019328 | |||
| 1325 | Ga0207652_10021781 | |||
| 1326 | Ga0207652_10022742 | |||
| 1327 | Ga0207652_10042448 | |||
| 1328 | Ga0207652_10047416 | |||
| 1329 | Ga0207652_10077647 | |||
| 1330 | Ga0207652_10088728 | |||
| 1331 | Ga0207652_10317154 | |||
| 1332 | Ga0207652_10319411 | |||
| 1333 | Ga0207652_10450201 | |||
| 1334 | Ga0207652_10603042 | |||
| 1335 | Ga0207652_10702635 | |||
| 1336 | Ga0207646_10899964 | |||
| 1337 | Ga0207681_10379228 | |||
| 1338 | Ga0207659_10128811 | |||
| 1339 | Ga0207687_10022442 | |||
| 1340 | Ga0207687_10126995 | |||
| 1341 | Ga0207687_10474638 | |||
| 1342 | Ga0207700_10062639 | |||
| 1343 | Ga0207700_10081972 | |||
| 1344 | Ga0207700_10182276 | |||
| 1345 | Ga0207664_10018495 | |||
| 1346 | Ga0207664_10031085 | |||
| 1347 | Ga0207664_10043381 | |||
| 1348 | Ga0207664_10112838 | |||
| 1349 | Ga0207664_10413711 | |||
| 1350 | Ga0207644_10086235 | |||
| 1351 | Ga0207690_10031594 | |||
| 1352 | Ga0207690_10088778 | |||
| 1353 | Ga0207690_10100819 | |||
| 1354 | Ga0207669_10035577 | |||
| 1355 | Ga0207704_10004196 | |||
| 1356 | Ga0207704_10150010 | |||
| 1357 | Ga0207665_10308452 | |||
| 1358 | Ga0207691_10022282 | |||
| 1359 | Ga0207711_10294197 | |||
| 1360 | Ga0207689_10053421 | |||
| 1361 | Ga0207661_10002819 | |||
| 1362 | Ga0207661_10079555 | |||
| 1363 | Ga0207661_10102395 | |||
| 1364 | Ga0207661_10171651 | |||
| 1365 | Ga0207661_10537311 | |||
| 1366 | Ga0207679_10035002 | |||
| 1367 | Ga0207667_10050181 | |||
| 1368 | Ga0207667_10151083 | |||
| 1369 | Ga0207667_10168935 | |||
| 1370 | Ga0207667_10182809 | |||
| 1371 | Ga0207667_10451502 | |||
| 1372 | Ga0207668_10152155 | |||
| 1373 | Ga0207640_10278293 | |||
| 1374 | Ga0207640_10278957 | |||
| 1375 | Ga0207677_10091618 | |||
| 1376 | Ga0207703_10313939 | |||
| 1377 | Ga0207639_10364076 | |||
| 1378 | Ga0207639_10594973 | |||
| 1379 | Ga0207678_10296634 | |||
| 1380 | Ga0207708_10000614 | |||
| 1381 | Ga0207702_10031510 | |||
| 1382 | Ga0207702_10192099 | |||
| 1383 | Ga0207702_10803164 | |||
| 1384 | Ga0207641_10488768 | |||
| 1385 | Ga0207648_10000312 | |||
| 1386 | Ga0207674_10001702 | |||
| 1387 | Ga0207674_10043773 | |||
| 1388 | Ga0207674_10135533 | |||
| 1389 | Ga0207675_100016684 | |||
| 1390 | Ga0207675_100289845 | |||
| 1391 | Ga0207675_100645692 | |||
| 1392 | Ga0207683_10000447 | |||
| 1393 | Ga0207698_10070332 | |||
| 1394 | Ga0207698_10174902 | |||
| 1395 | Ga0207698_10317733 | |||
| 1396 | Ga0207698_10373060 | |||
| 1397 | Ga0207698_11094741 | |||
| 1398 | Ga0207428_10010564 | |||
| 1399 | Ga0207428_10111771 | |||
| 1400 | Ga0268266_10480404 | |||
| 1401 | Ga0268265_10162983 | |||
| 1402 | Ga0265337_1037716 | |||
| 1403 | Ga0265319_1002232 | |||
| 1404 | Ga0265319_1005903 | |||
| 1405 | Ga0265319_1034276 | |||
| 1406 | Ga0265334_10005171 | |||
| 1407 | Ga0265334_10006308 | |||
| 1408 | Ga0265334_10057443 | |||
| 1409 | Ga0265318_10001217 | |||
| 1410 | Ga0265318_10004976 | |||
| 1411 | Ga0265318_10017733 | |||
| 1412 | Ga0265318_10033223 | |||
| 1413 | Ga0265322_10005028 | |||
| 1414 | Ga0265336_10019242 | |||
| 1415 | Ga0265338_10002936 | |||
| 1416 | Ga0265338_10004663 | |||
| 1417 | Ga0265338_10005415 | |||
| 1418 | Ga0265338_10006096 | |||
| 1419 | Ga0265338_10011028 | |||
| 1420 | Ga0265338_10022169 | |||
| 1421 | Ga0265338_10023362 | |||
| 1422 | Ga0265338_10032851 | |||
| 1423 | Ga0265338_10103090 | |||
| 1424 | Ga0265338_10115354 | |||
| 1425 | Ga0265338_10135654 | |||
| 1426 | Ga0265324_10010089 | |||
| 1427 | Ga0265330_10001984 | |||
| 1428 | Ga0265330_10021882 | |||
| 1429 | Ga0265332_10001963 | |||
| 1430 | Ga0265320_10010508 | |||
| 1431 | Ga0265320_10116265 | |||
| 1432 | Ga0265325_10001625 | |||
| 1433 | Ga0265325_10074785 | |||
| 1434 | Ga0265329_10004462 | |||
| 1435 | Ga0265340_10013617 | |||
| 1436 | Ga0265339_10015659 | |||
| 1437 | Ga0265339_10047254 | |||
| 1438 | Ga0265331_10004771 | |||
| 1439 | Ga0265331_10128843 | |||
| 1440 | Ga0265327_10010871 | |||
| 1441 | Ga0265327_10015346 | |||
| 1442 | Ga0265327_10020771 | |||
| 1443 | Ga0265327_10035186 | |||
| 1444 | Ga0265327_10039611 | |||
| 1445 | Ga0265316_10010353 | |||
| 1446 | Ga0265316_10031951 | |||
| 1447 | Ga0265313_10009457 | |||
| 1448 | Ga0265342_10007562 | |||
| 1449 | Ga0265342_10012474 | |||
| 1450 | Ga0265342_10035915 | |||
| 1451 | Ga0265342_10039995 | |||
| 1452 | Ga0265342_10068449 | |||
| 1453 | Ga0307409_100106171 | |||
| 1454 | Ga0307415_100008712 | |||
| 1455 | Ga0373926_0014617 | |||
| 1456 | Ga0373926_0016492 | |||
| 1457 | Ga0373926_0066166 | |||
| 1458 | Ga0373944_0011024 | |||
| 1459 | Ga0373944_0054386 | |||
| 1460 | Ga0373923_0075325 | |||
| 1461 | Ga0373945_0006065 | |||
| 1462 | Ga0373945_0036752 | |||
| 1463 | Ga0373943_0000202 | |||
| 1464 | Ga0373943_0000628 | |||
| 1465 | Ga0373943_0024122 | |||
| 1466 | Ga0373943_0098383 | |||
| 1467 | Ga0373943_0387907 | |||
| 1468 | Ga0373946_0048003 | |||
| 1469 | Ga0373935_0021166 | |||
| 1470 | Ga0373935_0080510 | |||
| 1471 | Ga0373927_0022200 | |||
| 1472 | Ga0373927_0049940 | |||
| 1473 | Ga0373927_0069551 | |||
| 1474 | Ga0373933_0118690 | |||
| 1475 | Ga0373947_0001859 | |||
| 1476 | Ga0373947_0004063 | |||
| 1477 | Ga0373947_0007481 | |||
| 1478 | Ga0373947_0110729 | |||
| 1479 | Ga0373925_0002950 | |||
| 1480 | Ga0373925_0004197 | |||
| 1481 | Ga0373925_0207685 | |||
| 1482 | Ga0395899_0003838 | |||
| 1483 | Ga0395899_0006929 | |||
| 1484 | Ga0395899_0013646 | |||
| 1485 | Ga0395899_0028021 | |||
| 1486 | Ga0395899_0028559 | |||
| 1487 | Ga0395899_0035495 | |||
| 1488 | Ga0395899_0042470 | |||
| 1489 | Ga0395899_0044960 | |||
| 1490 | Ga0395899_0182628 | |||
| 1491 | Ga0395900_0001305 | |||
| 1492 | Ga0395900_0001795 | |||
| 1493 | Ga0395900_0004382 | |||
| 1494 | Ga0395900_0008431 | |||
| 1495 | Ga0395900_0009973 | |||
| 1496 | Ga0395900_0019920 | |||
| 1497 | Ga0395900_0044983 | |||
| 1498 | Ga0395900_0051108 | |||
| 1499 | Ga0395900_0065587 | |||
| 1500 | Ga0395900_0101801 | |||
| 1501 | Ga0395900_0125629 | |||
| 1502 | Ga0395900_0451995 | |||
| 1503 | Ga0395900_0478995 | |||
| 1504 | Ga0395900_0856309 | |||
| 1505 | Ga0395898_0001041 | |||
| 1506 | Ga0395898_0005552 | |||
| 1507 | Ga0395898_0008130 | |||
| 1508 | Ga0395898_0014237 | |||
| 1509 | Ga0395898_0030154 | |||
| 1510 | Ga0395898_0049386 | |||
| 1511 | Ga0395898_0074819 | |||
| 1512 | Ga0395898_0132228 | |||
| 1513 | Ga0395898_0167725 | |||
| 1514 | Ga0395898_0230872 | |||
| 1515 | Ga0395898_0506764 | |||
| 1516 | Ga0395898_0511602 | |||
| 1517 | Ga0395898_0967131 | |||
| 1518 | Ga0395905_0003322 | |||
| 1519 | Ga0395905_0004844 | |||
| 1520 | Ga0395905_0007518 | |||
| 1521 | Ga0395905_0033772 | |||
| 1522 | Ga0395905_0062361 | |||
| 1523 | Ga0395905_0102848 | |||
| 1524 | Ga0395905_0187841 | |||
| 1525 | Ga0395905_0195282 | |||
| 1526 | Ga0395905_0220218 | |||
| 1527 | Ga0395905_0265085 | |||
| 1528 | Ga0395905_0407003 | |||
| 1529 | Ga0395905_0627517 | |||
| 1530 | Ga0395901_0002535 | |||
| 1531 | Ga0395901_0004613 | |||
| 1532 | Ga0395901_0012470 | |||
| 1533 | Ga0395901_0016459 | |||
| 1534 | Ga0395901_0021482 | |||
| 1535 | Ga0395901_0024699 | |||
| 1536 | Ga0395901_0028470 | |||
| 1537 | Ga0395901_0037776 | |||
| 1538 | Ga0395901_0043740 | |||
| 1539 | Ga0395901_0044798 | |||
| 1540 | Ga0395901_0068108 | |||
| 1541 | Ga0395901_0096495 | |||
| 1542 | Ga0395901_0118097 | |||
| 1543 | Ga0395901_0222416 | |||
| 1544 | Ga0395901_0230403 | |||
| 1545 | Ga0395901_0260587 | |||
| 1546 | Ga0395901_0319212 | |||
| 1547 | Ga0395901_0434127 | |||
| 1548 | Ga0395901_0643692 | |||
| 1549 | Ga0395901_0747391 | |||
| 1550 | Ga0395901_0802311 | |||
| 1551 | Ga0395901_1163899 | |||
| 1552 | Ga0436365_0668709 | |||
| 1553 | Ga0436365_1318472 | |||
| 1554 | Ga0436360_0831043 | |||
| 1555 | Ga0436360_0901858 | |||
| 1556 | Ga0436363_1243768 | |||
| 1557 | Ga0436362_0236793 | |||
| 1558 | Ga0436362_0621431 | |||
| 1559 | Ga0439466_0036859 | |||
| 1560 | Ga0439465_0036990 | |||
| 1561 | Ga0450912_003824 | |||
| 1562 | Ga0466969_0003769 | |||
| 1563 | Ga0466969_0059450 | |||
| 1564 | Ga0466969_0094108 | |||
| 1565 | Ga0466969_0171947 | |||
| 1566 | Ga0466972_0004423 | |||
| 1567 | Ga0466965_0026668 | |||
| 1568 | Ga0466965_0030986 | |||
| 1569 | Ga0466965_0185366 | |||
| 1570 | Ga0466966_0028895 | |||
| 1571 | Ga0466966_0036603 | |||
| 1572 | Ga0466966_0060326 | |||
| 1573 | Ga0466966_0382197 | |||
| 1574 | Ga0466961_0003294 | |||
| 1575 | Ga0466961_0004522 | |||
| 1576 | Ga0466961_0041467 | |||
| 1577 | Ga0466961_0041602 | |||
| 1578 | Ga0466961_0119588 | |||
| 1579 | Ga0466961_0250017 | |||
| 1580 | Ga0466961_0253003 | |||
| 1581 | Ga0466963_0000164 | |||
| 1582 | Ga0466963_0000276 | |||
| 1583 | Ga0466963_0000438 | |||
| 1584 | Ga0466963_0000517 | |||
| 1585 | Ga0466963_0000632 | |||
| 1586 | Ga0466963_0000673 | |||
| 1587 | Ga0466963_0000741 | |||
| 1588 | Ga0466963_0002101 | |||
| 1589 | Ga0466963_0002688 | |||
| 1590 | Ga0466963_0017815 | |||
| 1591 | Ga0466963_0029658 | |||
| 1592 | Ga0466963_0035834 | |||
| 1593 | Ga0466963_0038983 | |||
| 1594 | Ga0466963_0068247 | |||
| 1595 | Ga0466963_0110817 | |||
| 1596 | Ga0466963_0187657 | |||
| 1597 | Ga0466963_0192667 | |||
| 1598 | Ga0466963_0279434 | |||
| 1599 | Ga0466964_0003262 | |||
| 1600 | Ga0466964_0006725 | |||
| 1601 | Ga0466964_0013420 | |||
| 1602 | Ga0466964_0112453 | |||
| 1603 | Ga0466964_0115553 | |||
| 1604 | Ga0466964_0156853 | |||
| 1605 | Ga0466964_0182272 | |||
| 1606 | Ga0466971_0000481 | |||
| 1607 | Ga0466971_0001552 | |||
| 1608 | Ga0466971_0001914 | |||
| 1609 | Ga0466971_0019901 | |||
| 1610 | Ga0466971_0072725 | |||
| 1611 | Ga0466971_0124840 | |||
| 1612 | Ga0466968_0004224 | |||
| 1613 | Ga0466968_0006450 | |||
| 1614 | Ga0466968_0008503 | |||
| 1615 | Ga0466968_0091729 | |||
| 1616 | Ga0466968_0138655 | |||
| 1617 | Ga0466970_0050071 | |||
| 1618 | Ga0466970_0051273 | |||
| 1619 | Ga0466970_0116154 | |||
| 1620 | Ga0466957_0000468 | |||
| 1621 | Ga0466957_0001689 | |||
| 1622 | Ga0466957_0003049 | |||
| 1623 | Ga0466957_0003662 | |||
| 1624 | Ga0466957_0019150 | |||
| 1625 | Ga0466957_0039136 | |||
| 1626 | Ga0466957_0061801 | |||
| 1627 | Ga0466957_0066675 | |||
| 1628 | Ga0466957_0150446 | |||
| 1629 | Ga0466957_0435564 | |||
| 1630 | Ga0466960_0010750 | |||
| 1631 | Ga0466960_0011479 | |||
| 1632 | Ga0466959_0001767 | |||
| 1633 | Ga0466959_0010806 | |||
| 1634 | Ga0466959_0019080 | |||
| 1635 | Ga0466959_0028028 | |||
| 1636 | Ga0466959_0081124 | |||
| 1637 | Ga0466959_0128124 | |||
| 1638 | Ga0451576_0257673 | |||
| 1639 | Ga0466958_0002075 | |||
| 1640 | Ga0466958_0005483 | |||
| 1641 | Ga0466958_0007875 | |||
| 1642 | Ga0466958_0010034 | |||
| 1643 | Ga0466958_0032583 | |||
| 1644 | Ga0466958_0038614 | |||
| 1645 | Ga0466958_0084717 | |||
| 1646 | Ga0466958_0106467 | |||
| 1647 | Ga0466958_0151020 | |||
| 1648 | Ga0466967_0000047 | |||
| 1649 | Ga0466967_0002201 | |||
| 1650 | Ga0466967_0003956 | |||
| 1651 | Ga0466967_0005125 | |||
| 1652 | Ga0466967_0007722 | |||
| 1653 | Ga0466967_0011353 | |||
| 1654 | Ga0466967_0015887 | |||
| 1655 | Ga0466967_0016795 | |||
| 1656 | Ga0466967_0029149 | |||
| 1657 | Ga0466967_0037497 | |||
| 1658 | Ga0466967_0048736 | |||
| 1659 | Ga0466967_0058888 | |||
| 1660 | Ga0466967_0059909 | |||
| 1661 | Ga0466967_0059987 | |||
| 1662 | Ga0466967_0062637 | |||
| 1663 | Ga0466967_0090251 | |||
| 1664 | Ga0466967_0104505 | |||
| 1665 | Ga0466967_0185980 | |||
| 1666 | Ga0466967_0260828 | |||
| 1667 | Ga0466967_0271803 | |||
| 1668 | Ga0466967_0668370 | |||
| 1669 | Ga0466967_0715446 | |||
| 1670 | Ga0466967_0767658 | |||
| 1671 | Ga0495592_0002732 | |||
| 1672 | Ga0495592_0138274 | |||
| 1673 | Ga0495592_0462157 | |||
| 1674 | Ga0495603_0007242 | |||
| 1675 | Ga0495603_0007937 | |||
| 1676 | Ga0495603_0095717 | |||
| 1677 | Ga0495629_0001934 | |||
| 1678 | Ga0495629_0014311 | |||
| 1679 | Ga0495629_0014949 | |||
| 1680 | Ga0495629_0018947 | |||
| 1681 | Ga0495629_0209154 | |||
| 1682 | Ga0495629_0267095 | |||
| 1683 | Ga0495641_0002017 | |||
| 1684 | Ga0495641_0003398 | |||
| 1685 | Ga0495641_0009544 | |||
| 1686 | Ga0495641_0014182 | |||
| 1687 | Ga0495651_0054488 | |||
| 1688 | Ga0495651_0090009 | |||
| 1689 | Ga0495653_0005518 | |||
| 1690 | Ga0495653_0032590 | |||
| 1691 | Ga0495653_0048893 | |||
| 1692 | Ga0495653_0062456 | |||
| 1693 | Ga0495653_0068600 | |||
| 1694 | Ga0495653_0118801 | |||
| 1695 | Ga0495653_0457158 | |||
| 1696 | Ga0495580_0006348 | |||
| 1697 | Ga0495582_0005349 | |||
| 1698 | Ga0495582_0007435 | |||
| 1699 | Ga0495582_0013497 | |||
| 1700 | Ga0495582_0015744 | |||
| 1701 | Ga0495582_0017838 | |||
| 1702 | Ga0495605_0056138 | |||
| 1703 | Ga0495605_0160539 | |||
| 1704 | Ga0495639_0000291 | |||
| 1705 | Ga0495639_0002764 | |||
| 1706 | Ga0495662_0000267 | |||
| 1707 | Ga0495662_0006357 | |||
| 1708 | Ga0495662_0123477 | |||
| 1709 | Ga0495664_0007586 | |||
| 1710 | Ga0495664_0112373 | |||
| 1711 | Ga0495584_0159356 | |||
| 1712 | Ga0495585_0138335 | |||
| 1713 | Ga0495594_0161208 | |||
| 1714 | Ga0495594_0262739 | |||
| 1715 | Ga0495594_0275701 | |||
| 1716 | Ga0495594_0286919 | |||
| 1717 | Ga0495596_0036892 | |||
| 1718 | Ga0495607_0036467 | |||
| 1719 | Ga0495607_0062898 | |||
| 1720 | Ga0495608_0018741 | |||
| 1721 | Ga0495608_0066473 | |||
| 1722 | Ga0495618_0006267 | |||
| 1723 | Ga0495618_0052983 | |||
| 1724 | Ga0495628_0053021 | |||
| 1725 | Ga0495628_0056803 | |||
| 1726 | Ga0495628_0166266 | |||
| 1727 | Ga0495628_0332263 | |||
| 1728 | Ga0495630_0000631 | |||
| 1729 | Ga0495630_0001460 | |||
| 1730 | Ga0495630_0021106 | |||
| 1731 | Ga0495630_0029216 | |||
| 1732 | Ga0495630_0049495 | |||
| 1733 | Ga0495630_0271962 | |||
| 1734 | Ga0495630_0403736 | |||
| 1735 | Ga0495631_0188582 | |||
| 1736 | Ga0495631_0194473 | |||
| 1737 | Ga0495644_0020786 | |||
| 1738 | Ga0495644_0116957 | |||
| 1739 | Ga0495663_0025528 | |||
| 1740 | Ga0495666_0000270 | |||
| 1741 | Ga0495652_0004378 | |||
| 1742 | Ga0495652_0081678 | |||
| 1743 | Ga0495652_0160873 | |||
| 1744 | Ga0495652_0282418 | |||
| 1745 | Ga0495665_0000537 | |||
| 1746 | Ga0495665_0001487 | |||
| 1747 | Ga0495665_0116306 | |||
| 1748 | Ga0495640_0018801 | |||
| 1749 | Ga0495640_0019213 | |||
| 1750 | Ga0495640_0048828 | |||
| 1751 | Ga0495640_0077885 | |||
| 1752 | Ga0495640_0222989 | |||
| 1753 | Ga0495586_0004266 | |||
| 1754 | Ga0495586_0004990 | |||
| 1755 | Ga0495586_0040895 | |||
| 1756 | Ga0495586_0047008 | |||
| 1757 | Ga0495586_0145303 | |||
| 1758 | Ga0495587_0017090 | |||
| 1759 | Ga0495587_0024497 | |||
| 1760 | Ga0495587_0065614 | |||
| 1761 | Ga0495645_0009287 | |||
| 1762 | Ga0495645_0035797 | |||
| 1763 | Ga0495645_0138328 | |||
| 1764 | Ga0495645_0189408 | |||
| 1765 | Ga0495667_0005824 | |||
| 1766 | Ga0495667_0015940 | |||
| 1767 | Ga0495667_0016704 | |||
| 1768 | Ga0495667_0041279 | |||
| 1769 | Ga0495667_0189470 | |||
| 1770 | Ga0495667_0259366 | |||
| 1771 | Ga0495656_0009318 | |||
| 1772 | Ga0495656_0102958 | |||
| 1773 | Ga0495656_0166620 | |||
| 1774 | Ga0495634_0004560 | |||
| 1775 | Ga0495634_0016205 | |||
| 1776 | Ga0495634_0081971 | |||
| 1777 | Ga0495625_0067861 | |||
| 1778 | Ga0495635_0006305 | |||
| 1779 | Ga0495635_0013922 | |||
| 1780 | Ga0495635_0016213 | |||
| 1781 | Ga0495635_0056961 | |||
| 1782 | Ga0495635_0128028 | |||
| 1783 | Ga0495659_0048569 | |||
| 1784 | Ga0495657_0038051 | |||
| 1785 | Ga0495657_0076186 | |||
| 1786 | Ga0495657_0350915 | |||
| 1787 | Ga0495599_0061122 | |||
| 1788 | Ga0495599_0229952 | |||
| 1789 | Ga0495599_0247561 | |||
| 1790 | Ga0495623_0042995 | |||
| 1791 | Ga0495646_0041198 | |||
| 1792 | Ga0495646_0128671 | |||
| 1793 | Ga0495646_0151695 | |||
| 1794 | Ga0495647_0000243 | |||
| 1795 | Ga0495647_0004123 | |||
| 1796 | Ga0495647_0011761 | |||
| 1797 | Ga0495647_0023141 | |||
| 1798 | Ga0495658_0000462 | |||
| 1799 | Ga0495658_0000970 | |||
| 1800 | Ga0495658_0019086 | |||
| 1801 | Ga0495658_0083106 | |||
| 1802 | Ga0495658_0306790 | |||
| 1803 | Ga0495669_0014044 | |||
| 1804 | Ga0495613_0008628 | |||
| 1805 | Ga0495613_0027568 | |||
| 1806 | Ga0495613_0029268 | |||
| 1807 | Ga0495613_0163261 | |||
| 1808 | Ga0495624_0001273 | |||
| 1809 | Ga0495624_0033222 | |||
| 1810 | Ga0495624_0104906 | |||
| 1811 | Ga0495624_0378131 | |||
| 1812 | Ga0495671_0113464 | |||
| 1813 | Ga0495671_0114805 | |||
| 1814 | Ga0495600_0167237 | |||
| 1815 | Ga0495581_0000258 | |||
| 1816 | Ga0495581_0000746 | |||
| 1817 | Ga0495581_0001092 | |||
| 1818 | Ga0495581_0004100 | |||
| 1819 | Ga0495581_0008336 | |||
| 1820 | Ga0495604_0030056 | |||
| 1821 | Ga0495604_0076244 | |||
| 1822 | Ga0495604_0197932 | |||
| 1823 | Ga0495604_0286391 | |||
| 1824 | Ga0495604_0324458 | |||
| 1825 | Ga0495674_0004337 | |||
| 1826 | Ga0495674_0036575 | |||
| 1827 | Ga0495674_0064359 | |||
| 1828 | Ga0495674_0168556 | |||
| 1829 | Ga0495674_0387709 | |||
| 1830 | Ga0495676_0001520 | |||
| 1831 | Ga0495676_0004766 | |||
| 1832 | Ga0495676_0007780 | |||
| 1833 | Ga0495676_0024105 | |||
| 1834 | Ga0495676_0058823 | |||
| 1835 | Ga0495676_0418289 | |||
| 1836 | Ga0495676_0450820 | |||
| 1837 | Ga0495680_0001263 | |||
| 1838 | Ga0495680_0002837 | |||
| 1839 | Ga0495680_0017856 | |||
| 1840 | Ga0495680_0028617 | |||
| 1841 | Ga0495680_0349417 | |||
| 1842 | Ga0495680_0385136 | |||
| 1843 | Ga0495675_0176563 | |||
| 1844 | Ga0495677_0023071 | |||
| 1845 | Ga0495684_0007604 | |||
| 1846 | Ga0495684_0012663 | |||
| 1847 | Ga0495684_0014916 | |||
| 1848 | Ga0495684_0021053 | |||
| 1849 | Ga0495684_0030087 | |||
| 1850 | Ga0495684_0061022 | |||
| 1851 | Ga0495684_0169027 | |||
| 1852 | Ga0495593_0000732 | |||
| 1853 | Ga0495593_0002644 | |||
| 1854 | Ga0495602_0085890 | |||
| 1855 | Ga0495614_0000557 | |||
| 1856 | Ga0495614_0023684 | |||
| 1857 | Ga0495614_0060543 | |||
| 1858 | Ga0496100_0008150 | |||
| 1859 | Ga0496100_0040408 | |||
| 1860 | Ga0496100_0113576 | |||
| 1861 | Ga0496100_0228238 | |||
| 1862 | Ga0496101_0003811 | |||
| 1863 | Ga0496101_0010832 | |||
| 1864 | Ga0496101_0026134 | |||
| 1865 | Ga0496101_0146782 | |||
| 1866 | Ga0496101_0174525 | |||
| 1867 | Ga0496101_0262186 | |||
| 1868 | Ga0496101_0415623 | |||
| 1869 | Ga0496101_0630784 | |||
| 1870 | Ga0496102_0010626 | |||
| 1871 | Ga0496102_0070452 | |||
| 1872 | Ga0496102_0206464 | |||
| 1873 | Ga0496103_0006753 | |||
| 1874 | Ga0496103_0036752 | |||
| 1875 | Ga0496103_0093067 | |||
| 1876 | Ga0496103_0243429 | |||
| 1877 | Ga0496104_0022353 | |||
| 1878 | Ga0496104_0149671 | |||
| 1879 | Ga0496104_0156900 | |||
| 1880 | Ga0496104_0232231 | |||
| 1881 | Ga0496104_0251265 | |||
| 1882 | Ga0496104_0351028 | |||
| 1883 | Ga0496105_0001611 | |||
| 1884 | Ga0496105_0004708 | |||
| 1885 | Ga0496105_0057116 | |||
| 1886 | Ga0496105_0061507 | |||
| 1887 | Ga0496105_0175887 | |||
| 1888 | Ga0496106_0002200 | |||
| 1889 | Ga0496106_0004174 | |||
| 1890 | Ga0496106_0011451 | |||
| 1891 | Ga0496106_0022792 | |||
| 1892 | Ga0496106_0404585 | |||
| 1893 | Ga0496107_0001150 | |||
| 1894 | Ga0496107_0002928 | |||
| 1895 | Ga0496107_0014064 | |||
| 1896 | Ga0496107_0201854 | |||
| 1897 | Ga0496107_0451569 | |||
| 1898 | Ga0496108_0006645 | |||
| 1899 | Ga0496108_0010152 | |||
| 1900 | Ga0496108_0024322 | |||
| 1901 | Ga0496108_0409701 | |||
| 1902 | Ga0496109_0196856 | |||
| 1903 | Ga0496109_0235827 | |||
| 1904 | Ga0496109_0254992 | |||
| 1905 | Ga0496109_0366729 | |||
| 1906 | Ga0496109_0462015 | |||
| 1907 | Ga0496109_0496490 | |||
| 1908 | Ga0496109_0562687 | |||
| 1909 | Ga0496109_0751432 | |||
| 1910 | Ga0496109_1030744 | |||
| 1911 | Ga0496110_0002690 | |||
| 1912 | Ga0496110_0047839 | |||
| 1913 | Ga0496110_0343324 | |||
| 1914 | Ga0496110_0686612 | |||
| 1915 | Ga0496111_0014287 | |||
| 1916 | Ga0496111_0059759 | |||
| 1917 | Ga0496111_0160686 | |||
| 1918 | Ga0496111_0187939 | |||
| 1919 | Ga0496112_0007079 | |||
| 1920 | Ga0496112_0034788 | |||
| 1921 | Ga0496112_0056291 | |||
| 1922 | Ga0496112_0079720 | |||
| 1923 | Ga0496112_0108744 | |||
| 1924 | Ga0496112_0117198 | |||
| 1925 | Ga0496112_0131927 | |||
| 1926 | Ga0496112_0263658 | |||
| 1927 | Ga0496112_0299881 | |||
| 1928 | Ga0496113_0044850 | |||
| 1929 | Ga0496113_0126351 | |||
| 1930 | Ga0496113_0219291 | |||
| 1931 | Ga0496113_0346180 | |||
| 1932 | Ga0496113_0502337 | |||
| 1933 | Ga0496114_0002086 | |||
| 1934 | Ga0496114_0503008 | |||
| 1935 | Ga0496115_0001353 | |||
| 1936 | Ga0496115_0024962 | |||
| 1937 | Ga0496115_0056885 | |||
| 1938 | Ga0496115_0099828 | |||
| 1939 | Ga0496115_0256105 | |||
| 1940 | Ga0496115_0525401 | |||
| 1941 | Ga0501031_0256286 | |||
| 1942 | Ga0501034_0028414 | |||
| 1943 | Ga0501037_0006204 | |||
| 1944 | Ga0501038_0003135 | |||
| 1945 | Ga0501039_0094740 | |||
| 1946 | Ga0501040_0080921 | |||
| 1947 | Ga0501041_0036654 | |||
| 1948 | Ga0501041_0214000 | |||
| 1949 | Ga0501043_0063171 | |||
| 1950 | Ga0501046_0017653 | |||
| 1951 | Ga0501047_0021100 | |||
| 1952 | Ga0501047_0027663 | |||
| 1953 | Ga0501067_0061749 | |||
| 1954 | Ga0501067_0074663 | |||
| 1955 | Ga0501067_0172406 | |||
| 1956 | Ga0501068_0007889 | |||
| 1957 | Ga0501068_0403193 | |||
| 1958 | Ga0501070_0007708 | |||
| 1959 | Ga0501070_0010356 | |||
| 1960 | Ga0501070_0019327 | |||
| 1961 | Ga0501070_0084114 | |||
| 1962 | Ga0501071_0138067 | |||
| 1963 | Ga0501072_0012822 | |||
| 1964 | Ga0501072_0070333 | |||
| 1965 | Ga0501072_0144634 | |||
| 1966 | Ga0501072_0502649 | |||
| 1967 | Ga0501074_0034735 | |||
| 1968 | Ga0501074_0055240 | |||
| 1969 | Ga0501074_0057521 | |||
| 1970 | Ga0501074_0153948 | |||
| 1971 | Ga0501075_0470424 | |||
| 1972 | Ga0501076_0022308 | |||
| 1973 | Ga0501077_0004569 | |||
| 1974 | Ga0501079_0009230 | |||
| 1975 | Ga0501079_0270797 | |||
| 1976 | Ga0501079_0461466 | |||
| 1977 | Ga0501080_0036085 | |||
| 1978 | Ga0501080_0084403 | |||
| 1979 | Ga0501080_0176029 | |||
| 1980 | Ga0501083_0001297 | |||
| 1981 | Ga0501083_0007338 | |||
| 1982 | Ga0501035_0282180 | |||
| 1983 | Ga0501044_0033528 | |||
| 1984 | Ga0501045_0214998 | |||
| 1985 | Ga0501045_0529036 | |||
| 1986 | nmdc:mga0yw44_13762_c2 | |||
| 1987 | nmdc:mga05p37_25009_c1 | |||
| 1988 | nmdc:mga05p37_258217_c1 | |||
| 1989 | nmdc:mga05p37_26949_c1 | |||
| 1990 | nmdc:mga05p37_39439_c1 | |||
| 1991 | nmdc:mga09592_361372_c1 | |||
| 1992 | nmdc:mga09592_6807_c1 | |||
| 1993 | nmdc:mga0qj67_6100_c1 | |||
| 1994 | nmdc:mga06r32_471371_c1 | |||
| 1995 | nmdc:mga06r32_575595_c1 | |||
| 1996 | nmdc:mga08y16_144747_c1 | |||
| 1997 | nmdc:mga08y16_155070_c1 | |||
| 1998 | nmdc:mga08y16_218293_c1 | |||
| 1999 | nmdc:mga0n895_267183_c1 | |||
| 2000 | nmdc:mga0n895_349346_c1 | |||
| 2001 | nmdc:mga0n895_47778_c1 | |||
| 2002 | nmdc:mga0n895_795491_c1 | |||
| 2003 | nmdc:mga0n895_801903_c1 | |||
| 2004 | nmdc:mga0a205_598928_c1 | |||
| 2005 | Ga0495601_0005063 | |||
| 2006 | Ga0495601_0006407 | |||
| 2007 | Ga0495601_0034968 | |||
| 2008 | Ga0495601_0040071 | |||
| 2009 | Ga0495601_0141329 | |||
| 2010 | Ga0495612_0007992 | |||
| 2011 | Ga0495612_0014189 | |||
| 2012 | Ga0495595_0015153 | |||
| 2013 | Ga0495595_0024174 | |||
| 2014 | Ga0495595_0109074 | |||
| 2015 | Ga0495595_0117721 | |||
| 2016 | Ga0495619_0001368 | |||
| 2017 | Ga0495619_0006387 | |||
| 2018 | Ga0495619_0017193 | |||
| 2019 | Ga0495619_0036593 | |||
| 2020 | Ga0495619_0063403 | |||
| 2021 | Ga0495619_0082410 | |||
| 2022 | Ga0495619_0082549 | |||
| 2023 | Ga0500566_0004146 | |||
| 2024 | Ga0501082_0209501 | |||
| 2025 | Ga0466962_0000435 | |||
| 2026 | Ga0466962_0010761 | |||
| 2027 | Ga0466962_0042916 | |||
| 2028 | Ga0466962_0101008 | |||
| 2029 | Ga0466962_0284063 | |||
| 2030 | Ga0530510_0316201 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.6332 | 4 | 232 |
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.6219 | 4 | 232 |
| 8t6b-assembly1.cif.gz_A | human vmat2 in complex with serotonin | 0.4185 | 1 | 208 |
| 2y5y-assembly1.cif.gz_A | crystal structure of lacy in complex with an affinity inactivator | 0.4143 | 4 | 222 |
| 4ja3-assembly2.cif.gz_B | partially occluded inward open conformation of the xylose transporter xyle from e. coli | 0.4118 | 52 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.498 | 4 | 212 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.492 | 7 | 210 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4842 | 7 | 210 | 1.20.1250.20 |
| af_Q9VCJ5_201_360_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4785 | 47 | 213 | 1.20.1250.20 |
| af_A0A3B1DV80_20_452_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4589 | 3 | 209 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537W334-F1-model_v4 | DUF480 domain-containing protein | 0.8338 | 1 | 229 |
GO:0016020
GO:0017004 |
| AF-A0A832DCY9-F1-model_v4 | Cytochrome C biogenesis protein transmembrane domain-containing protein | 0.8291 | 4 | 226 |
GO:0016020
GO:0017004 |
| AF-A0A537W334-F1-model_v4 | DUF480 domain-containing protein | 0.8209 | 1 | 229 |
GO:0016020
GO:0017004 |
| AF-A0A7K4A7H0-F1-model_v4 | deleted | 0.8153 | 4 | 211 |
|
| AF-A0A0B2SQY6-F1-model_v4 | Proteasome subunit alpha type-6 | 0.8141 | 5 | 218 |
GO:0006511
GO:0009507 GO:0016020 GO:0017004 GO:0019773 |