F488038

General Info

Members Datasets Scaffolds Average Seq Length
1007 335 2014 183

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10349715|Ga0207659_103497152
Length 210
Sequence MSHHFASHIPSFRIGTSGDASLTSWVRTVAKSEARFDLPSWAQVTDKRRGHILRVTTLLDEWASAMRVGTKERTAWRDAGLFHDALKDAPDDELRELVGDVAYEPQMIHGPAAAAWLEQHGEKRRGVLDAVRYHTVGYLDWDRTGRALYMADFLEPGRKFSQRDRAFLAAQVPQDFDGVFRQVVRARLEWSLHEGYSLFPETVSLWNATR

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
304 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
307 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
308 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
309 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
310 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
311 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
315 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
316 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 18.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10349715 3300025926 Bacteria 1226
2 JGI25406J46586_10032713 3300003203 Bacteria 1929
3 Ga0065715_10273275 3300005293 Bacteria 1105
4 Ga0065715_10355927 3300005293 Bacteria 943
5 Ga0065707_10095745 3300005295 Bacteria 3343
6 Ga0070658_10002410 3300005327 Bacteria 15652
7 Ga0070658_10017737 3300005327 Bacteria 5694
8 Ga0070658_10091182 3300005327 Bacteria 2511
9 Ga0070676_10001204 3300005328 Bacteria 12947
10 Ga0070676_10036346 3300005328 Bacteria 2837
11 Ga0070676_10277778 3300005328 Bacteria 1127
12 Ga0070676_10474713 3300005328 Bacteria 884
13 Ga0070676_10643333 3300005328 Bacteria 769
14 Ga0070683_100002655 3300005329 Bacteria 14296
15 Ga0070683_100006959 3300005329 Bacteria 9511
16 Ga0070683_100010228 3300005329 Bacteria 8059
17 Ga0070683_100016249 3300005329 Bacteria 6559
18 Ga0070683_100044126 3300005329 Bacteria 4110
19 Ga0070683_100044551 3300005329 Bacteria 4091
20 Ga0070683_100071081 3300005329 Bacteria 3247
21 Ga0070683_100170065 3300005329 Unclassified 2069
22 Ga0070683_100192109 3300005329 Bacteria 1939
23 Ga0070683_100214490 3300005329 Bacteria 1829
24 Ga0070683_100328999 3300005329 Bacteria 1455
25 Ga0070683_100333987 3300005329 Bacteria 1443
26 Ga0070683_100756011 3300005329 Unclassified 931
27 Ga0070683_100786483 3300005329 Unclassified 912
28 Ga0070690_100109667 3300005330 Bacteria 1840
29 Ga0070670_100001025 3300005331 Bacteria 22087
30 Ga0070670_100042150 3300005331 Bacteria 3923
31 Ga0070670_100063363 3300005331 Bacteria 3173
32 Ga0070670_100079494 3300005331 Bacteria 2818
33 Ga0070670_100094359 3300005331 Bacteria 2573
34 Ga0070670_100101621 3300005331 Bacteria 2476
35 Ga0070677_10189805 3300005333 Bacteria 984
36 Ga0070677_10201500 3300005333 Bacteria 961
37 Ga0068869_100005737 3300005334 Bacteria 7837
38 Ga0068869_100426096 3300005334 Bacteria 1096
39 Ga0070666_10286668 3300005335 Unclassified 1171
40 Ga0070666_10330081 3300005335 Bacteria 1089
41 Ga0070666_10669090 3300005335 Bacteria 760
42 Ga0070680_100000152 3300005336 Bacteria 42779
43 Ga0070680_100019957 3300005336 Bacteria 5312
44 Ga0070680_100060577 3300005336 Bacteria 3097
45 Ga0070680_100086489 3300005336 Bacteria 2591
46 Ga0070680_100114688 3300005336 Bacteria 2245
47 Ga0070680_100367918 3300005336 Unclassified 1223
48 Ga0070680_100418248 3300005336 Bacteria 1143
49 Ga0070680_100440107 3300005336 Bacteria 1113
50 Ga0070680_100637462 3300005336 Bacteria 915
51 Ga0070682_100177369 3300005337 Bacteria 1485
52 Ga0068868_100004677 3300005338 Bacteria 9614
53 Ga0070660_100002497 3300005339 Bacteria 12624
54 Ga0070660_100005660 3300005339 Bacteria 8662
55 Ga0070660_100266266 3300005339 Bacteria 1400
56 Ga0070660_100285905 3300005339 Bacteria 1350
57 Ga0070660_100538871 3300005339 Unclassified 973
58 Ga0070689_100042472 3300005340 Bacteria 3491
59 Ga0070689_100061649 3300005340 Bacteria 2917
60 Ga0070689_100236026 3300005340 Unclassified 1505
61 Ga0070689_100268528 3300005340 Bacteria 1412
62 Ga0070691_10002555 3300005341 Bacteria 8115
63 Ga0070691_10067410 3300005341 Unclassified 1731
64 Ga0070691_10521298 3300005341 Unclassified 690
65 Ga0070687_100005938 3300005343 Bacteria 4968
66 Ga0070687_100024242 3300005343 Bacteria 2894
67 Ga0070687_100024463 3300005343 Bacteria 2884
68 Ga0070661_100000555 3300005344 Bacteria 28645
69 Ga0070661_100005738 3300005344 Bacteria 8549
70 Ga0070661_100008221 3300005344 Bacteria 7200
71 Ga0070661_100020996 3300005344 Bacteria 4662
72 Ga0070661_100128689 3300005344 Bacteria 1900
73 Ga0070661_100148062 3300005344 Bacteria 1774
74 Ga0070661_100246771 3300005344 Bacteria 1376
75 Ga0070661_100255601 3300005344 Bacteria 1353
76 Ga0070692_10014089 3300005345 Bacteria 3745
77 Ga0070692_10070664 3300005345 Bacteria 1859
78 Ga0070692_10608150 3300005345 Unclassified 724
79 Ga0070668_100000088 3300005347 Bacteria 57110
80 Ga0070668_100023628 3300005347 Bacteria 4651
81 Ga0070668_100661056 3300005347 Unclassified 919
82 Ga0070668_101143191 3300005347 Unclassified 704
83 Ga0070669_100005368 3300005353 Bacteria 9247
84 Ga0070669_100056611 3300005353 Bacteria 2875
85 Ga0070669_100120085 3300005353 Bacteria 2004
86 Ga0070675_100001976 3300005354 Bacteria 15191
87 Ga0070675_100013662 3300005354 Bacteria 6387
88 Ga0070675_100120175 3300005354 Bacteria 2232
89 Ga0070675_100150767 3300005354 Bacteria 1993
90 Ga0070675_100319735 3300005354 Bacteria 1371
91 Ga0070675_100472422 3300005354 Bacteria 1127
92 Ga0070671_100137716 3300005355 Bacteria 2058
93 Ga0070671_100300887 3300005355 Bacteria 1366
94 Ga0070671_100504097 3300005355 Unclassified 1041
95 Ga0070671_100615987 3300005355 Unclassified 938
96 Ga0070674_100003798 3300005356 Bacteria 8533
97 Ga0070674_100013303 3300005356 Bacteria 5084
98 Ga0070674_100147132 3300005356 Bacteria 1774
99 Ga0070674_100198665 3300005356 Bacteria 1547
100 Ga0070674_100510285 3300005356 Bacteria 1003
101 Ga0070673_100028459 3300005364 Bacteria 4156
102 Ga0070673_100050060 3300005364 Bacteria 3264
103 Ga0070673_100201425 3300005364 Bacteria 1714
104 Ga0070673_100216618 3300005364 Bacteria 1655
105 Ga0070673_100252801 3300005364 Bacteria 1537
106 Ga0070673_100281052 3300005364 Bacteria 1460
107 Ga0070673_100301543 3300005364 Bacteria 1410
108 Ga0070673_100450166 3300005364 Unclassified 1158
109 Ga0070688_100031906 3300005365 Bacteria 3173
110 Ga0070688_100063436 3300005365 Bacteria 2342
111 Ga0070688_100491661 3300005365 Bacteria 924
112 Ga0070659_100006879 3300005366 Bacteria 8236
113 Ga0070659_100061606 3300005366 Bacteria 2965
114 Ga0070659_100069090 3300005366 Bacteria 2804
115 Ga0070659_100179923 3300005366 Bacteria 1735
116 Ga0070659_100214597 3300005366 Unclassified 1587
117 Ga0070667_100012458 3300005367 Bacteria 7035
118 Ga0070667_100055305 3300005367 Bacteria 3352
119 Ga0070667_100066430 3300005367 Bacteria 3064
120 Ga0070667_100221626 3300005367 Bacteria 1684
121 Ga0070667_100286293 3300005367 Bacteria 1481
122 Ga0070709_10004052 3300005434 Bacteria 7902
123 Ga0070709_10023359 3300005434 Bacteria 3629
124 Ga0070714_100000878 3300005435 Bacteria 21352
125 Ga0070714_100029489 3300005435 Bacteria 4561
126 Ga0070713_100000396 3300005436 Bacteria 27994
127 Ga0070710_10254082 3300005437 Bacteria 1131
128 Ga0070701_10149335 3300005438 Bacteria 1344
129 Ga0070701_10234994 3300005438 Bacteria 1100
130 Ga0070701_10281856 3300005438 Bacteria 1015
131 Ga0070711_100052566 3300005439 Bacteria 2804
132 Ga0070711_100174789 3300005439 Bacteria 1640
133 Ga0070711_100224394 3300005439 Bacteria 1462
134 Ga0070700_100090726 3300005441 Bacteria 1993
135 Ga0070700_100136899 3300005441 Bacteria 1659
136 Ga0070700_100292263 3300005441 Bacteria 1186
137 Ga0070694_100079208 3300005444 Bacteria 2280
138 Ga0070694_100179946 3300005444 Bacteria 1563
139 Ga0070694_100267665 3300005444 Bacteria 1298
140 Ga0070663_100108781 3300005455 Bacteria 2080
141 Ga0070663_100185992 3300005455 Bacteria 1614
142 Ga0070678_100289888 3300005456 Bacteria 1387
143 Ga0070662_100004317 3300005457 Bacteria 8978
144 Ga0070662_100181640 3300005457 Bacteria 1659
145 Ga0070662_100229686 3300005457 Bacteria 1484
146 Ga0070662_100426416 3300005457 Bacteria 1098
147 Ga0070662_100639383 3300005457 Unclassified 897
148 Ga0070662_100833100 3300005457 Unclassified 785
149 Ga0070681_10000544 3300005458 Bacteria 31038
150 Ga0070681_10000828 3300005458 Bacteria 25847
151 Ga0070681_10003787 3300005458 Bacteria 14206
152 Ga0070681_10155741 3300005458 Unclassified 2210
153 Ga0070681_10221727 3300005458 Unclassified 1806
154 Ga0070681_10468086 3300005458 Bacteria 1173
155 Ga0068867_100104995 3300005459 Bacteria 2163
156 Ga0068867_100258165 3300005459 Bacteria 1420
157 Ga0068867_100261627 3300005459 Bacteria 1411
158 Ga0068867_100427333 3300005459 Bacteria 1124
159 Ga0068867_100510012 3300005459 Bacteria 1035
160 Ga0068867_100626134 3300005459 Unclassified 941
161 Ga0070685_10046604 3300005466 Bacteria 2489
162 Ga0070685_10216735 3300005466 Bacteria 1252
163 Ga0070685_10790231 3300005466 Bacteria 699
164 Ga0070706_100131012 3300005467 Bacteria 2340
165 Ga0070706_100371005 3300005467 Unclassified 1333
166 Ga0070706_101163976 3300005467 Bacteria 709
167 Ga0070707_100270212 3300005468 Bacteria 1653
168 Ga0070707_100440260 3300005468 Bacteria 1264
169 Ga0070707_101112879 3300005468 Unclassified 756
170 Ga0070698_100000109 3300005471 Bacteria 69210
171 Ga0070698_100024231 3300005471 Bacteria 6332
172 Ga0070698_100259097 3300005471 Unclassified 1671
173 Ga0070698_100662105 3300005471 Unclassified 985
174 Ga0070698_100878605 3300005471 Unclassified 842
175 Ga0070699_100020308 3300005518 Bacteria 5729
176 Ga0070699_100052769 3300005518 Bacteria 3518
177 Ga0070699_100575332 3300005518 Unclassified 1026
178 Ga0070699_100892501 3300005518 Unclassified 814
179 Ga0070679_100000443 3300005530 Bacteria 35227
180 Ga0070679_100031020 3300005530 Bacteria 5281
181 Ga0070679_100031238 3300005530 Bacteria 5260
182 Ga0070679_100085961 3300005530 Bacteria 3132
183 Ga0070679_100141190 3300005530 Bacteria 2388
184 Ga0070679_100185801 3300005530 Unclassified 2049
185 Ga0070679_100313477 3300005530 Unclassified 1518
186 Ga0070679_100565067 3300005530 Unclassified 1081
187 Ga0070679_101012165 3300005530 Unclassified 775
188 Ga0070684_100002554 3300005535 Bacteria 13445
189 Ga0070684_100003416 3300005535 Bacteria 11920
190 Ga0070684_100003432 3300005535 Bacteria 11900
191 Ga0070684_100015020 3300005535 Bacteria 6290
192 Ga0070684_100016134 3300005535 Bacteria 6102
193 Ga0070684_100018286 3300005535 Bacteria 5772
194 Ga0070684_100028725 3300005535 Bacteria 4705
195 Ga0070684_100037680 3300005535 Bacteria 4149
196 Ga0070684_100093956 3300005535 Bacteria 2670
197 Ga0070684_100114526 3300005535 Bacteria 2421
198 Ga0070684_100115653 3300005535 Bacteria 2409
199 Ga0070684_100124215 3300005535 Unclassified 2323
200 Ga0070684_100149010 3300005535 Bacteria 2119
201 Ga0070684_100175131 3300005535 Bacteria 1949
202 Ga0070684_100442800 3300005535 Bacteria 1200
203 Ga0070684_100687900 3300005535 Bacteria 953
204 Ga0068853_100035992 3300005539 Bacteria 4207
205 Ga0068853_100244149 3300005539 Bacteria 1647
206 Ga0068853_100312008 3300005539 Bacteria 1456
207 Ga0068853_100394836 3300005539 Bacteria 1294
208 Ga0068853_101182361 3300005539 Bacteria 738
209 Ga0068853_101376474 3300005539 Unclassified 682
210 Ga0070672_100018173 3300005543 Bacteria 5076
211 Ga0070672_100023853 3300005543 Bacteria 4513
212 Ga0070672_100027934 3300005543 Bacteria 4214
213 Ga0070672_100113141 3300005543 Bacteria 2215
214 Ga0070672_100133071 3300005543 Unclassified 2046
215 Ga0070672_100320472 3300005543 Bacteria 1317
216 Ga0070672_100397719 3300005543 Unclassified 1181
217 Ga0070672_100750729 3300005543 Unclassified 856
218 Ga0070686_100117084 3300005544 Bacteria 1824
219 Ga0070695_100867258 3300005545 Bacteria 727
220 Ga0070695_101068844 3300005545 Bacteria 659
221 Ga0070696_100000317 3300005546 Bacteria 29318
222 Ga0070696_100020562 3300005546 Bacteria 4472
223 Ga0070693_100079989 3300005547 Bacteria 1946
224 Ga0070665_100010586 3300005548 Bacteria 9338
225 Ga0070665_100230340 3300005548 Unclassified 1853
226 Ga0070704_100257060 3300005549 Bacteria 1437
227 Ga0070704_100801705 3300005549 Bacteria 841
228 Ga0068855_100085897 3300005563 Bacteria 3639
229 Ga0068855_100086933 3300005563 Bacteria 3614
230 Ga0068855_100455549 3300005563 Unclassified 1395
231 Ga0068855_100551007 3300005563 Bacteria 1248
232 Ga0068855_101807926 3300005563 Unclassified 621
233 Ga0070664_100002089 3300005564 Bacteria 15974
234 Ga0070664_100006546 3300005564 Bacteria 9392
235 Ga0070664_100012348 3300005564 Bacteria 6940
236 Ga0070664_100026387 3300005564 Bacteria 4819
237 Ga0070664_100030667 3300005564 Bacteria 4487
238 Ga0070664_100095861 3300005564 Bacteria 2574
239 Ga0070664_100113568 3300005564 Bacteria 2366
240 Ga0070664_100146290 3300005564 Bacteria 2084
241 Ga0070664_100160920 3300005564 Unclassified 1986
242 Ga0070664_100178590 3300005564 Bacteria 1886
243 Ga0070664_100228693 3300005564 Bacteria 1667
244 Ga0070664_100313134 3300005564 Bacteria 1421
245 Ga0070664_100349694 3300005564 Bacteria 1344
246 Ga0070664_100714266 3300005564 Unclassified 934
247 Ga0070664_100813410 3300005564 Unclassified 874
248 Ga0070664_100818941 3300005564 Unclassified 871
249 Ga0068857_100007962 3300005577 Bacteria 9148
250 Ga0068857_100009491 3300005577 Bacteria 8450
251 Ga0068857_100011118 3300005577 Bacteria 7830
252 Ga0068857_100011804 3300005577 Bacteria 7599
253 Ga0068857_100761267 3300005577 Bacteria 923
254 Ga0068854_100003700 3300005578 Bacteria 9569
255 Ga0068854_100020760 3300005578 Bacteria 4451
256 Ga0068854_100269544 3300005578 Bacteria 1366
257 Ga0068856_100114458 3300005614 Bacteria 2696
258 Ga0068856_101387449 3300005614 Bacteria 717
259 Ga0070702_100091836 3300005615 Bacteria 1843
260 Ga0070702_100290894 3300005615 Unclassified 1126
261 Ga0070702_100319699 3300005615 Bacteria 1081
262 Ga0068852_100006122 3300005616 Bacteria 8677
263 Ga0068852_100015703 3300005616 Bacteria 5883
264 Ga0068852_100134447 3300005616 Bacteria 2282
265 Ga0068852_100450576 3300005616 Bacteria 1274
266 Ga0068852_100546940 3300005616 Bacteria 1158
267 Ga0068852_100754629 3300005616 Unclassified 985
268 Ga0068859_100053778 3300005617 Bacteria 4049
269 Ga0068859_100293653 3300005617 Bacteria 1718
270 Ga0068859_100351783 3300005617 Bacteria 1568
271 Ga0068859_100656317 3300005617 Bacteria 1141
272 Ga0068859_100756530 3300005617 Bacteria 1060
273 Ga0068864_100141470 3300005618 Unclassified 2171
274 Ga0068864_100517546 3300005618 Unclassified 1150
275 Ga0068864_101048258 3300005618 Unclassified 810
276 Ga0068866_10306314 3300005718 Unclassified 994
277 Ga0068866_10393616 3300005718 Bacteria 892
278 Ga0068861_100000232 3300005719 Bacteria 30370
279 Ga0068861_100077862 3300005719 Bacteria 2588
280 Ga0068861_100156561 3300005719 Bacteria 1875
281 Ga0068851_10027152 3300005834 Bacteria 2820
282 Ga0068851_10036084 3300005834 Bacteria 2474
283 Ga0068851_10065661 3300005834 Bacteria 1868
284 Ga0068851_10095010 3300005834 Unclassified 1574
285 Ga0068851_10156066 3300005834 Bacteria 1251
286 Ga0068870_10006869 3300005840 Bacteria 5049
287 Ga0068870_10250824 3300005840 Bacteria 1097
288 Ga0068870_10419013 3300005840 Bacteria 876
289 Ga0068863_100043204 3300005841 Bacteria 4279
290 Ga0068863_100109300 3300005841 Bacteria 2632
291 Ga0068863_100460436 3300005841 Bacteria 1249
292 Ga0068858_100006089 3300005842 Bacteria 11768
293 Ga0068858_100014455 3300005842 Bacteria 7438
294 Ga0068860_100011913 3300005843 Bacteria 8570
295 Ga0068860_100221369 3300005843 Bacteria 1838
296 Ga0068860_100423138 3300005843 Unclassified 1320
297 Ga0068860_100486999 3300005843 Bacteria 1230
298 Ga0068862_100002069 3300005844 Bacteria 18108
299 Ga0068862_100263908 3300005844 Bacteria 1573
300 Ga0081539_10000103 3300005985 Bacteria 197839
301 Ga0070717_10061924 3300006028 Bacteria 3102
302 Ga0070712_100007912 3300006175 Bacteria 6666
303 Ga0070712_100474532 3300006175 Bacteria 1045
304 Ga0097621_100185964 3300006237 Bacteria 1797
305 Ga0097621_100571470 3300006237 Bacteria 1031
306 Ga0068871_100661266 3300006358 Unclassified 954
307 Ga0068871_100842550 3300006358 Unclassified 847
308 Ga0075428_100232369 3300006844 Bacteria 1990
309 Ga0075428_100232776 3300006844 Bacteria 1988
310 Ga0075428_100353655 3300006844 Bacteria 1577
311 Ga0075430_100003163 3300006846 Bacteria 13777
312 Ga0075430_100036168 3300006846 Bacteria 4187
313 Ga0075430_100181787 3300006846 Bacteria 1749
314 Ga0075430_100399391 3300006846 Unclassified 1135
315 Ga0075431_100067114 3300006847 Bacteria 3703
316 Ga0075431_100186026 3300006847 Bacteria 2130
317 Ga0075431_100207677 3300006847 Bacteria 2002
318 Ga0075431_100389263 3300006847 Unclassified 1397
319 Ga0075431_100629589 3300006847 Unclassified 1055
320 Ga0075431_100810872 3300006847 Unclassified 909
321 Ga0075433_10002721 3300006852 Bacteria 13507
322 Ga0075433_10112606 3300006852 Bacteria 2414
323 Ga0075433_10916867 3300006852 Bacteria 764
324 Ga0075434_100005668 3300006871 Bacteria 11393
325 Ga0075434_100068223 3300006871 Bacteria 3542
326 Ga0075434_100738619 3300006871 Bacteria 1001
327 Ga0075429_100027565 3300006880 Bacteria 4931
328 Ga0075429_100111764 3300006880 Bacteria 2388
329 Ga0075429_100142517 3300006880 Bacteria 2098
330 Ga0068865_100028967 3300006881 Bacteria 3669
331 Ga0068865_100060365 3300006881 Bacteria 2655
332 Ga0068865_100101244 3300006881 Bacteria 2109
333 Ga0068865_100159747 3300006881 Bacteria 1718
334 Ga0075436_100003392 3300006914 Bacteria 10911
335 Ga0075436_100012407 3300006914 Bacteria 5841
336 Ga0097620_100053777 3300006931 Bacteria 4049
337 Ga0097620_100293668 3300006931 Bacteria 1718
338 Ga0097620_100351751 3300006931 Bacteria 1568
339 Ga0097620_100656373 3300006931 Bacteria 1141
340 Ga0097620_100686397 3300006931 Unclassified 1115
341 Ga0075435_100251612 3300007076 Unclassified 1504
342 Ga0105240_10122856 3300009093 Bacteria 3124
343 Ga0105240_10156707 3300009093 Bacteria 2707
344 Ga0105240_10300375 3300009093 Bacteria 1837
345 Ga0105240_10325726 3300009093 Bacteria 1750
346 Ga0105240_10326059 3300009093 Bacteria 1749
347 Ga0105240_10478247 3300009093 Bacteria 1389
348 Ga0105240_10595926 3300009093 Bacteria 1217
349 Ga0105240_10696152 3300009093 Bacteria 1110
350 Ga0105240_10741242 3300009093 Bacteria 1069
351 Ga0111539_10021889 3300009094 Bacteria 7860
352 Ga0111539_10575171 3300009094 Bacteria 1312
353 Ga0105245_10081518 3300009098 Bacteria 2958
354 Ga0114129_10053397 3300009147 Bacteria 5667
355 Ga0114129_10162829 3300009147 Bacteria 3046
356 Ga0114129_10490559 3300009147 Bacteria 1606
357 Ga0114129_11590504 3300009147 Bacteria 800
358 Ga0105241_10000025 3300009174 Bacteria 132929
359 Ga0105241_10065551 3300009174 Bacteria 2806
360 Ga0105242_10006374 3300009176 Bacteria 9084
361 Ga0105242_10064484 3300009176 Bacteria 3020
362 Ga0105242_10256548 3300009176 Bacteria 1578
363 Ga0105242_10309902 3300009176 Bacteria 1444
364 Ga0105248_10005922 3300009177 Bacteria 13439
365 Ga0105248_10026512 3300009177 Bacteria 6447
366 Ga0105248_10091207 3300009177 Bacteria 3432
367 Ga0105248_10408004 3300009177 Bacteria 1530
368 Ga0105248_10462087 3300009177 Bacteria 1431
369 Ga0105248_11008291 3300009177 Bacteria 941
370 Ga0105248_11910839 3300009177 Unclassified 674
371 Ga0105237_10295613 3300009545 Bacteria 1622
372 Ga0105237_10726091 3300009545 Unclassified 1000
373 Ga0105237_11402295 3300009545 Unclassified 705
374 Ga0105238_10078912 3300009551 Bacteria 3282
375 Ga0105238_10449474 3300009551 Bacteria 1285
376 Ga0105238_10623356 3300009551 Bacteria 1087
377 Ga0105249_10001142 3300009553 Bacteria 23486
378 Ga0105249_10003811 3300009553 Bacteria 13018
379 Ga0105249_10200608 3300009553 Bacteria 1952
380 Ga0105239_10071801 3300010375 Bacteria 3803
381 Ga0105246_10020625 3300011119 Bacteria 4229
382 Ga0157373_10004494 3300013100 Bacteria 10499
383 Ga0157373_10062153 3300013100 Bacteria 2645
384 Ga0157373_10071049 3300013100 Bacteria 2459
385 Ga0157373_10076242 3300013100 Bacteria 2366
386 Ga0157373_10237349 3300013100 Bacteria 1288
387 Ga0157373_10318082 3300013100 Unclassified 1107
388 Ga0157373_10428382 3300013100 Bacteria 950
389 Ga0157371_10092788 3300013102 Bacteria 2139
390 Ga0157370_10001327 3300013104 Bacteria 30737
391 Ga0157370_10016352 3300013104 Bacteria 7513
392 Ga0157370_10017249 3300013104 Bacteria 7288
393 Ga0157370_10033024 3300013104 Bacteria 5047
394 Ga0157370_10036262 3300013104 Bacteria 4787
395 Ga0157370_10108006 3300013104 Bacteria 2603
396 Ga0157370_11232632 3300013104 Unclassified 675
397 Ga0157369_10006892 3300013105 Bacteria 13111
398 Ga0157369_10012342 3300013105 Bacteria 9700
399 Ga0157369_10034493 3300013105 Bacteria 5553
400 Ga0157369_10131562 3300013105 Bacteria 2651
401 Ga0157369_10179856 3300013105 Unclassified 2225
402 Ga0157369_10215251 3300013105 Bacteria 2012
403 Ga0157369_10401408 3300013105 Bacteria 1422
404 Ga0157369_10639492 3300013105 Bacteria 1097
405 Ga0157369_10724305 3300013105 Bacteria 1024
406 Ga0157374_10080629 3300013296 Bacteria 3087
407 Ga0157374_10145408 3300013296 Bacteria 2303
408 Ga0157378_10023659 3300013297 Bacteria 5403
409 Ga0157378_10144507 3300013297 Bacteria 2212
410 Ga0163162_10002411 3300013306 Bacteria 17589
411 Ga0163162_10049498 3300013306 Bacteria 4212
412 Ga0163162_10728175 3300013306 Bacteria 1112
413 Ga0157372_10004177 3300013307 Bacteria 15463
414 Ga0157372_10011138 3300013307 Bacteria 9565
415 Ga0157372_10016305 3300013307 Bacteria 7973
416 Ga0157372_10017385 3300013307 Bacteria 7718
417 Ga0157372_10031961 3300013307 Bacteria 5767
418 Ga0157372_10070153 3300013307 Bacteria 3942
419 Ga0157372_10130835 3300013307 Unclassified 2887
420 Ga0157372_10131366 3300013307 Bacteria 2881
421 Ga0157372_10187968 3300013307 Bacteria 2392
422 Ga0157372_10277202 3300013307 Unclassified 1949
423 Ga0157372_10485662 3300013307 Bacteria 1440
424 Ga0157372_10679064 3300013307 Bacteria 1199
425 Ga0157372_10939195 3300013307 Bacteria 1003
426 Ga0157375_10014333 3300013308 Bacteria 7068
427 Ga0157375_10047582 3300013308 Unclassified 4190
428 Ga0157375_10050500 3300013308 Bacteria 4080
429 Ga0157375_10054022 3300013308 Bacteria 3955
430 Ga0157375_10154573 3300013308 Bacteria 2432
431 Ga0157375_10284274 3300013308 Bacteria 1817
432 Ga0157375_10687563 3300013308 Bacteria 1177
433 Ga0157375_10909730 3300013308 Bacteria 1023
434 Ga0163163_10711212 3300014325 Bacteria 1068
435 Ga0157380_10003163 3300014326 Bacteria 11239
436 Ga0157380_10009480 3300014326 Bacteria 6977
437 Ga0157380_10188091 3300014326 Bacteria 1820
438 Ga0157377_10032846 3300014745 Bacteria 2829
439 Ga0157379_10005920 3300014968 Bacteria 10529
440 Ga0157376_10401869 3300014969 Unclassified 1325
441 Ga0157376_10745544 3300014969 Bacteria 988
442 Ga0182007_10067998 3300015262 Bacteria 1167
443 Ga0163161_10015002 3300017792 Bacteria 5398
444 Ga0163161_10233770 3300017792 Bacteria 1427
445 Ga0163161_10585124 3300017792 Unclassified 918
446 Ga0163161_10700688 3300017792 Bacteria 843
447 Ga0197907_10017702 3300020069 Bacteria 1419
448 Ga0206356_10075689 3300020070 Unclassified 972
449 Ga0213876_10060865 3300021384 Bacteria 1992
450 Ga0207697_10001978 3300025315 Bacteria 10862
451 Ga0207656_10122791 3300025321 Unclassified 1210
452 Ga0207682_10020365 3300025893 Bacteria 2605
453 Ga0207688_10031617 3300025901 Bacteria 2923
454 Ga0207688_10088681 3300025901 Bacteria 1774
455 Ga0207680_10391626 3300025903 Bacteria 981
456 Ga0207680_10410984 3300025903 Unclassified 957
457 Ga0207680_10473013 3300025903 Unclassified 891
458 Ga0207647_10335718 3300025904 Unclassified 857
459 Ga0207699_10376722 3300025906 Unclassified 1006
460 Ga0207645_10000513 3300025907 Bacteria 32149
461 Ga0207645_10015255 3300025907 Bacteria 5113
462 Ga0207645_10301681 3300025907 Bacteria 1066
463 Ga0207645_10317683 3300025907 Bacteria 1039
464 Ga0207645_10326291 3300025907 Unclassified 1024
465 Ga0207643_10006700 3300025908 Bacteria 6177
466 Ga0207643_10012415 3300025908 Bacteria 4605
467 Ga0207643_10142204 3300025908 Bacteria 1434
468 Ga0207705_10018465 3300025909 Bacteria 4987
469 Ga0207705_10043958 3300025909 Bacteria 3209
470 Ga0207705_10097736 3300025909 Bacteria 2157
471 Ga0207705_10098040 3300025909 Unclassified 2153
472 Ga0207705_10298338 3300025909 Bacteria 1236
473 Ga0207684_10212180 3300025910 Bacteria 1670
474 Ga0207684_10298461 3300025910 Bacteria 1389
475 Ga0207684_11138348 3300025910 Bacteria 648
476 Ga0207654_10001593 3300025911 Bacteria 11917
477 Ga0207654_10326658 3300025911 Bacteria 1050
478 Ga0207654_10628349 3300025911 Bacteria 768
479 Ga0207707_10000485 3300025912 Bacteria 41294
480 Ga0207707_10001404 3300025912 Bacteria 22300
481 Ga0207707_10003323 3300025912 Bacteria 14288
482 Ga0207707_10013100 3300025912 Bacteria 7224
483 Ga0207707_10158537 3300025912 Bacteria 1979
484 Ga0207707_10206286 3300025912 Bacteria 1713
485 Ga0207707_10342644 3300025912 Bacteria 1289
486 Ga0207695_10000824 3300025913 Bacteria 57448
487 Ga0207695_10002609 3300025913 Bacteria 26412
488 Ga0207695_10078082 3300025913 Bacteria 3360
489 Ga0207695_10096980 3300025913 Bacteria 2950
490 Ga0207695_10292987 3300025913 Bacteria 1519
491 Ga0207695_10402644 3300025913 Bacteria 1253
492 Ga0207671_10075826 3300025914 Bacteria 2516
493 Ga0207693_10013148 3300025915 Bacteria 6677
494 Ga0207663_10294971 3300025916 Bacteria 1209
495 Ga0207663_10523055 3300025916 Unclassified 924
496 Ga0207660_10000035 3300025917 Bacteria 65610
497 Ga0207660_10015223 3300025917 Bacteria 5074
498 Ga0207660_10019058 3300025917 Bacteria 4583
499 Ga0207660_10028034 3300025917 Bacteria 3849
500 Ga0207660_10121705 3300025917 Bacteria 1977
501 Ga0207660_10136788 3300025917 Bacteria 1870
502 Ga0207660_10182956 3300025917 Bacteria 1628
503 Ga0207660_10634949 3300025917 Unclassified 870
504 Ga0207660_10732738 3300025917 Bacteria 807
505 Ga0207662_10010778 3300025918 Bacteria 5052
506 Ga0207662_10383935 3300025918 Bacteria 949
507 Ga0207657_10008543 3300025919 Bacteria 10382
508 Ga0207657_10015548 3300025919 Bacteria 7369
509 Ga0207657_10331438 3300025919 Unclassified 1202
510 Ga0207649_10000422 3300025920 Bacteria 31054
511 Ga0207649_10008691 3300025920 Bacteria 5546
512 Ga0207649_10029805 3300025920 Bacteria 3226
513 Ga0207649_10065484 3300025920 Bacteria 2300
514 Ga0207649_10119389 3300025920 Unclassified 1775
515 Ga0207649_10335065 3300025920 Unclassified 1116
516 Ga0207649_10493410 3300025920 Unclassified 930
517 Ga0207652_10000609 3300025921 Bacteria 35652
518 Ga0207652_10001738 3300025921 Bacteria 19002
519 Ga0207652_10011989 3300025921 Bacteria 6995
520 Ga0207652_10056870 3300025921 Bacteria 3368
521 Ga0207652_10219553 3300025921 Bacteria 1713
522 Ga0207652_10413134 3300025921 Bacteria 1217
523 Ga0207652_10507352 3300025921 Bacteria 1086
524 Ga0207652_10759205 3300025921 Unclassified 863
525 Ga0207646_10425228 3300025922 Bacteria 1199
526 Ga0207646_11004086 3300025922 Unclassified 737
527 Ga0207646_11026607 3300025922 Unclassified 728
528 Ga0207646_11385717 3300025922 Unclassified 612
529 Ga0207681_10000537 3300025923 Bacteria 26181
530 Ga0207681_10034707 3300025923 Bacteria 3318
531 Ga0207694_10085578 3300025924 Bacteria 2482
532 Ga0207694_10207866 3300025924 Unclassified 1594
533 Ga0207650_10052293 3300025925 Bacteria 3026
534 Ga0207650_10120792 3300025925 Bacteria 2040
535 Ga0207650_10173696 3300025925 Unclassified 1714
536 Ga0207650_10242695 3300025925 Bacteria 1456
537 Ga0207650_10269554 3300025925 Bacteria 1383
538 Ga0207659_10061473 3300025926 Bacteria 2707
539 Ga0207659_10205568 3300025926 Bacteria 1575
540 Ga0207659_10206720 3300025926 Bacteria 1571
541 Ga0207659_10224618 3300025926 Bacteria 1512
542 Ga0207659_10367019 3300025926 Unclassified 1198
543 Ga0207659_10483512 3300025926 Bacteria 1046
544 Ga0207687_10135811 3300025927 Bacteria 1860
545 Ga0207687_10242373 3300025927 Bacteria 1429
546 Ga0207700_10001929 3300025928 Bacteria 11798
547 Ga0207700_10054647 3300025928 Bacteria 2999
548 Ga0207700_10824962 3300025928 Unclassified 830
549 Ga0207664_10158358 3300025929 Bacteria 1929
550 Ga0207664_10185845 3300025929 Unclassified 1787
551 Ga0207644_10026962 3300025931 Bacteria 3967
552 Ga0207644_10165031 3300025931 Bacteria 1725
553 Ga0207644_10290500 3300025931 Unclassified 1315
554 Ga0207690_10052603 3300025932 Bacteria 2728
555 Ga0207690_10056511 3300025932 Bacteria 2648
556 Ga0207690_10143089 3300025932 Bacteria 1765
557 Ga0207690_10361475 3300025932 Unclassified 1150
558 Ga0207690_11128459 3300025932 Unclassified 654
559 Ga0207706_10000055 3300025933 Bacteria 114144
560 Ga0207706_10176978 3300025933 Bacteria 1874
561 Ga0207706_10187413 3300025933 Bacteria 1816
562 Ga0207706_10214189 3300025933 Bacteria 1688
563 Ga0207706_10309150 3300025933 Bacteria 1377
564 Ga0207706_10329635 3300025933 Bacteria 1328
565 Ga0207686_10205727 3300025934 Unclassified 1412
566 Ga0207686_10208992 3300025934 Bacteria 1402
567 Ga0207670_10061060 3300025936 Bacteria 2570
568 Ga0207670_10085890 3300025936 Bacteria 2212
569 Ga0207670_10761482 3300025936 Bacteria 805
570 Ga0207669_10094447 3300025937 Bacteria 1957
571 Ga0207669_10160862 3300025937 Bacteria 1586
572 Ga0207669_10637938 3300025937 Bacteria 870
573 Ga0207704_10028767 3300025938 Bacteria 3089
574 Ga0207704_10151223 3300025938 Bacteria 1638
575 Ga0207704_10731198 3300025938 Unclassified 822
576 Ga0207691_10000129 3300025940 Bacteria 69176
577 Ga0207691_10004042 3300025940 Bacteria 14222
578 Ga0207691_10005297 3300025940 Bacteria 12447
579 Ga0207691_10023370 3300025940 Bacteria 5819
580 Ga0207691_10033533 3300025940 Bacteria 4780
581 Ga0207691_10081921 3300025940 Bacteria 2900
582 Ga0207691_10456618 3300025940 Unclassified 1087
583 Ga0207711_10127374 3300025941 Bacteria 2279
584 Ga0207711_10193642 3300025941 Bacteria 1853
585 Ga0207711_10573930 3300025941 Bacteria 1052
586 Ga0207711_10585926 3300025941 Unclassified 1040
587 Ga0207711_11167907 3300025941 Bacteria 711
588 Ga0207689_10008227 3300025942 Bacteria 9088
589 Ga0207689_10033942 3300025942 Bacteria 4238
590 Ga0207661_10007864 3300025944 Bacteria 7599
591 Ga0207661_10025413 3300025944 Bacteria 4501
592 Ga0207661_10031708 3300025944 Bacteria 4087
593 Ga0207661_10056884 3300025944 Bacteria 3142
594 Ga0207661_10085873 3300025944 Bacteria 2610
595 Ga0207661_10104508 3300025944 Bacteria 2385
596 Ga0207661_10182870 3300025944 Bacteria 1832
597 Ga0207661_10280349 3300025944 Bacteria 1489
598 Ga0207661_10391958 3300025944 Bacteria 1258
599 Ga0207661_10433192 3300025944 Bacteria 1196
600 Ga0207661_10599445 3300025944 Unclassified 1011
601 Ga0207661_10633717 3300025944 Bacteria 982
602 Ga0207679_10000382 3300025945 Bacteria 31883
603 Ga0207679_10002242 3300025945 Bacteria 11947
604 Ga0207679_10010118 3300025945 Bacteria 6064
605 Ga0207679_10037653 3300025945 Bacteria 3440
606 Ga0207679_10054688 3300025945 Bacteria 2940
607 Ga0207679_10061160 3300025945 Bacteria 2802
608 Ga0207679_10063534 3300025945 Bacteria 2756
609 Ga0207679_10117447 3300025945 Bacteria 2111
610 Ga0207679_10161392 3300025945 Bacteria 1835
611 Ga0207679_10327404 3300025945 Bacteria 1328
612 Ga0207679_10440743 3300025945 Bacteria 1153
613 Ga0207679_10780092 3300025945 Unclassified 870
614 Ga0207679_11293320 3300025945 Unclassified 669
615 Ga0207667_10033264 3300025949 Bacteria 5545
616 Ga0207667_10362706 3300025949 Bacteria 1477
617 Ga0207667_10379776 3300025949 Bacteria 1440
618 Ga0207667_10530769 3300025949 Unclassified 1192
619 Ga0207667_11087044 3300025949 Bacteria 783
620 Ga0207651_10029820 3300025960 Bacteria 3463
621 Ga0207651_10083254 3300025960 Bacteria 2313
622 Ga0207651_10092895 3300025960 Bacteria 2214
623 Ga0207651_10605585 3300025960 Unclassified 958
624 Ga0207712_10000920 3300025961 Bacteria 21293
625 Ga0207668_10011829 3300025972 Bacteria 5319
626 Ga0207668_10839735 3300025972 Unclassified 815
627 Ga0207668_10856515 3300025972 Unclassified 807
628 Ga0207640_10000266 3300025981 Bacteria 35167
629 Ga0207640_10215636 3300025981 Bacteria 1466
630 Ga0207640_10498686 3300025981 Bacteria 1013
631 Ga0207658_10249916 3300025986 Bacteria 1506
632 Ga0207658_10280463 3300025986 Bacteria 1428
633 Ga0207658_10294460 3300025986 Bacteria 1396
634 Ga0207658_10325495 3300025986 Bacteria 1332
635 Ga0207658_10421742 3300025986 Bacteria 1177
636 Ga0207658_10517945 3300025986 Bacteria 1064
637 Ga0207677_10097680 3300026023 Unclassified 2152
638 Ga0207677_10531505 3300026023 Bacteria 1022
639 Ga0207703_10080821 3300026035 Bacteria 2708
640 Ga0207703_10416516 3300026035 Bacteria 1249
641 Ga0207639_10207564 3300026041 Unclassified 1684
642 Ga0207639_10254522 3300026041 Unclassified 1533
643 Ga0207678_10247694 3300026067 Bacteria 1526
644 Ga0207708_10279451 3300026075 Bacteria 1353
645 Ga0207708_10348208 3300026075 Bacteria 1215
646 Ga0207702_10266759 3300026078 Bacteria 1614
647 Ga0207641_10240170 3300026088 Bacteria 1688
648 Ga0207641_10246014 3300026088 Bacteria 1668
649 Ga0207641_11337683 3300026088 Bacteria 717
650 Ga0207648_10010162 3300026089 Bacteria 8949
651 Ga0207648_10031606 3300026089 Bacteria 4681
652 Ga0207648_10095562 3300026089 Bacteria 2600
653 Ga0207648_10126987 3300026089 Bacteria 2244
654 Ga0207648_10440659 3300026089 Bacteria 1185
655 Ga0207648_11077389 3300026089 Unclassified 753
656 Ga0207676_10904212 3300026095 Unclassified 866
657 Ga0207676_10975147 3300026095 Unclassified 834
658 Ga0207674_10001035 3300026116 Bacteria 36267
659 Ga0207674_10002037 3300026116 Bacteria 25651
660 Ga0207674_10021081 3300026116 Bacteria 7027
661 Ga0207674_10026295 3300026116 Bacteria 6186
662 Ga0207675_100000073 3300026118 Bacteria 76959
663 Ga0207675_100084506 3300026118 Bacteria 2978
664 Ga0207675_100149855 3300026118 Bacteria 2219
665 Ga0207675_100910017 3300026118 Bacteria 896
666 Ga0207683_10123300 3300026121 Bacteria 2328
667 Ga0207683_10206373 3300026121 Bacteria 1787
668 Ga0207683_10471441 3300026121 Unclassified 1158
669 Ga0207698_10015286 3300026142 Bacteria 5135
670 Ga0207698_10108989 3300026142 Bacteria 2316
671 Ga0207698_10264879 3300026142 Bacteria 1581
672 Ga0207698_10719741 3300026142 Unclassified 995
673 Ga0207698_11204786 3300026142 Bacteria 771
674 Ga0207698_11435825 3300026142 Unclassified 705
675 Ga0209968_1003366 3300027526 Unclassified 2400
676 Ga0209999_1027386 3300027543 Unclassified 1055
677 Ga0209966_1010289 3300027695 Bacteria 1684
678 Ga0207428_10026683 3300027907 Bacteria 4817
679 Ga0207428_10842685 3300027907 Bacteria 650
680 Ga0268266_10115231 3300028379 Bacteria 2386
681 Ga0268266_10316838 3300028379 Bacteria 1459
682 Ga0268265_11492597 3300028380 Bacteria 679
683 Ga0268264_10031762 3300028381 Bacteria 4330
684 Ga0268264_11038521 3300028381 Unclassified 827
685 Ga0307405_10016213 3300031731 Bacteria 4057
686 Ga0307405_10016433 3300031731 Bacteria 4036
687 Ga0307405_10276914 3300031731 Unclassified 1261
688 Ga0307405_11082836 3300031731 Unclassified 688
689 Ga0307413_10004571 3300031824 Bacteria 6044
690 Ga0307413_10027025 3300031824 Bacteria 3173
691 Ga0307410_10116698 3300031852 Bacteria 1940
692 Ga0307410_10341241 3300031852 Unclassified 1194
693 Ga0307410_10347624 3300031852 Bacteria 1184
694 Ga0307410_10448733 3300031852 Unclassified 1052
695 Ga0307410_10775603 3300031852 Bacteria 813
696 Ga0307406_10087678 3300031901 Bacteria 2086
697 Ga0307406_10218708 3300031901 Bacteria 1414
698 Ga0307407_10011271 3300031903 Bacteria 4249
699 Ga0307407_10041647 3300031903 Bacteria 2570
700 Ga0307407_10247529 3300031903 Bacteria 1219
701 Ga0307412_10009112 3300031911 Bacteria 5688
702 Ga0307412_10124442 3300031911 Bacteria 1862
703 Ga0307412_10296314 3300031911 Unclassified 1276
704 Ga0307412_10388201 3300031911 Bacteria 1133
705 Ga0307409_100396701 3300031995 Unclassified 1316
706 Ga0307409_101314932 3300031995 Bacteria 748
707 Ga0307409_101325569 3300031995 Bacteria 745
708 Ga0307416_100069846 3300032002 Bacteria 2909
709 Ga0307416_100141905 3300032002 Bacteria 2185
710 Ga0307416_100490430 3300032002 Unclassified 1291
711 Ga0307416_100536132 3300032002 Bacteria 1241
712 Ga0307416_101020081 3300032002 Bacteria 931
713 Ga0307416_101026209 3300032002 Unclassified 928
714 Ga0307416_101089053 3300032002 Unclassified 903
715 Ga0307414_10007789 3300032004 Bacteria 6039
716 Ga0307414_10233273 3300032004 Bacteria 1519
717 Ga0307414_10754349 3300032004 Bacteria 885
718 Ga0307414_11134694 3300032004 Bacteria 723
719 Ga0307414_11236575 3300032004 Bacteria 692
720 Ga0307411_10001331 3300032005 Bacteria 9959
721 Ga0307411_10131190 3300032005 Bacteria 1832
722 Ga0307415_100078935 3300032126 Bacteria 2343
723 Ga0307415_100116145 3300032126 Unclassified 1996
724 Ga0307415_100248470 3300032126 Bacteria 1444
725 Ga0307415_100347533 3300032126 Bacteria 1247
726 Ga0307415_100446994 3300032126 Bacteria 1116
727 Ga0307415_100664362 3300032126 Unclassified 936
728 Ga0373934_0000319 3300035086 Bacteria 16910
729 Ga0373923_0079046 3300035111 Bacteria 1424
730 Ga0373945_0009272 3300035116 Unclassified 3223
731 Ga0373953_0010653 3300035117 Bacteria 3207
732 Ga0373953_0271481 3300035117 Unclassified 738
733 Ga0373954_0024387 3300035118 Bacteria 2758
734 Ga0373956_0007873 3300035119 Bacteria 4300
735 Ga0373956_0059152 3300035119 Bacteria 1733
736 Ga0373957_0110738 3300035120 Bacteria 1105
737 Ga0373943_0000549 3300035170 Bacteria 16230
738 Ga0373943_0746206 3300035170 Unclassified 581
739 Ga0373946_0140153 3300035171 Bacteria 1120
740 Ga0373946_0241080 3300035171 Bacteria 879
741 Ga0373955_0010711 3300035172 Bacteria 4341
742 Ga0373955_0570437 3300035172 Unclassified 692
743 Ga0373931_0147047 3300035691 Unclassified 1371
744 Ga0373935_0025192 3300035692 Unclassified 3666
745 Ga0373935_0140190 3300035692 Unclassified 1633
746 Ga0373935_0233897 3300035692 Bacteria 1281
747 Ga0373935_0675002 3300035692 Bacteria 759
748 Ga0373927_0015005 3300035695 Bacteria 5125
749 Ga0373927_0028039 3300035695 Bacteria 3674
750 Ga0373927_0101015 3300035695 Bacteria 1876
751 Ga0373933_0030909 3300035724 Bacteria 3103
752 Ga0373933_0033766 3300035724 Bacteria 2978
753 Ga0373947_0000580 3300035725 Bacteria 21452
754 Ga0373947_0065217 3300035725 Bacteria 2221
755 Ga0373937_0001736 3300036401 Bacteria 18330
756 Ga0373937_0139331 3300036401 Bacteria 2269
757 Ga0373937_0164017 3300036401 Bacteria 2083
758 Ga0373937_0270639 3300036401 Bacteria 1603
759 Ga0373925_0001431 3300037068 Bacteria 20677
760 Ga0373925_0032169 3300037068 Bacteria 3859
761 Ga0373925_0404870 3300037068 Unclassified 1113
762 Ga0436365_0475701 3300039437 Bacteria 3673
763 Ga0436365_0875476 3300039437 Bacteria 3780
764 Ga0436365_0982966 3300039437 Bacteria 2362
765 Ga0439448_0067275 3300042005 Unclassified 1190
766 Ga0439455_0067273 3300042012 Bacteria 958
767 Ga0439464_0083104 3300042439 Unclassified 958
768 Ga0451577_0000016 3300042876 Bacteria 531002
769 Ga0451577_0007492 3300042876 Bacteria 10716
770 Ga0451577_0021164 3300042876 Bacteria 5954
771 Ga0451577_0039290 3300042876 Bacteria 4252
772 Ga0451577_0156063 3300042876 Bacteria 2054
773 Ga0451577_0222580 3300042876 Bacteria 1706
774 Ga0466963_0118097 3300044694 Bacteria 1824
775 Ga0466963_0252359 3300044694 Unclassified 1238
776 Ga0453684_0000368 3300044712 Bacteria 185018
777 Ga0453684_0041760 3300044712 Bacteria 6194
778 Ga0453684_0051193 3300044712 Bacteria 5418
779 Ga0466959_0041971 3300045049 Bacteria 3376
780 Ga0451576_0235254 3300045051 Bacteria 1913
781 Ga0451576_0311411 3300045051 Bacteria 1647
782 Ga0451576_0629666 3300045051 Bacteria 1127
783 Ga0466958_0133777 3300045836 Bacteria 1558
784 Ga0466958_0317227 3300045836 Bacteria 1001
785 Ga0466967_0051897 3300045976 Bacteria 3597
786 Ga0466967_0054913 3300045976 Bacteria 3508
787 Ga0466967_0323715 3300045976 Bacteria 1487
788 Ga0466967_0947813 3300045976 Bacteria 856
789 Ga0495592_0016371 3300046454 Bacteria 5626
790 Ga0495592_0186271 3300046454 Bacteria 1410
791 Ga0495592_0220460 3300046454 Unclassified 1269
792 Ga0495629_0038669 3300046459 Bacteria 3360
793 Ga0495629_0053126 3300046459 Bacteria 2835
794 Ga0495651_0004559 3300046462 Bacteria 10591
795 Ga0495651_0039377 3300046462 Bacteria 3680
796 Ga0495651_0279390 3300046462 Unclassified 1129
797 Ga0495651_0363840 3300046462 Bacteria 952
798 Ga0495653_0086461 3300046463 Unclassified 2304
799 Ga0495653_0091967 3300046463 Bacteria 2216
800 Ga0495580_0003447 3300046472 Bacteria 13470
801 Ga0495580_0010878 3300046472 Bacteria 7062
802 Ga0495580_0030804 3300046472 Bacteria 3881
803 Ga0495582_0008502 3300046473 Bacteria 5662
804 Ga0495582_0067504 3300046473 Bacteria 1976
805 Ga0495582_0088330 3300046473 Bacteria 1727
806 Ga0495582_0404675 3300046473 Bacteria 787
807 Ga0495639_0001681 3300046475 Bacteria 9825
808 Ga0495639_0070550 3300046475 Bacteria 1613
809 Ga0495662_0007455 3300046476 Bacteria 5410
810 Ga0495594_0002309 3300046499 Bacteria 9931
811 Ga0495594_0005001 3300046499 Bacteria 6822
812 Ga0495594_0008462 3300046499 Bacteria 5302
813 Ga0495594_0085085 3300046499 Bacteria 1769
814 Ga0495594_0438186 3300046499 Bacteria 743
815 Ga0495596_0090328 3300046500 Archaea 1189
816 Ga0495596_0199361 3300046500 Bacteria 778
817 Ga0495608_0044993 3300046511 Bacteria 2944
818 Ga0495608_0052115 3300046511 Bacteria 2709
819 Ga0495618_0055155 3300046514 Unclassified 2516
820 Ga0495628_0006895 3300046516 Bacteria 9872
821 Ga0495628_0040706 3300046516 Bacteria 3712
822 Ga0495628_0139680 3300046516 Bacteria 1849
823 Ga0495630_0031856 3300046517 Bacteria 3927
824 Ga0495630_0040136 3300046517 Bacteria 3497
825 Ga0495630_0180271 3300046517 Unclassified 1610
826 Ga0495630_0502557 3300046517 Bacteria 930
827 Ga0495663_0072249 3300046525 Unclassified 1100
828 Ga0495663_0105894 3300046525 Bacteria 930
829 Ga0495663_0311400 3300046525 Unclassified 568
830 Ga0495652_0000859 3300046529 Bacteria 35014
831 Ga0495652_0032221 3300046529 Bacteria 4585
832 Ga0495652_0202719 3300046529 Bacteria 1504
833 Ga0495665_0000677 3300046531 Bacteria 17457
834 Ga0495665_0020133 3300046531 Bacteria 3585
835 Ga0495665_0069766 3300046531 Bacteria 1852
836 Ga0495640_0079411 3300046533 Bacteria 2184
837 Ga0495586_0039853 3300046535 Bacteria 2526
838 Ga0495586_0309322 3300046535 Unclassified 906
839 Ga0495586_0776136 3300046535 Bacteria 553
840 Ga0495587_0000360 3300046536 Bacteria 32695
841 Ga0495587_0004216 3300046536 Bacteria 9515
842 Ga0495587_0138258 3300046536 Bacteria 1391
843 Ga0495587_0436228 3300046536 Unclassified 726
844 Ga0495645_0000989 3300046543 Bacteria 19374
845 Ga0495645_0001984 3300046543 Bacteria 13903
846 Ga0495667_0015602 3300046559 Bacteria 5135
847 Ga0495667_0042983 3300046559 Bacteria 2995
848 Ga0495667_0584655 3300046559 Unclassified 696
849 Ga0495634_0314856 3300046642 Unclassified 943
850 Ga0495634_0599752 3300046642 Unclassified 639
851 Ga0495635_0040433 3300046663 Bacteria 3222
852 Ga0495635_0114467 3300046663 Bacteria 1841
853 Ga0495635_0399471 3300046663 Bacteria 913
854 Ga0495635_0582214 3300046663 Unclassified 732
855 Ga0495588_0000514 3300046674 Bacteria 18704
856 Ga0495588_0065723 3300046674 Bacteria 1882
857 Ga0495657_0097839 3300046675 Bacteria 1873
858 Ga0495657_0099581 3300046675 Bacteria 1853
859 Ga0495657_0260330 3300046675 Bacteria 1042
860 Ga0495599_0000395 3300046678 Bacteria 24958
861 Ga0495599_0002829 3300046678 Bacteria 10108
862 Ga0495599_0082817 3300046678 Bacteria 2004
863 Ga0495623_0086385 3300046679 Bacteria 1934
864 Ga0495623_0298155 3300046679 Unclassified 891
865 Ga0495646_0071561 3300046680 Bacteria 2040
866 Ga0495658_0001102 3300046683 Bacteria 14276
867 Ga0495658_0347535 3300046683 Unclassified 942
868 Ga0495669_0216707 3300046684 Bacteria 917
869 Ga0495613_0016681 3300046689 Bacteria 5468
870 Ga0495613_0168730 3300046689 Bacteria 1554
871 Ga0495624_0031704 3300046690 Bacteria 3433
872 Ga0495600_0030985 3300046809 Bacteria 3464
873 Ga0495600_0068387 3300046809 Bacteria 2321
874 Ga0495600_0194278 3300046809 Unclassified 1304
875 Ga0495600_0388838 3300046809 Unclassified 869
876 Ga0495581_0000585 3300047315 Bacteria 19041
877 Ga0495581_0062904 3300047315 Bacteria 2144
878 Ga0495581_0183552 3300047315 Bacteria 1224
879 Ga0495604_0350272 3300047317 Bacteria 981
880 Ga0495636_0063592 3300047318 Bacteria 1564
881 Ga0495674_0007720 3300047319 Bacteria 10274
882 Ga0495674_0154171 3300047319 Bacteria 1925
883 Ga0495674_0414300 3300047319 Bacteria 1086
884 Ga0495672_0004134 3300047320 Bacteria 12063
885 Ga0495680_0021757 3300047322 Bacteria 5361
886 Ga0495680_0375513 3300047322 Bacteria 986
887 Ga0495675_0035608 3300047444 Bacteria 3178
888 Ga0495675_0057125 3300047444 Unclassified 2474
889 Ga0495675_0080425 3300047444 Bacteria 2052
890 Ga0495675_0159323 3300047444 Bacteria 1390
891 Ga0495684_0064847 3300047471 Bacteria 2776
892 Ga0495684_0107907 3300047471 Bacteria 2103
893 Ga0495684_0180162 3300047471 Unclassified 1566
894 Ga0495684_0229930 3300047471 Bacteria 1356
895 Ga0495593_0030869 3300047673 Bacteria 2930
896 Ga0495593_0094833 3300047673 Unclassified 1535
897 Ga0495602_0189836 3300048088 Bacteria 1576
898 Ga0495602_0250120 3300048088 Bacteria 1321
899 Ga0495602_0645249 3300048088 Bacteria 723
900 Ga0496100_0159071 3300048903 Bacteria 1618
901 Ga0496101_0141520 3300048904 Bacteria 1834
902 Ga0496104_0032397 3300048907 Bacteria 4864
903 Ga0496104_0744650 3300048907 Bacteria 887
904 Ga0496105_0571089 3300048908 Bacteria 881
905 Ga0496108_0216403 3300048911 Unclassified 1664
906 Ga0496109_1277863 3300048912 Unclassified 670
907 Ga0496109_1367846 3300048912 Unclassified 644
908 Ga0496110_0319101 3300048913 Bacteria 1415
909 Ga0496111_0263127 3300048914 Bacteria 1280
910 Ga0496112_0395956 3300048915 Bacteria 1321
911 Ga0496112_0556589 3300048915 Bacteria 1080
912 Ga0496112_0781648 3300048915 Unclassified 880
913 Ga0496113_0022996 3300048916 Bacteria 4417
914 Ga0496114_0035290 3300048917 Bacteria 4129
915 Ga0496115_0002487 3300048918 Bacteria 13251
916 Ga0501031_0070260 3300049568 Bacteria 2281
917 Ga0501032_0164341 3300049569 Unclassified 1457
918 Ga0501032_0229141 3300049569 Bacteria 1208
919 Ga0501033_0006099 3300049570 Bacteria 9454
920 Ga0501033_0312624 3300049570 Bacteria 1104
921 Ga0501034_0026781 3300049571 Bacteria 5866
922 Ga0501034_0162813 3300049571 Bacteria 2201
923 Ga0501034_0508303 3300049571 Unclassified 1118
924 Ga0501036_0089981 3300049572 Bacteria 2593
925 Ga0501038_0093932 3300049574 Bacteria 2508
926 Ga0501038_0184294 3300049574 Bacteria 1683
927 Ga0501042_0074899 3300049578 Bacteria 2422
928 Ga0501042_0197577 3300049578 Bacteria 1450
929 Ga0501043_0007990 3300049579 Bacteria 8354
930 Ga0501046_0180761 3300049580 Bacteria 1577
931 Ga0501046_0664008 3300049580 Bacteria 736
932 Ga0501047_0016410 3300049581 Bacteria 7069
933 Ga0501047_0215059 3300049581 Bacteria 1779
934 Ga0501048_0052402 3300049582 Bacteria 2904
935 Ga0501048_0562265 3300049582 Bacteria 818
936 Ga0501067_0086560 3300049583 Bacteria 1739
937 Ga0501067_0410636 3300049583 Bacteria 755
938 Ga0501070_0012137 3300049586 Bacteria 7270
939 Ga0501070_0062638 3300049586 Bacteria 3081
940 Ga0501070_0545910 3300049586 Unclassified 928
941 Ga0501070_0793034 3300049586 Bacteria 744
942 Ga0501071_0346470 3300049587 Bacteria 1130
943 Ga0501072_0144679 3300049588 Bacteria 1896
944 Ga0501072_0207887 3300049588 Bacteria 1560
945 Ga0501072_0392506 3300049588 Bacteria 1101
946 Ga0501073_0162246 3300049589 Unclassified 1548
947 Ga0501073_0395404 3300049589 Bacteria 955
948 Ga0501074_0329823 3300049590 Bacteria 1083
949 Ga0501075_0267695 3300049591 Bacteria 1302
950 Ga0501076_0038186 3300049592 Bacteria 3770
951 Ga0501202_027084 3300049652 Unclassified 1176
952 Ga0501216_011001 3300049660 Bacteria 1464
953 Ga0501217_048090 3300049661 Unclassified 1107
954 Ga0501227_089836 3300049665 Unclassified 810
955 Ga0501233_019306 3300049668 Unclassified 1442
956 Ga0501235_001527 3300049669 Bacteria 4962
957 Ga0501255_032913 3300049684 Unclassified 730
958 Ga0501221_059199 3300049704 Unclassified 882
959 Ga0501225_0044441 3300049705 Unclassified 1228
960 Ga0501079_0120969 3300049741 Bacteria 2036
961 Ga0501083_0345029 3300049744 Unclassified 968
962 Ga0501263_010283 3300049760 Unclassified 1146
963 Ga0501265_015778 3300049762 Unclassified 973
964 Ga0501266_013283 3300049763 Unclassified 1070
965 Ga0501268_018984 3300049765 Bacteria 1161
966 Ga0501268_035255 3300049765 Unclassified 922
967 Ga0501274_004665 3300049771 Unclassified 1138
968 Ga0501035_0142088 3300049822 Bacteria 2086
969 Ga0501035_0190610 3300049822 Unclassified 1763
970 Ga0501035_0296488 3300049822 Bacteria 1363
971 Ga0501035_0807984 3300049822 Bacteria 749
972 Ga0501044_0009533 3300049823 Bacteria 10572
973 Ga0501044_0926121 3300049823 Bacteria 745
974 Ga0501045_0021355 3300049824 Bacteria 4630
975 nmdc:mga05p37_120740_c1 3300050507 Bacteria 3219
976 nmdc:mga05p37_262130_c1 3300050507 Bacteria 2068
977 nmdc:mga05p37_474039_c1 3300050507 Bacteria 1443
978 nmdc:mga05p37_58646_c1 3300050507 Bacteria 4741
979 nmdc:mga09592_13015_c1 3300050508 Bacteria 6791
980 nmdc:mga09592_420471_c1 3300050508 Bacteria 1154
981 nmdc:mga09592_77966_c1 3300050508 Bacteria 2819
982 nmdc:mga0qj67_158933_c1 3300050509 Unclassified 1834
983 nmdc:mga0qj67_4128_c1 3300050509 Bacteria 10526
984 nmdc:mga0qj67_59187_c1 3300050509 Bacteria 3038
985 nmdc:mga06r32_129574_c1 3300050510 Unclassified 2493
986 nmdc:mga06r32_1526844_c1 3300050510 Unclassified 608
987 nmdc:mga06r32_261715_c1 3300050510 Bacteria 1717
988 nmdc:mga06r32_537862_c1 3300050510 Unclassified 1143
989 nmdc:mga06r32_975005_c1 3300050510 Unclassified 801
990 nmdc:mga08y16_12861_c1 3300050511 Bacteria 8801
991 nmdc:mga08y16_451536_c1 3300050511 Bacteria 1311
992 nmdc:mga08y16_748790_c1 3300050511 Unclassified 973
993 nmdc:mga0n895_14894_c2 3300050512 Bacteria 4588
994 nmdc:mga0n895_24354_c1 3300050512 Bacteria 5703
995 nmdc:mga0rr50_416684_c1 3300050513 Bacteria 1136
996 nmdc:mga08x19_2070_c1 3300050514 Bacteria 12286
997 nmdc:mga08x19_5049_c1 3300050514 Bacteria 7808
998 nmdc:mga0a205_17614_c1 3300050515 Bacteria 6703
999 nmdc:mga0a205_20136_c1 3300050515 Bacteria 6294
1000 nmdc:mga0a205_410631_c1 3300050515 Bacteria 1217
1001 Ga0495601_0214451 3300053077 Bacteria 1257
1002 Ga0495601_0303036 3300053077 Bacteria 1041
1003 Ga0495612_0009455 3300053078 Bacteria 3953
1004 Ga0495595_0094867 3300053084 Bacteria 1435
1005 Ga0495595_0178581 3300053084 Unclassified 1052
1006 Ga0495619_0147505 3300053085 Bacteria 1622
1007 Ga0501082_0254557 3300060353 Bacteria 1527
1008 Ga0207659_10349715
1009 JGI25406J46586_10032713
1010 Ga0065715_10273275
1011 Ga0065715_10355927
1012 Ga0065707_10095745
1013 Ga0070658_10002410
1014 Ga0070658_10017737
1015 Ga0070658_10091182
1016 Ga0070676_10001204
1017 Ga0070676_10036346
1018 Ga0070676_10277778
1019 Ga0070676_10474713
1020 Ga0070676_10643333
1021 Ga0070683_100002655
1022 Ga0070683_100006959
1023 Ga0070683_100010228
1024 Ga0070683_100016249
1025 Ga0070683_100044126
1026 Ga0070683_100044551
1027 Ga0070683_100071081
1028 Ga0070683_100170065
1029 Ga0070683_100192109
1030 Ga0070683_100214490
1031 Ga0070683_100328999
1032 Ga0070683_100333987
1033 Ga0070683_100756011
1034 Ga0070683_100786483
1035 Ga0070690_100109667
1036 Ga0070670_100001025
1037 Ga0070670_100042150
1038 Ga0070670_100063363
1039 Ga0070670_100079494
1040 Ga0070670_100094359
1041 Ga0070670_100101621
1042 Ga0070677_10189805
1043 Ga0070677_10201500
1044 Ga0068869_100005737
1045 Ga0068869_100426096
1046 Ga0070666_10286668
1047 Ga0070666_10330081
1048 Ga0070666_10669090
1049 Ga0070680_100000152
1050 Ga0070680_100019957
1051 Ga0070680_100060577
1052 Ga0070680_100086489
1053 Ga0070680_100114688
1054 Ga0070680_100367918
1055 Ga0070680_100418248
1056 Ga0070680_100440107
1057 Ga0070680_100637462
1058 Ga0070682_100177369
1059 Ga0068868_100004677
1060 Ga0070660_100002497
1061 Ga0070660_100005660
1062 Ga0070660_100266266
1063 Ga0070660_100285905
1064 Ga0070660_100538871
1065 Ga0070689_100042472
1066 Ga0070689_100061649
1067 Ga0070689_100236026
1068 Ga0070689_100268528
1069 Ga0070691_10002555
1070 Ga0070691_10067410
1071 Ga0070691_10521298
1072 Ga0070687_100005938
1073 Ga0070687_100024242
1074 Ga0070687_100024463
1075 Ga0070661_100000555
1076 Ga0070661_100005738
1077 Ga0070661_100008221
1078 Ga0070661_100020996
1079 Ga0070661_100128689
1080 Ga0070661_100148062
1081 Ga0070661_100246771
1082 Ga0070661_100255601
1083 Ga0070692_10014089
1084 Ga0070692_10070664
1085 Ga0070692_10608150
1086 Ga0070668_100000088
1087 Ga0070668_100023628
1088 Ga0070668_100661056
1089 Ga0070668_101143191
1090 Ga0070669_100005368
1091 Ga0070669_100056611
1092 Ga0070669_100120085
1093 Ga0070675_100001976
1094 Ga0070675_100013662
1095 Ga0070675_100120175
1096 Ga0070675_100150767
1097 Ga0070675_100319735
1098 Ga0070675_100472422
1099 Ga0070671_100137716
1100 Ga0070671_100300887
1101 Ga0070671_100504097
1102 Ga0070671_100615987
1103 Ga0070674_100003798
1104 Ga0070674_100013303
1105 Ga0070674_100147132
1106 Ga0070674_100198665
1107 Ga0070674_100510285
1108 Ga0070673_100028459
1109 Ga0070673_100050060
1110 Ga0070673_100201425
1111 Ga0070673_100216618
1112 Ga0070673_100252801
1113 Ga0070673_100281052
1114 Ga0070673_100301543
1115 Ga0070673_100450166
1116 Ga0070688_100031906
1117 Ga0070688_100063436
1118 Ga0070688_100491661
1119 Ga0070659_100006879
1120 Ga0070659_100061606
1121 Ga0070659_100069090
1122 Ga0070659_100179923
1123 Ga0070659_100214597
1124 Ga0070667_100012458
1125 Ga0070667_100055305
1126 Ga0070667_100066430
1127 Ga0070667_100221626
1128 Ga0070667_100286293
1129 Ga0070709_10004052
1130 Ga0070709_10023359
1131 Ga0070714_100000878
1132 Ga0070714_100029489
1133 Ga0070713_100000396
1134 Ga0070710_10254082
1135 Ga0070701_10149335
1136 Ga0070701_10234994
1137 Ga0070701_10281856
1138 Ga0070711_100052566
1139 Ga0070711_100174789
1140 Ga0070711_100224394
1141 Ga0070700_100090726
1142 Ga0070700_100136899
1143 Ga0070700_100292263
1144 Ga0070694_100079208
1145 Ga0070694_100179946
1146 Ga0070694_100267665
1147 Ga0070663_100108781
1148 Ga0070663_100185992
1149 Ga0070678_100289888
1150 Ga0070662_100004317
1151 Ga0070662_100181640
1152 Ga0070662_100229686
1153 Ga0070662_100426416
1154 Ga0070662_100639383
1155 Ga0070662_100833100
1156 Ga0070681_10000544
1157 Ga0070681_10000828
1158 Ga0070681_10003787
1159 Ga0070681_10155741
1160 Ga0070681_10221727
1161 Ga0070681_10468086
1162 Ga0068867_100104995
1163 Ga0068867_100258165
1164 Ga0068867_100261627
1165 Ga0068867_100427333
1166 Ga0068867_100510012
1167 Ga0068867_100626134
1168 Ga0070685_10046604
1169 Ga0070685_10216735
1170 Ga0070685_10790231
1171 Ga0070706_100131012
1172 Ga0070706_100371005
1173 Ga0070706_101163976
1174 Ga0070707_100270212
1175 Ga0070707_100440260
1176 Ga0070707_101112879
1177 Ga0070698_100000109
1178 Ga0070698_100024231
1179 Ga0070698_100259097
1180 Ga0070698_100662105
1181 Ga0070698_100878605
1182 Ga0070699_100020308
1183 Ga0070699_100052769
1184 Ga0070699_100575332
1185 Ga0070699_100892501
1186 Ga0070679_100000443
1187 Ga0070679_100031020
1188 Ga0070679_100031238
1189 Ga0070679_100085961
1190 Ga0070679_100141190
1191 Ga0070679_100185801
1192 Ga0070679_100313477
1193 Ga0070679_100565067
1194 Ga0070679_101012165
1195 Ga0070684_100002554
1196 Ga0070684_100003416
1197 Ga0070684_100003432
1198 Ga0070684_100015020
1199 Ga0070684_100016134
1200 Ga0070684_100018286
1201 Ga0070684_100028725
1202 Ga0070684_100037680
1203 Ga0070684_100093956
1204 Ga0070684_100114526
1205 Ga0070684_100115653
1206 Ga0070684_100124215
1207 Ga0070684_100149010
1208 Ga0070684_100175131
1209 Ga0070684_100442800
1210 Ga0070684_100687900
1211 Ga0068853_100035992
1212 Ga0068853_100244149
1213 Ga0068853_100312008
1214 Ga0068853_100394836
1215 Ga0068853_101182361
1216 Ga0068853_101376474
1217 Ga0070672_100018173
1218 Ga0070672_100023853
1219 Ga0070672_100027934
1220 Ga0070672_100113141
1221 Ga0070672_100133071
1222 Ga0070672_100320472
1223 Ga0070672_100397719
1224 Ga0070672_100750729
1225 Ga0070686_100117084
1226 Ga0070695_100867258
1227 Ga0070695_101068844
1228 Ga0070696_100000317
1229 Ga0070696_100020562
1230 Ga0070693_100079989
1231 Ga0070665_100010586
1232 Ga0070665_100230340
1233 Ga0070704_100257060
1234 Ga0070704_100801705
1235 Ga0068855_100085897
1236 Ga0068855_100086933
1237 Ga0068855_100455549
1238 Ga0068855_100551007
1239 Ga0068855_101807926
1240 Ga0070664_100002089
1241 Ga0070664_100006546
1242 Ga0070664_100012348
1243 Ga0070664_100026387
1244 Ga0070664_100030667
1245 Ga0070664_100095861
1246 Ga0070664_100113568
1247 Ga0070664_100146290
1248 Ga0070664_100160920
1249 Ga0070664_100178590
1250 Ga0070664_100228693
1251 Ga0070664_100313134
1252 Ga0070664_100349694
1253 Ga0070664_100714266
1254 Ga0070664_100813410
1255 Ga0070664_100818941
1256 Ga0068857_100007962
1257 Ga0068857_100009491
1258 Ga0068857_100011118
1259 Ga0068857_100011804
1260 Ga0068857_100761267
1261 Ga0068854_100003700
1262 Ga0068854_100020760
1263 Ga0068854_100269544
1264 Ga0068856_100114458
1265 Ga0068856_101387449
1266 Ga0070702_100091836
1267 Ga0070702_100290894
1268 Ga0070702_100319699
1269 Ga0068852_100006122
1270 Ga0068852_100015703
1271 Ga0068852_100134447
1272 Ga0068852_100450576
1273 Ga0068852_100546940
1274 Ga0068852_100754629
1275 Ga0068859_100053778
1276 Ga0068859_100293653
1277 Ga0068859_100351783
1278 Ga0068859_100656317
1279 Ga0068859_100756530
1280 Ga0068864_100141470
1281 Ga0068864_100517546
1282 Ga0068864_101048258
1283 Ga0068866_10306314
1284 Ga0068866_10393616
1285 Ga0068861_100000232
1286 Ga0068861_100077862
1287 Ga0068861_100156561
1288 Ga0068851_10027152
1289 Ga0068851_10036084
1290 Ga0068851_10065661
1291 Ga0068851_10095010
1292 Ga0068851_10156066
1293 Ga0068870_10006869
1294 Ga0068870_10250824
1295 Ga0068870_10419013
1296 Ga0068863_100043204
1297 Ga0068863_100109300
1298 Ga0068863_100460436
1299 Ga0068858_100006089
1300 Ga0068858_100014455
1301 Ga0068860_100011913
1302 Ga0068860_100221369
1303 Ga0068860_100423138
1304 Ga0068860_100486999
1305 Ga0068862_100002069
1306 Ga0068862_100263908
1307 Ga0081539_10000103
1308 Ga0070717_10061924
1309 Ga0070712_100007912
1310 Ga0070712_100474532
1311 Ga0097621_100185964
1312 Ga0097621_100571470
1313 Ga0068871_100661266
1314 Ga0068871_100842550
1315 Ga0075428_100232369
1316 Ga0075428_100232776
1317 Ga0075428_100353655
1318 Ga0075430_100003163
1319 Ga0075430_100036168
1320 Ga0075430_100181787
1321 Ga0075430_100399391
1322 Ga0075431_100067114
1323 Ga0075431_100186026
1324 Ga0075431_100207677
1325 Ga0075431_100389263
1326 Ga0075431_100629589
1327 Ga0075431_100810872
1328 Ga0075433_10002721
1329 Ga0075433_10112606
1330 Ga0075433_10916867
1331 Ga0075434_100005668
1332 Ga0075434_100068223
1333 Ga0075434_100738619
1334 Ga0075429_100027565
1335 Ga0075429_100111764
1336 Ga0075429_100142517
1337 Ga0068865_100028967
1338 Ga0068865_100060365
1339 Ga0068865_100101244
1340 Ga0068865_100159747
1341 Ga0075436_100003392
1342 Ga0075436_100012407
1343 Ga0097620_100053777
1344 Ga0097620_100293668
1345 Ga0097620_100351751
1346 Ga0097620_100656373
1347 Ga0097620_100686397
1348 Ga0075435_100251612
1349 Ga0105240_10122856
1350 Ga0105240_10156707
1351 Ga0105240_10300375
1352 Ga0105240_10325726
1353 Ga0105240_10326059
1354 Ga0105240_10478247
1355 Ga0105240_10595926
1356 Ga0105240_10696152
1357 Ga0105240_10741242
1358 Ga0111539_10021889
1359 Ga0111539_10575171
1360 Ga0105245_10081518
1361 Ga0114129_10053397
1362 Ga0114129_10162829
1363 Ga0114129_10490559
1364 Ga0114129_11590504
1365 Ga0105241_10000025
1366 Ga0105241_10065551
1367 Ga0105242_10006374
1368 Ga0105242_10064484
1369 Ga0105242_10256548
1370 Ga0105242_10309902
1371 Ga0105248_10005922
1372 Ga0105248_10026512
1373 Ga0105248_10091207
1374 Ga0105248_10408004
1375 Ga0105248_10462087
1376 Ga0105248_11008291
1377 Ga0105248_11910839
1378 Ga0105237_10295613
1379 Ga0105237_10726091
1380 Ga0105237_11402295
1381 Ga0105238_10078912
1382 Ga0105238_10449474
1383 Ga0105238_10623356
1384 Ga0105249_10001142
1385 Ga0105249_10003811
1386 Ga0105249_10200608
1387 Ga0105239_10071801
1388 Ga0105246_10020625
1389 Ga0157373_10004494
1390 Ga0157373_10062153
1391 Ga0157373_10071049
1392 Ga0157373_10076242
1393 Ga0157373_10237349
1394 Ga0157373_10318082
1395 Ga0157373_10428382
1396 Ga0157371_10092788
1397 Ga0157370_10001327
1398 Ga0157370_10016352
1399 Ga0157370_10017249
1400 Ga0157370_10033024
1401 Ga0157370_10036262
1402 Ga0157370_10108006
1403 Ga0157370_11232632
1404 Ga0157369_10006892
1405 Ga0157369_10012342
1406 Ga0157369_10034493
1407 Ga0157369_10131562
1408 Ga0157369_10179856
1409 Ga0157369_10215251
1410 Ga0157369_10401408
1411 Ga0157369_10639492
1412 Ga0157369_10724305
1413 Ga0157374_10080629
1414 Ga0157374_10145408
1415 Ga0157378_10023659
1416 Ga0157378_10144507
1417 Ga0163162_10002411
1418 Ga0163162_10049498
1419 Ga0163162_10728175
1420 Ga0157372_10004177
1421 Ga0157372_10011138
1422 Ga0157372_10016305
1423 Ga0157372_10017385
1424 Ga0157372_10031961
1425 Ga0157372_10070153
1426 Ga0157372_10130835
1427 Ga0157372_10131366
1428 Ga0157372_10187968
1429 Ga0157372_10277202
1430 Ga0157372_10485662
1431 Ga0157372_10679064
1432 Ga0157372_10939195
1433 Ga0157375_10014333
1434 Ga0157375_10047582
1435 Ga0157375_10050500
1436 Ga0157375_10054022
1437 Ga0157375_10154573
1438 Ga0157375_10284274
1439 Ga0157375_10687563
1440 Ga0157375_10909730
1441 Ga0163163_10711212
1442 Ga0157380_10003163
1443 Ga0157380_10009480
1444 Ga0157380_10188091
1445 Ga0157377_10032846
1446 Ga0157379_10005920
1447 Ga0157376_10401869
1448 Ga0157376_10745544
1449 Ga0182007_10067998
1450 Ga0163161_10015002
1451 Ga0163161_10233770
1452 Ga0163161_10585124
1453 Ga0163161_10700688
1454 Ga0197907_10017702
1455 Ga0206356_10075689
1456 Ga0213876_10060865
1457 Ga0207697_10001978
1458 Ga0207656_10122791
1459 Ga0207682_10020365
1460 Ga0207688_10031617
1461 Ga0207688_10088681
1462 Ga0207680_10391626
1463 Ga0207680_10410984
1464 Ga0207680_10473013
1465 Ga0207647_10335718
1466 Ga0207699_10376722
1467 Ga0207645_10000513
1468 Ga0207645_10015255
1469 Ga0207645_10301681
1470 Ga0207645_10317683
1471 Ga0207645_10326291
1472 Ga0207643_10006700
1473 Ga0207643_10012415
1474 Ga0207643_10142204
1475 Ga0207705_10018465
1476 Ga0207705_10043958
1477 Ga0207705_10097736
1478 Ga0207705_10098040
1479 Ga0207705_10298338
1480 Ga0207684_10212180
1481 Ga0207684_10298461
1482 Ga0207684_11138348
1483 Ga0207654_10001593
1484 Ga0207654_10326658
1485 Ga0207654_10628349
1486 Ga0207707_10000485
1487 Ga0207707_10001404
1488 Ga0207707_10003323
1489 Ga0207707_10013100
1490 Ga0207707_10158537
1491 Ga0207707_10206286
1492 Ga0207707_10342644
1493 Ga0207695_10000824
1494 Ga0207695_10002609
1495 Ga0207695_10078082
1496 Ga0207695_10096980
1497 Ga0207695_10292987
1498 Ga0207695_10402644
1499 Ga0207671_10075826
1500 Ga0207693_10013148
1501 Ga0207663_10294971
1502 Ga0207663_10523055
1503 Ga0207660_10000035
1504 Ga0207660_10015223
1505 Ga0207660_10019058
1506 Ga0207660_10028034
1507 Ga0207660_10121705
1508 Ga0207660_10136788
1509 Ga0207660_10182956
1510 Ga0207660_10634949
1511 Ga0207660_10732738
1512 Ga0207662_10010778
1513 Ga0207662_10383935
1514 Ga0207657_10008543
1515 Ga0207657_10015548
1516 Ga0207657_10331438
1517 Ga0207649_10000422
1518 Ga0207649_10008691
1519 Ga0207649_10029805
1520 Ga0207649_10065484
1521 Ga0207649_10119389
1522 Ga0207649_10335065
1523 Ga0207649_10493410
1524 Ga0207652_10000609
1525 Ga0207652_10001738
1526 Ga0207652_10011989
1527 Ga0207652_10056870
1528 Ga0207652_10219553
1529 Ga0207652_10413134
1530 Ga0207652_10507352
1531 Ga0207652_10759205
1532 Ga0207646_10425228
1533 Ga0207646_11004086
1534 Ga0207646_11026607
1535 Ga0207646_11385717
1536 Ga0207681_10000537
1537 Ga0207681_10034707
1538 Ga0207694_10085578
1539 Ga0207694_10207866
1540 Ga0207650_10052293
1541 Ga0207650_10120792
1542 Ga0207650_10173696
1543 Ga0207650_10242695
1544 Ga0207650_10269554
1545 Ga0207659_10061473
1546 Ga0207659_10205568
1547 Ga0207659_10206720
1548 Ga0207659_10224618
1549 Ga0207659_10367019
1550 Ga0207659_10483512
1551 Ga0207687_10135811
1552 Ga0207687_10242373
1553 Ga0207700_10001929
1554 Ga0207700_10054647
1555 Ga0207700_10824962
1556 Ga0207664_10158358
1557 Ga0207664_10185845
1558 Ga0207644_10026962
1559 Ga0207644_10165031
1560 Ga0207644_10290500
1561 Ga0207690_10052603
1562 Ga0207690_10056511
1563 Ga0207690_10143089
1564 Ga0207690_10361475
1565 Ga0207690_11128459
1566 Ga0207706_10000055
1567 Ga0207706_10176978
1568 Ga0207706_10187413
1569 Ga0207706_10214189
1570 Ga0207706_10309150
1571 Ga0207706_10329635
1572 Ga0207686_10205727
1573 Ga0207686_10208992
1574 Ga0207670_10061060
1575 Ga0207670_10085890
1576 Ga0207670_10761482
1577 Ga0207669_10094447
1578 Ga0207669_10160862
1579 Ga0207669_10637938
1580 Ga0207704_10028767
1581 Ga0207704_10151223
1582 Ga0207704_10731198
1583 Ga0207691_10000129
1584 Ga0207691_10004042
1585 Ga0207691_10005297
1586 Ga0207691_10023370
1587 Ga0207691_10033533
1588 Ga0207691_10081921
1589 Ga0207691_10456618
1590 Ga0207711_10127374
1591 Ga0207711_10193642
1592 Ga0207711_10573930
1593 Ga0207711_10585926
1594 Ga0207711_11167907
1595 Ga0207689_10008227
1596 Ga0207689_10033942
1597 Ga0207661_10007864
1598 Ga0207661_10025413
1599 Ga0207661_10031708
1600 Ga0207661_10056884
1601 Ga0207661_10085873
1602 Ga0207661_10104508
1603 Ga0207661_10182870
1604 Ga0207661_10280349
1605 Ga0207661_10391958
1606 Ga0207661_10433192
1607 Ga0207661_10599445
1608 Ga0207661_10633717
1609 Ga0207679_10000382
1610 Ga0207679_10002242
1611 Ga0207679_10010118
1612 Ga0207679_10037653
1613 Ga0207679_10054688
1614 Ga0207679_10061160
1615 Ga0207679_10063534
1616 Ga0207679_10117447
1617 Ga0207679_10161392
1618 Ga0207679_10327404
1619 Ga0207679_10440743
1620 Ga0207679_10780092
1621 Ga0207679_11293320
1622 Ga0207667_10033264
1623 Ga0207667_10362706
1624 Ga0207667_10379776
1625 Ga0207667_10530769
1626 Ga0207667_11087044
1627 Ga0207651_10029820
1628 Ga0207651_10083254
1629 Ga0207651_10092895
1630 Ga0207651_10605585
1631 Ga0207712_10000920
1632 Ga0207668_10011829
1633 Ga0207668_10839735
1634 Ga0207668_10856515
1635 Ga0207640_10000266
1636 Ga0207640_10215636
1637 Ga0207640_10498686
1638 Ga0207658_10249916
1639 Ga0207658_10280463
1640 Ga0207658_10294460
1641 Ga0207658_10325495
1642 Ga0207658_10421742
1643 Ga0207658_10517945
1644 Ga0207677_10097680
1645 Ga0207677_10531505
1646 Ga0207703_10080821
1647 Ga0207703_10416516
1648 Ga0207639_10207564
1649 Ga0207639_10254522
1650 Ga0207678_10247694
1651 Ga0207708_10279451
1652 Ga0207708_10348208
1653 Ga0207702_10266759
1654 Ga0207641_10240170
1655 Ga0207641_10246014
1656 Ga0207641_11337683
1657 Ga0207648_10010162
1658 Ga0207648_10031606
1659 Ga0207648_10095562
1660 Ga0207648_10126987
1661 Ga0207648_10440659
1662 Ga0207648_11077389
1663 Ga0207676_10904212
1664 Ga0207676_10975147
1665 Ga0207674_10001035
1666 Ga0207674_10002037
1667 Ga0207674_10021081
1668 Ga0207674_10026295
1669 Ga0207675_100000073
1670 Ga0207675_100084506
1671 Ga0207675_100149855
1672 Ga0207675_100910017
1673 Ga0207683_10123300
1674 Ga0207683_10206373
1675 Ga0207683_10471441
1676 Ga0207698_10015286
1677 Ga0207698_10108989
1678 Ga0207698_10264879
1679 Ga0207698_10719741
1680 Ga0207698_11204786
1681 Ga0207698_11435825
1682 Ga0209968_1003366
1683 Ga0209999_1027386
1684 Ga0209966_1010289
1685 Ga0207428_10026683
1686 Ga0207428_10842685
1687 Ga0268266_10115231
1688 Ga0268266_10316838
1689 Ga0268265_11492597
1690 Ga0268264_10031762
1691 Ga0268264_11038521
1692 Ga0307405_10016213
1693 Ga0307405_10016433
1694 Ga0307405_10276914
1695 Ga0307405_11082836
1696 Ga0307413_10004571
1697 Ga0307413_10027025
1698 Ga0307410_10116698
1699 Ga0307410_10341241
1700 Ga0307410_10347624
1701 Ga0307410_10448733
1702 Ga0307410_10775603
1703 Ga0307406_10087678
1704 Ga0307406_10218708
1705 Ga0307407_10011271
1706 Ga0307407_10041647
1707 Ga0307407_10247529
1708 Ga0307412_10009112
1709 Ga0307412_10124442
1710 Ga0307412_10296314
1711 Ga0307412_10388201
1712 Ga0307409_100396701
1713 Ga0307409_101314932
1714 Ga0307409_101325569
1715 Ga0307416_100069846
1716 Ga0307416_100141905
1717 Ga0307416_100490430
1718 Ga0307416_100536132
1719 Ga0307416_101020081
1720 Ga0307416_101026209
1721 Ga0307416_101089053
1722 Ga0307414_10007789
1723 Ga0307414_10233273
1724 Ga0307414_10754349
1725 Ga0307414_11134694
1726 Ga0307414_11236575
1727 Ga0307411_10001331
1728 Ga0307411_10131190
1729 Ga0307415_100078935
1730 Ga0307415_100116145
1731 Ga0307415_100248470
1732 Ga0307415_100347533
1733 Ga0307415_100446994
1734 Ga0307415_100664362
1735 Ga0373934_0000319
1736 Ga0373923_0079046
1737 Ga0373945_0009272
1738 Ga0373953_0010653
1739 Ga0373953_0271481
1740 Ga0373954_0024387
1741 Ga0373956_0007873
1742 Ga0373956_0059152
1743 Ga0373957_0110738
1744 Ga0373943_0000549
1745 Ga0373943_0746206
1746 Ga0373946_0140153
1747 Ga0373946_0241080
1748 Ga0373955_0010711
1749 Ga0373955_0570437
1750 Ga0373931_0147047
1751 Ga0373935_0025192
1752 Ga0373935_0140190
1753 Ga0373935_0233897
1754 Ga0373935_0675002
1755 Ga0373927_0015005
1756 Ga0373927_0028039
1757 Ga0373927_0101015
1758 Ga0373933_0030909
1759 Ga0373933_0033766
1760 Ga0373947_0000580
1761 Ga0373947_0065217
1762 Ga0373937_0001736
1763 Ga0373937_0139331
1764 Ga0373937_0164017
1765 Ga0373937_0270639
1766 Ga0373925_0001431
1767 Ga0373925_0032169
1768 Ga0373925_0404870
1769 Ga0436365_0475701
1770 Ga0436365_0875476
1771 Ga0436365_0982966
1772 Ga0439448_0067275
1773 Ga0439455_0067273
1774 Ga0439464_0083104
1775 Ga0451577_0000016
1776 Ga0451577_0007492
1777 Ga0451577_0021164
1778 Ga0451577_0039290
1779 Ga0451577_0156063
1780 Ga0451577_0222580
1781 Ga0466963_0118097
1782 Ga0466963_0252359
1783 Ga0453684_0000368
1784 Ga0453684_0041760
1785 Ga0453684_0051193
1786 Ga0466959_0041971
1787 Ga0451576_0235254
1788 Ga0451576_0311411
1789 Ga0451576_0629666
1790 Ga0466958_0133777
1791 Ga0466958_0317227
1792 Ga0466967_0051897
1793 Ga0466967_0054913
1794 Ga0466967_0323715
1795 Ga0466967_0947813
1796 Ga0495592_0016371
1797 Ga0495592_0186271
1798 Ga0495592_0220460
1799 Ga0495629_0038669
1800 Ga0495629_0053126
1801 Ga0495651_0004559
1802 Ga0495651_0039377
1803 Ga0495651_0279390
1804 Ga0495651_0363840
1805 Ga0495653_0086461
1806 Ga0495653_0091967
1807 Ga0495580_0003447
1808 Ga0495580_0010878
1809 Ga0495580_0030804
1810 Ga0495582_0008502
1811 Ga0495582_0067504
1812 Ga0495582_0088330
1813 Ga0495582_0404675
1814 Ga0495639_0001681
1815 Ga0495639_0070550
1816 Ga0495662_0007455
1817 Ga0495594_0002309
1818 Ga0495594_0005001
1819 Ga0495594_0008462
1820 Ga0495594_0085085
1821 Ga0495594_0438186
1822 Ga0495596_0090328
1823 Ga0495596_0199361
1824 Ga0495608_0044993
1825 Ga0495608_0052115
1826 Ga0495618_0055155
1827 Ga0495628_0006895
1828 Ga0495628_0040706
1829 Ga0495628_0139680
1830 Ga0495630_0031856
1831 Ga0495630_0040136
1832 Ga0495630_0180271
1833 Ga0495630_0502557
1834 Ga0495663_0072249
1835 Ga0495663_0105894
1836 Ga0495663_0311400
1837 Ga0495652_0000859
1838 Ga0495652_0032221
1839 Ga0495652_0202719
1840 Ga0495665_0000677
1841 Ga0495665_0020133
1842 Ga0495665_0069766
1843 Ga0495640_0079411
1844 Ga0495586_0039853
1845 Ga0495586_0309322
1846 Ga0495586_0776136
1847 Ga0495587_0000360
1848 Ga0495587_0004216
1849 Ga0495587_0138258
1850 Ga0495587_0436228
1851 Ga0495645_0000989
1852 Ga0495645_0001984
1853 Ga0495667_0015602
1854 Ga0495667_0042983
1855 Ga0495667_0584655
1856 Ga0495634_0314856
1857 Ga0495634_0599752
1858 Ga0495635_0040433
1859 Ga0495635_0114467
1860 Ga0495635_0399471
1861 Ga0495635_0582214
1862 Ga0495588_0000514
1863 Ga0495588_0065723
1864 Ga0495657_0097839
1865 Ga0495657_0099581
1866 Ga0495657_0260330
1867 Ga0495599_0000395
1868 Ga0495599_0002829
1869 Ga0495599_0082817
1870 Ga0495623_0086385
1871 Ga0495623_0298155
1872 Ga0495646_0071561
1873 Ga0495658_0001102
1874 Ga0495658_0347535
1875 Ga0495669_0216707
1876 Ga0495613_0016681
1877 Ga0495613_0168730
1878 Ga0495624_0031704
1879 Ga0495600_0030985
1880 Ga0495600_0068387
1881 Ga0495600_0194278
1882 Ga0495600_0388838
1883 Ga0495581_0000585
1884 Ga0495581_0062904
1885 Ga0495581_0183552
1886 Ga0495604_0350272
1887 Ga0495636_0063592
1888 Ga0495674_0007720
1889 Ga0495674_0154171
1890 Ga0495674_0414300
1891 Ga0495672_0004134
1892 Ga0495680_0021757
1893 Ga0495680_0375513
1894 Ga0495675_0035608
1895 Ga0495675_0057125
1896 Ga0495675_0080425
1897 Ga0495675_0159323
1898 Ga0495684_0064847
1899 Ga0495684_0107907
1900 Ga0495684_0180162
1901 Ga0495684_0229930
1902 Ga0495593_0030869
1903 Ga0495593_0094833
1904 Ga0495602_0189836
1905 Ga0495602_0250120
1906 Ga0495602_0645249
1907 Ga0496100_0159071
1908 Ga0496101_0141520
1909 Ga0496104_0032397
1910 Ga0496104_0744650
1911 Ga0496105_0571089
1912 Ga0496108_0216403
1913 Ga0496109_1277863
1914 Ga0496109_1367846
1915 Ga0496110_0319101
1916 Ga0496111_0263127
1917 Ga0496112_0395956
1918 Ga0496112_0556589
1919 Ga0496112_0781648
1920 Ga0496113_0022996
1921 Ga0496114_0035290
1922 Ga0496115_0002487
1923 Ga0501031_0070260
1924 Ga0501032_0164341
1925 Ga0501032_0229141
1926 Ga0501033_0006099
1927 Ga0501033_0312624
1928 Ga0501034_0026781
1929 Ga0501034_0162813
1930 Ga0501034_0508303
1931 Ga0501036_0089981
1932 Ga0501038_0093932
1933 Ga0501038_0184294
1934 Ga0501042_0074899
1935 Ga0501042_0197577
1936 Ga0501043_0007990
1937 Ga0501046_0180761
1938 Ga0501046_0664008
1939 Ga0501047_0016410
1940 Ga0501047_0215059
1941 Ga0501048_0052402
1942 Ga0501048_0562265
1943 Ga0501067_0086560
1944 Ga0501067_0410636
1945 Ga0501070_0012137
1946 Ga0501070_0062638
1947 Ga0501070_0545910
1948 Ga0501070_0793034
1949 Ga0501071_0346470
1950 Ga0501072_0144679
1951 Ga0501072_0207887
1952 Ga0501072_0392506
1953 Ga0501073_0162246
1954 Ga0501073_0395404
1955 Ga0501074_0329823
1956 Ga0501075_0267695
1957 Ga0501076_0038186
1958 Ga0501202_027084
1959 Ga0501216_011001
1960 Ga0501217_048090
1961 Ga0501227_089836
1962 Ga0501233_019306
1963 Ga0501235_001527
1964 Ga0501255_032913
1965 Ga0501221_059199
1966 Ga0501225_0044441
1967 Ga0501079_0120969
1968 Ga0501083_0345029
1969 Ga0501263_010283
1970 Ga0501265_015778
1971 Ga0501266_013283
1972 Ga0501268_018984
1973 Ga0501268_035255
1974 Ga0501274_004665
1975 Ga0501035_0142088
1976 Ga0501035_0190610
1977 Ga0501035_0296488
1978 Ga0501035_0807984
1979 Ga0501044_0009533
1980 Ga0501044_0926121
1981 Ga0501045_0021355
1982 nmdc:mga05p37_120740_c1
1983 nmdc:mga05p37_262130_c1
1984 nmdc:mga05p37_474039_c1
1985 nmdc:mga05p37_58646_c1
1986 nmdc:mga09592_13015_c1
1987 nmdc:mga09592_420471_c1
1988 nmdc:mga09592_77966_c1
1989 nmdc:mga0qj67_158933_c1
1990 nmdc:mga0qj67_4128_c1
1991 nmdc:mga0qj67_59187_c1
1992 nmdc:mga06r32_129574_c1
1993 nmdc:mga06r32_1526844_c1
1994 nmdc:mga06r32_261715_c1
1995 nmdc:mga06r32_537862_c1
1996 nmdc:mga06r32_975005_c1
1997 nmdc:mga08y16_12861_c1
1998 nmdc:mga08y16_451536_c1
1999 nmdc:mga08y16_748790_c1
2000 nmdc:mga0n895_14894_c2
2001 nmdc:mga0n895_24354_c1
2002 nmdc:mga0rr50_416684_c1
2003 nmdc:mga08x19_2070_c1
2004 nmdc:mga08x19_5049_c1
2005 nmdc:mga0a205_17614_c1
2006 nmdc:mga0a205_20136_c1
2007 nmdc:mga0a205_410631_c1
2008 Ga0495601_0214451
2009 Ga0495601_0303036
2010 Ga0495612_0009455
2011 Ga0495595_0094867
2012 Ga0495595_0178581
2013 Ga0495619_0147505
2014 Ga0501082_0254557

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

48

166

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ogi-assembly1.cif.gz_A crystal structure of a putative metal dependent phosphohydrolase (sag1661) from streptococcus agalactiae serogroup v at 1.85 a resolution 0.8494 17 182
3ccg-assembly1.cif.gz_A-2 crystal structure of predicted hd superfamily hydrolase involved in nad metabolism (np_347894.1) from clostridium acetobutylicum at 1.50 a resolution 0.8482 17 182
8wmy-assembly1.cif.gz_B-2 crystal structure of yqek in complex with mg and adp. 0.8452 17 182
2o08-assembly1.cif.gz_B crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution 0.7859 1 182
2o08-assembly1.cif.gz_B crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution 0.7782 1 182
ID Description Score Start End Superfamily
af_Q2G297_1_187_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.847 17 183 1.10.3210.10
2ogiA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8421 18 182 1.10.3210.10
3ccgA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8248 18 182 1.10.3210.10
2o08B00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7831 1 182 1.10.3210.10
af_Q2G297_1_187_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7752 17 183 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A7W0W6K5-F1-model_v4 HD domain-containing protein 0.9819 8 183
AF-A0A3D4YNT0-F1-model_v4 HD domain-containing protein 0.9792 41 183
AF-A0A7W0GWJ6-F1-model_v4 HD domain-containing protein 0.9611 11 182
AF-A0A349LIQ4-F1-model_v4 HD domain-containing protein 0.9592 11 144
AF-A0A2V7S3C8-F1-model_v4 HD domain-containing protein 0.9573 11 183

Map