F488235

General Info

Members Datasets Scaffolds Average Seq Length
1015 327 2030 231

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100461979|Ga0070698_1004619792
Length 242
Sequence VITLAALVTRIPIAFVAGLASVITPCVLPLVPGYLSAVSAVETTRLGERGVARRIALATLPFILGFTVVFVVLGAAAAAIGGVVDPNRRIEIAGFVLVVLGLAFMGLLPWPERVVAPGLLTGARRRGSSVLLGGAFAVCAAPCIGTVLASILVLAGNSSTVWRGSLLLTAYSIGLGLAFLLAGVAFSRAMGAFRWLRDHYTVIRVASGATLVALGLLLFFHRDWWLRVLLNRLLEAIGLGNV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 8.18
Rhizosphere 91.13
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100461979 3300005471 Bacteria 1205
2 Ga0070658_10001317 3300005327 Bacteria 21168
3 Ga0070658_10022933 3300005327 Bacteria 5011
4 Ga0070683_100001088 3300005329 Bacteria 20441
5 Ga0070683_100001951 3300005329 Bacteria 16161
6 Ga0070683_100255007 3300005329 Unclassified 1668
7 Ga0070683_100272179 3300005329 Bacteria 1611
8 Ga0070680_100007887 3300005336 Bacteria 8120
9 Ga0070680_100083768 3300005336 Bacteria 2633
10 Ga0070680_100089388 3300005336 Bacteria 2548
11 Ga0070680_100411739 3300005336 Bacteria 1153
12 Ga0070682_100000829 3300005337 Bacteria 18032
13 Ga0070682_100090423 3300005337 Bacteria 2002
14 Ga0070682_100164403 3300005337 Bacteria 1536
15 Ga0068868_100016781 3300005338 Bacteria 5445
16 Ga0068868_100864109 3300005338 Bacteria 820
17 Ga0070660_100001059 3300005339 Bacteria 18513
18 Ga0070660_100008244 3300005339 Bacteria 7283
19 Ga0070660_100021867 3300005339 Bacteria 4723
20 Ga0070660_100033201 3300005339 Bacteria 3888
21 Ga0070660_100152063 3300005339 Bacteria 1861
22 Ga0070661_100019788 3300005344 Bacteria 4798
23 Ga0070661_100094101 3300005344 Bacteria 2220
24 Ga0070668_100097080 3300005347 Bacteria 2330
25 Ga0070669_100487942 3300005353 Bacteria 1020
26 Ga0070671_100113812 3300005355 Bacteria 2274
27 Ga0070674_100001923 3300005356 Bacteria 11314
28 Ga0070674_100131110 3300005356 Bacteria 1869
29 Ga0070688_100011954 3300005365 Bacteria 4848
30 Ga0070659_100009404 3300005366 Bacteria 7180
31 Ga0070659_100092639 3300005366 Bacteria 2423
32 Ga0070659_100194269 3300005366 Bacteria 1669
33 Ga0070709_10115489 3300005434 Bacteria 1810
34 Ga0070709_10338949 3300005434 Bacteria 1108
35 Ga0070714_100004653 3300005435 Bacteria 10359
36 Ga0070714_100303496 3300005435 Bacteria 1489
37 Ga0070714_100466897 3300005435 Bacteria 1200
38 Ga0070714_100501313 3300005435 Bacteria 1158
39 Ga0070713_100075434 3300005436 Bacteria 2860
40 Ga0070710_10037223 3300005437 Bacteria 2665
41 Ga0070711_100006191 3300005439 Bacteria 7198
42 Ga0070711_100033061 3300005439 Bacteria 3443
43 Ga0070700_100038025 3300005441 Bacteria 2931
44 Ga0070694_100014705 3300005444 Bacteria 4903
45 Ga0070694_100101036 3300005444 Bacteria 2040
46 Ga0070708_100081955 3300005445 Bacteria 2922
47 Ga0070678_100004589 3300005456 Bacteria 7848
48 Ga0070678_100324901 3300005456 Bacteria 1315
49 Ga0070681_10002352 3300005458 Bacteria 17268
50 Ga0070681_10003595 3300005458 Bacteria 14536
51 Ga0070681_10010574 3300005458 Bacteria 9115
52 Ga0070681_10013434 3300005458 Bacteria 8136
53 Ga0070681_10037244 3300005458 Bacteria 4882
54 Ga0070681_10037651 3300005458 Bacteria 4853
55 Ga0070681_10080413 3300005458 Bacteria 3215
56 Ga0070681_10085889 3300005458 Bacteria 3099
57 Ga0070681_10103037 3300005458 Bacteria 2798
58 Ga0070681_10905078 3300005458 Bacteria 801
59 Ga0068867_100002148 3300005459 Bacteria 13831
60 Ga0070685_10024215 3300005466 Bacteria 3332
61 Ga0070706_100234109 3300005467 Bacteria 1715
62 Ga0070706_100309288 3300005467 Unclassified 1474
63 Ga0070707_100592316 3300005468 Unclassified 1071
64 Ga0070698_100068513 3300005471 Bacteria 3565
65 Ga0070698_100403972 3300005471 Bacteria 1299
66 Ga0070679_100007912 3300005530 Bacteria 9974
67 Ga0070679_100020102 3300005530 Bacteria 6506
68 Ga0070679_100058729 3300005530 Bacteria 3833
69 Ga0070679_100144831 3300005530 Unclassified 2354
70 Ga0070679_100164593 3300005530 Bacteria 2192
71 Ga0070679_100167130 3300005530 Bacteria 2173
72 Ga0070679_100174091 3300005530 Bacteria 2125
73 Ga0070679_100258005 3300005530 Bacteria 1698
74 Ga0070679_100320406 3300005530 Bacteria 1499
75 Ga0070679_100343975 3300005530 Bacteria 1439
76 Ga0070679_100445843 3300005530 Bacteria 1239
77 Ga0070679_100685161 3300005530 Bacteria 968
78 Ga0070684_100024020 3300005535 Bacteria 5109
79 Ga0070684_100027971 3300005535 Bacteria 4765
80 Ga0070684_100036184 3300005535 Bacteria 4230
81 Ga0070684_100078135 3300005535 Bacteria 2923
82 Ga0070684_100178767 3300005535 Bacteria 1929
83 Ga0070684_100179445 3300005535 Bacteria 1925
84 Ga0070684_100206830 3300005535 Bacteria 1789
85 Ga0070684_100286270 3300005535 Bacteria 1510
86 Ga0070684_100353010 3300005535 Bacteria 1353
87 Ga0068853_100056394 3300005539 Bacteria 3387
88 Ga0068853_100211232 3300005539 Bacteria 1769
89 Ga0068853_100759342 3300005539 Bacteria 927
90 Ga0070672_100056701 3300005543 Bacteria 3073
91 Ga0070686_100004436 3300005544 Bacteria 7741
92 Ga0070695_100000007 3300005545 Bacteria 89343
93 Ga0070696_100007993 3300005546 Bacteria 7062
94 Ga0070693_100059312 3300005547 Bacteria 2218
95 Ga0070693_100061905 3300005547 Bacteria 2177
96 Ga0070693_100291123 3300005547 Bacteria 1097
97 Ga0070665_100011488 3300005548 Bacteria 8956
98 Ga0070665_100036558 3300005548 Bacteria 4940
99 Ga0068855_100007604 3300005563 Bacteria 13111
100 Ga0068855_100030809 3300005563 Bacteria 6413
101 Ga0068855_100085789 3300005563 Bacteria 3642
102 Ga0068855_100136965 3300005563 Bacteria 2792
103 Ga0068855_100142801 3300005563 Bacteria 2727
104 Ga0068855_100143099 3300005563 Bacteria 2724
105 Ga0070664_100183221 3300005564 Bacteria 1862
106 Ga0070664_100557813 3300005564 Unclassified 1059
107 Ga0068857_100019412 3300005577 Bacteria 5968
108 Ga0068857_100030217 3300005577 Bacteria 4782
109 Ga0068857_100030773 3300005577 Bacteria 4741
110 Ga0068854_100072256 3300005578 Bacteria 2526
111 Ga0068856_100018376 3300005614 Bacteria 6775
112 Ga0068856_100033958 3300005614 Bacteria 4995
113 Ga0068856_100045426 3300005614 Bacteria 4325
114 Ga0068856_100477282 3300005614 Bacteria 1268
115 Ga0068856_100682329 3300005614 Bacteria 1048
116 Ga0070702_100034424 3300005615 Bacteria 2792
117 Ga0068852_100027164 3300005616 Bacteria 4662
118 Ga0068852_100210811 3300005616 Bacteria 1843
119 Ga0068859_100014318 3300005617 Bacteria 7956
120 Ga0068859_100723792 3300005617 Bacteria 1085
121 Ga0068859_100891993 3300005617 Bacteria 974
122 Ga0068864_100442979 3300005618 Bacteria 1241
123 Ga0068866_10002212 3300005718 Bacteria 8077
124 Ga0068861_100007529 3300005719 Bacteria 7466
125 Ga0068861_100357831 3300005719 Bacteria 1283
126 Ga0068861_100385297 3300005719 Bacteria 1240
127 Ga0068863_100724928 3300005841 Bacteria 989
128 Ga0068858_100364670 3300005842 Bacteria 1385
129 Ga0081455_10001912 3300005937 Bacteria 25017
130 Ga0081455_10005929 3300005937 Bacteria 13262
131 Ga0081455_10031254 3300005937 Bacteria 4821
132 Ga0081455_10053919 3300005937 Bacteria 3431
133 Ga0081455_10201927 3300005937 Bacteria 1488
134 Ga0081538_10000238 3300005981 Bacteria 62256
135 Ga0081538_10000732 3300005981 Bacteria 35860
136 Ga0070717_10014842 3300006028 Bacteria 5994
137 Ga0070717_10307849 3300006028 Bacteria 1409
138 Ga0075365_10015502 3300006038 Bacteria 4613
139 Ga0070712_100004041 3300006175 Bacteria 9005
140 Ga0070712_100031937 3300006175 Bacteria 3552
141 Ga0070712_100443186 3300006175 Bacteria 1080
142 Ga0068871_100012365 3300006358 Bacteria 6288
143 Ga0068871_100249723 3300006358 Bacteria 1545
144 Ga0075428_100002031 3300006844 Bacteria 21804
145 Ga0075430_100017348 3300006846 Bacteria 6131
146 Ga0075431_100144540 3300006847 Bacteria 2451
147 Ga0075433_10018360 3300006852 Bacteria 5813
148 Ga0075433_10509230 3300006852 Bacteria 1059
149 Ga0075434_100009519 3300006871 Bacteria 9066
150 Ga0075434_100054617 3300006871 Bacteria 3968
151 Ga0075434_100067001 3300006871 Bacteria 3577
152 Ga0075434_100363118 3300006871 Bacteria 1469
153 Ga0075434_100872878 3300006871 Bacteria 915
154 Ga0075434_100883439 3300006871 Bacteria 909
155 Ga0075429_100016785 3300006880 Bacteria 6338
156 Ga0075429_100791609 3300006880 Bacteria 830
157 Ga0068865_100000598 3300006881 Bacteria 20240
158 Ga0068865_100188777 3300006881 Bacteria 1592
159 Ga0075436_100097594 3300006914 Bacteria 2044
160 Ga0097620_100014318 3300006931 Bacteria 7956
161 Ga0097620_100723681 3300006931 Bacteria 1085
162 Ga0097620_100892016 3300006931 Bacteria 974
163 Ga0075435_100003270 3300007076 Bacteria 10981
164 Ga0105240_10020317 3300009093 Bacteria 8862
165 Ga0105240_10030751 3300009093 Bacteria 6974
166 Ga0105240_10034249 3300009093 Bacteria 6553
167 Ga0105240_10045838 3300009093 Bacteria 5545
168 Ga0105240_10097231 3300009093 Bacteria 3588
169 Ga0105240_10261758 3300009093 Bacteria 1995
170 Ga0105240_10361728 3300009093 Bacteria 1643
171 Ga0105240_10394808 3300009093 Bacteria 1559
172 Ga0105240_10534683 3300009093 Bacteria 1299
173 Ga0111539_10007774 3300009094 Bacteria 13687
174 Ga0111539_10085758 3300009094 Bacteria 3701
175 Ga0111539_10232834 3300009094 Bacteria 2145
176 Ga0111539_10478988 3300009094 Unclassified 1449
177 Ga0111539_10566682 3300009094 Bacteria 1323
178 Ga0111539_11428249 3300009094 Bacteria 803
179 Ga0105245_10037476 3300009098 Bacteria 4311
180 Ga0105245_10042907 3300009098 Bacteria 4034
181 Ga0105245_10314189 3300009098 Bacteria 1542
182 Ga0105245_10386361 3300009098 Bacteria 1395
183 Ga0105245_10563244 3300009098 Bacteria 1162
184 Ga0105245_10832763 3300009098 Bacteria 962
185 Ga0105247_10019067 3300009101 Bacteria 4119
186 Ga0114129_10000663 3300009147 Bacteria 43174
187 Ga0114129_10019250 3300009147 Bacteria 9724
188 Ga0114129_10072699 3300009147 Bacteria 4794
189 Ga0114129_10154752 3300009147 Bacteria 3136
190 Ga0114129_10533366 3300009147 Bacteria 1529
191 Ga0114129_11463354 3300009147 Bacteria 841
192 Ga0105243_10001070 3300009148 Bacteria 25043
193 Ga0105243_10306972 3300009148 Bacteria 1440
194 Ga0105241_10006225 3300009174 Bacteria 8799
195 Ga0105241_10442831 3300009174 Bacteria 1148
196 Ga0105242_10264266 3300009176 Bacteria 1556
197 Ga0105242_10617391 3300009176 Bacteria 1050
198 Ga0105248_10338602 3300009177 Unclassified 1694
199 Ga0105237_10189511 3300009545 Bacteria 2057
200 Ga0105238_10090084 3300009551 Bacteria 3055
201 Ga0105238_10365572 3300009551 Bacteria 1433
202 Ga0105249_10000462 3300009553 Bacteria 37859
203 Ga0105239_10008937 3300010375 Bacteria 11336
204 Ga0105239_10459399 3300010375 Bacteria 1445
205 Ga0105239_10721398 3300010375 Bacteria 1140
206 Ga0105246_10031802 3300011119 Bacteria 3494
207 Ga0157371_10193305 3300013102 Bacteria 1457
208 Ga0157371_10390704 3300013102 Bacteria 1017
209 Ga0157370_10011210 3300013104 Bacteria 9401
210 Ga0157370_10018219 3300013104 Bacteria 7066
211 Ga0157370_10031630 3300013104 Bacteria 5175
212 Ga0157370_10115006 3300013104 Bacteria 2513
213 Ga0157369_10002883 3300013105 Bacteria 20540
214 Ga0157369_10005196 3300013105 Bacteria 15209
215 Ga0157369_10031406 3300013105 Bacteria 5849
216 Ga0157369_10049518 3300013105 Bacteria 4554
217 Ga0157369_10122807 3300013105 Bacteria 2755
218 Ga0157369_10182179 3300013105 Bacteria 2210
219 Ga0157369_10713978 3300013105 Unclassified 1032
220 Ga0157369_10799654 3300013105 Bacteria 969
221 Ga0157374_10088070 3300013296 Bacteria 2956
222 Ga0157374_10091638 3300013296 Bacteria 2899
223 Ga0157374_10195999 3300013296 Bacteria 1977
224 Ga0157374_10607440 3300013296 Bacteria 1104
225 Ga0157378_10003364 3300013297 Bacteria 14227
226 Ga0157378_10015883 3300013297 Bacteria 6592
227 Ga0163162_10006948 3300013306 Bacteria 10974
228 Ga0163162_10280169 3300013306 Bacteria 1799
229 Ga0157372_10014938 3300013307 Bacteria 8314
230 Ga0157372_10082283 3300013307 Bacteria 3644
231 Ga0157372_10179700 3300013307 Bacteria 2449
232 Ga0157372_10225425 3300013307 Bacteria 2173
233 Ga0157372_10394134 3300013307 Bacteria 1614
234 Ga0163163_10074767 3300014325 Bacteria 3381
235 Ga0157380_10006721 3300014326 Bacteria 8127
236 Ga0182008_10002753 3300014497 Bacteria 10904
237 Ga0157376_10030962 3300014969 Bacteria 4279
238 Ga0157376_10302804 3300014969 Bacteria 1514
239 Ga0197907_10486216 3300020069 Bacteria 4233
240 Ga0197907_10946547 3300020069 Bacteria 3017
241 Ga0206356_10571689 3300020070 Unclassified 1041
242 Ga0206356_11388465 3300020070 Bacteria 1437
243 Ga0206354_10168775 3300020081 Bacteria 1349
244 Ga0206354_10809368 3300020081 Bacteria 1258
245 Ga0206354_11438060 3300020081 Bacteria 2866
246 Ga0206353_10004980 3300020082 Bacteria 12482
247 Ga0206353_10855307 3300020082 Bacteria 1266
248 Ga0206353_10866168 3300020082 Bacteria 6983
249 Ga0206353_11560650 3300020082 Bacteria 1721
250 Ga0213874_10071456 3300021377 Bacteria 1108
251 Ga0207692_10048265 3300025898 Bacteria 2142
252 Ga0207642_10007289 3300025899 Bacteria 3726
253 Ga0207710_10039609 3300025900 Bacteria 2086
254 Ga0207688_10288445 3300025901 Bacteria 1001
255 Ga0207647_10020804 3300025904 Bacteria 4393
256 Ga0207685_10023373 3300025905 Bacteria 2103
257 Ga0207699_10007942 3300025906 Bacteria 5207
258 Ga0207699_10107165 3300025906 Bacteria 1785
259 Ga0207705_10003887 3300025909 Bacteria 11365
260 Ga0207705_10017397 3300025909 Bacteria 5148
261 Ga0207705_10050591 3300025909 Bacteria 2991
262 Ga0207705_10516960 3300025909 Bacteria 927
263 Ga0207684_10435422 3300025910 Bacteria 1126
264 Ga0207654_10033192 3300025911 Bacteria 2859
265 Ga0207654_10455564 3300025911 Bacteria 897
266 Ga0207707_10004063 3300025912 Bacteria 12958
267 Ga0207707_10008618 3300025912 Bacteria 8845
268 Ga0207707_10032326 3300025912 Bacteria 4579
269 Ga0207707_10054937 3300025912 Unclassified 3465
270 Ga0207707_10055614 3300025912 Bacteria 3442
271 Ga0207707_10064290 3300025912 Bacteria 3193
272 Ga0207707_10082866 3300025912 Bacteria 2800
273 Ga0207707_10151769 3300025912 Bacteria 2025
274 Ga0207707_10687163 3300025912 Bacteria 860
275 Ga0207695_10130596 3300025913 Bacteria 2470
276 Ga0207695_10173651 3300025913 Unclassified 2079
277 Ga0207695_10190224 3300025913 Bacteria 1970
278 Ga0207695_10256295 3300025913 Bacteria 1648
279 Ga0207695_10326251 3300025913 Bacteria 1424
280 Ga0207671_10531418 3300025914 Bacteria 938
281 Ga0207693_10000175 3300025915 Bacteria 58611
282 Ga0207693_10004462 3300025915 Bacteria 11827
283 Ga0207693_10024538 3300025915 Bacteria 4783
284 Ga0207693_10026443 3300025915 Bacteria 4593
285 Ga0207693_10214943 3300025915 Bacteria 1511
286 Ga0207693_10319788 3300025915 Bacteria 1215
287 Ga0207663_10006653 3300025916 Bacteria 5942
288 Ga0207663_10045032 3300025916 Bacteria 2712
289 Ga0207663_10187359 3300025916 Bacteria 1483
290 Ga0207663_10262673 3300025916 Bacteria 1275
291 Ga0207660_10044303 3300025917 Bacteria 3130
292 Ga0207660_10061836 3300025917 Bacteria 2696
293 Ga0207660_10118472 3300025917 Bacteria 2003
294 Ga0207660_10154121 3300025917 Bacteria 1768
295 Ga0207660_10207811 3300025917 Unclassified 1532
296 Ga0207660_10309457 3300025917 Bacteria 1259
297 Ga0207660_10342577 3300025917 Bacteria 1197
298 Ga0207660_10343859 3300025917 Bacteria 1195
299 Ga0207662_10224818 3300025918 Bacteria 1224
300 Ga0207657_10001687 3300025919 Bacteria 23810
301 Ga0207657_10001863 3300025919 Bacteria 22803
302 Ga0207657_10002690 3300025919 Bacteria 19155
303 Ga0207657_10003855 3300025919 Bacteria 15925
304 Ga0207657_10009516 3300025919 Bacteria 9758
305 Ga0207657_10028420 3300025919 Bacteria 5101
306 Ga0207657_10121615 3300025919 Bacteria 2148
307 Ga0207649_10063761 3300025920 Bacteria 2328
308 Ga0207649_10111534 3300025920 Bacteria 1828
309 Ga0207652_10019328 3300025921 Bacteria 5602
310 Ga0207652_10021781 3300025921 Bacteria 5293
311 Ga0207652_10022742 3300025921 Bacteria 5191
312 Ga0207652_10042448 3300025921 Bacteria 3871
313 Ga0207652_10047416 3300025921 Bacteria 3670
314 Ga0207652_10077647 3300025921 Unclassified 2898
315 Ga0207652_10088728 3300025921 Bacteria 2714
316 Ga0207652_10317154 3300025921 Bacteria 1407
317 Ga0207652_10319411 3300025921 Bacteria 1402
318 Ga0207652_10450201 3300025921 Bacteria 1161
319 Ga0207652_10603042 3300025921 Bacteria 984
320 Ga0207652_10702635 3300025921 Bacteria 902
321 Ga0207646_10899964 3300025922 Bacteria 785
322 Ga0207681_10379228 3300025923 Bacteria 1138
323 Ga0207659_10128811 3300025926 Bacteria 1950
324 Ga0207687_10022442 3300025927 Bacteria 4201
325 Ga0207687_10126995 3300025927 Bacteria 1916
326 Ga0207687_10474638 3300025927 Bacteria 1041
327 Ga0207700_10062639 3300025928 Bacteria 2825
328 Ga0207700_10081972 3300025928 Bacteria 2521
329 Ga0207700_10182276 3300025928 Bacteria 1759
330 Ga0207664_10018495 3300025929 Bacteria 5132
331 Ga0207664_10031085 3300025929 Bacteria 4082
332 Ga0207664_10043381 3300025929 Bacteria 3517
333 Ga0207664_10112838 3300025929 Bacteria 2263
334 Ga0207664_10413711 3300025929 Unclassified 1200
335 Ga0207644_10086235 3300025931 Bacteria 2331
336 Ga0207690_10031594 3300025932 Bacteria 3390
337 Ga0207690_10088778 3300025932 Bacteria 2178
338 Ga0207690_10100819 3300025932 Bacteria 2061
339 Ga0207669_10035577 3300025937 Bacteria 2835
340 Ga0207704_10004196 3300025938 Bacteria 6582
341 Ga0207704_10150010 3300025938 Bacteria 1644
342 Ga0207665_10308452 3300025939 Bacteria 1185
343 Ga0207691_10022282 3300025940 Bacteria 5976
344 Ga0207711_10294197 3300025941 Unclassified 1497
345 Ga0207689_10053421 3300025942 Bacteria 3329
346 Ga0207661_10002819 3300025944 Bacteria 12007
347 Ga0207661_10079555 3300025944 Bacteria 2702
348 Ga0207661_10102395 3300025944 Bacteria 2407
349 Ga0207661_10171651 3300025944 Bacteria 1888
350 Ga0207661_10537311 3300025944 Bacteria 1070
351 Ga0207679_10035002 3300025945 Bacteria 3549
352 Ga0207667_10050181 3300025949 Bacteria 4403
353 Ga0207667_10151083 3300025949 Bacteria 2390
354 Ga0207667_10168935 3300025949 Bacteria 2248
355 Ga0207667_10182809 3300025949 Bacteria 2152
356 Ga0207667_10451502 3300025949 Bacteria 1306
357 Ga0207668_10152155 3300025972 Bacteria 1792
358 Ga0207640_10278293 3300025981 Bacteria 1313
359 Ga0207640_10278957 3300025981 Bacteria 1312
360 Ga0207677_10091618 3300026023 Bacteria 2212
361 Ga0207703_10313939 3300026035 Bacteria 1433
362 Ga0207639_10364076 3300026041 Bacteria 1295
363 Ga0207639_10594973 3300026041 Bacteria 1019
364 Ga0207678_10296634 3300026067 Bacteria 1389
365 Ga0207708_10000614 3300026075 Bacteria 27403
366 Ga0207702_10031510 3300026078 Bacteria 4419
367 Ga0207702_10192099 3300026078 Bacteria 1887
368 Ga0207702_10803164 3300026078 Bacteria 930
369 Ga0207641_10488768 3300026088 Bacteria 1194
370 Ga0207648_10000312 3300026089 Bacteria 53245
371 Ga0207674_10001702 3300026116 Bacteria 28143
372 Ga0207674_10043773 3300026116 Bacteria 4615
373 Ga0207674_10135533 3300026116 Bacteria 2424
374 Ga0207675_100016684 3300026118 Bacteria 6857
375 Ga0207675_100289845 3300026118 Bacteria 1592
376 Ga0207675_100645692 3300026118 Bacteria 1064
377 Ga0207683_10000447 3300026121 Bacteria 38155
378 Ga0207698_10070332 3300026142 Bacteria 2772
379 Ga0207698_10174902 3300026142 Bacteria 1895
380 Ga0207698_10317733 3300026142 Bacteria 1457
381 Ga0207698_10373060 3300026142 Bacteria 1355
382 Ga0207698_11094741 3300026142 Bacteria 809
383 Ga0207428_10010564 3300027907 Bacteria 8238
384 Ga0207428_10111771 3300027907 Bacteria 2102
385 Ga0268266_10480404 3300028379 Bacteria 1184
386 Ga0268265_10162983 3300028380 Bacteria 1897
387 Ga0265337_1037716 3300028556 Bacteria 1405
388 Ga0265319_1002232 3300028563 Bacteria 10758
389 Ga0265319_1005903 3300028563 Bacteria 5758
390 Ga0265319_1034276 3300028563 Bacteria 1748
391 Ga0265334_10005171 3300028573 Bacteria 5718
392 Ga0265334_10006308 3300028573 Bacteria 5119
393 Ga0265334_10057443 3300028573 Bacteria 1474
394 Ga0265318_10001217 3300028577 Bacteria 15646
395 Ga0265318_10004976 3300028577 Bacteria 6328
396 Ga0265318_10017733 3300028577 Bacteria 2918
397 Ga0265318_10033223 3300028577 Bacteria 1993
398 Ga0265322_10005028 3300028654 Bacteria 3921
399 Ga0265336_10019242 3300028666 Bacteria 2204
400 Ga0265338_10002936 3300028800 Bacteria 24729
401 Ga0265338_10004663 3300028800 Bacteria 18409
402 Ga0265338_10005415 3300028800 Bacteria 16665
403 Ga0265338_10006096 3300028800 Bacteria 15479
404 Ga0265338_10011028 3300028800 Bacteria 10493
405 Ga0265338_10022169 3300028800 Bacteria 6588
406 Ga0265338_10023362 3300028800 Bacteria 6360
407 Ga0265338_10032851 3300028800 Bacteria 5051
408 Ga0265338_10103090 3300028800 Bacteria 2318
409 Ga0265338_10115354 3300028800 Bacteria 2153
410 Ga0265338_10135654 3300028800 Unclassified 1935
411 Ga0265324_10010089 3300029957 Bacteria 3658
412 Ga0265330_10001984 3300031235 Bacteria 11353
413 Ga0265330_10021882 3300031235 Bacteria 2913
414 Ga0265332_10001963 3300031238 Bacteria 10846
415 Ga0265320_10010508 3300031240 Bacteria 5511
416 Ga0265320_10116265 3300031240 Bacteria 1222
417 Ga0265325_10001625 3300031241 Bacteria 15662
418 Ga0265325_10074785 3300031241 Bacteria 1693
419 Ga0265329_10004462 3300031242 Bacteria 5809
420 Ga0265340_10013617 3300031247 Bacteria 4269
421 Ga0265339_10015659 3300031249 Bacteria 4539
422 Ga0265339_10047254 3300031249 Bacteria 2364
423 Ga0265331_10004771 3300031250 Bacteria 8354
424 Ga0265331_10128843 3300031250 Bacteria 1155
425 Ga0265327_10010871 3300031251 Bacteria 6339
426 Ga0265327_10015346 3300031251 Bacteria 4949
427 Ga0265327_10020771 3300031251 Bacteria 3988
428 Ga0265327_10035186 3300031251 Bacteria 2772
429 Ga0265327_10039611 3300031251 Bacteria 2557
430 Ga0265316_10010353 3300031344 Bacteria 8504
431 Ga0265316_10031951 3300031344 Bacteria 4300
432 Ga0265313_10009457 3300031595 Bacteria 6328
433 Ga0265342_10007562 3300031712 Bacteria 7934
434 Ga0265342_10012474 3300031712 Bacteria 5753
435 Ga0265342_10035915 3300031712 Bacteria 3030
436 Ga0265342_10039995 3300031712 Bacteria 2846
437 Ga0265342_10068449 3300031712 Bacteria 2075
438 Ga0307409_100106171 3300031995 Bacteria 2343
439 Ga0307415_100008712 3300032126 Bacteria 5642
440 Ga0373926_0014617 3300035083 Bacteria 2670
441 Ga0373926_0016492 3300035083 Bacteria 2528
442 Ga0373926_0066166 3300035083 Bacteria 1323
443 Ga0373944_0011024 3300035089 Bacteria 2472
444 Ga0373944_0054386 3300035089 Bacteria 1269
445 Ga0373923_0075325 3300035111 Bacteria 1456
446 Ga0373945_0006065 3300035116 Bacteria 3886
447 Ga0373945_0036752 3300035116 Bacteria 1756
448 Ga0373943_0000202 3300035170 Bacteria 24347
449 Ga0373943_0000628 3300035170 Bacteria 15270
450 Ga0373943_0024122 3300035170 Bacteria 2834
451 Ga0373943_0098383 3300035170 Unclassified 1526
452 Ga0373943_0387907 3300035170 Bacteria 805
453 Ga0373946_0048003 3300035171 Bacteria 1775
454 Ga0373935_0021166 3300035692 Bacteria 3980
455 Ga0373935_0080510 3300035692 Bacteria 2116
456 Ga0373927_0022200 3300035695 Bacteria 4158
457 Ga0373927_0049940 3300035695 Bacteria 2704
458 Ga0373927_0069551 3300035695 Unclassified 2278
459 Ga0373933_0118690 3300035724 Unclassified 1655
460 Ga0373947_0001859 3300035725 Bacteria 12872
461 Ga0373947_0004063 3300035725 Bacteria 8608
462 Ga0373947_0007481 3300035725 Bacteria 6321
463 Ga0373947_0110729 3300035725 Bacteria 1735
464 Ga0373925_0002950 3300037068 Bacteria 13427
465 Ga0373925_0004197 3300037068 Bacteria 10934
466 Ga0373925_0207685 3300037068 Bacteria 1559
467 Ga0395899_0003838 3300037312 Bacteria 11850
468 Ga0395899_0006929 3300037312 Bacteria 8778
469 Ga0395899_0013646 3300037312 Bacteria 6210
470 Ga0395899_0028021 3300037312 Bacteria 4242
471 Ga0395899_0028559 3300037312 Bacteria 4199
472 Ga0395899_0035495 3300037312 Bacteria 3743
473 Ga0395899_0042470 3300037312 Bacteria 3394
474 Ga0395899_0044960 3300037312 Bacteria 3289
475 Ga0395899_0182628 3300037312 Bacteria 1472
476 Ga0395900_0001305 3300037418 Bacteria 30343
477 Ga0395900_0001795 3300037418 Bacteria 24607
478 Ga0395900_0004382 3300037418 Bacteria 14980
479 Ga0395900_0008431 3300037418 Bacteria 10602
480 Ga0395900_0009973 3300037418 Bacteria 9723
481 Ga0395900_0019920 3300037418 Bacteria 6839
482 Ga0395900_0044983 3300037418 Bacteria 4546
483 Ga0395900_0051108 3300037418 Bacteria 4258
484 Ga0395900_0065587 3300037418 Bacteria 3730
485 Ga0395900_0101801 3300037418 Bacteria 2950
486 Ga0395900_0125629 3300037418 Bacteria 2631
487 Ga0395900_0451995 3300037418 Bacteria 1241
488 Ga0395900_0478995 3300037418 Bacteria 1197
489 Ga0395900_0856309 3300037418 Bacteria 834
490 Ga0395898_0001041 3300037466 Bacteria 43245
491 Ga0395898_0005552 3300037466 Bacteria 13601
492 Ga0395898_0008130 3300037466 Bacteria 11106
493 Ga0395898_0014237 3300037466 Bacteria 8176
494 Ga0395898_0030154 3300037466 Bacteria 5429
495 Ga0395898_0049386 3300037466 Bacteria 4122
496 Ga0395898_0074819 3300037466 Bacteria 3271
497 Ga0395898_0132228 3300037466 Bacteria 2389
498 Ga0395898_0167725 3300037466 Bacteria 2099
499 Ga0395898_0230872 3300037466 Unclassified 1765
500 Ga0395898_0506764 3300037466 Bacteria 1148
501 Ga0395898_0511602 3300037466 Bacteria 1142
502 Ga0395898_0967131 3300037466 Bacteria 788
503 Ga0395905_0003322 3300037471 Bacteria 17265
504 Ga0395905_0004844 3300037471 Bacteria 13879
505 Ga0395905_0007518 3300037471 Bacteria 10838
506 Ga0395905_0033772 3300037471 Bacteria 4805
507 Ga0395905_0062361 3300037471 Bacteria 3487
508 Ga0395905_0102848 3300037471 Bacteria 2682
509 Ga0395905_0187841 3300037471 Bacteria 1939
510 Ga0395905_0195282 3300037471 Bacteria 1897
511 Ga0395905_0220218 3300037471 Bacteria 1776
512 Ga0395905_0265085 3300037471 Bacteria 1603
513 Ga0395905_0407003 3300037471 Bacteria 1256
514 Ga0395905_0627517 3300037471 Bacteria 977
515 Ga0395901_0002535 3300038443 Bacteria 18515
516 Ga0395901_0004613 3300038443 Bacteria 13905
517 Ga0395901_0012470 3300038443 Bacteria 8625
518 Ga0395901_0016459 3300038443 Bacteria 7532
519 Ga0395901_0021482 3300038443 Bacteria 6614
520 Ga0395901_0024699 3300038443 Bacteria 6170
521 Ga0395901_0028470 3300038443 Bacteria 5745
522 Ga0395901_0037776 3300038443 Bacteria 4994
523 Ga0395901_0043740 3300038443 Bacteria 4645
524 Ga0395901_0044798 3300038443 Bacteria 4588
525 Ga0395901_0068108 3300038443 Bacteria 3708
526 Ga0395901_0096495 3300038443 Bacteria 3098
527 Ga0395901_0118097 3300038443 Bacteria 2786
528 Ga0395901_0222416 3300038443 Bacteria 1973
529 Ga0395901_0230403 3300038443 Bacteria 1934
530 Ga0395901_0260587 3300038443 Bacteria 1805
531 Ga0395901_0319212 3300038443 Bacteria 1607
532 Ga0395901_0434127 3300038443 Bacteria 1345
533 Ga0395901_0643692 3300038443 Bacteria 1064
534 Ga0395901_0747391 3300038443 Bacteria 971
535 Ga0395901_0802311 3300038443 Unclassified 930
536 Ga0395901_1163899 3300038443 Bacteria 739
537 Ga0436365_0668709 3300039437 Bacteria 1268
538 Ga0436365_1318472 3300039437 Bacteria 1476
539 Ga0436360_0831043 3300039438 Bacteria 12975
540 Ga0436360_0901858 3300039438 Bacteria 4491
541 Ga0436363_1243768 3300039450 Bacteria 2022
542 Ga0436362_0236793 3300039453 Bacteria 2518
543 Ga0436362_0621431 3300039453 Bacteria 861
544 Ga0439466_0036859 3300041411 Bacteria 1649
545 Ga0439465_0036990 3300041413 Bacteria 1569
546 Ga0450912_003824 3300042116 Bacteria 1092
547 Ga0466969_0003769 3300044656 Bacteria 8058
548 Ga0466969_0059450 3300044656 Bacteria 1859
549 Ga0466969_0094108 3300044656 Bacteria 1417
550 Ga0466969_0171947 3300044656 Bacteria 993
551 Ga0466972_0004423 3300044658 Bacteria 7027
552 Ga0466965_0026668 3300044683 Bacteria 2801
553 Ga0466965_0030986 3300044683 Bacteria 2607
554 Ga0466965_0185366 3300044683 Unclassified 1099
555 Ga0466966_0028895 3300044684 Bacteria 3610
556 Ga0466966_0036603 3300044684 Bacteria 3168
557 Ga0466966_0060326 3300044684 Bacteria 2394
558 Ga0466966_0382197 3300044684 Bacteria 846
559 Ga0466961_0003294 3300044693 Bacteria 10063
560 Ga0466961_0004522 3300044693 Bacteria 8722
561 Ga0466961_0041467 3300044693 Bacteria 2951
562 Ga0466961_0041602 3300044693 Bacteria 2946
563 Ga0466961_0119588 3300044693 Bacteria 1654
564 Ga0466961_0250017 3300044693 Bacteria 1089
565 Ga0466961_0253003 3300044693 Bacteria 1081
566 Ga0466963_0000164 3300044694 Bacteria 26985
567 Ga0466963_0000276 3300044694 Bacteria 22861
568 Ga0466963_0000438 3300044694 Bacteria 19248
569 Ga0466963_0000517 3300044694 Bacteria 18034
570 Ga0466963_0000632 3300044694 Bacteria 16887
571 Ga0466963_0000673 3300044694 Bacteria 16556
572 Ga0466963_0000741 3300044694 Bacteria 16079
573 Ga0466963_0002101 3300044694 Bacteria 11006
574 Ga0466963_0002688 3300044694 Bacteria 10010
575 Ga0466963_0017815 3300044694 Bacteria 4432
576 Ga0466963_0029658 3300044694 Bacteria 3523
577 Ga0466963_0035834 3300044694 Bacteria 3233
578 Ga0466963_0038983 3300044694 Bacteria 3109
579 Ga0466963_0068247 3300044694 Bacteria 2388
580 Ga0466963_0110817 3300044694 Bacteria 1884
581 Ga0466963_0187657 3300044694 Bacteria 1444
582 Ga0466963_0192667 3300044694 Bacteria 1424
583 Ga0466963_0279434 3300044694 Bacteria 1173
584 Ga0466964_0003262 3300044706 Bacteria 5904
585 Ga0466964_0006725 3300044706 Bacteria 4286
586 Ga0466964_0013420 3300044706 Bacteria 3109
587 Ga0466964_0112453 3300044706 Bacteria 1216
588 Ga0466964_0115553 3300044706 Bacteria 1202
589 Ga0466964_0156853 3300044706 Bacteria 1060
590 Ga0466964_0182272 3300044706 Bacteria 997
591 Ga0466971_0000481 3300044719 Bacteria 15690
592 Ga0466971_0001552 3300044719 Bacteria 9688
593 Ga0466971_0001914 3300044719 Bacteria 8834
594 Ga0466971_0019901 3300044719 Bacteria 2982
595 Ga0466971_0072725 3300044719 Unclassified 1562
596 Ga0466971_0124840 3300044719 Bacteria 1193
597 Ga0466968_0004224 3300044735 Bacteria 5355
598 Ga0466968_0006450 3300044735 Bacteria 4423
599 Ga0466968_0008503 3300044735 Bacteria 3931
600 Ga0466968_0091729 3300044735 Bacteria 1347
601 Ga0466968_0138655 3300044735 Bacteria 1111
602 Ga0466970_0050071 3300044765 Bacteria 2228
603 Ga0466970_0051273 3300044765 Bacteria 2202
604 Ga0466970_0116154 3300044765 Unclassified 1463
605 Ga0466957_0000468 3300044842 Bacteria 20063
606 Ga0466957_0001689 3300044842 Bacteria 11606
607 Ga0466957_0003049 3300044842 Bacteria 9108
608 Ga0466957_0003662 3300044842 Bacteria 8480
609 Ga0466957_0019150 3300044842 Bacteria 4025
610 Ga0466957_0039136 3300044842 Bacteria 2860
611 Ga0466957_0061801 3300044842 Bacteria 2300
612 Ga0466957_0066675 3300044842 Bacteria 2220
613 Ga0466957_0150446 3300044842 Bacteria 1505
614 Ga0466957_0435564 3300044842 Bacteria 901
615 Ga0466960_0010750 3300044901 Bacteria 3809
616 Ga0466960_0011479 3300044901 Bacteria 3709
617 Ga0466959_0001767 3300045049 Bacteria 13474
618 Ga0466959_0010806 3300045049 Bacteria 6543
619 Ga0466959_0019080 3300045049 Bacteria 5040
620 Ga0466959_0028028 3300045049 Bacteria 4176
621 Ga0466959_0081124 3300045049 Bacteria 2338
622 Ga0466959_0128124 3300045049 Bacteria 1800
623 Ga0451576_0257673 3300045051 Bacteria 1823
624 Ga0466958_0002075 3300045836 Bacteria 9910
625 Ga0466958_0005483 3300045836 Bacteria 6838
626 Ga0466958_0007875 3300045836 Bacteria 5888
627 Ga0466958_0010034 3300045836 Bacteria 5292
628 Ga0466958_0032583 3300045836 Bacteria 3101
629 Ga0466958_0038614 3300045836 Bacteria 2865
630 Ga0466958_0084717 3300045836 Bacteria 1955
631 Ga0466958_0106467 3300045836 Bacteria 1748
632 Ga0466958_0151020 3300045836 Bacteria 1465
633 Ga0466967_0000047 3300045976 Bacteria 43648
634 Ga0466967_0002201 3300045976 Bacteria 11993
635 Ga0466967_0003956 3300045976 Bacteria 9857
636 Ga0466967_0005125 3300045976 Bacteria 9006
637 Ga0466967_0007722 3300045976 Bacteria 7796
638 Ga0466967_0011353 3300045976 Bacteria 6740
639 Ga0466967_0015887 3300045976 Bacteria 5916
640 Ga0466967_0016795 3300045976 Bacteria 5785
641 Ga0466967_0029149 3300045976 Bacteria 4616
642 Ga0466967_0037497 3300045976 Bacteria 4149
643 Ga0466967_0048736 3300045976 Bacteria 3701
644 Ga0466967_0058888 3300045976 Bacteria 3397
645 Ga0466967_0059909 3300045976 Bacteria 3371
646 Ga0466967_0059987 3300045976 Bacteria 3369
647 Ga0466967_0062637 3300045976 Bacteria 3302
648 Ga0466967_0090251 3300045976 Bacteria 2783
649 Ga0466967_0104505 3300045976 Bacteria 2593
650 Ga0466967_0185980 3300045976 Bacteria 1961
651 Ga0466967_0260828 3300045976 Bacteria 1658
652 Ga0466967_0271803 3300045976 Bacteria 1624
653 Ga0466967_0668370 3300045976 Bacteria 1028
654 Ga0466967_0715446 3300045976 Bacteria 992
655 Ga0466967_0767658 3300045976 Bacteria 956
656 Ga0495592_0002732 3300046454 Bacteria 12499
657 Ga0495592_0138274 3300046454 Bacteria 1697
658 Ga0495592_0462157 3300046454 Bacteria 793
659 Ga0495603_0007242 3300046455 Bacteria 6660
660 Ga0495603_0007937 3300046455 Bacteria 6405
661 Ga0495603_0095717 3300046455 Bacteria 1735
662 Ga0495629_0001934 3300046459 Bacteria 16136
663 Ga0495629_0014311 3300046459 Bacteria 5709
664 Ga0495629_0014949 3300046459 Bacteria 5576
665 Ga0495629_0018947 3300046459 Bacteria 4922
666 Ga0495629_0209154 3300046459 Bacteria 1348
667 Ga0495629_0267095 3300046459 Unclassified 1176
668 Ga0495641_0002017 3300046461 Bacteria 16488
669 Ga0495641_0003398 3300046461 Bacteria 11936
670 Ga0495641_0009544 3300046461 Bacteria 5753
671 Ga0495641_0014182 3300046461 Bacteria 4325
672 Ga0495651_0054488 3300046462 Bacteria 3075
673 Ga0495651_0090009 3300046462 Bacteria 2302
674 Ga0495653_0005518 3300046463 Bacteria 10305
675 Ga0495653_0032590 3300046463 Bacteria 4135
676 Ga0495653_0048893 3300046463 Bacteria 3261
677 Ga0495653_0062456 3300046463 Bacteria 2815
678 Ga0495653_0068600 3300046463 Bacteria 2659
679 Ga0495653_0118801 3300046463 Unclassified 1888
680 Ga0495653_0457158 3300046463 Bacteria 802
681 Ga0495580_0006348 3300046472 Bacteria 9644
682 Ga0495582_0005349 3300046473 Bacteria 7166
683 Ga0495582_0007435 3300046473 Bacteria 6064
684 Ga0495582_0013497 3300046473 Bacteria 4498
685 Ga0495582_0015744 3300046473 Bacteria 4148
686 Ga0495582_0017838 3300046473 Bacteria 3880
687 Ga0495605_0056138 3300046474 Bacteria 1900
688 Ga0495605_0160539 3300046474 Unclassified 998
689 Ga0495639_0000291 3300046475 Bacteria 24492
690 Ga0495639_0002764 3300046475 Bacteria 7626
691 Ga0495662_0000267 3300046476 Bacteria 22132
692 Ga0495662_0006357 3300046476 Bacteria 5903
693 Ga0495662_0123477 3300046476 Bacteria 1271
694 Ga0495664_0007586 3300046477 Bacteria 6031
695 Ga0495664_0112373 3300046477 Bacteria 1644
696 Ga0495584_0159356 3300046491 Bacteria 1147
697 Ga0495585_0138335 3300046492 Bacteria 1277
698 Ga0495594_0161208 3300046499 Bacteria 1275
699 Ga0495594_0262739 3300046499 Bacteria 983
700 Ga0495594_0275701 3300046499 Bacteria 958
701 Ga0495594_0286919 3300046499 Bacteria 938
702 Ga0495596_0036892 3300046500 Bacteria 1935
703 Ga0495607_0036467 3300046501 Bacteria 2962
704 Ga0495607_0062898 3300046501 Bacteria 2102
705 Ga0495608_0018741 3300046511 Bacteria 4769
706 Ga0495608_0066473 3300046511 Bacteria 2360
707 Ga0495618_0006267 3300046514 Bacteria 7219
708 Ga0495618_0052983 3300046514 Bacteria 2566
709 Ga0495628_0053021 3300046516 Bacteria 3202
710 Ga0495628_0056803 3300046516 Bacteria 3080
711 Ga0495628_0166266 3300046516 Bacteria 1674
712 Ga0495628_0332263 3300046516 Bacteria 1120
713 Ga0495630_0000631 3300046517 Bacteria 25489
714 Ga0495630_0001460 3300046517 Bacteria 16372
715 Ga0495630_0021106 3300046517 Bacteria 4808
716 Ga0495630_0029216 3300046517 Bacteria 4097
717 Ga0495630_0049495 3300046517 Bacteria 3145
718 Ga0495630_0271962 3300046517 Bacteria 1294
719 Ga0495630_0403736 3300046517 Bacteria 1047
720 Ga0495631_0188582 3300046518 Bacteria 883
721 Ga0495631_0194473 3300046518 Bacteria 868
722 Ga0495644_0020786 3300046523 Bacteria 2504
723 Ga0495644_0116957 3300046523 Bacteria 1013
724 Ga0495663_0025528 3300046525 Bacteria 1723
725 Ga0495666_0000270 3300046526 Bacteria 22402
726 Ga0495652_0004378 3300046529 Bacteria 13510
727 Ga0495652_0081678 3300046529 Bacteria 2665
728 Ga0495652_0160873 3300046529 Bacteria 1743
729 Ga0495652_0282418 3300046529 Bacteria 1215
730 Ga0495665_0000537 3300046531 Bacteria 19212
731 Ga0495665_0001487 3300046531 Bacteria 12555
732 Ga0495665_0116306 3300046531 Unclassified 1401
733 Ga0495640_0018801 3300046533 Bacteria 5113
734 Ga0495640_0019213 3300046533 Bacteria 5047
735 Ga0495640_0048828 3300046533 Bacteria 2921
736 Ga0495640_0077885 3300046533 Bacteria 2209
737 Ga0495640_0222989 3300046533 Bacteria 1188
738 Ga0495586_0004266 3300046535 Bacteria 7645
739 Ga0495586_0004990 3300046535 Bacteria 7099
740 Ga0495586_0040895 3300046535 Bacteria 2495
741 Ga0495586_0047008 3300046535 Bacteria 2328
742 Ga0495586_0145303 3300046535 Bacteria 1333
743 Ga0495587_0017090 3300046536 Bacteria 4510
744 Ga0495587_0024497 3300046536 Bacteria 3697
745 Ga0495587_0065614 3300046536 Bacteria 2119
746 Ga0495645_0009287 3300046543 Bacteria 6879
747 Ga0495645_0035797 3300046543 Bacteria 3619
748 Ga0495645_0138328 3300046543 Bacteria 1701
749 Ga0495645_0189408 3300046543 Bacteria 1403
750 Ga0495667_0005824 3300046559 Bacteria 8353
751 Ga0495667_0015940 3300046559 Bacteria 5080
752 Ga0495667_0016704 3300046559 Bacteria 4956
753 Ga0495667_0041279 3300046559 Bacteria 3060
754 Ga0495667_0189470 3300046559 Bacteria 1318
755 Ga0495667_0259366 3300046559 Bacteria 1106
756 Ga0495656_0009318 3300046615 Bacteria 3527
757 Ga0495656_0102958 3300046615 Bacteria 1323
758 Ga0495656_0166620 3300046615 Bacteria 1074
759 Ga0495634_0004560 3300046642 Bacteria 10823
760 Ga0495634_0016205 3300046642 Bacteria 5333
761 Ga0495634_0081971 3300046642 Bacteria 2109
762 Ga0495625_0067861 3300046660 Bacteria 2509
763 Ga0495635_0006305 3300046663 Bacteria 8263
764 Ga0495635_0013922 3300046663 Bacteria 5627
765 Ga0495635_0016213 3300046663 Bacteria 5201
766 Ga0495635_0056961 3300046663 Bacteria 2690
767 Ga0495635_0128028 3300046663 Unclassified 1731
768 Ga0495659_0048569 3300046664 Bacteria 1538
769 Ga0495657_0038051 3300046675 Bacteria 3312
770 Ga0495657_0076186 3300046675 Bacteria 2179
771 Ga0495657_0350915 3300046675 Bacteria 873
772 Ga0495599_0061122 3300046678 Bacteria 2354
773 Ga0495599_0229952 3300046678 Bacteria 1132
774 Ga0495599_0247561 3300046678 Bacteria 1085
775 Ga0495623_0042995 3300046679 Bacteria 2876
776 Ga0495646_0041198 3300046680 Bacteria 2839
777 Ga0495646_0128671 3300046680 Bacteria 1427
778 Ga0495646_0151695 3300046680 Bacteria 1288
779 Ga0495647_0000243 3300046681 Bacteria 14906
780 Ga0495647_0004123 3300046681 Bacteria 4700
781 Ga0495647_0011761 3300046681 Bacteria 3003
782 Ga0495647_0023141 3300046681 Unclassified 2251
783 Ga0495658_0000462 3300046683 Bacteria 22553
784 Ga0495658_0000970 3300046683 Bacteria 15222
785 Ga0495658_0019086 3300046683 Bacteria 3575
786 Ga0495658_0083106 3300046683 Bacteria 1883
787 Ga0495658_0306790 3300046683 Unclassified 1004
788 Ga0495669_0014044 3300046684 Bacteria 3422
789 Ga0495613_0008628 3300046689 Bacteria 7561
790 Ga0495613_0027568 3300046689 Bacteria 4228
791 Ga0495613_0029268 3300046689 Bacteria 4096
792 Ga0495613_0163261 3300046689 Bacteria 1584
793 Ga0495624_0001273 3300046690 Bacteria 19870
794 Ga0495624_0033222 3300046690 Bacteria 3342
795 Ga0495624_0104906 3300046690 Bacteria 1739
796 Ga0495624_0378131 3300046690 Bacteria 851
797 Ga0495671_0113464 3300046692 Bacteria 1324
798 Ga0495671_0114805 3300046692 Bacteria 1315
799 Ga0495600_0167237 3300046809 Bacteria 1420
800 Ga0495581_0000258 3300047315 Bacteria 25364
801 Ga0495581_0000746 3300047315 Bacteria 17248
802 Ga0495581_0001092 3300047315 Bacteria 14774
803 Ga0495581_0004100 3300047315 Bacteria 8384
804 Ga0495581_0008336 3300047315 Bacteria 6007
805 Ga0495604_0030056 3300047317 Bacteria 4319
806 Ga0495604_0076244 3300047317 Bacteria 2522
807 Ga0495604_0197932 3300047317 Unclassified 1396
808 Ga0495604_0286391 3300047317 Bacteria 1111
809 Ga0495604_0324458 3300047317 Bacteria 1028
810 Ga0495674_0004337 3300047319 Bacteria 13635
811 Ga0495674_0036575 3300047319 Bacteria 4418
812 Ga0495674_0064359 3300047319 Bacteria 3188
813 Ga0495674_0168556 3300047319 Bacteria 1828
814 Ga0495674_0387709 3300047319 Bacteria 1129
815 Ga0495676_0001520 3300047321 Bacteria 20077
816 Ga0495676_0004766 3300047321 Bacteria 12422
817 Ga0495676_0007780 3300047321 Bacteria 9832
818 Ga0495676_0024105 3300047321 Bacteria 5272
819 Ga0495676_0058823 3300047321 Bacteria 3022
820 Ga0495676_0418289 3300047321 Bacteria 887
821 Ga0495676_0450820 3300047321 Bacteria 849
822 Ga0495680_0001263 3300047322 Bacteria 27605
823 Ga0495680_0002837 3300047322 Bacteria 17416
824 Ga0495680_0017856 3300047322 Bacteria 6038
825 Ga0495680_0028617 3300047322 Bacteria 4568
826 Ga0495680_0349417 3300047322 Bacteria 1030
827 Ga0495680_0385136 3300047322 Unclassified 971
828 Ga0495675_0176563 3300047444 Bacteria 1310
829 Ga0495677_0023071 3300047445 Bacteria 2259
830 Ga0495684_0007604 3300047471 Bacteria 8385
831 Ga0495684_0012663 3300047471 Bacteria 6509
832 Ga0495684_0014916 3300047471 Bacteria 5985
833 Ga0495684_0021053 3300047471 Bacteria 5023
834 Ga0495684_0030087 3300047471 Bacteria 4168
835 Ga0495684_0061022 3300047471 Bacteria 2869
836 Ga0495684_0169027 3300047471 Bacteria 1627
837 Ga0495593_0000732 3300047673 Bacteria 19043
838 Ga0495593_0002644 3300047673 Bacteria 10772
839 Ga0495602_0085890 3300048088 Bacteria 2628
840 Ga0495614_0000557 3300048089 Bacteria 15456
841 Ga0495614_0023684 3300048089 Bacteria 2650
842 Ga0495614_0060543 3300048089 Bacteria 1627
843 Ga0496100_0008150 3300048903 Bacteria 5832
844 Ga0496100_0040408 3300048903 Bacteria 2967
845 Ga0496100_0113576 3300048903 Bacteria 1885
846 Ga0496100_0228238 3300048903 Bacteria 1369
847 Ga0496101_0003811 3300048904 Bacteria 9420
848 Ga0496101_0010832 3300048904 Bacteria 6031
849 Ga0496101_0026134 3300048904 Bacteria 4058
850 Ga0496101_0146782 3300048904 Bacteria 1802
851 Ga0496101_0174525 3300048904 Bacteria 1653
852 Ga0496101_0262186 3300048904 Bacteria 1348
853 Ga0496101_0415623 3300048904 Bacteria 1060
854 Ga0496101_0630784 3300048904 Bacteria 847
855 Ga0496102_0010626 3300048905 Bacteria 7930
856 Ga0496102_0070452 3300048905 Bacteria 3210
857 Ga0496102_0206464 3300048905 Bacteria 1852
858 Ga0496103_0006753 3300048906 Bacteria 6848
859 Ga0496103_0036752 3300048906 Bacteria 3000
860 Ga0496103_0093067 3300048906 Bacteria 1903
861 Ga0496103_0243429 3300048906 Bacteria 1157
862 Ga0496104_0022353 3300048907 Bacteria 5808
863 Ga0496104_0149671 3300048907 Bacteria 2241
864 Ga0496104_0156900 3300048907 Bacteria 2184
865 Ga0496104_0232231 3300048907 Bacteria 1756
866 Ga0496104_0251265 3300048907 Bacteria 1681
867 Ga0496104_0351028 3300048907 Bacteria 1388
868 Ga0496105_0001611 3300048908 Bacteria 16018
869 Ga0496105_0004708 3300048908 Bacteria 10291
870 Ga0496105_0057116 3300048908 Bacteria 3223
871 Ga0496105_0061507 3300048908 Bacteria 3099
872 Ga0496105_0175887 3300048908 Bacteria 1753
873 Ga0496106_0002200 3300048909 Bacteria 14565
874 Ga0496106_0004174 3300048909 Bacteria 10769
875 Ga0496106_0011451 3300048909 Bacteria 6561
876 Ga0496106_0022792 3300048909 Bacteria 4651
877 Ga0496106_0404585 3300048909 Bacteria 1097
878 Ga0496107_0001150 3300048910 Bacteria 16019
879 Ga0496107_0002928 3300048910 Bacteria 11284
880 Ga0496107_0014064 3300048910 Bacteria 5602
881 Ga0496107_0201854 3300048910 Bacteria 1478
882 Ga0496107_0451569 3300048910 Unclassified 955
883 Ga0496108_0006645 3300048911 Bacteria 9367
884 Ga0496108_0010152 3300048911 Bacteria 7643
885 Ga0496108_0024322 3300048911 Bacteria 4985
886 Ga0496108_0409701 3300048911 Bacteria 1184
887 Ga0496109_0196856 3300048912 Bacteria 1894
888 Ga0496109_0235827 3300048912 Bacteria 1721
889 Ga0496109_0254992 3300048912 Bacteria 1652
890 Ga0496109_0366729 3300048912 Bacteria 1360
891 Ga0496109_0462015 3300048912 Unclassified 1199
892 Ga0496109_0496490 3300048912 Bacteria 1152
893 Ga0496109_0562687 3300048912 Bacteria 1075
894 Ga0496109_0751432 3300048912 Bacteria 913
895 Ga0496109_1030744 3300048912 Bacteria 760
896 Ga0496110_0002690 3300048913 Bacteria 13429
897 Ga0496110_0047839 3300048913 Bacteria 3747
898 Ga0496110_0343324 3300048913 Bacteria 1360
899 Ga0496110_0686612 3300048913 Bacteria 925
900 Ga0496111_0014287 3300048914 Bacteria 5420
901 Ga0496111_0059759 3300048914 Bacteria 2762
902 Ga0496111_0160686 3300048914 Bacteria 1668
903 Ga0496111_0187939 3300048914 Bacteria 1536
904 Ga0496112_0007079 3300048915 Bacteria 9912
905 Ga0496112_0034788 3300048915 Bacteria 4903
906 Ga0496112_0056291 3300048915 Bacteria 3870
907 Ga0496112_0079720 3300048915 Bacteria 3239
908 Ga0496112_0108744 3300048915 Bacteria 2743
909 Ga0496112_0117198 3300048915 Bacteria 2633
910 Ga0496112_0131927 3300048915 Bacteria 2469
911 Ga0496112_0263658 3300048915 Bacteria 1672
912 Ga0496112_0299881 3300048915 Bacteria 1552
913 Ga0496113_0044850 3300048916 Bacteria 3276
914 Ga0496113_0126351 3300048916 Bacteria 2003
915 Ga0496113_0219291 3300048916 Bacteria 1516
916 Ga0496113_0346180 3300048916 Bacteria 1192
917 Ga0496113_0502337 3300048916 Bacteria 974
918 Ga0496114_0002086 3300048917 Bacteria 15206
919 Ga0496114_0503008 3300048917 Bacteria 1072
920 Ga0496115_0001353 3300048918 Bacteria 17501
921 Ga0496115_0024962 3300048918 Bacteria 4650
922 Ga0496115_0056885 3300048918 Bacteria 3144
923 Ga0496115_0099828 3300048918 Bacteria 2379
924 Ga0496115_0256105 3300048918 Bacteria 1440
925 Ga0496115_0525401 3300048918 Bacteria 948
926 Ga0501031_0256286 3300049568 Bacteria 1137
927 Ga0501034_0028414 3300049571 Bacteria 5691
928 Ga0501037_0006204 3300049573 Bacteria 8742
929 Ga0501038_0003135 3300049574 Bacteria 15422
930 Ga0501039_0094740 3300049575 Bacteria 2327
931 Ga0501040_0080921 3300049576 Bacteria 2250
932 Ga0501041_0036654 3300049577 Bacteria 2970
933 Ga0501041_0214000 3300049577 Bacteria 1209
934 Ga0501043_0063171 3300049579 Bacteria 2908
935 Ga0501046_0017653 3300049580 Bacteria 5951
936 Ga0501047_0021100 3300049581 Bacteria 6254
937 Ga0501047_0027663 3300049581 Bacteria 5463
938 Ga0501067_0061749 3300049583 Bacteria 2074
939 Ga0501067_0074663 3300049583 Bacteria 1879
940 Ga0501067_0172406 3300049583 Bacteria 1205
941 Ga0501068_0007889 3300049584 Bacteria 5898
942 Ga0501068_0403193 3300049584 Bacteria 882
943 Ga0501070_0007708 3300049586 Bacteria 9126
944 Ga0501070_0010356 3300049586 Bacteria 7881
945 Ga0501070_0019327 3300049586 Bacteria 5714
946 Ga0501070_0084114 3300049586 Bacteria 2634
947 Ga0501071_0138067 3300049587 Bacteria 1814
948 Ga0501072_0012822 3300049588 Bacteria 6408
949 Ga0501072_0070333 3300049588 Bacteria 2763
950 Ga0501072_0144634 3300049588 Bacteria 1896
951 Ga0501072_0502649 3300049588 Bacteria 959
952 Ga0501074_0034735 3300049590 Bacteria 3654
953 Ga0501074_0055240 3300049590 Bacteria 2862
954 Ga0501074_0057521 3300049590 Bacteria 2801
955 Ga0501074_0153948 3300049590 Bacteria 1643
956 Ga0501075_0470424 3300049591 Bacteria 959
957 Ga0501076_0022308 3300049592 Bacteria 4865
958 Ga0501077_0004569 3300049593 Bacteria 8414
959 Ga0501079_0009230 3300049741 Bacteria 7471
960 Ga0501079_0270797 3300049741 Bacteria 1327
961 Ga0501079_0461466 3300049741 Bacteria 998
962 Ga0501080_0036085 3300049742 Bacteria 4615
963 Ga0501080_0084403 3300049742 Bacteria 2951
964 Ga0501080_0176029 3300049742 Bacteria 1970
965 Ga0501083_0001297 3300049744 Bacteria 16900
966 Ga0501083_0007338 3300049744 Bacteria 7819
967 Ga0501035_0282180 3300049822 Bacteria 1403
968 Ga0501044_0033528 3300049823 Bacteria 5396
969 Ga0501045_0214998 3300049824 Bacteria 1431
970 Ga0501045_0529036 3300049824 Bacteria 875
971 nmdc:mga0yw44_13762_c2 3300050492 Bacteria 943
972 nmdc:mga05p37_25009_c1 3300050507 Bacteria 7259
973 nmdc:mga05p37_258217_c1 3300050507 Bacteria 2087
974 nmdc:mga05p37_26949_c1 3300050507 Bacteria 6992
975 nmdc:mga05p37_39439_c1 3300050507 Bacteria 5799
976 nmdc:mga09592_361372_c1 3300050508 Bacteria 1256
977 nmdc:mga09592_6807_c1 3300050508 Bacteria 9303
978 nmdc:mga0qj67_6100_c1 3300050509 Bacteria 8833
979 nmdc:mga06r32_471371_c1 3300050510 Bacteria 1234
980 nmdc:mga06r32_575595_c1 3300050510 Bacteria 1099
981 nmdc:mga08y16_144747_c1 3300050511 Bacteria 2470
982 nmdc:mga08y16_155070_c1 3300050511 Bacteria 2380
983 nmdc:mga08y16_218293_c1 3300050511 Bacteria 1974
984 nmdc:mga0n895_267183_c1 3300050512 Bacteria 1735
985 nmdc:mga0n895_349346_c1 3300050512 Bacteria 1498
986 nmdc:mga0n895_47778_c1 3300050512 Bacteria 4186
987 nmdc:mga0n895_795491_c1 3300050512 Bacteria 936
988 nmdc:mga0n895_801903_c1 3300050512 Bacteria 932
989 nmdc:mga0a205_598928_c1 3300050515 Bacteria 955
990 Ga0495601_0005063 3300053077 Bacteria 7649
991 Ga0495601_0006407 3300053077 Bacteria 6882
992 Ga0495601_0034968 3300053077 Bacteria 3135
993 Ga0495601_0040071 3300053077 Bacteria 2933
994 Ga0495601_0141329 3300053077 Bacteria 1570
995 Ga0495612_0007992 3300053078 Bacteria 4307
996 Ga0495612_0014189 3300053078 Bacteria 3206
997 Ga0495595_0015153 3300053084 Bacteria 3284
998 Ga0495595_0024174 3300053084 Bacteria 2682
999 Ga0495595_0109074 3300053084 Bacteria 1341
1000 Ga0495595_0117721 3300053084 Bacteria 1292
1001 Ga0495619_0001368 3300053085 Bacteria 16040
1002 Ga0495619_0006387 3300053085 Bacteria 7469
1003 Ga0495619_0017193 3300053085 Bacteria 4581
1004 Ga0495619_0036593 3300053085 Bacteria 3197
1005 Ga0495619_0063403 3300053085 Bacteria 2462
1006 Ga0495619_0082410 3300053085 Unclassified 2168
1007 Ga0495619_0082549 3300053085 Bacteria 2166
1008 Ga0500566_0004146 3300053094 Bacteria 8645
1009 Ga0501082_0209501 3300060353 Bacteria 1696
1010 Ga0466962_0000435 3300061719 Bacteria 18150
1011 Ga0466962_0010761 3300061719 Bacteria 4396
1012 Ga0466962_0042916 3300061719 Bacteria 2165
1013 Ga0466962_0101008 3300061719 Bacteria 1385
1014 Ga0466962_0284063 3300061719 Bacteria 817
1015 Ga0530510_0316201 3300061734 Bacteria 1170
1016 Ga0070698_100461979
1017 Ga0070658_10001317
1018 Ga0070658_10022933
1019 Ga0070683_100001088
1020 Ga0070683_100001951
1021 Ga0070683_100255007
1022 Ga0070683_100272179
1023 Ga0070680_100007887
1024 Ga0070680_100083768
1025 Ga0070680_100089388
1026 Ga0070680_100411739
1027 Ga0070682_100000829
1028 Ga0070682_100090423
1029 Ga0070682_100164403
1030 Ga0068868_100016781
1031 Ga0068868_100864109
1032 Ga0070660_100001059
1033 Ga0070660_100008244
1034 Ga0070660_100021867
1035 Ga0070660_100033201
1036 Ga0070660_100152063
1037 Ga0070661_100019788
1038 Ga0070661_100094101
1039 Ga0070668_100097080
1040 Ga0070669_100487942
1041 Ga0070671_100113812
1042 Ga0070674_100001923
1043 Ga0070674_100131110
1044 Ga0070688_100011954
1045 Ga0070659_100009404
1046 Ga0070659_100092639
1047 Ga0070659_100194269
1048 Ga0070709_10115489
1049 Ga0070709_10338949
1050 Ga0070714_100004653
1051 Ga0070714_100303496
1052 Ga0070714_100466897
1053 Ga0070714_100501313
1054 Ga0070713_100075434
1055 Ga0070710_10037223
1056 Ga0070711_100006191
1057 Ga0070711_100033061
1058 Ga0070700_100038025
1059 Ga0070694_100014705
1060 Ga0070694_100101036
1061 Ga0070708_100081955
1062 Ga0070678_100004589
1063 Ga0070678_100324901
1064 Ga0070681_10002352
1065 Ga0070681_10003595
1066 Ga0070681_10010574
1067 Ga0070681_10013434
1068 Ga0070681_10037244
1069 Ga0070681_10037651
1070 Ga0070681_10080413
1071 Ga0070681_10085889
1072 Ga0070681_10103037
1073 Ga0070681_10905078
1074 Ga0068867_100002148
1075 Ga0070685_10024215
1076 Ga0070706_100234109
1077 Ga0070706_100309288
1078 Ga0070707_100592316
1079 Ga0070698_100068513
1080 Ga0070698_100403972
1081 Ga0070679_100007912
1082 Ga0070679_100020102
1083 Ga0070679_100058729
1084 Ga0070679_100144831
1085 Ga0070679_100164593
1086 Ga0070679_100167130
1087 Ga0070679_100174091
1088 Ga0070679_100258005
1089 Ga0070679_100320406
1090 Ga0070679_100343975
1091 Ga0070679_100445843
1092 Ga0070679_100685161
1093 Ga0070684_100024020
1094 Ga0070684_100027971
1095 Ga0070684_100036184
1096 Ga0070684_100078135
1097 Ga0070684_100178767
1098 Ga0070684_100179445
1099 Ga0070684_100206830
1100 Ga0070684_100286270
1101 Ga0070684_100353010
1102 Ga0068853_100056394
1103 Ga0068853_100211232
1104 Ga0068853_100759342
1105 Ga0070672_100056701
1106 Ga0070686_100004436
1107 Ga0070695_100000007
1108 Ga0070696_100007993
1109 Ga0070693_100059312
1110 Ga0070693_100061905
1111 Ga0070693_100291123
1112 Ga0070665_100011488
1113 Ga0070665_100036558
1114 Ga0068855_100007604
1115 Ga0068855_100030809
1116 Ga0068855_100085789
1117 Ga0068855_100136965
1118 Ga0068855_100142801
1119 Ga0068855_100143099
1120 Ga0070664_100183221
1121 Ga0070664_100557813
1122 Ga0068857_100019412
1123 Ga0068857_100030217
1124 Ga0068857_100030773
1125 Ga0068854_100072256
1126 Ga0068856_100018376
1127 Ga0068856_100033958
1128 Ga0068856_100045426
1129 Ga0068856_100477282
1130 Ga0068856_100682329
1131 Ga0070702_100034424
1132 Ga0068852_100027164
1133 Ga0068852_100210811
1134 Ga0068859_100014318
1135 Ga0068859_100723792
1136 Ga0068859_100891993
1137 Ga0068864_100442979
1138 Ga0068866_10002212
1139 Ga0068861_100007529
1140 Ga0068861_100357831
1141 Ga0068861_100385297
1142 Ga0068863_100724928
1143 Ga0068858_100364670
1144 Ga0081455_10001912
1145 Ga0081455_10005929
1146 Ga0081455_10031254
1147 Ga0081455_10053919
1148 Ga0081455_10201927
1149 Ga0081538_10000238
1150 Ga0081538_10000732
1151 Ga0070717_10014842
1152 Ga0070717_10307849
1153 Ga0075365_10015502
1154 Ga0070712_100004041
1155 Ga0070712_100031937
1156 Ga0070712_100443186
1157 Ga0068871_100012365
1158 Ga0068871_100249723
1159 Ga0075428_100002031
1160 Ga0075430_100017348
1161 Ga0075431_100144540
1162 Ga0075433_10018360
1163 Ga0075433_10509230
1164 Ga0075434_100009519
1165 Ga0075434_100054617
1166 Ga0075434_100067001
1167 Ga0075434_100363118
1168 Ga0075434_100872878
1169 Ga0075434_100883439
1170 Ga0075429_100016785
1171 Ga0075429_100791609
1172 Ga0068865_100000598
1173 Ga0068865_100188777
1174 Ga0075436_100097594
1175 Ga0097620_100014318
1176 Ga0097620_100723681
1177 Ga0097620_100892016
1178 Ga0075435_100003270
1179 Ga0105240_10020317
1180 Ga0105240_10030751
1181 Ga0105240_10034249
1182 Ga0105240_10045838
1183 Ga0105240_10097231
1184 Ga0105240_10261758
1185 Ga0105240_10361728
1186 Ga0105240_10394808
1187 Ga0105240_10534683
1188 Ga0111539_10007774
1189 Ga0111539_10085758
1190 Ga0111539_10232834
1191 Ga0111539_10478988
1192 Ga0111539_10566682
1193 Ga0111539_11428249
1194 Ga0105245_10037476
1195 Ga0105245_10042907
1196 Ga0105245_10314189
1197 Ga0105245_10386361
1198 Ga0105245_10563244
1199 Ga0105245_10832763
1200 Ga0105247_10019067
1201 Ga0114129_10000663
1202 Ga0114129_10019250
1203 Ga0114129_10072699
1204 Ga0114129_10154752
1205 Ga0114129_10533366
1206 Ga0114129_11463354
1207 Ga0105243_10001070
1208 Ga0105243_10306972
1209 Ga0105241_10006225
1210 Ga0105241_10442831
1211 Ga0105242_10264266
1212 Ga0105242_10617391
1213 Ga0105248_10338602
1214 Ga0105237_10189511
1215 Ga0105238_10090084
1216 Ga0105238_10365572
1217 Ga0105249_10000462
1218 Ga0105239_10008937
1219 Ga0105239_10459399
1220 Ga0105239_10721398
1221 Ga0105246_10031802
1222 Ga0157371_10193305
1223 Ga0157371_10390704
1224 Ga0157370_10011210
1225 Ga0157370_10018219
1226 Ga0157370_10031630
1227 Ga0157370_10115006
1228 Ga0157369_10002883
1229 Ga0157369_10005196
1230 Ga0157369_10031406
1231 Ga0157369_10049518
1232 Ga0157369_10122807
1233 Ga0157369_10182179
1234 Ga0157369_10713978
1235 Ga0157369_10799654
1236 Ga0157374_10088070
1237 Ga0157374_10091638
1238 Ga0157374_10195999
1239 Ga0157374_10607440
1240 Ga0157378_10003364
1241 Ga0157378_10015883
1242 Ga0163162_10006948
1243 Ga0163162_10280169
1244 Ga0157372_10014938
1245 Ga0157372_10082283
1246 Ga0157372_10179700
1247 Ga0157372_10225425
1248 Ga0157372_10394134
1249 Ga0163163_10074767
1250 Ga0157380_10006721
1251 Ga0182008_10002753
1252 Ga0157376_10030962
1253 Ga0157376_10302804
1254 Ga0197907_10486216
1255 Ga0197907_10946547
1256 Ga0206356_10571689
1257 Ga0206356_11388465
1258 Ga0206354_10168775
1259 Ga0206354_10809368
1260 Ga0206354_11438060
1261 Ga0206353_10004980
1262 Ga0206353_10855307
1263 Ga0206353_10866168
1264 Ga0206353_11560650
1265 Ga0213874_10071456
1266 Ga0207692_10048265
1267 Ga0207642_10007289
1268 Ga0207710_10039609
1269 Ga0207688_10288445
1270 Ga0207647_10020804
1271 Ga0207685_10023373
1272 Ga0207699_10007942
1273 Ga0207699_10107165
1274 Ga0207705_10003887
1275 Ga0207705_10017397
1276 Ga0207705_10050591
1277 Ga0207705_10516960
1278 Ga0207684_10435422
1279 Ga0207654_10033192
1280 Ga0207654_10455564
1281 Ga0207707_10004063
1282 Ga0207707_10008618
1283 Ga0207707_10032326
1284 Ga0207707_10054937
1285 Ga0207707_10055614
1286 Ga0207707_10064290
1287 Ga0207707_10082866
1288 Ga0207707_10151769
1289 Ga0207707_10687163
1290 Ga0207695_10130596
1291 Ga0207695_10173651
1292 Ga0207695_10190224
1293 Ga0207695_10256295
1294 Ga0207695_10326251
1295 Ga0207671_10531418
1296 Ga0207693_10000175
1297 Ga0207693_10004462
1298 Ga0207693_10024538
1299 Ga0207693_10026443
1300 Ga0207693_10214943
1301 Ga0207693_10319788
1302 Ga0207663_10006653
1303 Ga0207663_10045032
1304 Ga0207663_10187359
1305 Ga0207663_10262673
1306 Ga0207660_10044303
1307 Ga0207660_10061836
1308 Ga0207660_10118472
1309 Ga0207660_10154121
1310 Ga0207660_10207811
1311 Ga0207660_10309457
1312 Ga0207660_10342577
1313 Ga0207660_10343859
1314 Ga0207662_10224818
1315 Ga0207657_10001687
1316 Ga0207657_10001863
1317 Ga0207657_10002690
1318 Ga0207657_10003855
1319 Ga0207657_10009516
1320 Ga0207657_10028420
1321 Ga0207657_10121615
1322 Ga0207649_10063761
1323 Ga0207649_10111534
1324 Ga0207652_10019328
1325 Ga0207652_10021781
1326 Ga0207652_10022742
1327 Ga0207652_10042448
1328 Ga0207652_10047416
1329 Ga0207652_10077647
1330 Ga0207652_10088728
1331 Ga0207652_10317154
1332 Ga0207652_10319411
1333 Ga0207652_10450201
1334 Ga0207652_10603042
1335 Ga0207652_10702635
1336 Ga0207646_10899964
1337 Ga0207681_10379228
1338 Ga0207659_10128811
1339 Ga0207687_10022442
1340 Ga0207687_10126995
1341 Ga0207687_10474638
1342 Ga0207700_10062639
1343 Ga0207700_10081972
1344 Ga0207700_10182276
1345 Ga0207664_10018495
1346 Ga0207664_10031085
1347 Ga0207664_10043381
1348 Ga0207664_10112838
1349 Ga0207664_10413711
1350 Ga0207644_10086235
1351 Ga0207690_10031594
1352 Ga0207690_10088778
1353 Ga0207690_10100819
1354 Ga0207669_10035577
1355 Ga0207704_10004196
1356 Ga0207704_10150010
1357 Ga0207665_10308452
1358 Ga0207691_10022282
1359 Ga0207711_10294197
1360 Ga0207689_10053421
1361 Ga0207661_10002819
1362 Ga0207661_10079555
1363 Ga0207661_10102395
1364 Ga0207661_10171651
1365 Ga0207661_10537311
1366 Ga0207679_10035002
1367 Ga0207667_10050181
1368 Ga0207667_10151083
1369 Ga0207667_10168935
1370 Ga0207667_10182809
1371 Ga0207667_10451502
1372 Ga0207668_10152155
1373 Ga0207640_10278293
1374 Ga0207640_10278957
1375 Ga0207677_10091618
1376 Ga0207703_10313939
1377 Ga0207639_10364076
1378 Ga0207639_10594973
1379 Ga0207678_10296634
1380 Ga0207708_10000614
1381 Ga0207702_10031510
1382 Ga0207702_10192099
1383 Ga0207702_10803164
1384 Ga0207641_10488768
1385 Ga0207648_10000312
1386 Ga0207674_10001702
1387 Ga0207674_10043773
1388 Ga0207674_10135533
1389 Ga0207675_100016684
1390 Ga0207675_100289845
1391 Ga0207675_100645692
1392 Ga0207683_10000447
1393 Ga0207698_10070332
1394 Ga0207698_10174902
1395 Ga0207698_10317733
1396 Ga0207698_10373060
1397 Ga0207698_11094741
1398 Ga0207428_10010564
1399 Ga0207428_10111771
1400 Ga0268266_10480404
1401 Ga0268265_10162983
1402 Ga0265337_1037716
1403 Ga0265319_1002232
1404 Ga0265319_1005903
1405 Ga0265319_1034276
1406 Ga0265334_10005171
1407 Ga0265334_10006308
1408 Ga0265334_10057443
1409 Ga0265318_10001217
1410 Ga0265318_10004976
1411 Ga0265318_10017733
1412 Ga0265318_10033223
1413 Ga0265322_10005028
1414 Ga0265336_10019242
1415 Ga0265338_10002936
1416 Ga0265338_10004663
1417 Ga0265338_10005415
1418 Ga0265338_10006096
1419 Ga0265338_10011028
1420 Ga0265338_10022169
1421 Ga0265338_10023362
1422 Ga0265338_10032851
1423 Ga0265338_10103090
1424 Ga0265338_10115354
1425 Ga0265338_10135654
1426 Ga0265324_10010089
1427 Ga0265330_10001984
1428 Ga0265330_10021882
1429 Ga0265332_10001963
1430 Ga0265320_10010508
1431 Ga0265320_10116265
1432 Ga0265325_10001625
1433 Ga0265325_10074785
1434 Ga0265329_10004462
1435 Ga0265340_10013617
1436 Ga0265339_10015659
1437 Ga0265339_10047254
1438 Ga0265331_10004771
1439 Ga0265331_10128843
1440 Ga0265327_10010871
1441 Ga0265327_10015346
1442 Ga0265327_10020771
1443 Ga0265327_10035186
1444 Ga0265327_10039611
1445 Ga0265316_10010353
1446 Ga0265316_10031951
1447 Ga0265313_10009457
1448 Ga0265342_10007562
1449 Ga0265342_10012474
1450 Ga0265342_10035915
1451 Ga0265342_10039995
1452 Ga0265342_10068449
1453 Ga0307409_100106171
1454 Ga0307415_100008712
1455 Ga0373926_0014617
1456 Ga0373926_0016492
1457 Ga0373926_0066166
1458 Ga0373944_0011024
1459 Ga0373944_0054386
1460 Ga0373923_0075325
1461 Ga0373945_0006065
1462 Ga0373945_0036752
1463 Ga0373943_0000202
1464 Ga0373943_0000628
1465 Ga0373943_0024122
1466 Ga0373943_0098383
1467 Ga0373943_0387907
1468 Ga0373946_0048003
1469 Ga0373935_0021166
1470 Ga0373935_0080510
1471 Ga0373927_0022200
1472 Ga0373927_0049940
1473 Ga0373927_0069551
1474 Ga0373933_0118690
1475 Ga0373947_0001859
1476 Ga0373947_0004063
1477 Ga0373947_0007481
1478 Ga0373947_0110729
1479 Ga0373925_0002950
1480 Ga0373925_0004197
1481 Ga0373925_0207685
1482 Ga0395899_0003838
1483 Ga0395899_0006929
1484 Ga0395899_0013646
1485 Ga0395899_0028021
1486 Ga0395899_0028559
1487 Ga0395899_0035495
1488 Ga0395899_0042470
1489 Ga0395899_0044960
1490 Ga0395899_0182628
1491 Ga0395900_0001305
1492 Ga0395900_0001795
1493 Ga0395900_0004382
1494 Ga0395900_0008431
1495 Ga0395900_0009973
1496 Ga0395900_0019920
1497 Ga0395900_0044983
1498 Ga0395900_0051108
1499 Ga0395900_0065587
1500 Ga0395900_0101801
1501 Ga0395900_0125629
1502 Ga0395900_0451995
1503 Ga0395900_0478995
1504 Ga0395900_0856309
1505 Ga0395898_0001041
1506 Ga0395898_0005552
1507 Ga0395898_0008130
1508 Ga0395898_0014237
1509 Ga0395898_0030154
1510 Ga0395898_0049386
1511 Ga0395898_0074819
1512 Ga0395898_0132228
1513 Ga0395898_0167725
1514 Ga0395898_0230872
1515 Ga0395898_0506764
1516 Ga0395898_0511602
1517 Ga0395898_0967131
1518 Ga0395905_0003322
1519 Ga0395905_0004844
1520 Ga0395905_0007518
1521 Ga0395905_0033772
1522 Ga0395905_0062361
1523 Ga0395905_0102848
1524 Ga0395905_0187841
1525 Ga0395905_0195282
1526 Ga0395905_0220218
1527 Ga0395905_0265085
1528 Ga0395905_0407003
1529 Ga0395905_0627517
1530 Ga0395901_0002535
1531 Ga0395901_0004613
1532 Ga0395901_0012470
1533 Ga0395901_0016459
1534 Ga0395901_0021482
1535 Ga0395901_0024699
1536 Ga0395901_0028470
1537 Ga0395901_0037776
1538 Ga0395901_0043740
1539 Ga0395901_0044798
1540 Ga0395901_0068108
1541 Ga0395901_0096495
1542 Ga0395901_0118097
1543 Ga0395901_0222416
1544 Ga0395901_0230403
1545 Ga0395901_0260587
1546 Ga0395901_0319212
1547 Ga0395901_0434127
1548 Ga0395901_0643692
1549 Ga0395901_0747391
1550 Ga0395901_0802311
1551 Ga0395901_1163899
1552 Ga0436365_0668709
1553 Ga0436365_1318472
1554 Ga0436360_0831043
1555 Ga0436360_0901858
1556 Ga0436363_1243768
1557 Ga0436362_0236793
1558 Ga0436362_0621431
1559 Ga0439466_0036859
1560 Ga0439465_0036990
1561 Ga0450912_003824
1562 Ga0466969_0003769
1563 Ga0466969_0059450
1564 Ga0466969_0094108
1565 Ga0466969_0171947
1566 Ga0466972_0004423
1567 Ga0466965_0026668
1568 Ga0466965_0030986
1569 Ga0466965_0185366
1570 Ga0466966_0028895
1571 Ga0466966_0036603
1572 Ga0466966_0060326
1573 Ga0466966_0382197
1574 Ga0466961_0003294
1575 Ga0466961_0004522
1576 Ga0466961_0041467
1577 Ga0466961_0041602
1578 Ga0466961_0119588
1579 Ga0466961_0250017
1580 Ga0466961_0253003
1581 Ga0466963_0000164
1582 Ga0466963_0000276
1583 Ga0466963_0000438
1584 Ga0466963_0000517
1585 Ga0466963_0000632
1586 Ga0466963_0000673
1587 Ga0466963_0000741
1588 Ga0466963_0002101
1589 Ga0466963_0002688
1590 Ga0466963_0017815
1591 Ga0466963_0029658
1592 Ga0466963_0035834
1593 Ga0466963_0038983
1594 Ga0466963_0068247
1595 Ga0466963_0110817
1596 Ga0466963_0187657
1597 Ga0466963_0192667
1598 Ga0466963_0279434
1599 Ga0466964_0003262
1600 Ga0466964_0006725
1601 Ga0466964_0013420
1602 Ga0466964_0112453
1603 Ga0466964_0115553
1604 Ga0466964_0156853
1605 Ga0466964_0182272
1606 Ga0466971_0000481
1607 Ga0466971_0001552
1608 Ga0466971_0001914
1609 Ga0466971_0019901
1610 Ga0466971_0072725
1611 Ga0466971_0124840
1612 Ga0466968_0004224
1613 Ga0466968_0006450
1614 Ga0466968_0008503
1615 Ga0466968_0091729
1616 Ga0466968_0138655
1617 Ga0466970_0050071
1618 Ga0466970_0051273
1619 Ga0466970_0116154
1620 Ga0466957_0000468
1621 Ga0466957_0001689
1622 Ga0466957_0003049
1623 Ga0466957_0003662
1624 Ga0466957_0019150
1625 Ga0466957_0039136
1626 Ga0466957_0061801
1627 Ga0466957_0066675
1628 Ga0466957_0150446
1629 Ga0466957_0435564
1630 Ga0466960_0010750
1631 Ga0466960_0011479
1632 Ga0466959_0001767
1633 Ga0466959_0010806
1634 Ga0466959_0019080
1635 Ga0466959_0028028
1636 Ga0466959_0081124
1637 Ga0466959_0128124
1638 Ga0451576_0257673
1639 Ga0466958_0002075
1640 Ga0466958_0005483
1641 Ga0466958_0007875
1642 Ga0466958_0010034
1643 Ga0466958_0032583
1644 Ga0466958_0038614
1645 Ga0466958_0084717
1646 Ga0466958_0106467
1647 Ga0466958_0151020
1648 Ga0466967_0000047
1649 Ga0466967_0002201
1650 Ga0466967_0003956
1651 Ga0466967_0005125
1652 Ga0466967_0007722
1653 Ga0466967_0011353
1654 Ga0466967_0015887
1655 Ga0466967_0016795
1656 Ga0466967_0029149
1657 Ga0466967_0037497
1658 Ga0466967_0048736
1659 Ga0466967_0058888
1660 Ga0466967_0059909
1661 Ga0466967_0059987
1662 Ga0466967_0062637
1663 Ga0466967_0090251
1664 Ga0466967_0104505
1665 Ga0466967_0185980
1666 Ga0466967_0260828
1667 Ga0466967_0271803
1668 Ga0466967_0668370
1669 Ga0466967_0715446
1670 Ga0466967_0767658
1671 Ga0495592_0002732
1672 Ga0495592_0138274
1673 Ga0495592_0462157
1674 Ga0495603_0007242
1675 Ga0495603_0007937
1676 Ga0495603_0095717
1677 Ga0495629_0001934
1678 Ga0495629_0014311
1679 Ga0495629_0014949
1680 Ga0495629_0018947
1681 Ga0495629_0209154
1682 Ga0495629_0267095
1683 Ga0495641_0002017
1684 Ga0495641_0003398
1685 Ga0495641_0009544
1686 Ga0495641_0014182
1687 Ga0495651_0054488
1688 Ga0495651_0090009
1689 Ga0495653_0005518
1690 Ga0495653_0032590
1691 Ga0495653_0048893
1692 Ga0495653_0062456
1693 Ga0495653_0068600
1694 Ga0495653_0118801
1695 Ga0495653_0457158
1696 Ga0495580_0006348
1697 Ga0495582_0005349
1698 Ga0495582_0007435
1699 Ga0495582_0013497
1700 Ga0495582_0015744
1701 Ga0495582_0017838
1702 Ga0495605_0056138
1703 Ga0495605_0160539
1704 Ga0495639_0000291
1705 Ga0495639_0002764
1706 Ga0495662_0000267
1707 Ga0495662_0006357
1708 Ga0495662_0123477
1709 Ga0495664_0007586
1710 Ga0495664_0112373
1711 Ga0495584_0159356
1712 Ga0495585_0138335
1713 Ga0495594_0161208
1714 Ga0495594_0262739
1715 Ga0495594_0275701
1716 Ga0495594_0286919
1717 Ga0495596_0036892
1718 Ga0495607_0036467
1719 Ga0495607_0062898
1720 Ga0495608_0018741
1721 Ga0495608_0066473
1722 Ga0495618_0006267
1723 Ga0495618_0052983
1724 Ga0495628_0053021
1725 Ga0495628_0056803
1726 Ga0495628_0166266
1727 Ga0495628_0332263
1728 Ga0495630_0000631
1729 Ga0495630_0001460
1730 Ga0495630_0021106
1731 Ga0495630_0029216
1732 Ga0495630_0049495
1733 Ga0495630_0271962
1734 Ga0495630_0403736
1735 Ga0495631_0188582
1736 Ga0495631_0194473
1737 Ga0495644_0020786
1738 Ga0495644_0116957
1739 Ga0495663_0025528
1740 Ga0495666_0000270
1741 Ga0495652_0004378
1742 Ga0495652_0081678
1743 Ga0495652_0160873
1744 Ga0495652_0282418
1745 Ga0495665_0000537
1746 Ga0495665_0001487
1747 Ga0495665_0116306
1748 Ga0495640_0018801
1749 Ga0495640_0019213
1750 Ga0495640_0048828
1751 Ga0495640_0077885
1752 Ga0495640_0222989
1753 Ga0495586_0004266
1754 Ga0495586_0004990
1755 Ga0495586_0040895
1756 Ga0495586_0047008
1757 Ga0495586_0145303
1758 Ga0495587_0017090
1759 Ga0495587_0024497
1760 Ga0495587_0065614
1761 Ga0495645_0009287
1762 Ga0495645_0035797
1763 Ga0495645_0138328
1764 Ga0495645_0189408
1765 Ga0495667_0005824
1766 Ga0495667_0015940
1767 Ga0495667_0016704
1768 Ga0495667_0041279
1769 Ga0495667_0189470
1770 Ga0495667_0259366
1771 Ga0495656_0009318
1772 Ga0495656_0102958
1773 Ga0495656_0166620
1774 Ga0495634_0004560
1775 Ga0495634_0016205
1776 Ga0495634_0081971
1777 Ga0495625_0067861
1778 Ga0495635_0006305
1779 Ga0495635_0013922
1780 Ga0495635_0016213
1781 Ga0495635_0056961
1782 Ga0495635_0128028
1783 Ga0495659_0048569
1784 Ga0495657_0038051
1785 Ga0495657_0076186
1786 Ga0495657_0350915
1787 Ga0495599_0061122
1788 Ga0495599_0229952
1789 Ga0495599_0247561
1790 Ga0495623_0042995
1791 Ga0495646_0041198
1792 Ga0495646_0128671
1793 Ga0495646_0151695
1794 Ga0495647_0000243
1795 Ga0495647_0004123
1796 Ga0495647_0011761
1797 Ga0495647_0023141
1798 Ga0495658_0000462
1799 Ga0495658_0000970
1800 Ga0495658_0019086
1801 Ga0495658_0083106
1802 Ga0495658_0306790
1803 Ga0495669_0014044
1804 Ga0495613_0008628
1805 Ga0495613_0027568
1806 Ga0495613_0029268
1807 Ga0495613_0163261
1808 Ga0495624_0001273
1809 Ga0495624_0033222
1810 Ga0495624_0104906
1811 Ga0495624_0378131
1812 Ga0495671_0113464
1813 Ga0495671_0114805
1814 Ga0495600_0167237
1815 Ga0495581_0000258
1816 Ga0495581_0000746
1817 Ga0495581_0001092
1818 Ga0495581_0004100
1819 Ga0495581_0008336
1820 Ga0495604_0030056
1821 Ga0495604_0076244
1822 Ga0495604_0197932
1823 Ga0495604_0286391
1824 Ga0495604_0324458
1825 Ga0495674_0004337
1826 Ga0495674_0036575
1827 Ga0495674_0064359
1828 Ga0495674_0168556
1829 Ga0495674_0387709
1830 Ga0495676_0001520
1831 Ga0495676_0004766
1832 Ga0495676_0007780
1833 Ga0495676_0024105
1834 Ga0495676_0058823
1835 Ga0495676_0418289
1836 Ga0495676_0450820
1837 Ga0495680_0001263
1838 Ga0495680_0002837
1839 Ga0495680_0017856
1840 Ga0495680_0028617
1841 Ga0495680_0349417
1842 Ga0495680_0385136
1843 Ga0495675_0176563
1844 Ga0495677_0023071
1845 Ga0495684_0007604
1846 Ga0495684_0012663
1847 Ga0495684_0014916
1848 Ga0495684_0021053
1849 Ga0495684_0030087
1850 Ga0495684_0061022
1851 Ga0495684_0169027
1852 Ga0495593_0000732
1853 Ga0495593_0002644
1854 Ga0495602_0085890
1855 Ga0495614_0000557
1856 Ga0495614_0023684
1857 Ga0495614_0060543
1858 Ga0496100_0008150
1859 Ga0496100_0040408
1860 Ga0496100_0113576
1861 Ga0496100_0228238
1862 Ga0496101_0003811
1863 Ga0496101_0010832
1864 Ga0496101_0026134
1865 Ga0496101_0146782
1866 Ga0496101_0174525
1867 Ga0496101_0262186
1868 Ga0496101_0415623
1869 Ga0496101_0630784
1870 Ga0496102_0010626
1871 Ga0496102_0070452
1872 Ga0496102_0206464
1873 Ga0496103_0006753
1874 Ga0496103_0036752
1875 Ga0496103_0093067
1876 Ga0496103_0243429
1877 Ga0496104_0022353
1878 Ga0496104_0149671
1879 Ga0496104_0156900
1880 Ga0496104_0232231
1881 Ga0496104_0251265
1882 Ga0496104_0351028
1883 Ga0496105_0001611
1884 Ga0496105_0004708
1885 Ga0496105_0057116
1886 Ga0496105_0061507
1887 Ga0496105_0175887
1888 Ga0496106_0002200
1889 Ga0496106_0004174
1890 Ga0496106_0011451
1891 Ga0496106_0022792
1892 Ga0496106_0404585
1893 Ga0496107_0001150
1894 Ga0496107_0002928
1895 Ga0496107_0014064
1896 Ga0496107_0201854
1897 Ga0496107_0451569
1898 Ga0496108_0006645
1899 Ga0496108_0010152
1900 Ga0496108_0024322
1901 Ga0496108_0409701
1902 Ga0496109_0196856
1903 Ga0496109_0235827
1904 Ga0496109_0254992
1905 Ga0496109_0366729
1906 Ga0496109_0462015
1907 Ga0496109_0496490
1908 Ga0496109_0562687
1909 Ga0496109_0751432
1910 Ga0496109_1030744
1911 Ga0496110_0002690
1912 Ga0496110_0047839
1913 Ga0496110_0343324
1914 Ga0496110_0686612
1915 Ga0496111_0014287
1916 Ga0496111_0059759
1917 Ga0496111_0160686
1918 Ga0496111_0187939
1919 Ga0496112_0007079
1920 Ga0496112_0034788
1921 Ga0496112_0056291
1922 Ga0496112_0079720
1923 Ga0496112_0108744
1924 Ga0496112_0117198
1925 Ga0496112_0131927
1926 Ga0496112_0263658
1927 Ga0496112_0299881
1928 Ga0496113_0044850
1929 Ga0496113_0126351
1930 Ga0496113_0219291
1931 Ga0496113_0346180
1932 Ga0496113_0502337
1933 Ga0496114_0002086
1934 Ga0496114_0503008
1935 Ga0496115_0001353
1936 Ga0496115_0024962
1937 Ga0496115_0056885
1938 Ga0496115_0099828
1939 Ga0496115_0256105
1940 Ga0496115_0525401
1941 Ga0501031_0256286
1942 Ga0501034_0028414
1943 Ga0501037_0006204
1944 Ga0501038_0003135
1945 Ga0501039_0094740
1946 Ga0501040_0080921
1947 Ga0501041_0036654
1948 Ga0501041_0214000
1949 Ga0501043_0063171
1950 Ga0501046_0017653
1951 Ga0501047_0021100
1952 Ga0501047_0027663
1953 Ga0501067_0061749
1954 Ga0501067_0074663
1955 Ga0501067_0172406
1956 Ga0501068_0007889
1957 Ga0501068_0403193
1958 Ga0501070_0007708
1959 Ga0501070_0010356
1960 Ga0501070_0019327
1961 Ga0501070_0084114
1962 Ga0501071_0138067
1963 Ga0501072_0012822
1964 Ga0501072_0070333
1965 Ga0501072_0144634
1966 Ga0501072_0502649
1967 Ga0501074_0034735
1968 Ga0501074_0055240
1969 Ga0501074_0057521
1970 Ga0501074_0153948
1971 Ga0501075_0470424
1972 Ga0501076_0022308
1973 Ga0501077_0004569
1974 Ga0501079_0009230
1975 Ga0501079_0270797
1976 Ga0501079_0461466
1977 Ga0501080_0036085
1978 Ga0501080_0084403
1979 Ga0501080_0176029
1980 Ga0501083_0001297
1981 Ga0501083_0007338
1982 Ga0501035_0282180
1983 Ga0501044_0033528
1984 Ga0501045_0214998
1985 Ga0501045_0529036
1986 nmdc:mga0yw44_13762_c2
1987 nmdc:mga05p37_25009_c1
1988 nmdc:mga05p37_258217_c1
1989 nmdc:mga05p37_26949_c1
1990 nmdc:mga05p37_39439_c1
1991 nmdc:mga09592_361372_c1
1992 nmdc:mga09592_6807_c1
1993 nmdc:mga0qj67_6100_c1
1994 nmdc:mga06r32_471371_c1
1995 nmdc:mga06r32_575595_c1
1996 nmdc:mga08y16_144747_c1
1997 nmdc:mga08y16_155070_c1
1998 nmdc:mga08y16_218293_c1
1999 nmdc:mga0n895_267183_c1
2000 nmdc:mga0n895_349346_c1
2001 nmdc:mga0n895_47778_c1
2002 nmdc:mga0n895_795491_c1
2003 nmdc:mga0n895_801903_c1
2004 nmdc:mga0a205_598928_c1
2005 Ga0495601_0005063
2006 Ga0495601_0006407
2007 Ga0495601_0034968
2008 Ga0495601_0040071
2009 Ga0495601_0141329
2010 Ga0495612_0007992
2011 Ga0495612_0014189
2012 Ga0495595_0015153
2013 Ga0495595_0024174
2014 Ga0495595_0109074
2015 Ga0495595_0117721
2016 Ga0495619_0001368
2017 Ga0495619_0006387
2018 Ga0495619_0017193
2019 Ga0495619_0036593
2020 Ga0495619_0063403
2021 Ga0495619_0082410
2022 Ga0495619_0082549
2023 Ga0500566_0004146
2024 Ga0501082_0209501
2025 Ga0466962_0000435
2026 Ga0466962_0010761
2027 Ga0466962_0042916
2028 Ga0466962_0101008
2029 Ga0466962_0284063
2030 Ga0530510_0316201

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

14

220

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.6332 4 232
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.6219 4 232
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.4185 1 208
2y5y-assembly1.cif.gz_A crystal structure of lacy in complex with an affinity inactivator 0.4143 4 222
4ja3-assembly2.cif.gz_B partially occluded inward open conformation of the xylose transporter xyle from e. coli 0.4118 52 212
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.498 4 212 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.492 7 210 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4842 7 210 1.20.1250.20
af_Q9VCJ5_201_360_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4785 47 213 1.20.1250.20
af_A0A3B1DV80_20_452_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4589 3 209 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537W334-F1-model_v4 DUF480 domain-containing protein 0.8338 1 229 GO:0016020
GO:0017004
AF-A0A832DCY9-F1-model_v4 Cytochrome C biogenesis protein transmembrane domain-containing protein 0.8291 4 226 GO:0016020
GO:0017004
AF-A0A537W334-F1-model_v4 DUF480 domain-containing protein 0.8209 1 229 GO:0016020
GO:0017004
AF-A0A7K4A7H0-F1-model_v4 deleted 0.8153 4 211
AF-A0A0B2SQY6-F1-model_v4 Proteasome subunit alpha type-6 0.8141 5 218 GO:0006511
GO:0009507
GO:0016020
GO:0017004
GO:0019773

Map