F488038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 335 | 2014 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300025926|Ga0207659_10349715|Ga0207659_103497152 |
| Length | 210 |
| Sequence | MSHHFASHIPSFRIGTSGDASLTSWVRTVAKSEARFDLPSWAQVTDKRRGHILRVTTLLDEWASAMRVGTKERTAWRDAGLFHDALKDAPDDELRELVGDVAYEPQMIHGPAAAAWLEQHGEKRRGVLDAVRYHTVGYLDWDRTGRALYMADFLEPGRKFSQRDRAFLAAQVPQDFDGVFRQVVRARLEWSLHEGYSLFPETVSLWNATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 220 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 305 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 306 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 310 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 311 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 317 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 98.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207659_10349715 | 3300025926 | Bacteria | 1226 |
| 2 | JGI25406J46586_10032713 | 3300003203 | Bacteria | 1929 |
| 3 | Ga0065715_10273275 | 3300005293 | Bacteria | 1105 |
| 4 | Ga0065715_10355927 | 3300005293 | Bacteria | 943 |
| 5 | Ga0065707_10095745 | 3300005295 | Bacteria | 3343 |
| 6 | Ga0070658_10002410 | 3300005327 | Bacteria | 15652 |
| 7 | Ga0070658_10017737 | 3300005327 | Bacteria | 5694 |
| 8 | Ga0070658_10091182 | 3300005327 | Bacteria | 2511 |
| 9 | Ga0070676_10001204 | 3300005328 | Bacteria | 12947 |
| 10 | Ga0070676_10036346 | 3300005328 | Bacteria | 2837 |
| 11 | Ga0070676_10277778 | 3300005328 | Bacteria | 1127 |
| 12 | Ga0070676_10474713 | 3300005328 | Bacteria | 884 |
| 13 | Ga0070676_10643333 | 3300005328 | Bacteria | 769 |
| 14 | Ga0070683_100002655 | 3300005329 | Bacteria | 14296 |
| 15 | Ga0070683_100006959 | 3300005329 | Bacteria | 9511 |
| 16 | Ga0070683_100010228 | 3300005329 | Bacteria | 8059 |
| 17 | Ga0070683_100016249 | 3300005329 | Bacteria | 6559 |
| 18 | Ga0070683_100044126 | 3300005329 | Bacteria | 4110 |
| 19 | Ga0070683_100044551 | 3300005329 | Bacteria | 4091 |
| 20 | Ga0070683_100071081 | 3300005329 | Bacteria | 3247 |
| 21 | Ga0070683_100170065 | 3300005329 | Unclassified | 2069 |
| 22 | Ga0070683_100192109 | 3300005329 | Bacteria | 1939 |
| 23 | Ga0070683_100214490 | 3300005329 | Bacteria | 1829 |
| 24 | Ga0070683_100328999 | 3300005329 | Bacteria | 1455 |
| 25 | Ga0070683_100333987 | 3300005329 | Bacteria | 1443 |
| 26 | Ga0070683_100756011 | 3300005329 | Unclassified | 931 |
| 27 | Ga0070683_100786483 | 3300005329 | Unclassified | 912 |
| 28 | Ga0070690_100109667 | 3300005330 | Bacteria | 1840 |
| 29 | Ga0070670_100001025 | 3300005331 | Bacteria | 22087 |
| 30 | Ga0070670_100042150 | 3300005331 | Bacteria | 3923 |
| 31 | Ga0070670_100063363 | 3300005331 | Bacteria | 3173 |
| 32 | Ga0070670_100079494 | 3300005331 | Bacteria | 2818 |
| 33 | Ga0070670_100094359 | 3300005331 | Bacteria | 2573 |
| 34 | Ga0070670_100101621 | 3300005331 | Bacteria | 2476 |
| 35 | Ga0070677_10189805 | 3300005333 | Bacteria | 984 |
| 36 | Ga0070677_10201500 | 3300005333 | Bacteria | 961 |
| 37 | Ga0068869_100005737 | 3300005334 | Bacteria | 7837 |
| 38 | Ga0068869_100426096 | 3300005334 | Bacteria | 1096 |
| 39 | Ga0070666_10286668 | 3300005335 | Unclassified | 1171 |
| 40 | Ga0070666_10330081 | 3300005335 | Bacteria | 1089 |
| 41 | Ga0070666_10669090 | 3300005335 | Bacteria | 760 |
| 42 | Ga0070680_100000152 | 3300005336 | Bacteria | 42779 |
| 43 | Ga0070680_100019957 | 3300005336 | Bacteria | 5312 |
| 44 | Ga0070680_100060577 | 3300005336 | Bacteria | 3097 |
| 45 | Ga0070680_100086489 | 3300005336 | Bacteria | 2591 |
| 46 | Ga0070680_100114688 | 3300005336 | Bacteria | 2245 |
| 47 | Ga0070680_100367918 | 3300005336 | Unclassified | 1223 |
| 48 | Ga0070680_100418248 | 3300005336 | Bacteria | 1143 |
| 49 | Ga0070680_100440107 | 3300005336 | Bacteria | 1113 |
| 50 | Ga0070680_100637462 | 3300005336 | Bacteria | 915 |
| 51 | Ga0070682_100177369 | 3300005337 | Bacteria | 1485 |
| 52 | Ga0068868_100004677 | 3300005338 | Bacteria | 9614 |
| 53 | Ga0070660_100002497 | 3300005339 | Bacteria | 12624 |
| 54 | Ga0070660_100005660 | 3300005339 | Bacteria | 8662 |
| 55 | Ga0070660_100266266 | 3300005339 | Bacteria | 1400 |
| 56 | Ga0070660_100285905 | 3300005339 | Bacteria | 1350 |
| 57 | Ga0070660_100538871 | 3300005339 | Unclassified | 973 |
| 58 | Ga0070689_100042472 | 3300005340 | Bacteria | 3491 |
| 59 | Ga0070689_100061649 | 3300005340 | Bacteria | 2917 |
| 60 | Ga0070689_100236026 | 3300005340 | Unclassified | 1505 |
| 61 | Ga0070689_100268528 | 3300005340 | Bacteria | 1412 |
| 62 | Ga0070691_10002555 | 3300005341 | Bacteria | 8115 |
| 63 | Ga0070691_10067410 | 3300005341 | Unclassified | 1731 |
| 64 | Ga0070691_10521298 | 3300005341 | Unclassified | 690 |
| 65 | Ga0070687_100005938 | 3300005343 | Bacteria | 4968 |
| 66 | Ga0070687_100024242 | 3300005343 | Bacteria | 2894 |
| 67 | Ga0070687_100024463 | 3300005343 | Bacteria | 2884 |
| 68 | Ga0070661_100000555 | 3300005344 | Bacteria | 28645 |
| 69 | Ga0070661_100005738 | 3300005344 | Bacteria | 8549 |
| 70 | Ga0070661_100008221 | 3300005344 | Bacteria | 7200 |
| 71 | Ga0070661_100020996 | 3300005344 | Bacteria | 4662 |
| 72 | Ga0070661_100128689 | 3300005344 | Bacteria | 1900 |
| 73 | Ga0070661_100148062 | 3300005344 | Bacteria | 1774 |
| 74 | Ga0070661_100246771 | 3300005344 | Bacteria | 1376 |
| 75 | Ga0070661_100255601 | 3300005344 | Bacteria | 1353 |
| 76 | Ga0070692_10014089 | 3300005345 | Bacteria | 3745 |
| 77 | Ga0070692_10070664 | 3300005345 | Bacteria | 1859 |
| 78 | Ga0070692_10608150 | 3300005345 | Unclassified | 724 |
| 79 | Ga0070668_100000088 | 3300005347 | Bacteria | 57110 |
| 80 | Ga0070668_100023628 | 3300005347 | Bacteria | 4651 |
| 81 | Ga0070668_100661056 | 3300005347 | Unclassified | 919 |
| 82 | Ga0070668_101143191 | 3300005347 | Unclassified | 704 |
| 83 | Ga0070669_100005368 | 3300005353 | Bacteria | 9247 |
| 84 | Ga0070669_100056611 | 3300005353 | Bacteria | 2875 |
| 85 | Ga0070669_100120085 | 3300005353 | Bacteria | 2004 |
| 86 | Ga0070675_100001976 | 3300005354 | Bacteria | 15191 |
| 87 | Ga0070675_100013662 | 3300005354 | Bacteria | 6387 |
| 88 | Ga0070675_100120175 | 3300005354 | Bacteria | 2232 |
| 89 | Ga0070675_100150767 | 3300005354 | Bacteria | 1993 |
| 90 | Ga0070675_100319735 | 3300005354 | Bacteria | 1371 |
| 91 | Ga0070675_100472422 | 3300005354 | Bacteria | 1127 |
| 92 | Ga0070671_100137716 | 3300005355 | Bacteria | 2058 |
| 93 | Ga0070671_100300887 | 3300005355 | Bacteria | 1366 |
| 94 | Ga0070671_100504097 | 3300005355 | Unclassified | 1041 |
| 95 | Ga0070671_100615987 | 3300005355 | Unclassified | 938 |
| 96 | Ga0070674_100003798 | 3300005356 | Bacteria | 8533 |
| 97 | Ga0070674_100013303 | 3300005356 | Bacteria | 5084 |
| 98 | Ga0070674_100147132 | 3300005356 | Bacteria | 1774 |
| 99 | Ga0070674_100198665 | 3300005356 | Bacteria | 1547 |
| 100 | Ga0070674_100510285 | 3300005356 | Bacteria | 1003 |
| 101 | Ga0070673_100028459 | 3300005364 | Bacteria | 4156 |
| 102 | Ga0070673_100050060 | 3300005364 | Bacteria | 3264 |
| 103 | Ga0070673_100201425 | 3300005364 | Bacteria | 1714 |
| 104 | Ga0070673_100216618 | 3300005364 | Bacteria | 1655 |
| 105 | Ga0070673_100252801 | 3300005364 | Bacteria | 1537 |
| 106 | Ga0070673_100281052 | 3300005364 | Bacteria | 1460 |
| 107 | Ga0070673_100301543 | 3300005364 | Bacteria | 1410 |
| 108 | Ga0070673_100450166 | 3300005364 | Unclassified | 1158 |
| 109 | Ga0070688_100031906 | 3300005365 | Bacteria | 3173 |
| 110 | Ga0070688_100063436 | 3300005365 | Bacteria | 2342 |
| 111 | Ga0070688_100491661 | 3300005365 | Bacteria | 924 |
| 112 | Ga0070659_100006879 | 3300005366 | Bacteria | 8236 |
| 113 | Ga0070659_100061606 | 3300005366 | Bacteria | 2965 |
| 114 | Ga0070659_100069090 | 3300005366 | Bacteria | 2804 |
| 115 | Ga0070659_100179923 | 3300005366 | Bacteria | 1735 |
| 116 | Ga0070659_100214597 | 3300005366 | Unclassified | 1587 |
| 117 | Ga0070667_100012458 | 3300005367 | Bacteria | 7035 |
| 118 | Ga0070667_100055305 | 3300005367 | Bacteria | 3352 |
| 119 | Ga0070667_100066430 | 3300005367 | Bacteria | 3064 |
| 120 | Ga0070667_100221626 | 3300005367 | Bacteria | 1684 |
| 121 | Ga0070667_100286293 | 3300005367 | Bacteria | 1481 |
| 122 | Ga0070709_10004052 | 3300005434 | Bacteria | 7902 |
| 123 | Ga0070709_10023359 | 3300005434 | Bacteria | 3629 |
| 124 | Ga0070714_100000878 | 3300005435 | Bacteria | 21352 |
| 125 | Ga0070714_100029489 | 3300005435 | Bacteria | 4561 |
| 126 | Ga0070713_100000396 | 3300005436 | Bacteria | 27994 |
| 127 | Ga0070710_10254082 | 3300005437 | Bacteria | 1131 |
| 128 | Ga0070701_10149335 | 3300005438 | Bacteria | 1344 |
| 129 | Ga0070701_10234994 | 3300005438 | Bacteria | 1100 |
| 130 | Ga0070701_10281856 | 3300005438 | Bacteria | 1015 |
| 131 | Ga0070711_100052566 | 3300005439 | Bacteria | 2804 |
| 132 | Ga0070711_100174789 | 3300005439 | Bacteria | 1640 |
| 133 | Ga0070711_100224394 | 3300005439 | Bacteria | 1462 |
| 134 | Ga0070700_100090726 | 3300005441 | Bacteria | 1993 |
| 135 | Ga0070700_100136899 | 3300005441 | Bacteria | 1659 |
| 136 | Ga0070700_100292263 | 3300005441 | Bacteria | 1186 |
| 137 | Ga0070694_100079208 | 3300005444 | Bacteria | 2280 |
| 138 | Ga0070694_100179946 | 3300005444 | Bacteria | 1563 |
| 139 | Ga0070694_100267665 | 3300005444 | Bacteria | 1298 |
| 140 | Ga0070663_100108781 | 3300005455 | Bacteria | 2080 |
| 141 | Ga0070663_100185992 | 3300005455 | Bacteria | 1614 |
| 142 | Ga0070678_100289888 | 3300005456 | Bacteria | 1387 |
| 143 | Ga0070662_100004317 | 3300005457 | Bacteria | 8978 |
| 144 | Ga0070662_100181640 | 3300005457 | Bacteria | 1659 |
| 145 | Ga0070662_100229686 | 3300005457 | Bacteria | 1484 |
| 146 | Ga0070662_100426416 | 3300005457 | Bacteria | 1098 |
| 147 | Ga0070662_100639383 | 3300005457 | Unclassified | 897 |
| 148 | Ga0070662_100833100 | 3300005457 | Unclassified | 785 |
| 149 | Ga0070681_10000544 | 3300005458 | Bacteria | 31038 |
| 150 | Ga0070681_10000828 | 3300005458 | Bacteria | 25847 |
| 151 | Ga0070681_10003787 | 3300005458 | Bacteria | 14206 |
| 152 | Ga0070681_10155741 | 3300005458 | Unclassified | 2210 |
| 153 | Ga0070681_10221727 | 3300005458 | Unclassified | 1806 |
| 154 | Ga0070681_10468086 | 3300005458 | Bacteria | 1173 |
| 155 | Ga0068867_100104995 | 3300005459 | Bacteria | 2163 |
| 156 | Ga0068867_100258165 | 3300005459 | Bacteria | 1420 |
| 157 | Ga0068867_100261627 | 3300005459 | Bacteria | 1411 |
| 158 | Ga0068867_100427333 | 3300005459 | Bacteria | 1124 |
| 159 | Ga0068867_100510012 | 3300005459 | Bacteria | 1035 |
| 160 | Ga0068867_100626134 | 3300005459 | Unclassified | 941 |
| 161 | Ga0070685_10046604 | 3300005466 | Bacteria | 2489 |
| 162 | Ga0070685_10216735 | 3300005466 | Bacteria | 1252 |
| 163 | Ga0070685_10790231 | 3300005466 | Bacteria | 699 |
| 164 | Ga0070706_100131012 | 3300005467 | Bacteria | 2340 |
| 165 | Ga0070706_100371005 | 3300005467 | Unclassified | 1333 |
| 166 | Ga0070706_101163976 | 3300005467 | Bacteria | 709 |
| 167 | Ga0070707_100270212 | 3300005468 | Bacteria | 1653 |
| 168 | Ga0070707_100440260 | 3300005468 | Bacteria | 1264 |
| 169 | Ga0070707_101112879 | 3300005468 | Unclassified | 756 |
| 170 | Ga0070698_100000109 | 3300005471 | Bacteria | 69210 |
| 171 | Ga0070698_100024231 | 3300005471 | Bacteria | 6332 |
| 172 | Ga0070698_100259097 | 3300005471 | Unclassified | 1671 |
| 173 | Ga0070698_100662105 | 3300005471 | Unclassified | 985 |
| 174 | Ga0070698_100878605 | 3300005471 | Unclassified | 842 |
| 175 | Ga0070699_100020308 | 3300005518 | Bacteria | 5729 |
| 176 | Ga0070699_100052769 | 3300005518 | Bacteria | 3518 |
| 177 | Ga0070699_100575332 | 3300005518 | Unclassified | 1026 |
| 178 | Ga0070699_100892501 | 3300005518 | Unclassified | 814 |
| 179 | Ga0070679_100000443 | 3300005530 | Bacteria | 35227 |
| 180 | Ga0070679_100031020 | 3300005530 | Bacteria | 5281 |
| 181 | Ga0070679_100031238 | 3300005530 | Bacteria | 5260 |
| 182 | Ga0070679_100085961 | 3300005530 | Bacteria | 3132 |
| 183 | Ga0070679_100141190 | 3300005530 | Bacteria | 2388 |
| 184 | Ga0070679_100185801 | 3300005530 | Unclassified | 2049 |
| 185 | Ga0070679_100313477 | 3300005530 | Unclassified | 1518 |
| 186 | Ga0070679_100565067 | 3300005530 | Unclassified | 1081 |
| 187 | Ga0070679_101012165 | 3300005530 | Unclassified | 775 |
| 188 | Ga0070684_100002554 | 3300005535 | Bacteria | 13445 |
| 189 | Ga0070684_100003416 | 3300005535 | Bacteria | 11920 |
| 190 | Ga0070684_100003432 | 3300005535 | Bacteria | 11900 |
| 191 | Ga0070684_100015020 | 3300005535 | Bacteria | 6290 |
| 192 | Ga0070684_100016134 | 3300005535 | Bacteria | 6102 |
| 193 | Ga0070684_100018286 | 3300005535 | Bacteria | 5772 |
| 194 | Ga0070684_100028725 | 3300005535 | Bacteria | 4705 |
| 195 | Ga0070684_100037680 | 3300005535 | Bacteria | 4149 |
| 196 | Ga0070684_100093956 | 3300005535 | Bacteria | 2670 |
| 197 | Ga0070684_100114526 | 3300005535 | Bacteria | 2421 |
| 198 | Ga0070684_100115653 | 3300005535 | Bacteria | 2409 |
| 199 | Ga0070684_100124215 | 3300005535 | Unclassified | 2323 |
| 200 | Ga0070684_100149010 | 3300005535 | Bacteria | 2119 |
| 201 | Ga0070684_100175131 | 3300005535 | Bacteria | 1949 |
| 202 | Ga0070684_100442800 | 3300005535 | Bacteria | 1200 |
| 203 | Ga0070684_100687900 | 3300005535 | Bacteria | 953 |
| 204 | Ga0068853_100035992 | 3300005539 | Bacteria | 4207 |
| 205 | Ga0068853_100244149 | 3300005539 | Bacteria | 1647 |
| 206 | Ga0068853_100312008 | 3300005539 | Bacteria | 1456 |
| 207 | Ga0068853_100394836 | 3300005539 | Bacteria | 1294 |
| 208 | Ga0068853_101182361 | 3300005539 | Bacteria | 738 |
| 209 | Ga0068853_101376474 | 3300005539 | Unclassified | 682 |
| 210 | Ga0070672_100018173 | 3300005543 | Bacteria | 5076 |
| 211 | Ga0070672_100023853 | 3300005543 | Bacteria | 4513 |
| 212 | Ga0070672_100027934 | 3300005543 | Bacteria | 4214 |
| 213 | Ga0070672_100113141 | 3300005543 | Bacteria | 2215 |
| 214 | Ga0070672_100133071 | 3300005543 | Unclassified | 2046 |
| 215 | Ga0070672_100320472 | 3300005543 | Bacteria | 1317 |
| 216 | Ga0070672_100397719 | 3300005543 | Unclassified | 1181 |
| 217 | Ga0070672_100750729 | 3300005543 | Unclassified | 856 |
| 218 | Ga0070686_100117084 | 3300005544 | Bacteria | 1824 |
| 219 | Ga0070695_100867258 | 3300005545 | Bacteria | 727 |
| 220 | Ga0070695_101068844 | 3300005545 | Bacteria | 659 |
| 221 | Ga0070696_100000317 | 3300005546 | Bacteria | 29318 |
| 222 | Ga0070696_100020562 | 3300005546 | Bacteria | 4472 |
| 223 | Ga0070693_100079989 | 3300005547 | Bacteria | 1946 |
| 224 | Ga0070665_100010586 | 3300005548 | Bacteria | 9338 |
| 225 | Ga0070665_100230340 | 3300005548 | Unclassified | 1853 |
| 226 | Ga0070704_100257060 | 3300005549 | Bacteria | 1437 |
| 227 | Ga0070704_100801705 | 3300005549 | Bacteria | 841 |
| 228 | Ga0068855_100085897 | 3300005563 | Bacteria | 3639 |
| 229 | Ga0068855_100086933 | 3300005563 | Bacteria | 3614 |
| 230 | Ga0068855_100455549 | 3300005563 | Unclassified | 1395 |
| 231 | Ga0068855_100551007 | 3300005563 | Bacteria | 1248 |
| 232 | Ga0068855_101807926 | 3300005563 | Unclassified | 621 |
| 233 | Ga0070664_100002089 | 3300005564 | Bacteria | 15974 |
| 234 | Ga0070664_100006546 | 3300005564 | Bacteria | 9392 |
| 235 | Ga0070664_100012348 | 3300005564 | Bacteria | 6940 |
| 236 | Ga0070664_100026387 | 3300005564 | Bacteria | 4819 |
| 237 | Ga0070664_100030667 | 3300005564 | Bacteria | 4487 |
| 238 | Ga0070664_100095861 | 3300005564 | Bacteria | 2574 |
| 239 | Ga0070664_100113568 | 3300005564 | Bacteria | 2366 |
| 240 | Ga0070664_100146290 | 3300005564 | Bacteria | 2084 |
| 241 | Ga0070664_100160920 | 3300005564 | Unclassified | 1986 |
| 242 | Ga0070664_100178590 | 3300005564 | Bacteria | 1886 |
| 243 | Ga0070664_100228693 | 3300005564 | Bacteria | 1667 |
| 244 | Ga0070664_100313134 | 3300005564 | Bacteria | 1421 |
| 245 | Ga0070664_100349694 | 3300005564 | Bacteria | 1344 |
| 246 | Ga0070664_100714266 | 3300005564 | Unclassified | 934 |
| 247 | Ga0070664_100813410 | 3300005564 | Unclassified | 874 |
| 248 | Ga0070664_100818941 | 3300005564 | Unclassified | 871 |
| 249 | Ga0068857_100007962 | 3300005577 | Bacteria | 9148 |
| 250 | Ga0068857_100009491 | 3300005577 | Bacteria | 8450 |
| 251 | Ga0068857_100011118 | 3300005577 | Bacteria | 7830 |
| 252 | Ga0068857_100011804 | 3300005577 | Bacteria | 7599 |
| 253 | Ga0068857_100761267 | 3300005577 | Bacteria | 923 |
| 254 | Ga0068854_100003700 | 3300005578 | Bacteria | 9569 |
| 255 | Ga0068854_100020760 | 3300005578 | Bacteria | 4451 |
| 256 | Ga0068854_100269544 | 3300005578 | Bacteria | 1366 |
| 257 | Ga0068856_100114458 | 3300005614 | Bacteria | 2696 |
| 258 | Ga0068856_101387449 | 3300005614 | Bacteria | 717 |
| 259 | Ga0070702_100091836 | 3300005615 | Bacteria | 1843 |
| 260 | Ga0070702_100290894 | 3300005615 | Unclassified | 1126 |
| 261 | Ga0070702_100319699 | 3300005615 | Bacteria | 1081 |
| 262 | Ga0068852_100006122 | 3300005616 | Bacteria | 8677 |
| 263 | Ga0068852_100015703 | 3300005616 | Bacteria | 5883 |
| 264 | Ga0068852_100134447 | 3300005616 | Bacteria | 2282 |
| 265 | Ga0068852_100450576 | 3300005616 | Bacteria | 1274 |
| 266 | Ga0068852_100546940 | 3300005616 | Bacteria | 1158 |
| 267 | Ga0068852_100754629 | 3300005616 | Unclassified | 985 |
| 268 | Ga0068859_100053778 | 3300005617 | Bacteria | 4049 |
| 269 | Ga0068859_100293653 | 3300005617 | Bacteria | 1718 |
| 270 | Ga0068859_100351783 | 3300005617 | Bacteria | 1568 |
| 271 | Ga0068859_100656317 | 3300005617 | Bacteria | 1141 |
| 272 | Ga0068859_100756530 | 3300005617 | Bacteria | 1060 |
| 273 | Ga0068864_100141470 | 3300005618 | Unclassified | 2171 |
| 274 | Ga0068864_100517546 | 3300005618 | Unclassified | 1150 |
| 275 | Ga0068864_101048258 | 3300005618 | Unclassified | 810 |
| 276 | Ga0068866_10306314 | 3300005718 | Unclassified | 994 |
| 277 | Ga0068866_10393616 | 3300005718 | Bacteria | 892 |
| 278 | Ga0068861_100000232 | 3300005719 | Bacteria | 30370 |
| 279 | Ga0068861_100077862 | 3300005719 | Bacteria | 2588 |
| 280 | Ga0068861_100156561 | 3300005719 | Bacteria | 1875 |
| 281 | Ga0068851_10027152 | 3300005834 | Bacteria | 2820 |
| 282 | Ga0068851_10036084 | 3300005834 | Bacteria | 2474 |
| 283 | Ga0068851_10065661 | 3300005834 | Bacteria | 1868 |
| 284 | Ga0068851_10095010 | 3300005834 | Unclassified | 1574 |
| 285 | Ga0068851_10156066 | 3300005834 | Bacteria | 1251 |
| 286 | Ga0068870_10006869 | 3300005840 | Bacteria | 5049 |
| 287 | Ga0068870_10250824 | 3300005840 | Bacteria | 1097 |
| 288 | Ga0068870_10419013 | 3300005840 | Bacteria | 876 |
| 289 | Ga0068863_100043204 | 3300005841 | Bacteria | 4279 |
| 290 | Ga0068863_100109300 | 3300005841 | Bacteria | 2632 |
| 291 | Ga0068863_100460436 | 3300005841 | Bacteria | 1249 |
| 292 | Ga0068858_100006089 | 3300005842 | Bacteria | 11768 |
| 293 | Ga0068858_100014455 | 3300005842 | Bacteria | 7438 |
| 294 | Ga0068860_100011913 | 3300005843 | Bacteria | 8570 |
| 295 | Ga0068860_100221369 | 3300005843 | Bacteria | 1838 |
| 296 | Ga0068860_100423138 | 3300005843 | Unclassified | 1320 |
| 297 | Ga0068860_100486999 | 3300005843 | Bacteria | 1230 |
| 298 | Ga0068862_100002069 | 3300005844 | Bacteria | 18108 |
| 299 | Ga0068862_100263908 | 3300005844 | Bacteria | 1573 |
| 300 | Ga0081539_10000103 | 3300005985 | Bacteria | 197839 |
| 301 | Ga0070717_10061924 | 3300006028 | Bacteria | 3102 |
| 302 | Ga0070712_100007912 | 3300006175 | Bacteria | 6666 |
| 303 | Ga0070712_100474532 | 3300006175 | Bacteria | 1045 |
| 304 | Ga0097621_100185964 | 3300006237 | Bacteria | 1797 |
| 305 | Ga0097621_100571470 | 3300006237 | Bacteria | 1031 |
| 306 | Ga0068871_100661266 | 3300006358 | Unclassified | 954 |
| 307 | Ga0068871_100842550 | 3300006358 | Unclassified | 847 |
| 308 | Ga0075428_100232369 | 3300006844 | Bacteria | 1990 |
| 309 | Ga0075428_100232776 | 3300006844 | Bacteria | 1988 |
| 310 | Ga0075428_100353655 | 3300006844 | Bacteria | 1577 |
| 311 | Ga0075430_100003163 | 3300006846 | Bacteria | 13777 |
| 312 | Ga0075430_100036168 | 3300006846 | Bacteria | 4187 |
| 313 | Ga0075430_100181787 | 3300006846 | Bacteria | 1749 |
| 314 | Ga0075430_100399391 | 3300006846 | Unclassified | 1135 |
| 315 | Ga0075431_100067114 | 3300006847 | Bacteria | 3703 |
| 316 | Ga0075431_100186026 | 3300006847 | Bacteria | 2130 |
| 317 | Ga0075431_100207677 | 3300006847 | Bacteria | 2002 |
| 318 | Ga0075431_100389263 | 3300006847 | Unclassified | 1397 |
| 319 | Ga0075431_100629589 | 3300006847 | Unclassified | 1055 |
| 320 | Ga0075431_100810872 | 3300006847 | Unclassified | 909 |
| 321 | Ga0075433_10002721 | 3300006852 | Bacteria | 13507 |
| 322 | Ga0075433_10112606 | 3300006852 | Bacteria | 2414 |
| 323 | Ga0075433_10916867 | 3300006852 | Bacteria | 764 |
| 324 | Ga0075434_100005668 | 3300006871 | Bacteria | 11393 |
| 325 | Ga0075434_100068223 | 3300006871 | Bacteria | 3542 |
| 326 | Ga0075434_100738619 | 3300006871 | Bacteria | 1001 |
| 327 | Ga0075429_100027565 | 3300006880 | Bacteria | 4931 |
| 328 | Ga0075429_100111764 | 3300006880 | Bacteria | 2388 |
| 329 | Ga0075429_100142517 | 3300006880 | Bacteria | 2098 |
| 330 | Ga0068865_100028967 | 3300006881 | Bacteria | 3669 |
| 331 | Ga0068865_100060365 | 3300006881 | Bacteria | 2655 |
| 332 | Ga0068865_100101244 | 3300006881 | Bacteria | 2109 |
| 333 | Ga0068865_100159747 | 3300006881 | Bacteria | 1718 |
| 334 | Ga0075436_100003392 | 3300006914 | Bacteria | 10911 |
| 335 | Ga0075436_100012407 | 3300006914 | Bacteria | 5841 |
| 336 | Ga0097620_100053777 | 3300006931 | Bacteria | 4049 |
| 337 | Ga0097620_100293668 | 3300006931 | Bacteria | 1718 |
| 338 | Ga0097620_100351751 | 3300006931 | Bacteria | 1568 |
| 339 | Ga0097620_100656373 | 3300006931 | Bacteria | 1141 |
| 340 | Ga0097620_100686397 | 3300006931 | Unclassified | 1115 |
| 341 | Ga0075435_100251612 | 3300007076 | Unclassified | 1504 |
| 342 | Ga0105240_10122856 | 3300009093 | Bacteria | 3124 |
| 343 | Ga0105240_10156707 | 3300009093 | Bacteria | 2707 |
| 344 | Ga0105240_10300375 | 3300009093 | Bacteria | 1837 |
| 345 | Ga0105240_10325726 | 3300009093 | Bacteria | 1750 |
| 346 | Ga0105240_10326059 | 3300009093 | Bacteria | 1749 |
| 347 | Ga0105240_10478247 | 3300009093 | Bacteria | 1389 |
| 348 | Ga0105240_10595926 | 3300009093 | Bacteria | 1217 |
| 349 | Ga0105240_10696152 | 3300009093 | Bacteria | 1110 |
| 350 | Ga0105240_10741242 | 3300009093 | Bacteria | 1069 |
| 351 | Ga0111539_10021889 | 3300009094 | Bacteria | 7860 |
| 352 | Ga0111539_10575171 | 3300009094 | Bacteria | 1312 |
| 353 | Ga0105245_10081518 | 3300009098 | Bacteria | 2958 |
| 354 | Ga0114129_10053397 | 3300009147 | Bacteria | 5667 |
| 355 | Ga0114129_10162829 | 3300009147 | Bacteria | 3046 |
| 356 | Ga0114129_10490559 | 3300009147 | Bacteria | 1606 |
| 357 | Ga0114129_11590504 | 3300009147 | Bacteria | 800 |
| 358 | Ga0105241_10000025 | 3300009174 | Bacteria | 132929 |
| 359 | Ga0105241_10065551 | 3300009174 | Bacteria | 2806 |
| 360 | Ga0105242_10006374 | 3300009176 | Bacteria | 9084 |
| 361 | Ga0105242_10064484 | 3300009176 | Bacteria | 3020 |
| 362 | Ga0105242_10256548 | 3300009176 | Bacteria | 1578 |
| 363 | Ga0105242_10309902 | 3300009176 | Bacteria | 1444 |
| 364 | Ga0105248_10005922 | 3300009177 | Bacteria | 13439 |
| 365 | Ga0105248_10026512 | 3300009177 | Bacteria | 6447 |
| 366 | Ga0105248_10091207 | 3300009177 | Bacteria | 3432 |
| 367 | Ga0105248_10408004 | 3300009177 | Bacteria | 1530 |
| 368 | Ga0105248_10462087 | 3300009177 | Bacteria | 1431 |
| 369 | Ga0105248_11008291 | 3300009177 | Bacteria | 941 |
| 370 | Ga0105248_11910839 | 3300009177 | Unclassified | 674 |
| 371 | Ga0105237_10295613 | 3300009545 | Bacteria | 1622 |
| 372 | Ga0105237_10726091 | 3300009545 | Unclassified | 1000 |
| 373 | Ga0105237_11402295 | 3300009545 | Unclassified | 705 |
| 374 | Ga0105238_10078912 | 3300009551 | Bacteria | 3282 |
| 375 | Ga0105238_10449474 | 3300009551 | Bacteria | 1285 |
| 376 | Ga0105238_10623356 | 3300009551 | Bacteria | 1087 |
| 377 | Ga0105249_10001142 | 3300009553 | Bacteria | 23486 |
| 378 | Ga0105249_10003811 | 3300009553 | Bacteria | 13018 |
| 379 | Ga0105249_10200608 | 3300009553 | Bacteria | 1952 |
| 380 | Ga0105239_10071801 | 3300010375 | Bacteria | 3803 |
| 381 | Ga0105246_10020625 | 3300011119 | Bacteria | 4229 |
| 382 | Ga0157373_10004494 | 3300013100 | Bacteria | 10499 |
| 383 | Ga0157373_10062153 | 3300013100 | Bacteria | 2645 |
| 384 | Ga0157373_10071049 | 3300013100 | Bacteria | 2459 |
| 385 | Ga0157373_10076242 | 3300013100 | Bacteria | 2366 |
| 386 | Ga0157373_10237349 | 3300013100 | Bacteria | 1288 |
| 387 | Ga0157373_10318082 | 3300013100 | Unclassified | 1107 |
| 388 | Ga0157373_10428382 | 3300013100 | Bacteria | 950 |
| 389 | Ga0157371_10092788 | 3300013102 | Bacteria | 2139 |
| 390 | Ga0157370_10001327 | 3300013104 | Bacteria | 30737 |
| 391 | Ga0157370_10016352 | 3300013104 | Bacteria | 7513 |
| 392 | Ga0157370_10017249 | 3300013104 | Bacteria | 7288 |
| 393 | Ga0157370_10033024 | 3300013104 | Bacteria | 5047 |
| 394 | Ga0157370_10036262 | 3300013104 | Bacteria | 4787 |
| 395 | Ga0157370_10108006 | 3300013104 | Bacteria | 2603 |
| 396 | Ga0157370_11232632 | 3300013104 | Unclassified | 675 |
| 397 | Ga0157369_10006892 | 3300013105 | Bacteria | 13111 |
| 398 | Ga0157369_10012342 | 3300013105 | Bacteria | 9700 |
| 399 | Ga0157369_10034493 | 3300013105 | Bacteria | 5553 |
| 400 | Ga0157369_10131562 | 3300013105 | Bacteria | 2651 |
| 401 | Ga0157369_10179856 | 3300013105 | Unclassified | 2225 |
| 402 | Ga0157369_10215251 | 3300013105 | Bacteria | 2012 |
| 403 | Ga0157369_10401408 | 3300013105 | Bacteria | 1422 |
| 404 | Ga0157369_10639492 | 3300013105 | Bacteria | 1097 |
| 405 | Ga0157369_10724305 | 3300013105 | Bacteria | 1024 |
| 406 | Ga0157374_10080629 | 3300013296 | Bacteria | 3087 |
| 407 | Ga0157374_10145408 | 3300013296 | Bacteria | 2303 |
| 408 | Ga0157378_10023659 | 3300013297 | Bacteria | 5403 |
| 409 | Ga0157378_10144507 | 3300013297 | Bacteria | 2212 |
| 410 | Ga0163162_10002411 | 3300013306 | Bacteria | 17589 |
| 411 | Ga0163162_10049498 | 3300013306 | Bacteria | 4212 |
| 412 | Ga0163162_10728175 | 3300013306 | Bacteria | 1112 |
| 413 | Ga0157372_10004177 | 3300013307 | Bacteria | 15463 |
| 414 | Ga0157372_10011138 | 3300013307 | Bacteria | 9565 |
| 415 | Ga0157372_10016305 | 3300013307 | Bacteria | 7973 |
| 416 | Ga0157372_10017385 | 3300013307 | Bacteria | 7718 |
| 417 | Ga0157372_10031961 | 3300013307 | Bacteria | 5767 |
| 418 | Ga0157372_10070153 | 3300013307 | Bacteria | 3942 |
| 419 | Ga0157372_10130835 | 3300013307 | Unclassified | 2887 |
| 420 | Ga0157372_10131366 | 3300013307 | Bacteria | 2881 |
| 421 | Ga0157372_10187968 | 3300013307 | Bacteria | 2392 |
| 422 | Ga0157372_10277202 | 3300013307 | Unclassified | 1949 |
| 423 | Ga0157372_10485662 | 3300013307 | Bacteria | 1440 |
| 424 | Ga0157372_10679064 | 3300013307 | Bacteria | 1199 |
| 425 | Ga0157372_10939195 | 3300013307 | Bacteria | 1003 |
| 426 | Ga0157375_10014333 | 3300013308 | Bacteria | 7068 |
| 427 | Ga0157375_10047582 | 3300013308 | Unclassified | 4190 |
| 428 | Ga0157375_10050500 | 3300013308 | Bacteria | 4080 |
| 429 | Ga0157375_10054022 | 3300013308 | Bacteria | 3955 |
| 430 | Ga0157375_10154573 | 3300013308 | Bacteria | 2432 |
| 431 | Ga0157375_10284274 | 3300013308 | Bacteria | 1817 |
| 432 | Ga0157375_10687563 | 3300013308 | Bacteria | 1177 |
| 433 | Ga0157375_10909730 | 3300013308 | Bacteria | 1023 |
| 434 | Ga0163163_10711212 | 3300014325 | Bacteria | 1068 |
| 435 | Ga0157380_10003163 | 3300014326 | Bacteria | 11239 |
| 436 | Ga0157380_10009480 | 3300014326 | Bacteria | 6977 |
| 437 | Ga0157380_10188091 | 3300014326 | Bacteria | 1820 |
| 438 | Ga0157377_10032846 | 3300014745 | Bacteria | 2829 |
| 439 | Ga0157379_10005920 | 3300014968 | Bacteria | 10529 |
| 440 | Ga0157376_10401869 | 3300014969 | Unclassified | 1325 |
| 441 | Ga0157376_10745544 | 3300014969 | Bacteria | 988 |
| 442 | Ga0182007_10067998 | 3300015262 | Bacteria | 1167 |
| 443 | Ga0163161_10015002 | 3300017792 | Bacteria | 5398 |
| 444 | Ga0163161_10233770 | 3300017792 | Bacteria | 1427 |
| 445 | Ga0163161_10585124 | 3300017792 | Unclassified | 918 |
| 446 | Ga0163161_10700688 | 3300017792 | Bacteria | 843 |
| 447 | Ga0197907_10017702 | 3300020069 | Bacteria | 1419 |
| 448 | Ga0206356_10075689 | 3300020070 | Unclassified | 972 |
| 449 | Ga0213876_10060865 | 3300021384 | Bacteria | 1992 |
| 450 | Ga0207697_10001978 | 3300025315 | Bacteria | 10862 |
| 451 | Ga0207656_10122791 | 3300025321 | Unclassified | 1210 |
| 452 | Ga0207682_10020365 | 3300025893 | Bacteria | 2605 |
| 453 | Ga0207688_10031617 | 3300025901 | Bacteria | 2923 |
| 454 | Ga0207688_10088681 | 3300025901 | Bacteria | 1774 |
| 455 | Ga0207680_10391626 | 3300025903 | Bacteria | 981 |
| 456 | Ga0207680_10410984 | 3300025903 | Unclassified | 957 |
| 457 | Ga0207680_10473013 | 3300025903 | Unclassified | 891 |
| 458 | Ga0207647_10335718 | 3300025904 | Unclassified | 857 |
| 459 | Ga0207699_10376722 | 3300025906 | Unclassified | 1006 |
| 460 | Ga0207645_10000513 | 3300025907 | Bacteria | 32149 |
| 461 | Ga0207645_10015255 | 3300025907 | Bacteria | 5113 |
| 462 | Ga0207645_10301681 | 3300025907 | Bacteria | 1066 |
| 463 | Ga0207645_10317683 | 3300025907 | Bacteria | 1039 |
| 464 | Ga0207645_10326291 | 3300025907 | Unclassified | 1024 |
| 465 | Ga0207643_10006700 | 3300025908 | Bacteria | 6177 |
| 466 | Ga0207643_10012415 | 3300025908 | Bacteria | 4605 |
| 467 | Ga0207643_10142204 | 3300025908 | Bacteria | 1434 |
| 468 | Ga0207705_10018465 | 3300025909 | Bacteria | 4987 |
| 469 | Ga0207705_10043958 | 3300025909 | Bacteria | 3209 |
| 470 | Ga0207705_10097736 | 3300025909 | Bacteria | 2157 |
| 471 | Ga0207705_10098040 | 3300025909 | Unclassified | 2153 |
| 472 | Ga0207705_10298338 | 3300025909 | Bacteria | 1236 |
| 473 | Ga0207684_10212180 | 3300025910 | Bacteria | 1670 |
| 474 | Ga0207684_10298461 | 3300025910 | Bacteria | 1389 |
| 475 | Ga0207684_11138348 | 3300025910 | Bacteria | 648 |
| 476 | Ga0207654_10001593 | 3300025911 | Bacteria | 11917 |
| 477 | Ga0207654_10326658 | 3300025911 | Bacteria | 1050 |
| 478 | Ga0207654_10628349 | 3300025911 | Bacteria | 768 |
| 479 | Ga0207707_10000485 | 3300025912 | Bacteria | 41294 |
| 480 | Ga0207707_10001404 | 3300025912 | Bacteria | 22300 |
| 481 | Ga0207707_10003323 | 3300025912 | Bacteria | 14288 |
| 482 | Ga0207707_10013100 | 3300025912 | Bacteria | 7224 |
| 483 | Ga0207707_10158537 | 3300025912 | Bacteria | 1979 |
| 484 | Ga0207707_10206286 | 3300025912 | Bacteria | 1713 |
| 485 | Ga0207707_10342644 | 3300025912 | Bacteria | 1289 |
| 486 | Ga0207695_10000824 | 3300025913 | Bacteria | 57448 |
| 487 | Ga0207695_10002609 | 3300025913 | Bacteria | 26412 |
| 488 | Ga0207695_10078082 | 3300025913 | Bacteria | 3360 |
| 489 | Ga0207695_10096980 | 3300025913 | Bacteria | 2950 |
| 490 | Ga0207695_10292987 | 3300025913 | Bacteria | 1519 |
| 491 | Ga0207695_10402644 | 3300025913 | Bacteria | 1253 |
| 492 | Ga0207671_10075826 | 3300025914 | Bacteria | 2516 |
| 493 | Ga0207693_10013148 | 3300025915 | Bacteria | 6677 |
| 494 | Ga0207663_10294971 | 3300025916 | Bacteria | 1209 |
| 495 | Ga0207663_10523055 | 3300025916 | Unclassified | 924 |
| 496 | Ga0207660_10000035 | 3300025917 | Bacteria | 65610 |
| 497 | Ga0207660_10015223 | 3300025917 | Bacteria | 5074 |
| 498 | Ga0207660_10019058 | 3300025917 | Bacteria | 4583 |
| 499 | Ga0207660_10028034 | 3300025917 | Bacteria | 3849 |
| 500 | Ga0207660_10121705 | 3300025917 | Bacteria | 1977 |
| 501 | Ga0207660_10136788 | 3300025917 | Bacteria | 1870 |
| 502 | Ga0207660_10182956 | 3300025917 | Bacteria | 1628 |
| 503 | Ga0207660_10634949 | 3300025917 | Unclassified | 870 |
| 504 | Ga0207660_10732738 | 3300025917 | Bacteria | 807 |
| 505 | Ga0207662_10010778 | 3300025918 | Bacteria | 5052 |
| 506 | Ga0207662_10383935 | 3300025918 | Bacteria | 949 |
| 507 | Ga0207657_10008543 | 3300025919 | Bacteria | 10382 |
| 508 | Ga0207657_10015548 | 3300025919 | Bacteria | 7369 |
| 509 | Ga0207657_10331438 | 3300025919 | Unclassified | 1202 |
| 510 | Ga0207649_10000422 | 3300025920 | Bacteria | 31054 |
| 511 | Ga0207649_10008691 | 3300025920 | Bacteria | 5546 |
| 512 | Ga0207649_10029805 | 3300025920 | Bacteria | 3226 |
| 513 | Ga0207649_10065484 | 3300025920 | Bacteria | 2300 |
| 514 | Ga0207649_10119389 | 3300025920 | Unclassified | 1775 |
| 515 | Ga0207649_10335065 | 3300025920 | Unclassified | 1116 |
| 516 | Ga0207649_10493410 | 3300025920 | Unclassified | 930 |
| 517 | Ga0207652_10000609 | 3300025921 | Bacteria | 35652 |
| 518 | Ga0207652_10001738 | 3300025921 | Bacteria | 19002 |
| 519 | Ga0207652_10011989 | 3300025921 | Bacteria | 6995 |
| 520 | Ga0207652_10056870 | 3300025921 | Bacteria | 3368 |
| 521 | Ga0207652_10219553 | 3300025921 | Bacteria | 1713 |
| 522 | Ga0207652_10413134 | 3300025921 | Bacteria | 1217 |
| 523 | Ga0207652_10507352 | 3300025921 | Bacteria | 1086 |
| 524 | Ga0207652_10759205 | 3300025921 | Unclassified | 863 |
| 525 | Ga0207646_10425228 | 3300025922 | Bacteria | 1199 |
| 526 | Ga0207646_11004086 | 3300025922 | Unclassified | 737 |
| 527 | Ga0207646_11026607 | 3300025922 | Unclassified | 728 |
| 528 | Ga0207646_11385717 | 3300025922 | Unclassified | 612 |
| 529 | Ga0207681_10000537 | 3300025923 | Bacteria | 26181 |
| 530 | Ga0207681_10034707 | 3300025923 | Bacteria | 3318 |
| 531 | Ga0207694_10085578 | 3300025924 | Bacteria | 2482 |
| 532 | Ga0207694_10207866 | 3300025924 | Unclassified | 1594 |
| 533 | Ga0207650_10052293 | 3300025925 | Bacteria | 3026 |
| 534 | Ga0207650_10120792 | 3300025925 | Bacteria | 2040 |
| 535 | Ga0207650_10173696 | 3300025925 | Unclassified | 1714 |
| 536 | Ga0207650_10242695 | 3300025925 | Bacteria | 1456 |
| 537 | Ga0207650_10269554 | 3300025925 | Bacteria | 1383 |
| 538 | Ga0207659_10061473 | 3300025926 | Bacteria | 2707 |
| 539 | Ga0207659_10205568 | 3300025926 | Bacteria | 1575 |
| 540 | Ga0207659_10206720 | 3300025926 | Bacteria | 1571 |
| 541 | Ga0207659_10224618 | 3300025926 | Bacteria | 1512 |
| 542 | Ga0207659_10367019 | 3300025926 | Unclassified | 1198 |
| 543 | Ga0207659_10483512 | 3300025926 | Bacteria | 1046 |
| 544 | Ga0207687_10135811 | 3300025927 | Bacteria | 1860 |
| 545 | Ga0207687_10242373 | 3300025927 | Bacteria | 1429 |
| 546 | Ga0207700_10001929 | 3300025928 | Bacteria | 11798 |
| 547 | Ga0207700_10054647 | 3300025928 | Bacteria | 2999 |
| 548 | Ga0207700_10824962 | 3300025928 | Unclassified | 830 |
| 549 | Ga0207664_10158358 | 3300025929 | Bacteria | 1929 |
| 550 | Ga0207664_10185845 | 3300025929 | Unclassified | 1787 |
| 551 | Ga0207644_10026962 | 3300025931 | Bacteria | 3967 |
| 552 | Ga0207644_10165031 | 3300025931 | Bacteria | 1725 |
| 553 | Ga0207644_10290500 | 3300025931 | Unclassified | 1315 |
| 554 | Ga0207690_10052603 | 3300025932 | Bacteria | 2728 |
| 555 | Ga0207690_10056511 | 3300025932 | Bacteria | 2648 |
| 556 | Ga0207690_10143089 | 3300025932 | Bacteria | 1765 |
| 557 | Ga0207690_10361475 | 3300025932 | Unclassified | 1150 |
| 558 | Ga0207690_11128459 | 3300025932 | Unclassified | 654 |
| 559 | Ga0207706_10000055 | 3300025933 | Bacteria | 114144 |
| 560 | Ga0207706_10176978 | 3300025933 | Bacteria | 1874 |
| 561 | Ga0207706_10187413 | 3300025933 | Bacteria | 1816 |
| 562 | Ga0207706_10214189 | 3300025933 | Bacteria | 1688 |
| 563 | Ga0207706_10309150 | 3300025933 | Bacteria | 1377 |
| 564 | Ga0207706_10329635 | 3300025933 | Bacteria | 1328 |
| 565 | Ga0207686_10205727 | 3300025934 | Unclassified | 1412 |
| 566 | Ga0207686_10208992 | 3300025934 | Bacteria | 1402 |
| 567 | Ga0207670_10061060 | 3300025936 | Bacteria | 2570 |
| 568 | Ga0207670_10085890 | 3300025936 | Bacteria | 2212 |
| 569 | Ga0207670_10761482 | 3300025936 | Bacteria | 805 |
| 570 | Ga0207669_10094447 | 3300025937 | Bacteria | 1957 |
| 571 | Ga0207669_10160862 | 3300025937 | Bacteria | 1586 |
| 572 | Ga0207669_10637938 | 3300025937 | Bacteria | 870 |
| 573 | Ga0207704_10028767 | 3300025938 | Bacteria | 3089 |
| 574 | Ga0207704_10151223 | 3300025938 | Bacteria | 1638 |
| 575 | Ga0207704_10731198 | 3300025938 | Unclassified | 822 |
| 576 | Ga0207691_10000129 | 3300025940 | Bacteria | 69176 |
| 577 | Ga0207691_10004042 | 3300025940 | Bacteria | 14222 |
| 578 | Ga0207691_10005297 | 3300025940 | Bacteria | 12447 |
| 579 | Ga0207691_10023370 | 3300025940 | Bacteria | 5819 |
| 580 | Ga0207691_10033533 | 3300025940 | Bacteria | 4780 |
| 581 | Ga0207691_10081921 | 3300025940 | Bacteria | 2900 |
| 582 | Ga0207691_10456618 | 3300025940 | Unclassified | 1087 |
| 583 | Ga0207711_10127374 | 3300025941 | Bacteria | 2279 |
| 584 | Ga0207711_10193642 | 3300025941 | Bacteria | 1853 |
| 585 | Ga0207711_10573930 | 3300025941 | Bacteria | 1052 |
| 586 | Ga0207711_10585926 | 3300025941 | Unclassified | 1040 |
| 587 | Ga0207711_11167907 | 3300025941 | Bacteria | 711 |
| 588 | Ga0207689_10008227 | 3300025942 | Bacteria | 9088 |
| 589 | Ga0207689_10033942 | 3300025942 | Bacteria | 4238 |
| 590 | Ga0207661_10007864 | 3300025944 | Bacteria | 7599 |
| 591 | Ga0207661_10025413 | 3300025944 | Bacteria | 4501 |
| 592 | Ga0207661_10031708 | 3300025944 | Bacteria | 4087 |
| 593 | Ga0207661_10056884 | 3300025944 | Bacteria | 3142 |
| 594 | Ga0207661_10085873 | 3300025944 | Bacteria | 2610 |
| 595 | Ga0207661_10104508 | 3300025944 | Bacteria | 2385 |
| 596 | Ga0207661_10182870 | 3300025944 | Bacteria | 1832 |
| 597 | Ga0207661_10280349 | 3300025944 | Bacteria | 1489 |
| 598 | Ga0207661_10391958 | 3300025944 | Bacteria | 1258 |
| 599 | Ga0207661_10433192 | 3300025944 | Bacteria | 1196 |
| 600 | Ga0207661_10599445 | 3300025944 | Unclassified | 1011 |
| 601 | Ga0207661_10633717 | 3300025944 | Bacteria | 982 |
| 602 | Ga0207679_10000382 | 3300025945 | Bacteria | 31883 |
| 603 | Ga0207679_10002242 | 3300025945 | Bacteria | 11947 |
| 604 | Ga0207679_10010118 | 3300025945 | Bacteria | 6064 |
| 605 | Ga0207679_10037653 | 3300025945 | Bacteria | 3440 |
| 606 | Ga0207679_10054688 | 3300025945 | Bacteria | 2940 |
| 607 | Ga0207679_10061160 | 3300025945 | Bacteria | 2802 |
| 608 | Ga0207679_10063534 | 3300025945 | Bacteria | 2756 |
| 609 | Ga0207679_10117447 | 3300025945 | Bacteria | 2111 |
| 610 | Ga0207679_10161392 | 3300025945 | Bacteria | 1835 |
| 611 | Ga0207679_10327404 | 3300025945 | Bacteria | 1328 |
| 612 | Ga0207679_10440743 | 3300025945 | Bacteria | 1153 |
| 613 | Ga0207679_10780092 | 3300025945 | Unclassified | 870 |
| 614 | Ga0207679_11293320 | 3300025945 | Unclassified | 669 |
| 615 | Ga0207667_10033264 | 3300025949 | Bacteria | 5545 |
| 616 | Ga0207667_10362706 | 3300025949 | Bacteria | 1477 |
| 617 | Ga0207667_10379776 | 3300025949 | Bacteria | 1440 |
| 618 | Ga0207667_10530769 | 3300025949 | Unclassified | 1192 |
| 619 | Ga0207667_11087044 | 3300025949 | Bacteria | 783 |
| 620 | Ga0207651_10029820 | 3300025960 | Bacteria | 3463 |
| 621 | Ga0207651_10083254 | 3300025960 | Bacteria | 2313 |
| 622 | Ga0207651_10092895 | 3300025960 | Bacteria | 2214 |
| 623 | Ga0207651_10605585 | 3300025960 | Unclassified | 958 |
| 624 | Ga0207712_10000920 | 3300025961 | Bacteria | 21293 |
| 625 | Ga0207668_10011829 | 3300025972 | Bacteria | 5319 |
| 626 | Ga0207668_10839735 | 3300025972 | Unclassified | 815 |
| 627 | Ga0207668_10856515 | 3300025972 | Unclassified | 807 |
| 628 | Ga0207640_10000266 | 3300025981 | Bacteria | 35167 |
| 629 | Ga0207640_10215636 | 3300025981 | Bacteria | 1466 |
| 630 | Ga0207640_10498686 | 3300025981 | Bacteria | 1013 |
| 631 | Ga0207658_10249916 | 3300025986 | Bacteria | 1506 |
| 632 | Ga0207658_10280463 | 3300025986 | Bacteria | 1428 |
| 633 | Ga0207658_10294460 | 3300025986 | Bacteria | 1396 |
| 634 | Ga0207658_10325495 | 3300025986 | Bacteria | 1332 |
| 635 | Ga0207658_10421742 | 3300025986 | Bacteria | 1177 |
| 636 | Ga0207658_10517945 | 3300025986 | Bacteria | 1064 |
| 637 | Ga0207677_10097680 | 3300026023 | Unclassified | 2152 |
| 638 | Ga0207677_10531505 | 3300026023 | Bacteria | 1022 |
| 639 | Ga0207703_10080821 | 3300026035 | Bacteria | 2708 |
| 640 | Ga0207703_10416516 | 3300026035 | Bacteria | 1249 |
| 641 | Ga0207639_10207564 | 3300026041 | Unclassified | 1684 |
| 642 | Ga0207639_10254522 | 3300026041 | Unclassified | 1533 |
| 643 | Ga0207678_10247694 | 3300026067 | Bacteria | 1526 |
| 644 | Ga0207708_10279451 | 3300026075 | Bacteria | 1353 |
| 645 | Ga0207708_10348208 | 3300026075 | Bacteria | 1215 |
| 646 | Ga0207702_10266759 | 3300026078 | Bacteria | 1614 |
| 647 | Ga0207641_10240170 | 3300026088 | Bacteria | 1688 |
| 648 | Ga0207641_10246014 | 3300026088 | Bacteria | 1668 |
| 649 | Ga0207641_11337683 | 3300026088 | Bacteria | 717 |
| 650 | Ga0207648_10010162 | 3300026089 | Bacteria | 8949 |
| 651 | Ga0207648_10031606 | 3300026089 | Bacteria | 4681 |
| 652 | Ga0207648_10095562 | 3300026089 | Bacteria | 2600 |
| 653 | Ga0207648_10126987 | 3300026089 | Bacteria | 2244 |
| 654 | Ga0207648_10440659 | 3300026089 | Bacteria | 1185 |
| 655 | Ga0207648_11077389 | 3300026089 | Unclassified | 753 |
| 656 | Ga0207676_10904212 | 3300026095 | Unclassified | 866 |
| 657 | Ga0207676_10975147 | 3300026095 | Unclassified | 834 |
| 658 | Ga0207674_10001035 | 3300026116 | Bacteria | 36267 |
| 659 | Ga0207674_10002037 | 3300026116 | Bacteria | 25651 |
| 660 | Ga0207674_10021081 | 3300026116 | Bacteria | 7027 |
| 661 | Ga0207674_10026295 | 3300026116 | Bacteria | 6186 |
| 662 | Ga0207675_100000073 | 3300026118 | Bacteria | 76959 |
| 663 | Ga0207675_100084506 | 3300026118 | Bacteria | 2978 |
| 664 | Ga0207675_100149855 | 3300026118 | Bacteria | 2219 |
| 665 | Ga0207675_100910017 | 3300026118 | Bacteria | 896 |
| 666 | Ga0207683_10123300 | 3300026121 | Bacteria | 2328 |
| 667 | Ga0207683_10206373 | 3300026121 | Bacteria | 1787 |
| 668 | Ga0207683_10471441 | 3300026121 | Unclassified | 1158 |
| 669 | Ga0207698_10015286 | 3300026142 | Bacteria | 5135 |
| 670 | Ga0207698_10108989 | 3300026142 | Bacteria | 2316 |
| 671 | Ga0207698_10264879 | 3300026142 | Bacteria | 1581 |
| 672 | Ga0207698_10719741 | 3300026142 | Unclassified | 995 |
| 673 | Ga0207698_11204786 | 3300026142 | Bacteria | 771 |
| 674 | Ga0207698_11435825 | 3300026142 | Unclassified | 705 |
| 675 | Ga0209968_1003366 | 3300027526 | Unclassified | 2400 |
| 676 | Ga0209999_1027386 | 3300027543 | Unclassified | 1055 |
| 677 | Ga0209966_1010289 | 3300027695 | Bacteria | 1684 |
| 678 | Ga0207428_10026683 | 3300027907 | Bacteria | 4817 |
| 679 | Ga0207428_10842685 | 3300027907 | Bacteria | 650 |
| 680 | Ga0268266_10115231 | 3300028379 | Bacteria | 2386 |
| 681 | Ga0268266_10316838 | 3300028379 | Bacteria | 1459 |
| 682 | Ga0268265_11492597 | 3300028380 | Bacteria | 679 |
| 683 | Ga0268264_10031762 | 3300028381 | Bacteria | 4330 |
| 684 | Ga0268264_11038521 | 3300028381 | Unclassified | 827 |
| 685 | Ga0307405_10016213 | 3300031731 | Bacteria | 4057 |
| 686 | Ga0307405_10016433 | 3300031731 | Bacteria | 4036 |
| 687 | Ga0307405_10276914 | 3300031731 | Unclassified | 1261 |
| 688 | Ga0307405_11082836 | 3300031731 | Unclassified | 688 |
| 689 | Ga0307413_10004571 | 3300031824 | Bacteria | 6044 |
| 690 | Ga0307413_10027025 | 3300031824 | Bacteria | 3173 |
| 691 | Ga0307410_10116698 | 3300031852 | Bacteria | 1940 |
| 692 | Ga0307410_10341241 | 3300031852 | Unclassified | 1194 |
| 693 | Ga0307410_10347624 | 3300031852 | Bacteria | 1184 |
| 694 | Ga0307410_10448733 | 3300031852 | Unclassified | 1052 |
| 695 | Ga0307410_10775603 | 3300031852 | Bacteria | 813 |
| 696 | Ga0307406_10087678 | 3300031901 | Bacteria | 2086 |
| 697 | Ga0307406_10218708 | 3300031901 | Bacteria | 1414 |
| 698 | Ga0307407_10011271 | 3300031903 | Bacteria | 4249 |
| 699 | Ga0307407_10041647 | 3300031903 | Bacteria | 2570 |
| 700 | Ga0307407_10247529 | 3300031903 | Bacteria | 1219 |
| 701 | Ga0307412_10009112 | 3300031911 | Bacteria | 5688 |
| 702 | Ga0307412_10124442 | 3300031911 | Bacteria | 1862 |
| 703 | Ga0307412_10296314 | 3300031911 | Unclassified | 1276 |
| 704 | Ga0307412_10388201 | 3300031911 | Bacteria | 1133 |
| 705 | Ga0307409_100396701 | 3300031995 | Unclassified | 1316 |
| 706 | Ga0307409_101314932 | 3300031995 | Bacteria | 748 |
| 707 | Ga0307409_101325569 | 3300031995 | Bacteria | 745 |
| 708 | Ga0307416_100069846 | 3300032002 | Bacteria | 2909 |
| 709 | Ga0307416_100141905 | 3300032002 | Bacteria | 2185 |
| 710 | Ga0307416_100490430 | 3300032002 | Unclassified | 1291 |
| 711 | Ga0307416_100536132 | 3300032002 | Bacteria | 1241 |
| 712 | Ga0307416_101020081 | 3300032002 | Bacteria | 931 |
| 713 | Ga0307416_101026209 | 3300032002 | Unclassified | 928 |
| 714 | Ga0307416_101089053 | 3300032002 | Unclassified | 903 |
| 715 | Ga0307414_10007789 | 3300032004 | Bacteria | 6039 |
| 716 | Ga0307414_10233273 | 3300032004 | Bacteria | 1519 |
| 717 | Ga0307414_10754349 | 3300032004 | Bacteria | 885 |
| 718 | Ga0307414_11134694 | 3300032004 | Bacteria | 723 |
| 719 | Ga0307414_11236575 | 3300032004 | Bacteria | 692 |
| 720 | Ga0307411_10001331 | 3300032005 | Bacteria | 9959 |
| 721 | Ga0307411_10131190 | 3300032005 | Bacteria | 1832 |
| 722 | Ga0307415_100078935 | 3300032126 | Bacteria | 2343 |
| 723 | Ga0307415_100116145 | 3300032126 | Unclassified | 1996 |
| 724 | Ga0307415_100248470 | 3300032126 | Bacteria | 1444 |
| 725 | Ga0307415_100347533 | 3300032126 | Bacteria | 1247 |
| 726 | Ga0307415_100446994 | 3300032126 | Bacteria | 1116 |
| 727 | Ga0307415_100664362 | 3300032126 | Unclassified | 936 |
| 728 | Ga0373934_0000319 | 3300035086 | Bacteria | 16910 |
| 729 | Ga0373923_0079046 | 3300035111 | Bacteria | 1424 |
| 730 | Ga0373945_0009272 | 3300035116 | Unclassified | 3223 |
| 731 | Ga0373953_0010653 | 3300035117 | Bacteria | 3207 |
| 732 | Ga0373953_0271481 | 3300035117 | Unclassified | 738 |
| 733 | Ga0373954_0024387 | 3300035118 | Bacteria | 2758 |
| 734 | Ga0373956_0007873 | 3300035119 | Bacteria | 4300 |
| 735 | Ga0373956_0059152 | 3300035119 | Bacteria | 1733 |
| 736 | Ga0373957_0110738 | 3300035120 | Bacteria | 1105 |
| 737 | Ga0373943_0000549 | 3300035170 | Bacteria | 16230 |
| 738 | Ga0373943_0746206 | 3300035170 | Unclassified | 581 |
| 739 | Ga0373946_0140153 | 3300035171 | Bacteria | 1120 |
| 740 | Ga0373946_0241080 | 3300035171 | Bacteria | 879 |
| 741 | Ga0373955_0010711 | 3300035172 | Bacteria | 4341 |
| 742 | Ga0373955_0570437 | 3300035172 | Unclassified | 692 |
| 743 | Ga0373931_0147047 | 3300035691 | Unclassified | 1371 |
| 744 | Ga0373935_0025192 | 3300035692 | Unclassified | 3666 |
| 745 | Ga0373935_0140190 | 3300035692 | Unclassified | 1633 |
| 746 | Ga0373935_0233897 | 3300035692 | Bacteria | 1281 |
| 747 | Ga0373935_0675002 | 3300035692 | Bacteria | 759 |
| 748 | Ga0373927_0015005 | 3300035695 | Bacteria | 5125 |
| 749 | Ga0373927_0028039 | 3300035695 | Bacteria | 3674 |
| 750 | Ga0373927_0101015 | 3300035695 | Bacteria | 1876 |
| 751 | Ga0373933_0030909 | 3300035724 | Bacteria | 3103 |
| 752 | Ga0373933_0033766 | 3300035724 | Bacteria | 2978 |
| 753 | Ga0373947_0000580 | 3300035725 | Bacteria | 21452 |
| 754 | Ga0373947_0065217 | 3300035725 | Bacteria | 2221 |
| 755 | Ga0373937_0001736 | 3300036401 | Bacteria | 18330 |
| 756 | Ga0373937_0139331 | 3300036401 | Bacteria | 2269 |
| 757 | Ga0373937_0164017 | 3300036401 | Bacteria | 2083 |
| 758 | Ga0373937_0270639 | 3300036401 | Bacteria | 1603 |
| 759 | Ga0373925_0001431 | 3300037068 | Bacteria | 20677 |
| 760 | Ga0373925_0032169 | 3300037068 | Bacteria | 3859 |
| 761 | Ga0373925_0404870 | 3300037068 | Unclassified | 1113 |
| 762 | Ga0436365_0475701 | 3300039437 | Bacteria | 3673 |
| 763 | Ga0436365_0875476 | 3300039437 | Bacteria | 3780 |
| 764 | Ga0436365_0982966 | 3300039437 | Bacteria | 2362 |
| 765 | Ga0439448_0067275 | 3300042005 | Unclassified | 1190 |
| 766 | Ga0439455_0067273 | 3300042012 | Bacteria | 958 |
| 767 | Ga0439464_0083104 | 3300042439 | Unclassified | 958 |
| 768 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 769 | Ga0451577_0007492 | 3300042876 | Bacteria | 10716 |
| 770 | Ga0451577_0021164 | 3300042876 | Bacteria | 5954 |
| 771 | Ga0451577_0039290 | 3300042876 | Bacteria | 4252 |
| 772 | Ga0451577_0156063 | 3300042876 | Bacteria | 2054 |
| 773 | Ga0451577_0222580 | 3300042876 | Bacteria | 1706 |
| 774 | Ga0466963_0118097 | 3300044694 | Bacteria | 1824 |
| 775 | Ga0466963_0252359 | 3300044694 | Unclassified | 1238 |
| 776 | Ga0453684_0000368 | 3300044712 | Bacteria | 185018 |
| 777 | Ga0453684_0041760 | 3300044712 | Bacteria | 6194 |
| 778 | Ga0453684_0051193 | 3300044712 | Bacteria | 5418 |
| 779 | Ga0466959_0041971 | 3300045049 | Bacteria | 3376 |
| 780 | Ga0451576_0235254 | 3300045051 | Bacteria | 1913 |
| 781 | Ga0451576_0311411 | 3300045051 | Bacteria | 1647 |
| 782 | Ga0451576_0629666 | 3300045051 | Bacteria | 1127 |
| 783 | Ga0466958_0133777 | 3300045836 | Bacteria | 1558 |
| 784 | Ga0466958_0317227 | 3300045836 | Bacteria | 1001 |
| 785 | Ga0466967_0051897 | 3300045976 | Bacteria | 3597 |
| 786 | Ga0466967_0054913 | 3300045976 | Bacteria | 3508 |
| 787 | Ga0466967_0323715 | 3300045976 | Bacteria | 1487 |
| 788 | Ga0466967_0947813 | 3300045976 | Bacteria | 856 |
| 789 | Ga0495592_0016371 | 3300046454 | Bacteria | 5626 |
| 790 | Ga0495592_0186271 | 3300046454 | Bacteria | 1410 |
| 791 | Ga0495592_0220460 | 3300046454 | Unclassified | 1269 |
| 792 | Ga0495629_0038669 | 3300046459 | Bacteria | 3360 |
| 793 | Ga0495629_0053126 | 3300046459 | Bacteria | 2835 |
| 794 | Ga0495651_0004559 | 3300046462 | Bacteria | 10591 |
| 795 | Ga0495651_0039377 | 3300046462 | Bacteria | 3680 |
| 796 | Ga0495651_0279390 | 3300046462 | Unclassified | 1129 |
| 797 | Ga0495651_0363840 | 3300046462 | Bacteria | 952 |
| 798 | Ga0495653_0086461 | 3300046463 | Unclassified | 2304 |
| 799 | Ga0495653_0091967 | 3300046463 | Bacteria | 2216 |
| 800 | Ga0495580_0003447 | 3300046472 | Bacteria | 13470 |
| 801 | Ga0495580_0010878 | 3300046472 | Bacteria | 7062 |
| 802 | Ga0495580_0030804 | 3300046472 | Bacteria | 3881 |
| 803 | Ga0495582_0008502 | 3300046473 | Bacteria | 5662 |
| 804 | Ga0495582_0067504 | 3300046473 | Bacteria | 1976 |
| 805 | Ga0495582_0088330 | 3300046473 | Bacteria | 1727 |
| 806 | Ga0495582_0404675 | 3300046473 | Bacteria | 787 |
| 807 | Ga0495639_0001681 | 3300046475 | Bacteria | 9825 |
| 808 | Ga0495639_0070550 | 3300046475 | Bacteria | 1613 |
| 809 | Ga0495662_0007455 | 3300046476 | Bacteria | 5410 |
| 810 | Ga0495594_0002309 | 3300046499 | Bacteria | 9931 |
| 811 | Ga0495594_0005001 | 3300046499 | Bacteria | 6822 |
| 812 | Ga0495594_0008462 | 3300046499 | Bacteria | 5302 |
| 813 | Ga0495594_0085085 | 3300046499 | Bacteria | 1769 |
| 814 | Ga0495594_0438186 | 3300046499 | Bacteria | 743 |
| 815 | Ga0495596_0090328 | 3300046500 | Archaea | 1189 |
| 816 | Ga0495596_0199361 | 3300046500 | Bacteria | 778 |
| 817 | Ga0495608_0044993 | 3300046511 | Bacteria | 2944 |
| 818 | Ga0495608_0052115 | 3300046511 | Bacteria | 2709 |
| 819 | Ga0495618_0055155 | 3300046514 | Unclassified | 2516 |
| 820 | Ga0495628_0006895 | 3300046516 | Bacteria | 9872 |
| 821 | Ga0495628_0040706 | 3300046516 | Bacteria | 3712 |
| 822 | Ga0495628_0139680 | 3300046516 | Bacteria | 1849 |
| 823 | Ga0495630_0031856 | 3300046517 | Bacteria | 3927 |
| 824 | Ga0495630_0040136 | 3300046517 | Bacteria | 3497 |
| 825 | Ga0495630_0180271 | 3300046517 | Unclassified | 1610 |
| 826 | Ga0495630_0502557 | 3300046517 | Bacteria | 930 |
| 827 | Ga0495663_0072249 | 3300046525 | Unclassified | 1100 |
| 828 | Ga0495663_0105894 | 3300046525 | Bacteria | 930 |
| 829 | Ga0495663_0311400 | 3300046525 | Unclassified | 568 |
| 830 | Ga0495652_0000859 | 3300046529 | Bacteria | 35014 |
| 831 | Ga0495652_0032221 | 3300046529 | Bacteria | 4585 |
| 832 | Ga0495652_0202719 | 3300046529 | Bacteria | 1504 |
| 833 | Ga0495665_0000677 | 3300046531 | Bacteria | 17457 |
| 834 | Ga0495665_0020133 | 3300046531 | Bacteria | 3585 |
| 835 | Ga0495665_0069766 | 3300046531 | Bacteria | 1852 |
| 836 | Ga0495640_0079411 | 3300046533 | Bacteria | 2184 |
| 837 | Ga0495586_0039853 | 3300046535 | Bacteria | 2526 |
| 838 | Ga0495586_0309322 | 3300046535 | Unclassified | 906 |
| 839 | Ga0495586_0776136 | 3300046535 | Bacteria | 553 |
| 840 | Ga0495587_0000360 | 3300046536 | Bacteria | 32695 |
| 841 | Ga0495587_0004216 | 3300046536 | Bacteria | 9515 |
| 842 | Ga0495587_0138258 | 3300046536 | Bacteria | 1391 |
| 843 | Ga0495587_0436228 | 3300046536 | Unclassified | 726 |
| 844 | Ga0495645_0000989 | 3300046543 | Bacteria | 19374 |
| 845 | Ga0495645_0001984 | 3300046543 | Bacteria | 13903 |
| 846 | Ga0495667_0015602 | 3300046559 | Bacteria | 5135 |
| 847 | Ga0495667_0042983 | 3300046559 | Bacteria | 2995 |
| 848 | Ga0495667_0584655 | 3300046559 | Unclassified | 696 |
| 849 | Ga0495634_0314856 | 3300046642 | Unclassified | 943 |
| 850 | Ga0495634_0599752 | 3300046642 | Unclassified | 639 |
| 851 | Ga0495635_0040433 | 3300046663 | Bacteria | 3222 |
| 852 | Ga0495635_0114467 | 3300046663 | Bacteria | 1841 |
| 853 | Ga0495635_0399471 | 3300046663 | Bacteria | 913 |
| 854 | Ga0495635_0582214 | 3300046663 | Unclassified | 732 |
| 855 | Ga0495588_0000514 | 3300046674 | Bacteria | 18704 |
| 856 | Ga0495588_0065723 | 3300046674 | Bacteria | 1882 |
| 857 | Ga0495657_0097839 | 3300046675 | Bacteria | 1873 |
| 858 | Ga0495657_0099581 | 3300046675 | Bacteria | 1853 |
| 859 | Ga0495657_0260330 | 3300046675 | Bacteria | 1042 |
| 860 | Ga0495599_0000395 | 3300046678 | Bacteria | 24958 |
| 861 | Ga0495599_0002829 | 3300046678 | Bacteria | 10108 |
| 862 | Ga0495599_0082817 | 3300046678 | Bacteria | 2004 |
| 863 | Ga0495623_0086385 | 3300046679 | Bacteria | 1934 |
| 864 | Ga0495623_0298155 | 3300046679 | Unclassified | 891 |
| 865 | Ga0495646_0071561 | 3300046680 | Bacteria | 2040 |
| 866 | Ga0495658_0001102 | 3300046683 | Bacteria | 14276 |
| 867 | Ga0495658_0347535 | 3300046683 | Unclassified | 942 |
| 868 | Ga0495669_0216707 | 3300046684 | Bacteria | 917 |
| 869 | Ga0495613_0016681 | 3300046689 | Bacteria | 5468 |
| 870 | Ga0495613_0168730 | 3300046689 | Bacteria | 1554 |
| 871 | Ga0495624_0031704 | 3300046690 | Bacteria | 3433 |
| 872 | Ga0495600_0030985 | 3300046809 | Bacteria | 3464 |
| 873 | Ga0495600_0068387 | 3300046809 | Bacteria | 2321 |
| 874 | Ga0495600_0194278 | 3300046809 | Unclassified | 1304 |
| 875 | Ga0495600_0388838 | 3300046809 | Unclassified | 869 |
| 876 | Ga0495581_0000585 | 3300047315 | Bacteria | 19041 |
| 877 | Ga0495581_0062904 | 3300047315 | Bacteria | 2144 |
| 878 | Ga0495581_0183552 | 3300047315 | Bacteria | 1224 |
| 879 | Ga0495604_0350272 | 3300047317 | Bacteria | 981 |
| 880 | Ga0495636_0063592 | 3300047318 | Bacteria | 1564 |
| 881 | Ga0495674_0007720 | 3300047319 | Bacteria | 10274 |
| 882 | Ga0495674_0154171 | 3300047319 | Bacteria | 1925 |
| 883 | Ga0495674_0414300 | 3300047319 | Bacteria | 1086 |
| 884 | Ga0495672_0004134 | 3300047320 | Bacteria | 12063 |
| 885 | Ga0495680_0021757 | 3300047322 | Bacteria | 5361 |
| 886 | Ga0495680_0375513 | 3300047322 | Bacteria | 986 |
| 887 | Ga0495675_0035608 | 3300047444 | Bacteria | 3178 |
| 888 | Ga0495675_0057125 | 3300047444 | Unclassified | 2474 |
| 889 | Ga0495675_0080425 | 3300047444 | Bacteria | 2052 |
| 890 | Ga0495675_0159323 | 3300047444 | Bacteria | 1390 |
| 891 | Ga0495684_0064847 | 3300047471 | Bacteria | 2776 |
| 892 | Ga0495684_0107907 | 3300047471 | Bacteria | 2103 |
| 893 | Ga0495684_0180162 | 3300047471 | Unclassified | 1566 |
| 894 | Ga0495684_0229930 | 3300047471 | Bacteria | 1356 |
| 895 | Ga0495593_0030869 | 3300047673 | Bacteria | 2930 |
| 896 | Ga0495593_0094833 | 3300047673 | Unclassified | 1535 |
| 897 | Ga0495602_0189836 | 3300048088 | Bacteria | 1576 |
| 898 | Ga0495602_0250120 | 3300048088 | Bacteria | 1321 |
| 899 | Ga0495602_0645249 | 3300048088 | Bacteria | 723 |
| 900 | Ga0496100_0159071 | 3300048903 | Bacteria | 1618 |
| 901 | Ga0496101_0141520 | 3300048904 | Bacteria | 1834 |
| 902 | Ga0496104_0032397 | 3300048907 | Bacteria | 4864 |
| 903 | Ga0496104_0744650 | 3300048907 | Bacteria | 887 |
| 904 | Ga0496105_0571089 | 3300048908 | Bacteria | 881 |
| 905 | Ga0496108_0216403 | 3300048911 | Unclassified | 1664 |
| 906 | Ga0496109_1277863 | 3300048912 | Unclassified | 670 |
| 907 | Ga0496109_1367846 | 3300048912 | Unclassified | 644 |
| 908 | Ga0496110_0319101 | 3300048913 | Bacteria | 1415 |
| 909 | Ga0496111_0263127 | 3300048914 | Bacteria | 1280 |
| 910 | Ga0496112_0395956 | 3300048915 | Bacteria | 1321 |
| 911 | Ga0496112_0556589 | 3300048915 | Bacteria | 1080 |
| 912 | Ga0496112_0781648 | 3300048915 | Unclassified | 880 |
| 913 | Ga0496113_0022996 | 3300048916 | Bacteria | 4417 |
| 914 | Ga0496114_0035290 | 3300048917 | Bacteria | 4129 |
| 915 | Ga0496115_0002487 | 3300048918 | Bacteria | 13251 |
| 916 | Ga0501031_0070260 | 3300049568 | Bacteria | 2281 |
| 917 | Ga0501032_0164341 | 3300049569 | Unclassified | 1457 |
| 918 | Ga0501032_0229141 | 3300049569 | Bacteria | 1208 |
| 919 | Ga0501033_0006099 | 3300049570 | Bacteria | 9454 |
| 920 | Ga0501033_0312624 | 3300049570 | Bacteria | 1104 |
| 921 | Ga0501034_0026781 | 3300049571 | Bacteria | 5866 |
| 922 | Ga0501034_0162813 | 3300049571 | Bacteria | 2201 |
| 923 | Ga0501034_0508303 | 3300049571 | Unclassified | 1118 |
| 924 | Ga0501036_0089981 | 3300049572 | Bacteria | 2593 |
| 925 | Ga0501038_0093932 | 3300049574 | Bacteria | 2508 |
| 926 | Ga0501038_0184294 | 3300049574 | Bacteria | 1683 |
| 927 | Ga0501042_0074899 | 3300049578 | Bacteria | 2422 |
| 928 | Ga0501042_0197577 | 3300049578 | Bacteria | 1450 |
| 929 | Ga0501043_0007990 | 3300049579 | Bacteria | 8354 |
| 930 | Ga0501046_0180761 | 3300049580 | Bacteria | 1577 |
| 931 | Ga0501046_0664008 | 3300049580 | Bacteria | 736 |
| 932 | Ga0501047_0016410 | 3300049581 | Bacteria | 7069 |
| 933 | Ga0501047_0215059 | 3300049581 | Bacteria | 1779 |
| 934 | Ga0501048_0052402 | 3300049582 | Bacteria | 2904 |
| 935 | Ga0501048_0562265 | 3300049582 | Bacteria | 818 |
| 936 | Ga0501067_0086560 | 3300049583 | Bacteria | 1739 |
| 937 | Ga0501067_0410636 | 3300049583 | Bacteria | 755 |
| 938 | Ga0501070_0012137 | 3300049586 | Bacteria | 7270 |
| 939 | Ga0501070_0062638 | 3300049586 | Bacteria | 3081 |
| 940 | Ga0501070_0545910 | 3300049586 | Unclassified | 928 |
| 941 | Ga0501070_0793034 | 3300049586 | Bacteria | 744 |
| 942 | Ga0501071_0346470 | 3300049587 | Bacteria | 1130 |
| 943 | Ga0501072_0144679 | 3300049588 | Bacteria | 1896 |
| 944 | Ga0501072_0207887 | 3300049588 | Bacteria | 1560 |
| 945 | Ga0501072_0392506 | 3300049588 | Bacteria | 1101 |
| 946 | Ga0501073_0162246 | 3300049589 | Unclassified | 1548 |
| 947 | Ga0501073_0395404 | 3300049589 | Bacteria | 955 |
| 948 | Ga0501074_0329823 | 3300049590 | Bacteria | 1083 |
| 949 | Ga0501075_0267695 | 3300049591 | Bacteria | 1302 |
| 950 | Ga0501076_0038186 | 3300049592 | Bacteria | 3770 |
| 951 | Ga0501202_027084 | 3300049652 | Unclassified | 1176 |
| 952 | Ga0501216_011001 | 3300049660 | Bacteria | 1464 |
| 953 | Ga0501217_048090 | 3300049661 | Unclassified | 1107 |
| 954 | Ga0501227_089836 | 3300049665 | Unclassified | 810 |
| 955 | Ga0501233_019306 | 3300049668 | Unclassified | 1442 |
| 956 | Ga0501235_001527 | 3300049669 | Bacteria | 4962 |
| 957 | Ga0501255_032913 | 3300049684 | Unclassified | 730 |
| 958 | Ga0501221_059199 | 3300049704 | Unclassified | 882 |
| 959 | Ga0501225_0044441 | 3300049705 | Unclassified | 1228 |
| 960 | Ga0501079_0120969 | 3300049741 | Bacteria | 2036 |
| 961 | Ga0501083_0345029 | 3300049744 | Unclassified | 968 |
| 962 | Ga0501263_010283 | 3300049760 | Unclassified | 1146 |
| 963 | Ga0501265_015778 | 3300049762 | Unclassified | 973 |
| 964 | Ga0501266_013283 | 3300049763 | Unclassified | 1070 |
| 965 | Ga0501268_018984 | 3300049765 | Bacteria | 1161 |
| 966 | Ga0501268_035255 | 3300049765 | Unclassified | 922 |
| 967 | Ga0501274_004665 | 3300049771 | Unclassified | 1138 |
| 968 | Ga0501035_0142088 | 3300049822 | Bacteria | 2086 |
| 969 | Ga0501035_0190610 | 3300049822 | Unclassified | 1763 |
| 970 | Ga0501035_0296488 | 3300049822 | Bacteria | 1363 |
| 971 | Ga0501035_0807984 | 3300049822 | Bacteria | 749 |
| 972 | Ga0501044_0009533 | 3300049823 | Bacteria | 10572 |
| 973 | Ga0501044_0926121 | 3300049823 | Bacteria | 745 |
| 974 | Ga0501045_0021355 | 3300049824 | Bacteria | 4630 |
| 975 | nmdc:mga05p37_120740_c1 | 3300050507 | Bacteria | 3219 |
| 976 | nmdc:mga05p37_262130_c1 | 3300050507 | Bacteria | 2068 |
| 977 | nmdc:mga05p37_474039_c1 | 3300050507 | Bacteria | 1443 |
| 978 | nmdc:mga05p37_58646_c1 | 3300050507 | Bacteria | 4741 |
| 979 | nmdc:mga09592_13015_c1 | 3300050508 | Bacteria | 6791 |
| 980 | nmdc:mga09592_420471_c1 | 3300050508 | Bacteria | 1154 |
| 981 | nmdc:mga09592_77966_c1 | 3300050508 | Bacteria | 2819 |
| 982 | nmdc:mga0qj67_158933_c1 | 3300050509 | Unclassified | 1834 |
| 983 | nmdc:mga0qj67_4128_c1 | 3300050509 | Bacteria | 10526 |
| 984 | nmdc:mga0qj67_59187_c1 | 3300050509 | Bacteria | 3038 |
| 985 | nmdc:mga06r32_129574_c1 | 3300050510 | Unclassified | 2493 |
| 986 | nmdc:mga06r32_1526844_c1 | 3300050510 | Unclassified | 608 |
| 987 | nmdc:mga06r32_261715_c1 | 3300050510 | Bacteria | 1717 |
| 988 | nmdc:mga06r32_537862_c1 | 3300050510 | Unclassified | 1143 |
| 989 | nmdc:mga06r32_975005_c1 | 3300050510 | Unclassified | 801 |
| 990 | nmdc:mga08y16_12861_c1 | 3300050511 | Bacteria | 8801 |
| 991 | nmdc:mga08y16_451536_c1 | 3300050511 | Bacteria | 1311 |
| 992 | nmdc:mga08y16_748790_c1 | 3300050511 | Unclassified | 973 |
| 993 | nmdc:mga0n895_14894_c2 | 3300050512 | Bacteria | 4588 |
| 994 | nmdc:mga0n895_24354_c1 | 3300050512 | Bacteria | 5703 |
| 995 | nmdc:mga0rr50_416684_c1 | 3300050513 | Bacteria | 1136 |
| 996 | nmdc:mga08x19_2070_c1 | 3300050514 | Bacteria | 12286 |
| 997 | nmdc:mga08x19_5049_c1 | 3300050514 | Bacteria | 7808 |
| 998 | nmdc:mga0a205_17614_c1 | 3300050515 | Bacteria | 6703 |
| 999 | nmdc:mga0a205_20136_c1 | 3300050515 | Bacteria | 6294 |
| 1000 | nmdc:mga0a205_410631_c1 | 3300050515 | Bacteria | 1217 |
| 1001 | Ga0495601_0214451 | 3300053077 | Bacteria | 1257 |
| 1002 | Ga0495601_0303036 | 3300053077 | Bacteria | 1041 |
| 1003 | Ga0495612_0009455 | 3300053078 | Bacteria | 3953 |
| 1004 | Ga0495595_0094867 | 3300053084 | Bacteria | 1435 |
| 1005 | Ga0495595_0178581 | 3300053084 | Unclassified | 1052 |
| 1006 | Ga0495619_0147505 | 3300053085 | Bacteria | 1622 |
| 1007 | Ga0501082_0254557 | 3300060353 | Bacteria | 1527 |
| 1008 | Ga0207659_10349715 | |||
| 1009 | JGI25406J46586_10032713 | |||
| 1010 | Ga0065715_10273275 | |||
| 1011 | Ga0065715_10355927 | |||
| 1012 | Ga0065707_10095745 | |||
| 1013 | Ga0070658_10002410 | |||
| 1014 | Ga0070658_10017737 | |||
| 1015 | Ga0070658_10091182 | |||
| 1016 | Ga0070676_10001204 | |||
| 1017 | Ga0070676_10036346 | |||
| 1018 | Ga0070676_10277778 | |||
| 1019 | Ga0070676_10474713 | |||
| 1020 | Ga0070676_10643333 | |||
| 1021 | Ga0070683_100002655 | |||
| 1022 | Ga0070683_100006959 | |||
| 1023 | Ga0070683_100010228 | |||
| 1024 | Ga0070683_100016249 | |||
| 1025 | Ga0070683_100044126 | |||
| 1026 | Ga0070683_100044551 | |||
| 1027 | Ga0070683_100071081 | |||
| 1028 | Ga0070683_100170065 | |||
| 1029 | Ga0070683_100192109 | |||
| 1030 | Ga0070683_100214490 | |||
| 1031 | Ga0070683_100328999 | |||
| 1032 | Ga0070683_100333987 | |||
| 1033 | Ga0070683_100756011 | |||
| 1034 | Ga0070683_100786483 | |||
| 1035 | Ga0070690_100109667 | |||
| 1036 | Ga0070670_100001025 | |||
| 1037 | Ga0070670_100042150 | |||
| 1038 | Ga0070670_100063363 | |||
| 1039 | Ga0070670_100079494 | |||
| 1040 | Ga0070670_100094359 | |||
| 1041 | Ga0070670_100101621 | |||
| 1042 | Ga0070677_10189805 | |||
| 1043 | Ga0070677_10201500 | |||
| 1044 | Ga0068869_100005737 | |||
| 1045 | Ga0068869_100426096 | |||
| 1046 | Ga0070666_10286668 | |||
| 1047 | Ga0070666_10330081 | |||
| 1048 | Ga0070666_10669090 | |||
| 1049 | Ga0070680_100000152 | |||
| 1050 | Ga0070680_100019957 | |||
| 1051 | Ga0070680_100060577 | |||
| 1052 | Ga0070680_100086489 | |||
| 1053 | Ga0070680_100114688 | |||
| 1054 | Ga0070680_100367918 | |||
| 1055 | Ga0070680_100418248 | |||
| 1056 | Ga0070680_100440107 | |||
| 1057 | Ga0070680_100637462 | |||
| 1058 | Ga0070682_100177369 | |||
| 1059 | Ga0068868_100004677 | |||
| 1060 | Ga0070660_100002497 | |||
| 1061 | Ga0070660_100005660 | |||
| 1062 | Ga0070660_100266266 | |||
| 1063 | Ga0070660_100285905 | |||
| 1064 | Ga0070660_100538871 | |||
| 1065 | Ga0070689_100042472 | |||
| 1066 | Ga0070689_100061649 | |||
| 1067 | Ga0070689_100236026 | |||
| 1068 | Ga0070689_100268528 | |||
| 1069 | Ga0070691_10002555 | |||
| 1070 | Ga0070691_10067410 | |||
| 1071 | Ga0070691_10521298 | |||
| 1072 | Ga0070687_100005938 | |||
| 1073 | Ga0070687_100024242 | |||
| 1074 | Ga0070687_100024463 | |||
| 1075 | Ga0070661_100000555 | |||
| 1076 | Ga0070661_100005738 | |||
| 1077 | Ga0070661_100008221 | |||
| 1078 | Ga0070661_100020996 | |||
| 1079 | Ga0070661_100128689 | |||
| 1080 | Ga0070661_100148062 | |||
| 1081 | Ga0070661_100246771 | |||
| 1082 | Ga0070661_100255601 | |||
| 1083 | Ga0070692_10014089 | |||
| 1084 | Ga0070692_10070664 | |||
| 1085 | Ga0070692_10608150 | |||
| 1086 | Ga0070668_100000088 | |||
| 1087 | Ga0070668_100023628 | |||
| 1088 | Ga0070668_100661056 | |||
| 1089 | Ga0070668_101143191 | |||
| 1090 | Ga0070669_100005368 | |||
| 1091 | Ga0070669_100056611 | |||
| 1092 | Ga0070669_100120085 | |||
| 1093 | Ga0070675_100001976 | |||
| 1094 | Ga0070675_100013662 | |||
| 1095 | Ga0070675_100120175 | |||
| 1096 | Ga0070675_100150767 | |||
| 1097 | Ga0070675_100319735 | |||
| 1098 | Ga0070675_100472422 | |||
| 1099 | Ga0070671_100137716 | |||
| 1100 | Ga0070671_100300887 | |||
| 1101 | Ga0070671_100504097 | |||
| 1102 | Ga0070671_100615987 | |||
| 1103 | Ga0070674_100003798 | |||
| 1104 | Ga0070674_100013303 | |||
| 1105 | Ga0070674_100147132 | |||
| 1106 | Ga0070674_100198665 | |||
| 1107 | Ga0070674_100510285 | |||
| 1108 | Ga0070673_100028459 | |||
| 1109 | Ga0070673_100050060 | |||
| 1110 | Ga0070673_100201425 | |||
| 1111 | Ga0070673_100216618 | |||
| 1112 | Ga0070673_100252801 | |||
| 1113 | Ga0070673_100281052 | |||
| 1114 | Ga0070673_100301543 | |||
| 1115 | Ga0070673_100450166 | |||
| 1116 | Ga0070688_100031906 | |||
| 1117 | Ga0070688_100063436 | |||
| 1118 | Ga0070688_100491661 | |||
| 1119 | Ga0070659_100006879 | |||
| 1120 | Ga0070659_100061606 | |||
| 1121 | Ga0070659_100069090 | |||
| 1122 | Ga0070659_100179923 | |||
| 1123 | Ga0070659_100214597 | |||
| 1124 | Ga0070667_100012458 | |||
| 1125 | Ga0070667_100055305 | |||
| 1126 | Ga0070667_100066430 | |||
| 1127 | Ga0070667_100221626 | |||
| 1128 | Ga0070667_100286293 | |||
| 1129 | Ga0070709_10004052 | |||
| 1130 | Ga0070709_10023359 | |||
| 1131 | Ga0070714_100000878 | |||
| 1132 | Ga0070714_100029489 | |||
| 1133 | Ga0070713_100000396 | |||
| 1134 | Ga0070710_10254082 | |||
| 1135 | Ga0070701_10149335 | |||
| 1136 | Ga0070701_10234994 | |||
| 1137 | Ga0070701_10281856 | |||
| 1138 | Ga0070711_100052566 | |||
| 1139 | Ga0070711_100174789 | |||
| 1140 | Ga0070711_100224394 | |||
| 1141 | Ga0070700_100090726 | |||
| 1142 | Ga0070700_100136899 | |||
| 1143 | Ga0070700_100292263 | |||
| 1144 | Ga0070694_100079208 | |||
| 1145 | Ga0070694_100179946 | |||
| 1146 | Ga0070694_100267665 | |||
| 1147 | Ga0070663_100108781 | |||
| 1148 | Ga0070663_100185992 | |||
| 1149 | Ga0070678_100289888 | |||
| 1150 | Ga0070662_100004317 | |||
| 1151 | Ga0070662_100181640 | |||
| 1152 | Ga0070662_100229686 | |||
| 1153 | Ga0070662_100426416 | |||
| 1154 | Ga0070662_100639383 | |||
| 1155 | Ga0070662_100833100 | |||
| 1156 | Ga0070681_10000544 | |||
| 1157 | Ga0070681_10000828 | |||
| 1158 | Ga0070681_10003787 | |||
| 1159 | Ga0070681_10155741 | |||
| 1160 | Ga0070681_10221727 | |||
| 1161 | Ga0070681_10468086 | |||
| 1162 | Ga0068867_100104995 | |||
| 1163 | Ga0068867_100258165 | |||
| 1164 | Ga0068867_100261627 | |||
| 1165 | Ga0068867_100427333 | |||
| 1166 | Ga0068867_100510012 | |||
| 1167 | Ga0068867_100626134 | |||
| 1168 | Ga0070685_10046604 | |||
| 1169 | Ga0070685_10216735 | |||
| 1170 | Ga0070685_10790231 | |||
| 1171 | Ga0070706_100131012 | |||
| 1172 | Ga0070706_100371005 | |||
| 1173 | Ga0070706_101163976 | |||
| 1174 | Ga0070707_100270212 | |||
| 1175 | Ga0070707_100440260 | |||
| 1176 | Ga0070707_101112879 | |||
| 1177 | Ga0070698_100000109 | |||
| 1178 | Ga0070698_100024231 | |||
| 1179 | Ga0070698_100259097 | |||
| 1180 | Ga0070698_100662105 | |||
| 1181 | Ga0070698_100878605 | |||
| 1182 | Ga0070699_100020308 | |||
| 1183 | Ga0070699_100052769 | |||
| 1184 | Ga0070699_100575332 | |||
| 1185 | Ga0070699_100892501 | |||
| 1186 | Ga0070679_100000443 | |||
| 1187 | Ga0070679_100031020 | |||
| 1188 | Ga0070679_100031238 | |||
| 1189 | Ga0070679_100085961 | |||
| 1190 | Ga0070679_100141190 | |||
| 1191 | Ga0070679_100185801 | |||
| 1192 | Ga0070679_100313477 | |||
| 1193 | Ga0070679_100565067 | |||
| 1194 | Ga0070679_101012165 | |||
| 1195 | Ga0070684_100002554 | |||
| 1196 | Ga0070684_100003416 | |||
| 1197 | Ga0070684_100003432 | |||
| 1198 | Ga0070684_100015020 | |||
| 1199 | Ga0070684_100016134 | |||
| 1200 | Ga0070684_100018286 | |||
| 1201 | Ga0070684_100028725 | |||
| 1202 | Ga0070684_100037680 | |||
| 1203 | Ga0070684_100093956 | |||
| 1204 | Ga0070684_100114526 | |||
| 1205 | Ga0070684_100115653 | |||
| 1206 | Ga0070684_100124215 | |||
| 1207 | Ga0070684_100149010 | |||
| 1208 | Ga0070684_100175131 | |||
| 1209 | Ga0070684_100442800 | |||
| 1210 | Ga0070684_100687900 | |||
| 1211 | Ga0068853_100035992 | |||
| 1212 | Ga0068853_100244149 | |||
| 1213 | Ga0068853_100312008 | |||
| 1214 | Ga0068853_100394836 | |||
| 1215 | Ga0068853_101182361 | |||
| 1216 | Ga0068853_101376474 | |||
| 1217 | Ga0070672_100018173 | |||
| 1218 | Ga0070672_100023853 | |||
| 1219 | Ga0070672_100027934 | |||
| 1220 | Ga0070672_100113141 | |||
| 1221 | Ga0070672_100133071 | |||
| 1222 | Ga0070672_100320472 | |||
| 1223 | Ga0070672_100397719 | |||
| 1224 | Ga0070672_100750729 | |||
| 1225 | Ga0070686_100117084 | |||
| 1226 | Ga0070695_100867258 | |||
| 1227 | Ga0070695_101068844 | |||
| 1228 | Ga0070696_100000317 | |||
| 1229 | Ga0070696_100020562 | |||
| 1230 | Ga0070693_100079989 | |||
| 1231 | Ga0070665_100010586 | |||
| 1232 | Ga0070665_100230340 | |||
| 1233 | Ga0070704_100257060 | |||
| 1234 | Ga0070704_100801705 | |||
| 1235 | Ga0068855_100085897 | |||
| 1236 | Ga0068855_100086933 | |||
| 1237 | Ga0068855_100455549 | |||
| 1238 | Ga0068855_100551007 | |||
| 1239 | Ga0068855_101807926 | |||
| 1240 | Ga0070664_100002089 | |||
| 1241 | Ga0070664_100006546 | |||
| 1242 | Ga0070664_100012348 | |||
| 1243 | Ga0070664_100026387 | |||
| 1244 | Ga0070664_100030667 | |||
| 1245 | Ga0070664_100095861 | |||
| 1246 | Ga0070664_100113568 | |||
| 1247 | Ga0070664_100146290 | |||
| 1248 | Ga0070664_100160920 | |||
| 1249 | Ga0070664_100178590 | |||
| 1250 | Ga0070664_100228693 | |||
| 1251 | Ga0070664_100313134 | |||
| 1252 | Ga0070664_100349694 | |||
| 1253 | Ga0070664_100714266 | |||
| 1254 | Ga0070664_100813410 | |||
| 1255 | Ga0070664_100818941 | |||
| 1256 | Ga0068857_100007962 | |||
| 1257 | Ga0068857_100009491 | |||
| 1258 | Ga0068857_100011118 | |||
| 1259 | Ga0068857_100011804 | |||
| 1260 | Ga0068857_100761267 | |||
| 1261 | Ga0068854_100003700 | |||
| 1262 | Ga0068854_100020760 | |||
| 1263 | Ga0068854_100269544 | |||
| 1264 | Ga0068856_100114458 | |||
| 1265 | Ga0068856_101387449 | |||
| 1266 | Ga0070702_100091836 | |||
| 1267 | Ga0070702_100290894 | |||
| 1268 | Ga0070702_100319699 | |||
| 1269 | Ga0068852_100006122 | |||
| 1270 | Ga0068852_100015703 | |||
| 1271 | Ga0068852_100134447 | |||
| 1272 | Ga0068852_100450576 | |||
| 1273 | Ga0068852_100546940 | |||
| 1274 | Ga0068852_100754629 | |||
| 1275 | Ga0068859_100053778 | |||
| 1276 | Ga0068859_100293653 | |||
| 1277 | Ga0068859_100351783 | |||
| 1278 | Ga0068859_100656317 | |||
| 1279 | Ga0068859_100756530 | |||
| 1280 | Ga0068864_100141470 | |||
| 1281 | Ga0068864_100517546 | |||
| 1282 | Ga0068864_101048258 | |||
| 1283 | Ga0068866_10306314 | |||
| 1284 | Ga0068866_10393616 | |||
| 1285 | Ga0068861_100000232 | |||
| 1286 | Ga0068861_100077862 | |||
| 1287 | Ga0068861_100156561 | |||
| 1288 | Ga0068851_10027152 | |||
| 1289 | Ga0068851_10036084 | |||
| 1290 | Ga0068851_10065661 | |||
| 1291 | Ga0068851_10095010 | |||
| 1292 | Ga0068851_10156066 | |||
| 1293 | Ga0068870_10006869 | |||
| 1294 | Ga0068870_10250824 | |||
| 1295 | Ga0068870_10419013 | |||
| 1296 | Ga0068863_100043204 | |||
| 1297 | Ga0068863_100109300 | |||
| 1298 | Ga0068863_100460436 | |||
| 1299 | Ga0068858_100006089 | |||
| 1300 | Ga0068858_100014455 | |||
| 1301 | Ga0068860_100011913 | |||
| 1302 | Ga0068860_100221369 | |||
| 1303 | Ga0068860_100423138 | |||
| 1304 | Ga0068860_100486999 | |||
| 1305 | Ga0068862_100002069 | |||
| 1306 | Ga0068862_100263908 | |||
| 1307 | Ga0081539_10000103 | |||
| 1308 | Ga0070717_10061924 | |||
| 1309 | Ga0070712_100007912 | |||
| 1310 | Ga0070712_100474532 | |||
| 1311 | Ga0097621_100185964 | |||
| 1312 | Ga0097621_100571470 | |||
| 1313 | Ga0068871_100661266 | |||
| 1314 | Ga0068871_100842550 | |||
| 1315 | Ga0075428_100232369 | |||
| 1316 | Ga0075428_100232776 | |||
| 1317 | Ga0075428_100353655 | |||
| 1318 | Ga0075430_100003163 | |||
| 1319 | Ga0075430_100036168 | |||
| 1320 | Ga0075430_100181787 | |||
| 1321 | Ga0075430_100399391 | |||
| 1322 | Ga0075431_100067114 | |||
| 1323 | Ga0075431_100186026 | |||
| 1324 | Ga0075431_100207677 | |||
| 1325 | Ga0075431_100389263 | |||
| 1326 | Ga0075431_100629589 | |||
| 1327 | Ga0075431_100810872 | |||
| 1328 | Ga0075433_10002721 | |||
| 1329 | Ga0075433_10112606 | |||
| 1330 | Ga0075433_10916867 | |||
| 1331 | Ga0075434_100005668 | |||
| 1332 | Ga0075434_100068223 | |||
| 1333 | Ga0075434_100738619 | |||
| 1334 | Ga0075429_100027565 | |||
| 1335 | Ga0075429_100111764 | |||
| 1336 | Ga0075429_100142517 | |||
| 1337 | Ga0068865_100028967 | |||
| 1338 | Ga0068865_100060365 | |||
| 1339 | Ga0068865_100101244 | |||
| 1340 | Ga0068865_100159747 | |||
| 1341 | Ga0075436_100003392 | |||
| 1342 | Ga0075436_100012407 | |||
| 1343 | Ga0097620_100053777 | |||
| 1344 | Ga0097620_100293668 | |||
| 1345 | Ga0097620_100351751 | |||
| 1346 | Ga0097620_100656373 | |||
| 1347 | Ga0097620_100686397 | |||
| 1348 | Ga0075435_100251612 | |||
| 1349 | Ga0105240_10122856 | |||
| 1350 | Ga0105240_10156707 | |||
| 1351 | Ga0105240_10300375 | |||
| 1352 | Ga0105240_10325726 | |||
| 1353 | Ga0105240_10326059 | |||
| 1354 | Ga0105240_10478247 | |||
| 1355 | Ga0105240_10595926 | |||
| 1356 | Ga0105240_10696152 | |||
| 1357 | Ga0105240_10741242 | |||
| 1358 | Ga0111539_10021889 | |||
| 1359 | Ga0111539_10575171 | |||
| 1360 | Ga0105245_10081518 | |||
| 1361 | Ga0114129_10053397 | |||
| 1362 | Ga0114129_10162829 | |||
| 1363 | Ga0114129_10490559 | |||
| 1364 | Ga0114129_11590504 | |||
| 1365 | Ga0105241_10000025 | |||
| 1366 | Ga0105241_10065551 | |||
| 1367 | Ga0105242_10006374 | |||
| 1368 | Ga0105242_10064484 | |||
| 1369 | Ga0105242_10256548 | |||
| 1370 | Ga0105242_10309902 | |||
| 1371 | Ga0105248_10005922 | |||
| 1372 | Ga0105248_10026512 | |||
| 1373 | Ga0105248_10091207 | |||
| 1374 | Ga0105248_10408004 | |||
| 1375 | Ga0105248_10462087 | |||
| 1376 | Ga0105248_11008291 | |||
| 1377 | Ga0105248_11910839 | |||
| 1378 | Ga0105237_10295613 | |||
| 1379 | Ga0105237_10726091 | |||
| 1380 | Ga0105237_11402295 | |||
| 1381 | Ga0105238_10078912 | |||
| 1382 | Ga0105238_10449474 | |||
| 1383 | Ga0105238_10623356 | |||
| 1384 | Ga0105249_10001142 | |||
| 1385 | Ga0105249_10003811 | |||
| 1386 | Ga0105249_10200608 | |||
| 1387 | Ga0105239_10071801 | |||
| 1388 | Ga0105246_10020625 | |||
| 1389 | Ga0157373_10004494 | |||
| 1390 | Ga0157373_10062153 | |||
| 1391 | Ga0157373_10071049 | |||
| 1392 | Ga0157373_10076242 | |||
| 1393 | Ga0157373_10237349 | |||
| 1394 | Ga0157373_10318082 | |||
| 1395 | Ga0157373_10428382 | |||
| 1396 | Ga0157371_10092788 | |||
| 1397 | Ga0157370_10001327 | |||
| 1398 | Ga0157370_10016352 | |||
| 1399 | Ga0157370_10017249 | |||
| 1400 | Ga0157370_10033024 | |||
| 1401 | Ga0157370_10036262 | |||
| 1402 | Ga0157370_10108006 | |||
| 1403 | Ga0157370_11232632 | |||
| 1404 | Ga0157369_10006892 | |||
| 1405 | Ga0157369_10012342 | |||
| 1406 | Ga0157369_10034493 | |||
| 1407 | Ga0157369_10131562 | |||
| 1408 | Ga0157369_10179856 | |||
| 1409 | Ga0157369_10215251 | |||
| 1410 | Ga0157369_10401408 | |||
| 1411 | Ga0157369_10639492 | |||
| 1412 | Ga0157369_10724305 | |||
| 1413 | Ga0157374_10080629 | |||
| 1414 | Ga0157374_10145408 | |||
| 1415 | Ga0157378_10023659 | |||
| 1416 | Ga0157378_10144507 | |||
| 1417 | Ga0163162_10002411 | |||
| 1418 | Ga0163162_10049498 | |||
| 1419 | Ga0163162_10728175 | |||
| 1420 | Ga0157372_10004177 | |||
| 1421 | Ga0157372_10011138 | |||
| 1422 | Ga0157372_10016305 | |||
| 1423 | Ga0157372_10017385 | |||
| 1424 | Ga0157372_10031961 | |||
| 1425 | Ga0157372_10070153 | |||
| 1426 | Ga0157372_10130835 | |||
| 1427 | Ga0157372_10131366 | |||
| 1428 | Ga0157372_10187968 | |||
| 1429 | Ga0157372_10277202 | |||
| 1430 | Ga0157372_10485662 | |||
| 1431 | Ga0157372_10679064 | |||
| 1432 | Ga0157372_10939195 | |||
| 1433 | Ga0157375_10014333 | |||
| 1434 | Ga0157375_10047582 | |||
| 1435 | Ga0157375_10050500 | |||
| 1436 | Ga0157375_10054022 | |||
| 1437 | Ga0157375_10154573 | |||
| 1438 | Ga0157375_10284274 | |||
| 1439 | Ga0157375_10687563 | |||
| 1440 | Ga0157375_10909730 | |||
| 1441 | Ga0163163_10711212 | |||
| 1442 | Ga0157380_10003163 | |||
| 1443 | Ga0157380_10009480 | |||
| 1444 | Ga0157380_10188091 | |||
| 1445 | Ga0157377_10032846 | |||
| 1446 | Ga0157379_10005920 | |||
| 1447 | Ga0157376_10401869 | |||
| 1448 | Ga0157376_10745544 | |||
| 1449 | Ga0182007_10067998 | |||
| 1450 | Ga0163161_10015002 | |||
| 1451 | Ga0163161_10233770 | |||
| 1452 | Ga0163161_10585124 | |||
| 1453 | Ga0163161_10700688 | |||
| 1454 | Ga0197907_10017702 | |||
| 1455 | Ga0206356_10075689 | |||
| 1456 | Ga0213876_10060865 | |||
| 1457 | Ga0207697_10001978 | |||
| 1458 | Ga0207656_10122791 | |||
| 1459 | Ga0207682_10020365 | |||
| 1460 | Ga0207688_10031617 | |||
| 1461 | Ga0207688_10088681 | |||
| 1462 | Ga0207680_10391626 | |||
| 1463 | Ga0207680_10410984 | |||
| 1464 | Ga0207680_10473013 | |||
| 1465 | Ga0207647_10335718 | |||
| 1466 | Ga0207699_10376722 | |||
| 1467 | Ga0207645_10000513 | |||
| 1468 | Ga0207645_10015255 | |||
| 1469 | Ga0207645_10301681 | |||
| 1470 | Ga0207645_10317683 | |||
| 1471 | Ga0207645_10326291 | |||
| 1472 | Ga0207643_10006700 | |||
| 1473 | Ga0207643_10012415 | |||
| 1474 | Ga0207643_10142204 | |||
| 1475 | Ga0207705_10018465 | |||
| 1476 | Ga0207705_10043958 | |||
| 1477 | Ga0207705_10097736 | |||
| 1478 | Ga0207705_10098040 | |||
| 1479 | Ga0207705_10298338 | |||
| 1480 | Ga0207684_10212180 | |||
| 1481 | Ga0207684_10298461 | |||
| 1482 | Ga0207684_11138348 | |||
| 1483 | Ga0207654_10001593 | |||
| 1484 | Ga0207654_10326658 | |||
| 1485 | Ga0207654_10628349 | |||
| 1486 | Ga0207707_10000485 | |||
| 1487 | Ga0207707_10001404 | |||
| 1488 | Ga0207707_10003323 | |||
| 1489 | Ga0207707_10013100 | |||
| 1490 | Ga0207707_10158537 | |||
| 1491 | Ga0207707_10206286 | |||
| 1492 | Ga0207707_10342644 | |||
| 1493 | Ga0207695_10000824 | |||
| 1494 | Ga0207695_10002609 | |||
| 1495 | Ga0207695_10078082 | |||
| 1496 | Ga0207695_10096980 | |||
| 1497 | Ga0207695_10292987 | |||
| 1498 | Ga0207695_10402644 | |||
| 1499 | Ga0207671_10075826 | |||
| 1500 | Ga0207693_10013148 | |||
| 1501 | Ga0207663_10294971 | |||
| 1502 | Ga0207663_10523055 | |||
| 1503 | Ga0207660_10000035 | |||
| 1504 | Ga0207660_10015223 | |||
| 1505 | Ga0207660_10019058 | |||
| 1506 | Ga0207660_10028034 | |||
| 1507 | Ga0207660_10121705 | |||
| 1508 | Ga0207660_10136788 | |||
| 1509 | Ga0207660_10182956 | |||
| 1510 | Ga0207660_10634949 | |||
| 1511 | Ga0207660_10732738 | |||
| 1512 | Ga0207662_10010778 | |||
| 1513 | Ga0207662_10383935 | |||
| 1514 | Ga0207657_10008543 | |||
| 1515 | Ga0207657_10015548 | |||
| 1516 | Ga0207657_10331438 | |||
| 1517 | Ga0207649_10000422 | |||
| 1518 | Ga0207649_10008691 | |||
| 1519 | Ga0207649_10029805 | |||
| 1520 | Ga0207649_10065484 | |||
| 1521 | Ga0207649_10119389 | |||
| 1522 | Ga0207649_10335065 | |||
| 1523 | Ga0207649_10493410 | |||
| 1524 | Ga0207652_10000609 | |||
| 1525 | Ga0207652_10001738 | |||
| 1526 | Ga0207652_10011989 | |||
| 1527 | Ga0207652_10056870 | |||
| 1528 | Ga0207652_10219553 | |||
| 1529 | Ga0207652_10413134 | |||
| 1530 | Ga0207652_10507352 | |||
| 1531 | Ga0207652_10759205 | |||
| 1532 | Ga0207646_10425228 | |||
| 1533 | Ga0207646_11004086 | |||
| 1534 | Ga0207646_11026607 | |||
| 1535 | Ga0207646_11385717 | |||
| 1536 | Ga0207681_10000537 | |||
| 1537 | Ga0207681_10034707 | |||
| 1538 | Ga0207694_10085578 | |||
| 1539 | Ga0207694_10207866 | |||
| 1540 | Ga0207650_10052293 | |||
| 1541 | Ga0207650_10120792 | |||
| 1542 | Ga0207650_10173696 | |||
| 1543 | Ga0207650_10242695 | |||
| 1544 | Ga0207650_10269554 | |||
| 1545 | Ga0207659_10061473 | |||
| 1546 | Ga0207659_10205568 | |||
| 1547 | Ga0207659_10206720 | |||
| 1548 | Ga0207659_10224618 | |||
| 1549 | Ga0207659_10367019 | |||
| 1550 | Ga0207659_10483512 | |||
| 1551 | Ga0207687_10135811 | |||
| 1552 | Ga0207687_10242373 | |||
| 1553 | Ga0207700_10001929 | |||
| 1554 | Ga0207700_10054647 | |||
| 1555 | Ga0207700_10824962 | |||
| 1556 | Ga0207664_10158358 | |||
| 1557 | Ga0207664_10185845 | |||
| 1558 | Ga0207644_10026962 | |||
| 1559 | Ga0207644_10165031 | |||
| 1560 | Ga0207644_10290500 | |||
| 1561 | Ga0207690_10052603 | |||
| 1562 | Ga0207690_10056511 | |||
| 1563 | Ga0207690_10143089 | |||
| 1564 | Ga0207690_10361475 | |||
| 1565 | Ga0207690_11128459 | |||
| 1566 | Ga0207706_10000055 | |||
| 1567 | Ga0207706_10176978 | |||
| 1568 | Ga0207706_10187413 | |||
| 1569 | Ga0207706_10214189 | |||
| 1570 | Ga0207706_10309150 | |||
| 1571 | Ga0207706_10329635 | |||
| 1572 | Ga0207686_10205727 | |||
| 1573 | Ga0207686_10208992 | |||
| 1574 | Ga0207670_10061060 | |||
| 1575 | Ga0207670_10085890 | |||
| 1576 | Ga0207670_10761482 | |||
| 1577 | Ga0207669_10094447 | |||
| 1578 | Ga0207669_10160862 | |||
| 1579 | Ga0207669_10637938 | |||
| 1580 | Ga0207704_10028767 | |||
| 1581 | Ga0207704_10151223 | |||
| 1582 | Ga0207704_10731198 | |||
| 1583 | Ga0207691_10000129 | |||
| 1584 | Ga0207691_10004042 | |||
| 1585 | Ga0207691_10005297 | |||
| 1586 | Ga0207691_10023370 | |||
| 1587 | Ga0207691_10033533 | |||
| 1588 | Ga0207691_10081921 | |||
| 1589 | Ga0207691_10456618 | |||
| 1590 | Ga0207711_10127374 | |||
| 1591 | Ga0207711_10193642 | |||
| 1592 | Ga0207711_10573930 | |||
| 1593 | Ga0207711_10585926 | |||
| 1594 | Ga0207711_11167907 | |||
| 1595 | Ga0207689_10008227 | |||
| 1596 | Ga0207689_10033942 | |||
| 1597 | Ga0207661_10007864 | |||
| 1598 | Ga0207661_10025413 | |||
| 1599 | Ga0207661_10031708 | |||
| 1600 | Ga0207661_10056884 | |||
| 1601 | Ga0207661_10085873 | |||
| 1602 | Ga0207661_10104508 | |||
| 1603 | Ga0207661_10182870 | |||
| 1604 | Ga0207661_10280349 | |||
| 1605 | Ga0207661_10391958 | |||
| 1606 | Ga0207661_10433192 | |||
| 1607 | Ga0207661_10599445 | |||
| 1608 | Ga0207661_10633717 | |||
| 1609 | Ga0207679_10000382 | |||
| 1610 | Ga0207679_10002242 | |||
| 1611 | Ga0207679_10010118 | |||
| 1612 | Ga0207679_10037653 | |||
| 1613 | Ga0207679_10054688 | |||
| 1614 | Ga0207679_10061160 | |||
| 1615 | Ga0207679_10063534 | |||
| 1616 | Ga0207679_10117447 | |||
| 1617 | Ga0207679_10161392 | |||
| 1618 | Ga0207679_10327404 | |||
| 1619 | Ga0207679_10440743 | |||
| 1620 | Ga0207679_10780092 | |||
| 1621 | Ga0207679_11293320 | |||
| 1622 | Ga0207667_10033264 | |||
| 1623 | Ga0207667_10362706 | |||
| 1624 | Ga0207667_10379776 | |||
| 1625 | Ga0207667_10530769 | |||
| 1626 | Ga0207667_11087044 | |||
| 1627 | Ga0207651_10029820 | |||
| 1628 | Ga0207651_10083254 | |||
| 1629 | Ga0207651_10092895 | |||
| 1630 | Ga0207651_10605585 | |||
| 1631 | Ga0207712_10000920 | |||
| 1632 | Ga0207668_10011829 | |||
| 1633 | Ga0207668_10839735 | |||
| 1634 | Ga0207668_10856515 | |||
| 1635 | Ga0207640_10000266 | |||
| 1636 | Ga0207640_10215636 | |||
| 1637 | Ga0207640_10498686 | |||
| 1638 | Ga0207658_10249916 | |||
| 1639 | Ga0207658_10280463 | |||
| 1640 | Ga0207658_10294460 | |||
| 1641 | Ga0207658_10325495 | |||
| 1642 | Ga0207658_10421742 | |||
| 1643 | Ga0207658_10517945 | |||
| 1644 | Ga0207677_10097680 | |||
| 1645 | Ga0207677_10531505 | |||
| 1646 | Ga0207703_10080821 | |||
| 1647 | Ga0207703_10416516 | |||
| 1648 | Ga0207639_10207564 | |||
| 1649 | Ga0207639_10254522 | |||
| 1650 | Ga0207678_10247694 | |||
| 1651 | Ga0207708_10279451 | |||
| 1652 | Ga0207708_10348208 | |||
| 1653 | Ga0207702_10266759 | |||
| 1654 | Ga0207641_10240170 | |||
| 1655 | Ga0207641_10246014 | |||
| 1656 | Ga0207641_11337683 | |||
| 1657 | Ga0207648_10010162 | |||
| 1658 | Ga0207648_10031606 | |||
| 1659 | Ga0207648_10095562 | |||
| 1660 | Ga0207648_10126987 | |||
| 1661 | Ga0207648_10440659 | |||
| 1662 | Ga0207648_11077389 | |||
| 1663 | Ga0207676_10904212 | |||
| 1664 | Ga0207676_10975147 | |||
| 1665 | Ga0207674_10001035 | |||
| 1666 | Ga0207674_10002037 | |||
| 1667 | Ga0207674_10021081 | |||
| 1668 | Ga0207674_10026295 | |||
| 1669 | Ga0207675_100000073 | |||
| 1670 | Ga0207675_100084506 | |||
| 1671 | Ga0207675_100149855 | |||
| 1672 | Ga0207675_100910017 | |||
| 1673 | Ga0207683_10123300 | |||
| 1674 | Ga0207683_10206373 | |||
| 1675 | Ga0207683_10471441 | |||
| 1676 | Ga0207698_10015286 | |||
| 1677 | Ga0207698_10108989 | |||
| 1678 | Ga0207698_10264879 | |||
| 1679 | Ga0207698_10719741 | |||
| 1680 | Ga0207698_11204786 | |||
| 1681 | Ga0207698_11435825 | |||
| 1682 | Ga0209968_1003366 | |||
| 1683 | Ga0209999_1027386 | |||
| 1684 | Ga0209966_1010289 | |||
| 1685 | Ga0207428_10026683 | |||
| 1686 | Ga0207428_10842685 | |||
| 1687 | Ga0268266_10115231 | |||
| 1688 | Ga0268266_10316838 | |||
| 1689 | Ga0268265_11492597 | |||
| 1690 | Ga0268264_10031762 | |||
| 1691 | Ga0268264_11038521 | |||
| 1692 | Ga0307405_10016213 | |||
| 1693 | Ga0307405_10016433 | |||
| 1694 | Ga0307405_10276914 | |||
| 1695 | Ga0307405_11082836 | |||
| 1696 | Ga0307413_10004571 | |||
| 1697 | Ga0307413_10027025 | |||
| 1698 | Ga0307410_10116698 | |||
| 1699 | Ga0307410_10341241 | |||
| 1700 | Ga0307410_10347624 | |||
| 1701 | Ga0307410_10448733 | |||
| 1702 | Ga0307410_10775603 | |||
| 1703 | Ga0307406_10087678 | |||
| 1704 | Ga0307406_10218708 | |||
| 1705 | Ga0307407_10011271 | |||
| 1706 | Ga0307407_10041647 | |||
| 1707 | Ga0307407_10247529 | |||
| 1708 | Ga0307412_10009112 | |||
| 1709 | Ga0307412_10124442 | |||
| 1710 | Ga0307412_10296314 | |||
| 1711 | Ga0307412_10388201 | |||
| 1712 | Ga0307409_100396701 | |||
| 1713 | Ga0307409_101314932 | |||
| 1714 | Ga0307409_101325569 | |||
| 1715 | Ga0307416_100069846 | |||
| 1716 | Ga0307416_100141905 | |||
| 1717 | Ga0307416_100490430 | |||
| 1718 | Ga0307416_100536132 | |||
| 1719 | Ga0307416_101020081 | |||
| 1720 | Ga0307416_101026209 | |||
| 1721 | Ga0307416_101089053 | |||
| 1722 | Ga0307414_10007789 | |||
| 1723 | Ga0307414_10233273 | |||
| 1724 | Ga0307414_10754349 | |||
| 1725 | Ga0307414_11134694 | |||
| 1726 | Ga0307414_11236575 | |||
| 1727 | Ga0307411_10001331 | |||
| 1728 | Ga0307411_10131190 | |||
| 1729 | Ga0307415_100078935 | |||
| 1730 | Ga0307415_100116145 | |||
| 1731 | Ga0307415_100248470 | |||
| 1732 | Ga0307415_100347533 | |||
| 1733 | Ga0307415_100446994 | |||
| 1734 | Ga0307415_100664362 | |||
| 1735 | Ga0373934_0000319 | |||
| 1736 | Ga0373923_0079046 | |||
| 1737 | Ga0373945_0009272 | |||
| 1738 | Ga0373953_0010653 | |||
| 1739 | Ga0373953_0271481 | |||
| 1740 | Ga0373954_0024387 | |||
| 1741 | Ga0373956_0007873 | |||
| 1742 | Ga0373956_0059152 | |||
| 1743 | Ga0373957_0110738 | |||
| 1744 | Ga0373943_0000549 | |||
| 1745 | Ga0373943_0746206 | |||
| 1746 | Ga0373946_0140153 | |||
| 1747 | Ga0373946_0241080 | |||
| 1748 | Ga0373955_0010711 | |||
| 1749 | Ga0373955_0570437 | |||
| 1750 | Ga0373931_0147047 | |||
| 1751 | Ga0373935_0025192 | |||
| 1752 | Ga0373935_0140190 | |||
| 1753 | Ga0373935_0233897 | |||
| 1754 | Ga0373935_0675002 | |||
| 1755 | Ga0373927_0015005 | |||
| 1756 | Ga0373927_0028039 | |||
| 1757 | Ga0373927_0101015 | |||
| 1758 | Ga0373933_0030909 | |||
| 1759 | Ga0373933_0033766 | |||
| 1760 | Ga0373947_0000580 | |||
| 1761 | Ga0373947_0065217 | |||
| 1762 | Ga0373937_0001736 | |||
| 1763 | Ga0373937_0139331 | |||
| 1764 | Ga0373937_0164017 | |||
| 1765 | Ga0373937_0270639 | |||
| 1766 | Ga0373925_0001431 | |||
| 1767 | Ga0373925_0032169 | |||
| 1768 | Ga0373925_0404870 | |||
| 1769 | Ga0436365_0475701 | |||
| 1770 | Ga0436365_0875476 | |||
| 1771 | Ga0436365_0982966 | |||
| 1772 | Ga0439448_0067275 | |||
| 1773 | Ga0439455_0067273 | |||
| 1774 | Ga0439464_0083104 | |||
| 1775 | Ga0451577_0000016 | |||
| 1776 | Ga0451577_0007492 | |||
| 1777 | Ga0451577_0021164 | |||
| 1778 | Ga0451577_0039290 | |||
| 1779 | Ga0451577_0156063 | |||
| 1780 | Ga0451577_0222580 | |||
| 1781 | Ga0466963_0118097 | |||
| 1782 | Ga0466963_0252359 | |||
| 1783 | Ga0453684_0000368 | |||
| 1784 | Ga0453684_0041760 | |||
| 1785 | Ga0453684_0051193 | |||
| 1786 | Ga0466959_0041971 | |||
| 1787 | Ga0451576_0235254 | |||
| 1788 | Ga0451576_0311411 | |||
| 1789 | Ga0451576_0629666 | |||
| 1790 | Ga0466958_0133777 | |||
| 1791 | Ga0466958_0317227 | |||
| 1792 | Ga0466967_0051897 | |||
| 1793 | Ga0466967_0054913 | |||
| 1794 | Ga0466967_0323715 | |||
| 1795 | Ga0466967_0947813 | |||
| 1796 | Ga0495592_0016371 | |||
| 1797 | Ga0495592_0186271 | |||
| 1798 | Ga0495592_0220460 | |||
| 1799 | Ga0495629_0038669 | |||
| 1800 | Ga0495629_0053126 | |||
| 1801 | Ga0495651_0004559 | |||
| 1802 | Ga0495651_0039377 | |||
| 1803 | Ga0495651_0279390 | |||
| 1804 | Ga0495651_0363840 | |||
| 1805 | Ga0495653_0086461 | |||
| 1806 | Ga0495653_0091967 | |||
| 1807 | Ga0495580_0003447 | |||
| 1808 | Ga0495580_0010878 | |||
| 1809 | Ga0495580_0030804 | |||
| 1810 | Ga0495582_0008502 | |||
| 1811 | Ga0495582_0067504 | |||
| 1812 | Ga0495582_0088330 | |||
| 1813 | Ga0495582_0404675 | |||
| 1814 | Ga0495639_0001681 | |||
| 1815 | Ga0495639_0070550 | |||
| 1816 | Ga0495662_0007455 | |||
| 1817 | Ga0495594_0002309 | |||
| 1818 | Ga0495594_0005001 | |||
| 1819 | Ga0495594_0008462 | |||
| 1820 | Ga0495594_0085085 | |||
| 1821 | Ga0495594_0438186 | |||
| 1822 | Ga0495596_0090328 | |||
| 1823 | Ga0495596_0199361 | |||
| 1824 | Ga0495608_0044993 | |||
| 1825 | Ga0495608_0052115 | |||
| 1826 | Ga0495618_0055155 | |||
| 1827 | Ga0495628_0006895 | |||
| 1828 | Ga0495628_0040706 | |||
| 1829 | Ga0495628_0139680 | |||
| 1830 | Ga0495630_0031856 | |||
| 1831 | Ga0495630_0040136 | |||
| 1832 | Ga0495630_0180271 | |||
| 1833 | Ga0495630_0502557 | |||
| 1834 | Ga0495663_0072249 | |||
| 1835 | Ga0495663_0105894 | |||
| 1836 | Ga0495663_0311400 | |||
| 1837 | Ga0495652_0000859 | |||
| 1838 | Ga0495652_0032221 | |||
| 1839 | Ga0495652_0202719 | |||
| 1840 | Ga0495665_0000677 | |||
| 1841 | Ga0495665_0020133 | |||
| 1842 | Ga0495665_0069766 | |||
| 1843 | Ga0495640_0079411 | |||
| 1844 | Ga0495586_0039853 | |||
| 1845 | Ga0495586_0309322 | |||
| 1846 | Ga0495586_0776136 | |||
| 1847 | Ga0495587_0000360 | |||
| 1848 | Ga0495587_0004216 | |||
| 1849 | Ga0495587_0138258 | |||
| 1850 | Ga0495587_0436228 | |||
| 1851 | Ga0495645_0000989 | |||
| 1852 | Ga0495645_0001984 | |||
| 1853 | Ga0495667_0015602 | |||
| 1854 | Ga0495667_0042983 | |||
| 1855 | Ga0495667_0584655 | |||
| 1856 | Ga0495634_0314856 | |||
| 1857 | Ga0495634_0599752 | |||
| 1858 | Ga0495635_0040433 | |||
| 1859 | Ga0495635_0114467 | |||
| 1860 | Ga0495635_0399471 | |||
| 1861 | Ga0495635_0582214 | |||
| 1862 | Ga0495588_0000514 | |||
| 1863 | Ga0495588_0065723 | |||
| 1864 | Ga0495657_0097839 | |||
| 1865 | Ga0495657_0099581 | |||
| 1866 | Ga0495657_0260330 | |||
| 1867 | Ga0495599_0000395 | |||
| 1868 | Ga0495599_0002829 | |||
| 1869 | Ga0495599_0082817 | |||
| 1870 | Ga0495623_0086385 | |||
| 1871 | Ga0495623_0298155 | |||
| 1872 | Ga0495646_0071561 | |||
| 1873 | Ga0495658_0001102 | |||
| 1874 | Ga0495658_0347535 | |||
| 1875 | Ga0495669_0216707 | |||
| 1876 | Ga0495613_0016681 | |||
| 1877 | Ga0495613_0168730 | |||
| 1878 | Ga0495624_0031704 | |||
| 1879 | Ga0495600_0030985 | |||
| 1880 | Ga0495600_0068387 | |||
| 1881 | Ga0495600_0194278 | |||
| 1882 | Ga0495600_0388838 | |||
| 1883 | Ga0495581_0000585 | |||
| 1884 | Ga0495581_0062904 | |||
| 1885 | Ga0495581_0183552 | |||
| 1886 | Ga0495604_0350272 | |||
| 1887 | Ga0495636_0063592 | |||
| 1888 | Ga0495674_0007720 | |||
| 1889 | Ga0495674_0154171 | |||
| 1890 | Ga0495674_0414300 | |||
| 1891 | Ga0495672_0004134 | |||
| 1892 | Ga0495680_0021757 | |||
| 1893 | Ga0495680_0375513 | |||
| 1894 | Ga0495675_0035608 | |||
| 1895 | Ga0495675_0057125 | |||
| 1896 | Ga0495675_0080425 | |||
| 1897 | Ga0495675_0159323 | |||
| 1898 | Ga0495684_0064847 | |||
| 1899 | Ga0495684_0107907 | |||
| 1900 | Ga0495684_0180162 | |||
| 1901 | Ga0495684_0229930 | |||
| 1902 | Ga0495593_0030869 | |||
| 1903 | Ga0495593_0094833 | |||
| 1904 | Ga0495602_0189836 | |||
| 1905 | Ga0495602_0250120 | |||
| 1906 | Ga0495602_0645249 | |||
| 1907 | Ga0496100_0159071 | |||
| 1908 | Ga0496101_0141520 | |||
| 1909 | Ga0496104_0032397 | |||
| 1910 | Ga0496104_0744650 | |||
| 1911 | Ga0496105_0571089 | |||
| 1912 | Ga0496108_0216403 | |||
| 1913 | Ga0496109_1277863 | |||
| 1914 | Ga0496109_1367846 | |||
| 1915 | Ga0496110_0319101 | |||
| 1916 | Ga0496111_0263127 | |||
| 1917 | Ga0496112_0395956 | |||
| 1918 | Ga0496112_0556589 | |||
| 1919 | Ga0496112_0781648 | |||
| 1920 | Ga0496113_0022996 | |||
| 1921 | Ga0496114_0035290 | |||
| 1922 | Ga0496115_0002487 | |||
| 1923 | Ga0501031_0070260 | |||
| 1924 | Ga0501032_0164341 | |||
| 1925 | Ga0501032_0229141 | |||
| 1926 | Ga0501033_0006099 | |||
| 1927 | Ga0501033_0312624 | |||
| 1928 | Ga0501034_0026781 | |||
| 1929 | Ga0501034_0162813 | |||
| 1930 | Ga0501034_0508303 | |||
| 1931 | Ga0501036_0089981 | |||
| 1932 | Ga0501038_0093932 | |||
| 1933 | Ga0501038_0184294 | |||
| 1934 | Ga0501042_0074899 | |||
| 1935 | Ga0501042_0197577 | |||
| 1936 | Ga0501043_0007990 | |||
| 1937 | Ga0501046_0180761 | |||
| 1938 | Ga0501046_0664008 | |||
| 1939 | Ga0501047_0016410 | |||
| 1940 | Ga0501047_0215059 | |||
| 1941 | Ga0501048_0052402 | |||
| 1942 | Ga0501048_0562265 | |||
| 1943 | Ga0501067_0086560 | |||
| 1944 | Ga0501067_0410636 | |||
| 1945 | Ga0501070_0012137 | |||
| 1946 | Ga0501070_0062638 | |||
| 1947 | Ga0501070_0545910 | |||
| 1948 | Ga0501070_0793034 | |||
| 1949 | Ga0501071_0346470 | |||
| 1950 | Ga0501072_0144679 | |||
| 1951 | Ga0501072_0207887 | |||
| 1952 | Ga0501072_0392506 | |||
| 1953 | Ga0501073_0162246 | |||
| 1954 | Ga0501073_0395404 | |||
| 1955 | Ga0501074_0329823 | |||
| 1956 | Ga0501075_0267695 | |||
| 1957 | Ga0501076_0038186 | |||
| 1958 | Ga0501202_027084 | |||
| 1959 | Ga0501216_011001 | |||
| 1960 | Ga0501217_048090 | |||
| 1961 | Ga0501227_089836 | |||
| 1962 | Ga0501233_019306 | |||
| 1963 | Ga0501235_001527 | |||
| 1964 | Ga0501255_032913 | |||
| 1965 | Ga0501221_059199 | |||
| 1966 | Ga0501225_0044441 | |||
| 1967 | Ga0501079_0120969 | |||
| 1968 | Ga0501083_0345029 | |||
| 1969 | Ga0501263_010283 | |||
| 1970 | Ga0501265_015778 | |||
| 1971 | Ga0501266_013283 | |||
| 1972 | Ga0501268_018984 | |||
| 1973 | Ga0501268_035255 | |||
| 1974 | Ga0501274_004665 | |||
| 1975 | Ga0501035_0142088 | |||
| 1976 | Ga0501035_0190610 | |||
| 1977 | Ga0501035_0296488 | |||
| 1978 | Ga0501035_0807984 | |||
| 1979 | Ga0501044_0009533 | |||
| 1980 | Ga0501044_0926121 | |||
| 1981 | Ga0501045_0021355 | |||
| 1982 | nmdc:mga05p37_120740_c1 | |||
| 1983 | nmdc:mga05p37_262130_c1 | |||
| 1984 | nmdc:mga05p37_474039_c1 | |||
| 1985 | nmdc:mga05p37_58646_c1 | |||
| 1986 | nmdc:mga09592_13015_c1 | |||
| 1987 | nmdc:mga09592_420471_c1 | |||
| 1988 | nmdc:mga09592_77966_c1 | |||
| 1989 | nmdc:mga0qj67_158933_c1 | |||
| 1990 | nmdc:mga0qj67_4128_c1 | |||
| 1991 | nmdc:mga0qj67_59187_c1 | |||
| 1992 | nmdc:mga06r32_129574_c1 | |||
| 1993 | nmdc:mga06r32_1526844_c1 | |||
| 1994 | nmdc:mga06r32_261715_c1 | |||
| 1995 | nmdc:mga06r32_537862_c1 | |||
| 1996 | nmdc:mga06r32_975005_c1 | |||
| 1997 | nmdc:mga08y16_12861_c1 | |||
| 1998 | nmdc:mga08y16_451536_c1 | |||
| 1999 | nmdc:mga08y16_748790_c1 | |||
| 2000 | nmdc:mga0n895_14894_c2 | |||
| 2001 | nmdc:mga0n895_24354_c1 | |||
| 2002 | nmdc:mga0rr50_416684_c1 | |||
| 2003 | nmdc:mga08x19_2070_c1 | |||
| 2004 | nmdc:mga08x19_5049_c1 | |||
| 2005 | nmdc:mga0a205_17614_c1 | |||
| 2006 | nmdc:mga0a205_20136_c1 | |||
| 2007 | nmdc:mga0a205_410631_c1 | |||
| 2008 | Ga0495601_0214451 | |||
| 2009 | Ga0495601_0303036 | |||
| 2010 | Ga0495612_0009455 | |||
| 2011 | Ga0495595_0094867 | |||
| 2012 | Ga0495595_0178581 | |||
| 2013 | Ga0495619_0147505 | |||
| 2014 | Ga0501082_0254557 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ogi-assembly1.cif.gz_A | crystal structure of a putative metal dependent phosphohydrolase (sag1661) from streptococcus agalactiae serogroup v at 1.85 a resolution | 0.8494 | 17 | 182 |
| 3ccg-assembly1.cif.gz_A-2 | crystal structure of predicted hd superfamily hydrolase involved in nad metabolism (np_347894.1) from clostridium acetobutylicum at 1.50 a resolution | 0.8482 | 17 | 182 |
| 8wmy-assembly1.cif.gz_B-2 | crystal structure of yqek in complex with mg and adp. | 0.8452 | 17 | 182 |
| 2o08-assembly1.cif.gz_B | crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution | 0.7859 | 1 | 182 |
| 2o08-assembly1.cif.gz_B | crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution | 0.7782 | 1 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G297_1_187_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.847 | 17 | 183 | 1.10.3210.10 |
| 2ogiA00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8421 | 18 | 182 | 1.10.3210.10 |
| 3ccgA00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8248 | 18 | 182 | 1.10.3210.10 |
| 2o08B00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7831 | 1 | 182 | 1.10.3210.10 |
| af_Q2G297_1_187_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7752 | 17 | 183 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0W6K5-F1-model_v4 | HD domain-containing protein | 0.9819 | 8 | 183 |
|
| AF-A0A3D4YNT0-F1-model_v4 | HD domain-containing protein | 0.9792 | 41 | 183 |
|
| AF-A0A7W0GWJ6-F1-model_v4 | HD domain-containing protein | 0.9611 | 11 | 182 |
|
| AF-A0A349LIQ4-F1-model_v4 | HD domain-containing protein | 0.9592 | 11 | 144 |
|
| AF-A0A2V7S3C8-F1-model_v4 | HD domain-containing protein | 0.9573 | 11 | 183 |
|