F487798

General Info

Members Datasets Scaffolds Average Seq Length
997 384 837 162

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10286104|Ga0163161_102861043
Length 161
Sequence MSACTLVLRSIGLLSVLALTGCATWFTGNYEDPQVHLVKVEVVKANLLQQRFILRFRIDNPNRRSLPVRGMSYSVRLEDMLLSEGETSDWFSVAGRSGEYYEVPVRTNLWQHVRELSKLLKHPDRPIRYELRGELRTGVLFGHDVVLNHTGEINARGLPGH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
26 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
27 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
28 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
29 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
30 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
31 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
32 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
33 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
34 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
35 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
36 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
37 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
38 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
39 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
40 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
41 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
42 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
43 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
44 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
45 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
46 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
47 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
48 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
49 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
50 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
51 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
52 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
53 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
54 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
55 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
56 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
57 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
58 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
59 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
60 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
61 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
62 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
63 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
64 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
65 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
66 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
67 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
68 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
69 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
70 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
71 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
72 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
73 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
74 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
75 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
76 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
77 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
78 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
79 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
80 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
81 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
82 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
83 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
84 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
85 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
86 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
87 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
88 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
89 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
90 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
91 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
92 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
93 2773857670 Pseudomonas sp. 478 Isolate Unclassified
94 2773857673 Pseudomonas sp. 443 Isolate Unclassified
95 2784132063 Pseudomonas sp. 424 Isolate Unclassified
96 2784132072 Pseudomonas sp. 460 Isolate Unclassified
97 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
98 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
99 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
100 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
101 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
102 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
103 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
104 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
105 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
106 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
107 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
108 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
109 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
110 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
111 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
112 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
113 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
114 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
115 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
116 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
117 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
118 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
119 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
120 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
121 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
122 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
123 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
124 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
125 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
126 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
127 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
128 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
129 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
130 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
131 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
132 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
133 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
134 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
135 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
136 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
137 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
138 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
139 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
140 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
141 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
142 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
143 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
144 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
145 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
146 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
147 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
148 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
149 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
150 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
151 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
152 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
153 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
154 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
155 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
156 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
157 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
159 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
160 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
161 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
162 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
163 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
164 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
165 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
166 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
175 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
186 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
211 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
212 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
213 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
214 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
227 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
228 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
235 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
236 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
239 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
240 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
241 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
244 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
245 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
246 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
247 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
248 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
251 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
254 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
336 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
363 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
364 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
371 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
372 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
373 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
374 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
375 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
376 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
377 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
378 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
379 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
380 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
381 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
382 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
383 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
384 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.95
Metatranscriptomes 0
Isolates 16.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 2.51
Rhizoplane 5.92
Rhizosphere 79.44
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_106 2124908027 Bacteria 15461
2 MRS2a_Contig_720 2124908027 Bacteria 19927
3 SwRhRL2b_contig_3419659 2162886007 Bacteria 4287
4 JGI25162J39368_1000241 3300002737 Bacteria 54556
5 JGI25163J39215_1000634 3300002771 Bacteria 9556
6 JGI25164J39214_1000188 3300002772 Bacteria 54558
7 JGI25165J46597_1000339 3300003214 Bacteria 54558
8 Ga0055536_1000399 3300003781 Bacteria 31587
9 Ga0055530_10000296 3300003791 Bacteria 45176
10 Ga0055530_10011182 3300003791 Bacteria 3245
11 Ga0055530_10023691 3300003791 Bacteria 1758
12 Ga0055540_1000377 3300003792 Bacteria 37349
13 Ga0055540_1001027 3300003792 Bacteria 17928
14 Ga0055540_1004307 3300003792 Bacteria 6489
15 Ga0055531_10001226 3300003794 Bacteria 19551
16 Ga0065714_10002540 3300005288 Bacteria 29164
17 Ga0065714_10002948 3300005288 Bacteria 9441
18 Ga0065714_10004279 3300005288 Bacteria 8125
19 Ga0065714_10007294 3300005288 Bacteria 3426
20 Ga0065714_10019883 3300005288 Bacteria 1796
21 Ga0065714_10094395 3300005288 Bacteria 1813
22 Ga0065714_10099614 3300005288 Bacteria 1683
23 Ga0065714_10103470 3300005288 Bacteria 1602
24 Ga0065714_10134401 3300005288 Bacteria 1222
25 Ga0065714_10138296 3300005288 Bacteria 1168
26 Ga0065704_10070421 3300005289 Bacteria 25665
27 Ga0065704_10081346 3300005289 Bacteria 3775
28 Ga0065704_10255164 3300005289 Bacteria 979
29 Ga0065712_10069868 3300005290 Bacteria 6596
30 Ga0065715_10022161 3300005293 Bacteria 2146
31 Ga0075364_10268850 3300006051 Bacteria 1159
32 Ga0075364_10481150 3300006051 Bacteria 849
33 Ga0075364_10496380 3300006051 Bacteria 834
34 Ga0075432_10002541 3300006058 Bacteria 6087
35 Ga0075432_10004673 3300006058 Bacteria 4662
36 Ga0075432_10005880 3300006058 Bacteria 4174
37 Ga0075432_10018819 3300006058 Bacteria 2357
38 Ga0075432_10019681 3300006058 Bacteria 2308
39 Ga0075432_10079590 3300006058 Bacteria 1186
40 Ga0075432_10117174 3300006058 Bacteria 997
41 Ga0075432_10144997 3300006058 Bacteria 908
42 Ga0075432_10249389 3300006058 Bacteria 720
43 Ga0075362_10049502 3300006177 Bacteria 1877
44 Ga0075362_10059424 3300006177 Bacteria 1726
45 Ga0075362_10115785 3300006177 Bacteria 1265
46 Ga0075436_100188016 3300006914 Bacteria 1461
47 Ga0075436_100214683 3300006914 Bacteria 1364
48 Ga0075436_100289934 3300006914 Bacteria 1171
49 Ga0079104_1000689 3300006946 Bacteria 30929
50 Ga0079104_1034611 3300006946 Bacteria 1225
51 Ga0099826_10032511 3300006948 Bacteria 3760
52 Ga0105251_10014540 3300009011 Bacteria 4343
53 Ga0105251_10029928 3300009011 Bacteria 2739
54 Ga0105251_10252690 3300009011 Bacteria 795
55 Ga0105244_10001071 3300009036 Bacteria 22821
56 Ga0105244_10030138 3300009036 Bacteria 2889
57 Ga0105244_10038550 3300009036 Bacteria 2492
58 Ga0105244_10145656 3300009036 Bacteria 1137
59 Ga0105244_10199829 3300009036 Bacteria 943
60 Ga0105244_10260476 3300009036 Bacteria 807
61 Ga0105250_10037295 3300009092 Bacteria 1951
62 Ga0105250_10043734 3300009092 Bacteria 1796
63 Ga0105250_10084649 3300009092 Bacteria 1287
64 Ga0105243_10000586 3300009148 Bacteria 36575
65 Ga0105243_10008101 3300009148 Bacteria 8065
66 Ga0105243_10106625 3300009148 Bacteria 2336
67 Ga0105242_10206729 3300009176 Bacteria 1747
68 Ga0105249_10331643 3300009553 Bacteria 1535
69 Ga0105246_10001208 3300011119 Bacteria 15112
70 Ga0105246_10090943 3300011119 Bacteria 2199
71 Ga0157345_1000963 3300012498 Bacteria 2120
72 Ga0157347_1002410 3300012502 Bacteria 1597
73 Ga0157373_10013301 3300013100 Bacteria 6038
74 Ga0157373_10019482 3300013100 Bacteria 4937
75 Ga0157373_10078808 3300013100 Bacteria 2323
76 Ga0157373_10386778 3300013100 Bacteria 1001
77 Ga0157371_10000885 3300013102 Bacteria 33767
78 Ga0157371_10005098 3300013102 Bacteria 11204
79 Ga0157371_10006075 3300013102 Bacteria 10045
80 Ga0157371_10118713 3300013102 Bacteria 1880
81 Ga0157370_10013230 3300013104 Bacteria 8503
82 Ga0157370_10167167 3300013104 Bacteria 2045
83 Ga0157370_10199760 3300013104 Bacteria 1855
84 Ga0157370_10505524 3300013104 Bacteria 1110
85 Ga0157369_10015038 3300013105 Bacteria 8733
86 Ga0157369_10203228 3300013105 Bacteria 2079
87 Ga0157369_10270853 3300013105 Bacteria 1769
88 Ga0163162_10001282 3300013306 Bacteria 23512
89 Ga0163162_10008097 3300013306 Bacteria 10258
90 Ga0157372_10005224 3300013307 Bacteria 13803
91 Ga0157375_10088960 3300013308 Bacteria 3143
92 Ga0182008_10000338 3300014497 Bacteria 36590
93 Ga0182008_10003138 3300014497 Bacteria 10109
94 Ga0182008_10004581 3300014497 Bacteria 8046
95 Ga0182008_10065183 3300014497 Bacteria 1792
96 Ga0182008_10318160 3300014497 Bacteria 818
97 Ga0182006_1001039 3300015261 Bacteria 18022
98 Ga0182006_1002350 3300015261 Bacteria 10383
99 Ga0182006_1006812 3300015261 Bacteria 5272
100 Ga0182006_1008122 3300015261 Bacteria 4764
101 Ga0182006_1008986 3300015261 Bacteria 4502
102 Ga0182006_1032599 3300015261 Bacteria 2092
103 Ga0182006_1117531 3300015261 Bacteria 927
104 Ga0182007_10000531 3300015262 Bacteria 22530
105 Ga0182005_1000391 3300015265 Bacteria 23860
106 Ga0182005_1002318 3300015265 Bacteria 6934
107 Ga0182005_1004961 3300015265 Bacteria 4215
108 Ga0182005_1011182 3300015265 Bacteria 2565
109 Ga0182005_1021687 3300015265 Bacteria 1761
110 Ga0182005_1074826 3300015265 Bacteria 932
111 Ga0182005_1175742 3300015265 Bacteria 634
112 Ga0163161_10003870 3300017792 Bacteria 10496
113 Ga0163161_10011775 3300017792 Bacteria 6065
114 Ga0163161_10091297 3300017792 Bacteria 2254
115 Ga0163161_10129951 3300017792 Bacteria 1899
116 Ga0163161_10286104 3300017792 Bacteria 1294
117 Ga0163161_10408239 3300017792 Bacteria 1090
118 Ga0163161_11152063 3300017792 Bacteria 668
119 Ga0209760_100099 3300025207 Bacteria 66726
120 Ga0209563_100593 3300025230 Bacteria 11920
121 Ga0207427_100001 3300025231 Bacteria 1410763
122 Ga0209437_100003 3300025233 Bacteria 1517827
123 Ga0209233_1000007 3300025261 Bacteria 1411234
124 Ga0209675_1002564 3300025291 Bacteria 9217
125 Ga0209676_1000016 3300025292 Bacteria 655561
126 Ga0209676_1000033 3300025292 Bacteria 463236
127 Ga0209676_1000080 3300025292 Bacteria 287400
128 Ga0209676_1005886 3300025292 Bacteria 6236
129 Ga0209676_1006105 3300025292 Bacteria 6049
130 Ga0209050_1000036 3300025298 Bacteria 423070
131 Ga0209050_1000117 3300025298 Bacteria 202979
132 Ga0209050_1000187 3300025298 Bacteria 139437
133 Ga0209050_1001895 3300025298 Bacteria 20032
134 Ga0209051_1000077 3300025303 Bacteria 202959
135 Ga0209051_1000131 3300025303 Bacteria 139437
136 Ga0209051_1001300 3300025303 Bacteria 21966
137 Ga0209051_1003680 3300025303 Bacteria 9907
138 Ga0209051_1100299 3300025303 Bacteria 781
139 Ga0209257_1000173 3300025304 Bacteria 166678
140 Ga0209257_1005683 3300025304 Bacteria 8592
141 Ga0207696_1000083 3300025711 Bacteria 197352
142 Ga0207696_1002110 3300025711 Bacteria 9988
143 Ga0207696_1011128 3300025711 Bacteria 3256
144 Ga0207696_1023231 3300025711 Bacteria 1958
145 Ga0207696_1034639 3300025711 Bacteria 1507
146 Ga0207696_1070395 3300025711 Bacteria 973
147 Ga0207696_1171183 3300025711 Bacteria 576
148 Ga0207655_1000896 3300025728 Bacteria 31326
149 Ga0207655_1001618 3300025728 Bacteria 20023
150 Ga0207655_1002914 3300025728 Bacteria 13182
151 Ga0207655_1007603 3300025728 Bacteria 7008
152 Ga0207655_1009084 3300025728 Bacteria 6220
153 Ga0207655_1059240 3300025728 Bacteria 1492
154 Ga0207655_1074462 3300025728 Bacteria 1249
155 Ga0207713_1000689 3300025735 Bacteria 31727
156 Ga0207713_1001389 3300025735 Bacteria 19633
157 Ga0207713_1001940 3300025735 Bacteria 15644
158 Ga0207713_1008663 3300025735 Bacteria 5817
159 Ga0207713_1010616 3300025735 Bacteria 5081
160 Ga0207713_1019697 3300025735 Bacteria 3293
161 Ga0207681_10061653 3300025923 Bacteria 2579
162 Ga0207686_10101637 3300025934 Bacteria 1921
163 Ga0207709_10000036 3300025935 Bacteria 292568
164 Ga0207709_10000517 3300025935 Bacteria 33655
165 Ga0207709_10107691 3300025935 Bacteria 1857
166 Ga0207712_10236672 3300025961 Bacteria 1469
167 Ga0209281_1000013 3300027111 Bacteria 653449
168 Ga0209281_1000202 3300027111 Bacteria 135240
169 Ga0209281_1011153 3300027111 Bacteria 2022
170 Ga0209281_1019925 3300027111 Bacteria 1319
171 Ga0209974_10057430 3300027876 Bacteria 1314
172 Ga0207428_10015030 3300027907 Bacteria 6707
173 Ga0207428_10045078 3300027907 Bacteria 3555
174 Ga0207428_10055312 3300027907 Bacteria 3156
175 Ga0207428_10073102 3300027907 Bacteria 2691
176 Ga0207428_10107728 3300027907 Bacteria 2147
177 Ga0207428_10227391 3300027907 Bacteria 1397
178 Ga0207428_10265778 3300027907 Bacteria 1277
179 Ga0207428_10447791 3300027907 Bacteria 942
180 Ga0207428_10609963 3300027907 Bacteria 786
181 Ga0268266_10011767 3300028379 Bacteria 7587
182 Ga0307511_10161596 3300030521 Bacteria 1256
183 Ga0314311_1174749 3300030733 Bacteria 3224
184 Ga0316178_1049075 3300030735 Bacteria 8388
185 Ga0316180_1144020 3300030736 Bacteria 892
186 Ga0316183_1074327 3300030742 Bacteria 3627
187 Ga0316181_1243246 3300030744 Bacteria 3868
188 Ga0307408_100022319 3300031548 Bacteria 4299
189 Ga0307408_100066429 3300031548 Bacteria 2648
190 Ga0307408_100103943 3300031548 Bacteria 2169
191 Ga0307408_100187547 3300031548 Bacteria 1663
192 Ga0307405_10000689 3300031731 Bacteria 13060
193 Ga0307405_10050184 3300031731 Bacteria 2582
194 Ga0307413_10004010 3300031824 Bacteria 6327
195 Ga0307413_10016016 3300031824 Bacteria 3858
196 Ga0307406_10009015 3300031901 Bacteria 5579
197 Ga0307406_10010053 3300031901 Bacteria 5326
198 Ga0307406_10503723 3300031901 Bacteria 982
199 Ga0307407_10008536 3300031903 Bacteria 4710
200 Ga0307407_10091846 3300031903 Bacteria 1863
201 Ga0307407_10924193 3300031903 Bacteria 670
202 Ga0307412_10001346 3300031911 Bacteria 13689
203 Ga0307412_10005151 3300031911 Bacteria 7322
204 Ga0307412_10007351 3300031911 Bacteria 6245
205 Ga0307412_10105917 3300031911 Bacteria 1998
206 Ga0307409_100157295 3300031995 Bacteria 1982
207 Ga0307409_100410987 3300031995 Bacteria 1295
208 Ga0307416_100009580 3300032002 Bacteria 6349
209 Ga0307416_101421112 3300032002 Bacteria 799
210 Ga0307414_10044133 3300032004 Bacteria 3041
211 Ga0307414_10071613 3300032004 Bacteria 2501
212 Ga0307414_10075402 3300032004 Bacteria 2447
213 Ga0307414_10164506 3300032004 Bacteria 1766
214 Ga0307411_10009789 3300032005 Bacteria 5065
215 Ga0307411_10010618 3300032005 Bacteria 4919
216 Ga0307411_10040007 3300032005 Bacteria 2970
217 Ga0307510_10007066 3300033180 Bacteria 13382
218 Ga0237819_02832 3300038705 Bacteria 3301
219 Ga0439438_000622 3300041405 Bacteria 15975
220 Ga0439438_001115 3300041405 Bacteria 11950
221 Ga0439438_001130 3300041405 Bacteria 11875
222 Ga0439438_008191 3300041405 Bacteria 3492
223 Ga0439438_018232 3300041405 Bacteria 2003
224 Ga0439438_018576 3300041405 Bacteria 1977
225 Ga0439438_026197 3300041405 Bacteria 1582
226 Ga0439438_053223 3300041405 Bacteria 1025
227 Ga0439447_000562 3300041407 Bacteria 13807
228 Ga0439447_001274 3300041407 Bacteria 9172
229 Ga0439447_001610 3300041407 Bacteria 8274
230 Ga0439447_002472 3300041407 Bacteria 6723
231 Ga0439447_013606 3300041407 Bacteria 2303
232 Ga0439447_035683 3300041407 Bacteria 1231
233 Ga0439447_041230 3300041407 Bacteria 1124
234 Ga0439466_0001323 3300041411 Bacteria 9652
235 Ga0439466_0002331 3300041411 Bacteria 7448
236 Ga0439466_0003049 3300041411 Bacteria 6528
237 Ga0439466_0003571 3300041411 Bacteria 6010
238 Ga0439466_0004648 3300041411 Bacteria 5272
239 Ga0439466_0022710 3300041411 Bacteria 2212
240 Ga0439466_0025087 3300041411 Bacteria 2083
241 Ga0439466_0030367 3300041411 Bacteria 1854
242 Ga0439466_0032338 3300041411 Bacteria 1784
243 Ga0439466_0050348 3300041411 Bacteria 1366
244 Ga0439465_0016881 3300041413 Bacteria 2278
245 Ga0439465_0116620 3300041413 Bacteria 933
246 Ga0439465_0168346 3300041413 Bacteria 788
247 Ga0439465_0207111 3300041413 Bacteria 716
248 Ga0439431_0000577 3300041997 Bacteria 7800
249 Ga0439431_0163933 3300041997 Bacteria 636
250 Ga0439445_0048581 3300042004 Bacteria 1141
251 Ga0439432_001876 3300042006 Bacteria 7905
252 Ga0439432_005177 3300042006 Bacteria 4711
253 Ga0439432_005468 3300042006 Bacteria 4570
254 Ga0439432_020304 3300042006 Bacteria 2209
255 Ga0439432_022764 3300042006 Bacteria 2068
256 Ga0439432_075889 3300042006 Bacteria 1021
257 Ga0439451_000883 3300042009 Bacteria 5759
258 Ga0439451_002436 3300042009 Bacteria 3769
259 Ga0439451_003412 3300042009 Bacteria 3218
260 Ga0439452_000336 3300042010 Bacteria 29226
261 Ga0439452_000995 3300042010 Bacteria 12672
262 Ga0439452_001056 3300042010 Bacteria 12156
263 Ga0439452_001213 3300042010 Bacteria 11034
264 Ga0439452_002534 3300042010 Bacteria 6721
265 Ga0439452_002813 3300042010 Bacteria 6284
266 Ga0439452_059732 3300042010 Bacteria 856
267 Ga0439456_002709 3300042013 Bacteria 3572
268 Ga0439456_024926 3300042013 Bacteria 1269
269 Ga0439456_043770 3300042013 Bacteria 973
270 Ga0439456_045940 3300042013 Bacteria 951
271 Ga0439463_001283 3300042016 Bacteria 6684
272 Ga0439463_002076 3300042016 Bacteria 5189
273 Ga0439463_023968 3300042016 Bacteria 1528
274 Ga0450911_000236 3300042115 Bacteria 20967
275 Ga0450911_001170 3300042115 Bacteria 6438
276 Ga0450911_002913 3300042115 Bacteria 3175
277 Ga0450911_009374 3300042115 Bacteria 1372
278 Ga0450919_000274 3300042121 Bacteria 5993
279 Ga0450919_008559 3300042121 Bacteria 1182
280 Ga0450920_000195 3300042122 Bacteria 8766
281 Ga0450922_000235 3300042124 Bacteria 5950
282 Ga0450922_000315 3300042124 Bacteria 5102
283 Ga0450923_004163 3300042125 Bacteria 2252
284 Ga0450890_000253 3300042127 Bacteria 7884
285 Ga0450891_004145 3300042129 Bacteria 1364
286 Ga0450902_001174 3300042137 Bacteria 3508
287 Ga0450902_001667 3300042137 Bacteria 3062
288 Ga0450902_011710 3300042137 Bacteria 1397
289 Ga0450902_012096 3300042137 Bacteria 1378
290 Ga0450902_028617 3300042137 Bacteria 935
291 Ga0450902_031531 3300042137 Bacteria 893
292 Ga0450903_000936 3300042138 Bacteria 5598
293 Ga0450903_003047 3300042138 Bacteria 2921
294 Ga0450903_040402 3300042138 Bacteria 691
295 Ga0450903_044996 3300042138 Bacteria 650
296 Ga0450904_031927 3300042139 Bacteria 552
297 Ga0450905_005396 3300042142 Bacteria 1716
298 Ga0450905_021358 3300042142 Bacteria 956
299 Ga0450906_000867 3300042145 Bacteria 6661
300 Ga0450906_001408 3300042145 Bacteria 5250
301 Ga0450906_003874 3300042145 Bacteria 3178
302 Ga0450907_000081 3300042146 Bacteria 37093
303 Ga0450907_000598 3300042146 Bacteria 9613
304 Ga0450907_007383 3300042146 Bacteria 1835
305 Ga0450910_000174 3300042147 Bacteria 6998
306 Ga0450910_001175 3300042147 Bacteria 3246
307 Ga0450910_003075 3300042147 Bacteria 2201
308 Ga0439446_0000876 3300042156 Bacteria 6467
309 Ga0439446_0001332 3300042156 Bacteria 5567
310 Ga0439446_0171698 3300042156 Bacteria 721
311 Ga0450908_000376 3300042184 Bacteria 8622
312 Ga0450908_018968 3300042184 Bacteria 1212
313 Ga0450909_001944 3300042185 Bacteria 2918
314 Ga0450909_002149 3300042185 Bacteria 2784
315 Ga0439434_0000388 3300042435 Bacteria 12500
316 Ga0439434_0051190 3300042435 Bacteria 1280
317 Ga0439464_0034012 3300042439 Bacteria 1436
318 Ga0439460_0000859 3300042461 Bacteria 6948
319 Ga0439460_0166221 3300042461 Bacteria 741
320 Ga0450918_004126 3300042531 Bacteria 2664
321 Ga0450918_021634 3300042531 Bacteria 1123
322 Ga0450918_023546 3300042531 Bacteria 1076
323 Ga0439440_0000576 3300042993 Bacteria 6210
324 Ga0495617_001218 3300046452 Bacteria 11597
325 Ga0495617_005363 3300046452 Bacteria 4553
326 Ga0495617_007102 3300046452 Bacteria 3905
327 Ga0495617_010936 3300046452 Bacteria 3103
328 Ga0495617_012573 3300046452 Bacteria 2885
329 Ga0495617_020305 3300046452 Bacteria 2245
330 Ga0495617_049747 3300046452 Bacteria 1394
331 Ga0495627_001791 3300046453 Bacteria 11479
332 Ga0495627_006194 3300046453 Bacteria 4713
333 Ga0495627_006685 3300046453 Bacteria 4492
334 Ga0495627_129309 3300046453 Bacteria 711
335 Ga0495603_0003858 3300046455 Bacteria 8923
336 Ga0495603_0092917 3300046455 Bacteria 1763
337 Ga0495603_0194583 3300046455 Bacteria 1172
338 Ga0495590_0000340 3300046457 Bacteria 24206
339 Ga0495590_0001333 3300046457 Bacteria 10744
340 Ga0495590_0002583 3300046457 Bacteria 7479
341 Ga0495590_0004417 3300046457 Bacteria 5681
342 Ga0495590_0019690 3300046457 Bacteria 2401
343 Ga0495591_000633 3300046458 Bacteria 26111
344 Ga0495591_002519 3300046458 Bacteria 10121
345 Ga0495591_002584 3300046458 Bacteria 9935
346 Ga0495591_008802 3300046458 Bacteria 4088
347 Ga0495591_009585 3300046458 Bacteria 3831
348 Ga0495591_012408 3300046458 Bacteria 3175
349 Ga0495591_018098 3300046458 Bacteria 2398
350 Ga0495591_023770 3300046458 Bacteria 1956
351 Ga0495591_059646 3300046458 Bacteria 1017
352 Ga0495591_077683 3300046458 Bacteria 851
353 Ga0495629_0015028 3300046459 Bacteria 5564
354 Ga0495638_0002645 3300046460 Bacteria 14417
355 Ga0495638_0009148 3300046460 Bacteria 6966
356 Ga0495638_0010758 3300046460 Bacteria 6332
357 Ga0495638_0023996 3300046460 Bacteria 3982
358 Ga0495638_0034364 3300046460 Bacteria 3236
359 Ga0495638_0050089 3300046460 Bacteria 2609
360 Ga0495638_0064290 3300046460 Bacteria 2260
361 Ga0495638_0064486 3300046460 Bacteria 2256
362 Ga0495638_0064956 3300046460 Bacteria 2247
363 Ga0495638_0084009 3300046460 Bacteria 1927
364 Ga0495638_0085556 3300046460 Bacteria 1906
365 Ga0495638_0134542 3300046460 Bacteria 1449
366 Ga0495638_0142437 3300046460 Bacteria 1397
367 Ga0495638_0165470 3300046460 Bacteria 1272
368 Ga0495653_0010482 3300046463 Bacteria 7584
369 Ga0495653_0052221 3300046463 Bacteria 3133
370 Ga0495653_0085405 3300046463 Bacteria 2321
371 Ga0495653_0159743 3300046463 Bacteria 1565
372 Ga0495650_0007966 3300046471 Bacteria 6272
373 Ga0495650_0015573 3300046471 Bacteria 3893
374 Ga0495650_0016047 3300046471 Bacteria 3813
375 Ga0495650_0017444 3300046471 Bacteria 3600
376 Ga0495650_0018746 3300046471 Bacteria 3430
377 Ga0495650_0023955 3300046471 Bacteria 2893
378 Ga0495650_0073164 3300046471 Bacteria 1339
379 Ga0495650_0092021 3300046471 Bacteria 1152
380 Ga0495580_0250074 3300046472 Bacteria 1214
381 Ga0495582_0004449 3300046473 Bacteria 7884
382 Ga0495605_0000700 3300046474 Bacteria 24891
383 Ga0495605_0002331 3300046474 Bacteria 11830
384 Ga0495605_0019673 3300046474 Bacteria 3602
385 Ga0495605_0023230 3300046474 Bacteria 3265
386 Ga0495605_0041057 3300046474 Bacteria 2305
387 Ga0495605_0060777 3300046474 Bacteria 1810
388 Ga0495605_0151194 3300046474 Bacteria 1036
389 Ga0495639_0000127 3300046475 Bacteria 39107
390 Ga0495639_0037026 3300046475 Bacteria 2186
391 Ga0495664_0114421 3300046477 Bacteria 1630
392 Ga0495584_0001750 3300046491 Bacteria 12669
393 Ga0495584_0004667 3300046491 Bacteria 7342
394 Ga0495584_0008797 3300046491 Bacteria 5221
395 Ga0495584_0008873 3300046491 Bacteria 5200
396 Ga0495584_0011359 3300046491 Bacteria 4561
397 Ga0495584_0012377 3300046491 Bacteria 4354
398 Ga0495584_0021299 3300046491 Bacteria 3294
399 Ga0495584_0024745 3300046491 Bacteria 3044
400 Ga0495584_0040868 3300046491 Bacteria 2341
401 Ga0495584_0044151 3300046491 Bacteria 2249
402 Ga0495584_0073468 3300046491 Bacteria 1718
403 Ga0495584_0138481 3300046491 Bacteria 1235
404 Ga0495585_0002826 3300046492 Bacteria 12104
405 Ga0495585_0011764 3300046492 Bacteria 5170
406 Ga0495585_0018754 3300046492 Bacteria 3991
407 Ga0495585_0045695 3300046492 Bacteria 2443
408 Ga0495585_0049598 3300046492 Bacteria 2330
409 Ga0495585_0099235 3300046492 Bacteria 1559
410 Ga0495585_0162603 3300046492 Bacteria 1157
411 Ga0495585_0186226 3300046492 Bacteria 1064
412 Ga0495585_0208205 3300046492 Bacteria 992
413 Ga0495594_0016316 3300046499 Bacteria 3912
414 Ga0495594_0060916 3300046499 Bacteria 2088
415 Ga0495594_0075949 3300046499 Bacteria 1873
416 Ga0495596_0000457 3300046500 Bacteria 25996
417 Ga0495596_0019474 3300046500 Bacteria 2787
418 Ga0495607_0001842 3300046501 Bacteria 18063
419 Ga0495607_0002479 3300046501 Bacteria 14986
420 Ga0495607_0005447 3300046501 Bacteria 9109
421 Ga0495607_0005775 3300046501 Bacteria 8799
422 Ga0495607_0013328 3300046501 Bacteria 5390
423 Ga0495607_0013603 3300046501 Bacteria 5327
424 Ga0495607_0016376 3300046501 Bacteria 4784
425 Ga0495607_0061679 3300046501 Bacteria 2129
426 Ga0495607_0077667 3300046501 Bacteria 1833
427 Ga0495607_0084186 3300046501 Bacteria 1740
428 Ga0495607_0137774 3300046501 Bacteria 1262
429 Ga0495607_0148658 3300046501 Bacteria 1201
430 Ga0495607_0179240 3300046501 Bacteria 1063
431 Ga0495607_0203729 3300046501 Bacteria 977
432 Ga0495583_0007690 3300046506 Bacteria 6716
433 Ga0495583_0014015 3300046506 Bacteria 4439
434 Ga0495583_0014566 3300046506 Bacteria 4330
435 Ga0495583_0022404 3300046506 Bacteria 3223
436 Ga0495583_0106411 3300046506 Bacteria 1192
437 Ga0495583_0138743 3300046506 Bacteria 1013
438 Ga0495606_0001929 3300046507 Bacteria 25724
439 Ga0495606_0007990 3300046507 Bacteria 9303
440 Ga0495606_0012463 3300046507 Bacteria 6812
441 Ga0495606_0017049 3300046507 Bacteria 5508
442 Ga0495606_0041100 3300046507 Bacteria 3102
443 Ga0495610_0002647 3300046512 Bacteria 14796
444 Ga0495610_0005392 3300046512 Bacteria 9113
445 Ga0495610_0009009 3300046512 Bacteria 6369
446 Ga0495610_0010638 3300046512 Bacteria 5698
447 Ga0495610_0011594 3300046512 Bacteria 5375
448 Ga0495610_0012442 3300046512 Bacteria 5122
449 Ga0495610_0087769 3300046512 Bacteria 1415
450 Ga0495610_0125868 3300046512 Bacteria 1117
451 Ga0495610_0192625 3300046512 Bacteria 840
452 Ga0495616_0005949 3300046513 Bacteria 7439
453 Ga0495616_0006578 3300046513 Bacteria 7020
454 Ga0495616_0010463 3300046513 Bacteria 5368
455 Ga0495616_0011608 3300046513 Bacteria 5040
456 Ga0495616_0024545 3300046513 Bacteria 3232
457 Ga0495616_0069276 3300046513 Bacteria 1710
458 Ga0495616_0073496 3300046513 Bacteria 1649
459 Ga0495616_0100340 3300046513 Bacteria 1358
460 Ga0495616_0105290 3300046513 Bacteria 1317
461 Ga0495616_0156085 3300046513 Bacteria 1029
462 Ga0495616_0180702 3300046513 Bacteria 937
463 Ga0495620_0002168 3300046515 Bacteria 11412
464 Ga0495620_0002462 3300046515 Bacteria 10729
465 Ga0495620_0008445 3300046515 Bacteria 5529
466 Ga0495620_0028806 3300046515 Bacteria 2577
467 Ga0495620_0046241 3300046515 Bacteria 1880
468 Ga0495620_0075737 3300046515 Bacteria 1368
469 Ga0495620_0083338 3300046515 Bacteria 1291
470 Ga0495628_0840388 3300046516 Bacteria 640
471 Ga0495630_0078352 3300046517 Bacteria 2491
472 Ga0495630_0091744 3300046517 Bacteria 2295
473 Ga0495630_0466701 3300046517 Bacteria 967
474 Ga0495631_0000294 3300046518 Bacteria 34947
475 Ga0495631_0002372 3300046518 Bacteria 10702
476 Ga0495631_0007666 3300046518 Bacteria 5481
477 Ga0495631_0041905 3300046518 Bacteria 2024
478 Ga0495631_0044994 3300046518 Bacteria 1944
479 Ga0495632_0000183 3300046519 Bacteria 63981
480 Ga0495632_0001201 3300046519 Bacteria 21985
481 Ga0495632_0002627 3300046519 Bacteria 13526
482 Ga0495632_0004421 3300046519 Bacteria 9556
483 Ga0495632_0005950 3300046519 Bacteria 7946
484 Ga0495632_0007805 3300046519 Bacteria 6666
485 Ga0495632_0017318 3300046519 Bacteria 3981
486 Ga0495632_0035099 3300046519 Bacteria 2561
487 Ga0495632_0049023 3300046519 Bacteria 2089
488 Ga0495632_0093532 3300046519 Bacteria 1422
489 Ga0495637_0002968 3300046520 Bacteria 9127
490 Ga0495637_0009266 3300046520 Bacteria 4805
491 Ga0495637_0010088 3300046520 Bacteria 4583
492 Ga0495637_0010262 3300046520 Bacteria 4536
493 Ga0495637_0035167 3300046520 Bacteria 2189
494 Ga0495637_0043001 3300046520 Bacteria 1930
495 Ga0495637_0045602 3300046520 Bacteria 1858
496 Ga0495637_0059646 3300046520 Bacteria 1569
497 Ga0495637_0083973 3300046520 Bacteria 1265
498 Ga0495637_0111711 3300046520 Bacteria 1058
499 Ga0495637_0131342 3300046520 Bacteria 956
500 Ga0495637_0161470 3300046520 Bacteria 840
501 Ga0495637_0205299 3300046520 Bacteria 722
502 Ga0495637_0295540 3300046520 Bacteria 575
503 Ga0495643_0014649 3300046522 Bacteria 4659
504 Ga0495643_0016933 3300046522 Bacteria 4272
505 Ga0495643_0017538 3300046522 Bacteria 4182
506 Ga0495643_0019098 3300046522 Bacteria 3968
507 Ga0495643_0105656 3300046522 Bacteria 1437
508 Ga0495644_0004258 3300046523 Bacteria 5618
509 Ga0495644_0005826 3300046523 Bacteria 4812
510 Ga0495644_0040476 3300046523 Bacteria 1757
511 Ga0495644_0066275 3300046523 Bacteria 1356
512 Ga0495644_0273253 3300046523 Bacteria 658
513 Ga0495648_0000923 3300046524 Bacteria 30591
514 Ga0495648_0002722 3300046524 Bacteria 15969
515 Ga0495648_0036194 3300046524 Bacteria 3189
516 Ga0495648_0079026 3300046524 Bacteria 1879
517 Ga0495648_0095692 3300046524 Bacteria 1651
518 Ga0495648_0099249 3300046524 Bacteria 1611
519 Ga0495648_0203327 3300046524 Bacteria 989
520 Ga0495648_0228193 3300046524 Bacteria 913
521 Ga0495648_0275636 3300046524 Bacteria 799
522 Ga0495666_0015745 3300046526 Bacteria 3767
523 Ga0495666_0032703 3300046526 Bacteria 2544
524 Ga0495642_0000312 3300046528 Bacteria 26988
525 Ga0495642_0000897 3300046528 Bacteria 13984
526 Ga0495642_0002322 3300046528 Bacteria 7760
527 Ga0495652_0439226 3300046529 Bacteria 916
528 Ga0495654_0002100 3300046530 Bacteria 13029
529 Ga0495654_0002528 3300046530 Bacteria 11757
530 Ga0495654_0007579 3300046530 Bacteria 6047
531 Ga0495654_0007607 3300046530 Bacteria 6034
532 Ga0495654_0012687 3300046530 Bacteria 4524
533 Ga0495654_0021176 3300046530 Bacteria 3384
534 Ga0495654_0021975 3300046530 Bacteria 3317
535 Ga0495654_0024421 3300046530 Bacteria 3122
536 Ga0495654_0027101 3300046530 Bacteria 2940
537 Ga0495654_0028283 3300046530 Bacteria 2867
538 Ga0495654_0031338 3300046530 Bacteria 2699
539 Ga0495654_0031917 3300046530 Bacteria 2672
540 Ga0495654_0110378 3300046530 Bacteria 1255
541 Ga0495654_0175813 3300046530 Bacteria 930
542 Ga0495586_0015830 3300046535 Bacteria 4011
543 Ga0495587_0001908 3300046536 Bacteria 13882
544 Ga0495587_0007201 3300046536 Bacteria 7218
545 Ga0495609_0001932 3300046538 Bacteria 13181
546 Ga0495609_0004194 3300046538 Bacteria 7993
547 Ga0495609_0004674 3300046538 Bacteria 7422
548 Ga0495609_0021438 3300046538 Bacteria 2980
549 Ga0495609_0051376 3300046538 Bacteria 1835
550 Ga0495609_0079690 3300046538 Bacteria 1432
551 Ga0495609_0350620 3300046538 Bacteria 595
552 Ga0495597_0003033 3300046542 Bacteria 10119
553 Ga0495597_0009193 3300046542 Bacteria 4899
554 Ga0495597_0010022 3300046542 Bacteria 4651
555 Ga0495597_0014359 3300046542 Bacteria 3773
556 Ga0495597_0020977 3300046542 Bacteria 3038
557 Ga0495597_0029760 3300046542 Bacteria 2491
558 Ga0495597_0050053 3300046542 Bacteria 1845
559 Ga0495597_0061422 3300046542 Bacteria 1636
560 Ga0495622_0001755 3300046557 Bacteria 10719
561 Ga0495622_0015333 3300046557 Bacteria 3563
562 Ga0495622_0019585 3300046557 Bacteria 3150
563 Ga0495622_0020506 3300046557 Bacteria 3077
564 Ga0495622_0258027 3300046557 Bacteria 765
565 Ga0495622_0441280 3300046557 Bacteria 558
566 Ga0495633_0003303 3300046558 Bacteria 10841
567 Ga0495633_0011367 3300046558 Bacteria 4802
568 Ga0495633_0065146 3300046558 Bacteria 1703
569 Ga0495633_0135241 3300046558 Bacteria 1140
570 Ga0495656_0000491 3300046615 Bacteria 12892
571 Ga0495656_0032403 3300046615 Bacteria 2126
572 Ga0495656_0052182 3300046615 Bacteria 1752
573 Ga0495668_0004170 3300046616 Bacteria 10429
574 Ga0495668_0027292 3300046616 Bacteria 3235
575 Ga0495668_0032164 3300046616 Bacteria 2953
576 Ga0495668_0106871 3300046616 Bacteria 1530
577 Ga0495634_0002797 3300046642 Bacteria 14334
578 Ga0495611_0000487 3300046648 Bacteria 23735
579 Ga0495611_0054715 3300046648 Bacteria 1804
580 Ga0495625_0007666 3300046660 Bacteria 9357
581 Ga0495625_0014306 3300046660 Bacteria 6339
582 Ga0495625_0014464 3300046660 Bacteria 6296
583 Ga0495625_0015838 3300046660 Bacteria 5952
584 Ga0495625_0016152 3300046660 Bacteria 5882
585 Ga0495625_0106148 3300046660 Bacteria 1923
586 Ga0495635_0002332 3300046663 Bacteria 12897
587 Ga0495635_0031323 3300046663 Bacteria 3692
588 Ga0495659_0000591 3300046664 Bacteria 13378
589 Ga0495659_0001632 3300046664 Bacteria 7526
590 Ga0495659_0010672 3300046664 Bacteria 2953
591 Ga0495659_0064831 3300046664 Bacteria 1357
592 Ga0495661_0008492 3300046665 Bacteria 7102
593 Ga0495661_0009218 3300046665 Bacteria 6782
594 Ga0495661_0017401 3300046665 Bacteria 4748
595 Ga0495661_0051155 3300046665 Bacteria 2496
596 Ga0495661_0057687 3300046665 Bacteria 2317
597 Ga0495661_0066453 3300046665 Bacteria 2122
598 Ga0495661_0070489 3300046665 Bacteria 2045
599 Ga0495661_0095133 3300046665 Bacteria 1687
600 Ga0495661_0139804 3300046665 Bacteria 1318
601 Ga0495588_0023300 3300046674 Bacteria 3065
602 Ga0495588_0027484 3300046674 Bacteria 2843
603 Ga0495588_0046580 3300046674 Bacteria 2224
604 Ga0495657_0050499 3300046675 Bacteria 2796
605 Ga0495623_0002029 3300046679 Bacteria 13596
606 Ga0495623_0009473 3300046679 Bacteria 6323
607 Ga0495646_0010104 3300046680 Bacteria 6001
608 Ga0495646_0047230 3300046680 Bacteria 2621
609 Ga0495646_0086285 3300046680 Bacteria 1820
610 Ga0495669_0004265 3300046684 Bacteria 5895
611 Ga0495669_0165100 3300046684 Bacteria 1052
612 Ga0495613_0020891 3300046689 Bacteria 4880
613 Ga0495613_0022276 3300046689 Bacteria 4722
614 Ga0495613_0042354 3300046689 Bacteria 3369
615 Ga0495613_0561385 3300046689 Bacteria 763
616 Ga0495624_0001085 3300046690 Bacteria 21505
617 Ga0495670_0001055 3300046691 Bacteria 13357
618 Ga0495670_0001104 3300046691 Bacteria 13098
619 Ga0495670_0005125 3300046691 Bacteria 6442
620 Ga0495670_0008302 3300046691 Bacteria 5105
621 Ga0495670_0009909 3300046691 Bacteria 4684
622 Ga0495670_0330820 3300046691 Bacteria 818
623 Ga0495671_0004083 3300046692 Bacteria 8807
624 Ga0495671_0007553 3300046692 Bacteria 6183
625 Ga0495671_0012257 3300046692 Bacteria 4687
626 Ga0495671_0015074 3300046692 Bacteria 4150
627 Ga0495671_0015870 3300046692 Bacteria 4031
628 Ga0495671_0027361 3300046692 Bacteria 2946
629 Ga0495671_0030922 3300046692 Bacteria 2739
630 Ga0495671_0031043 3300046692 Bacteria 2732
631 Ga0495671_0035115 3300046692 Bacteria 2547
632 Ga0495671_0055995 3300046692 Bacteria 1952
633 Ga0495671_0057175 3300046692 Bacteria 1930
634 Ga0495671_0060411 3300046692 Bacteria 1871
635 Ga0495671_0076969 3300046692 Bacteria 1635
636 Ga0495671_0079487 3300046692 Bacteria 1607
637 Ga0495649_0001766 3300046694 Bacteria 15936
638 Ga0495649_0004367 3300046694 Bacteria 9252
639 Ga0495649_0005632 3300046694 Bacteria 7914
640 Ga0495649_0016452 3300046694 Bacteria 4190
641 Ga0495649_0020115 3300046694 Bacteria 3745
642 Ga0495649_0020534 3300046694 Bacteria 3705
643 Ga0495649_0032096 3300046694 Bacteria 2895
644 Ga0495649_0049470 3300046694 Bacteria 2283
645 Ga0495649_0071964 3300046694 Bacteria 1853
646 Ga0495649_0095201 3300046694 Bacteria 1585
647 Ga0495649_0177445 3300046694 Bacteria 1112
648 Ga0495589_0001608 3300046794 Bacteria 12945
649 Ga0495589_0001746 3300046794 Bacteria 12363
650 Ga0495589_0005329 3300046794 Bacteria 6789
651 Ga0495589_0005643 3300046794 Bacteria 6596
652 Ga0495589_0015569 3300046794 Bacteria 3911
653 Ga0495589_0016565 3300046794 Bacteria 3787
654 Ga0495589_0033831 3300046794 Bacteria 2565
655 Ga0495589_0057359 3300046794 Bacteria 1915
656 Ga0495589_0086181 3300046794 Bacteria 1525
657 Ga0495600_0160639 3300046809 Bacteria 1452
658 Ga0495660_0003783 3300046810 Bacteria 9280
659 Ga0495660_0003851 3300046810 Bacteria 9179
660 Ga0495660_0011544 3300046810 Bacteria 5123
661 Ga0495660_0012592 3300046810 Bacteria 4908
662 Ga0495660_0021925 3300046810 Bacteria 3652
663 Ga0495660_0029670 3300046810 Bacteria 3084
664 Ga0495660_0030468 3300046810 Bacteria 3038
665 Ga0495660_0047599 3300046810 Bacteria 2347
666 Ga0495660_0053564 3300046810 Bacteria 2189
667 Ga0495660_0058681 3300046810 Bacteria 2071
668 Ga0495660_0103433 3300046810 Bacteria 1463
669 Ga0495660_0117331 3300046810 Bacteria 1350
670 Ga0495660_0289892 3300046810 Bacteria 745
671 Ga0495581_0010307 3300047315 Bacteria 5406
672 Ga0495581_0044694 3300047315 Bacteria 2561
673 Ga0495604_0029265 3300047317 Bacteria 4381
674 Ga0495604_0059325 3300047317 Bacteria 2933
675 Ga0495604_0111279 3300047317 Bacteria 1996
676 Ga0495636_0001055 3300047318 Bacteria 10355
677 Ga0495636_0022025 3300047318 Bacteria 2575
678 Ga0495674_0047960 3300047319 Bacteria 3783
679 Ga0495672_0002383 3300047320 Bacteria 17353
680 Ga0495672_0003039 3300047320 Bacteria 14728
681 Ga0495672_0003187 3300047320 Bacteria 14263
682 Ga0495672_0005960 3300047320 Bacteria 9549
683 Ga0495672_0012445 3300047320 Bacteria 5937
684 Ga0495672_0017745 3300047320 Bacteria 4749
685 Ga0495672_0031915 3300047320 Bacteria 3283
686 Ga0495672_0032209 3300047320 Bacteria 3265
687 Ga0495672_0058391 3300047320 Bacteria 2236
688 Ga0495672_0073928 3300047320 Bacteria 1921
689 Ga0495672_0082572 3300047320 Bacteria 1786
690 Ga0495672_0106604 3300047320 Bacteria 1510
691 Ga0495676_0015978 3300047321 Bacteria 6668
692 Ga0495676_0056136 3300047321 Bacteria 3116
693 Ga0495680_0001587 3300047322 Bacteria 24283
694 Ga0495680_0093522 3300047322 Bacteria 2250
695 Ga0495680_0284472 3300047322 Bacteria 1164
696 Ga0495680_0416067 3300047322 Bacteria 925
697 Ga0495683_0000198 3300047323 Bacteria 56969
698 Ga0495683_0000448 3300047323 Bacteria 32509
699 Ga0495683_0000617 3300047323 Bacteria 26583
700 Ga0495683_0000910 3300047323 Bacteria 20890
701 Ga0495683_0009635 3300047323 Bacteria 5141
702 Ga0495683_0012907 3300047323 Bacteria 4381
703 Ga0495683_0013782 3300047323 Bacteria 4220
704 Ga0495683_0027507 3300047323 Bacteria 2907
705 Ga0495683_0056254 3300047323 Bacteria 1957
706 Ga0495683_0086781 3300047323 Bacteria 1520
707 Ga0495683_0123406 3300047323 Bacteria 1227
708 Ga0495683_0162825 3300047323 Bacteria 1030
709 Ga0495687_003790 3300047443 Bacteria 10669
710 Ga0495687_013843 3300047443 Bacteria 4182
711 Ga0495675_0030493 3300047444 Bacteria 3440
712 Ga0495675_0117975 3300047444 Bacteria 1653
713 Ga0495677_0001430 3300047445 Bacteria 9577
714 Ga0495679_005361 3300047446 Bacteria 5694
715 Ga0495679_011232 3300047446 Bacteria 3470
716 Ga0495679_013436 3300047446 Bacteria 3075
717 Ga0495679_145801 3300047446 Bacteria 637
718 Ga0495685_160417 3300047447 Bacteria 728
719 Ga0495673_0000383 3300047469 Bacteria 52691
720 Ga0495673_0000472 3300047469 Bacteria 43659
721 Ga0495673_0002062 3300047469 Bacteria 14697
722 Ga0495673_0021691 3300047469 Bacteria 3165
723 Ga0495673_0027958 3300047469 Bacteria 2676
724 Ga0495673_0031306 3300047469 Bacteria 2491
725 Ga0495673_0053895 3300047469 Bacteria 1751
726 Ga0495673_0058980 3300047469 Bacteria 1651
727 Ga0495673_0066051 3300047469 Bacteria 1534
728 Ga0495673_0089684 3300047469 Bacteria 1258
729 Ga0495673_0147903 3300047469 Bacteria 910
730 Ga0495673_0180215 3300047469 Bacteria 800
731 Ga0495681_0003553 3300047470 Bacteria 10852
732 Ga0495681_0003948 3300047470 Bacteria 10223
733 Ga0495681_0004564 3300047470 Bacteria 9433
734 Ga0495681_0005637 3300047470 Bacteria 8344
735 Ga0495681_0006128 3300047470 Bacteria 7940
736 Ga0495681_0007283 3300047470 Bacteria 7100
737 Ga0495681_0009958 3300047470 Bacteria 5797
738 Ga0495681_0010065 3300047470 Bacteria 5757
739 Ga0495681_0012873 3300047470 Bacteria 4890
740 Ga0495681_0026846 3300047470 Bacteria 2988
741 Ga0495681_0031297 3300047470 Bacteria 2695
742 Ga0495681_0043211 3300047470 Bacteria 2175
743 Ga0495681_0058497 3300047470 Bacteria 1785
744 Ga0495684_0035067 3300047471 Bacteria 3849
745 Ga0495684_0045783 3300047471 Bacteria 3347
746 Ga0495686_0005610 3300047472 Bacteria 9853
747 Ga0495686_0019160 3300047472 Bacteria 4576
748 Ga0495686_0021948 3300047472 Bacteria 4228
749 Ga0495686_0030929 3300047472 Bacteria 3474
750 Ga0495686_0041748 3300047472 Bacteria 2919
751 Ga0495593_0006783 3300047673 Bacteria 6703
752 Ga0495593_0018799 3300047673 Bacteria 3879
753 Ga0495593_0043944 3300047673 Bacteria 2392
754 Ga0495602_0070938 3300048088 Bacteria 2977
755 Ga0495602_0188766 3300048088 Bacteria 1582
756 Ga0495626_0001604 3300048091 Bacteria 17630
757 Ga0495626_0001676 3300048091 Bacteria 17098
758 Ga0495626_0002209 3300048091 Bacteria 13951
759 Ga0495626_0008122 3300048091 Bacteria 5784
760 Ga0495626_0008334 3300048091 Bacteria 5693
761 Ga0495626_0013008 3300048091 Bacteria 4338
762 Ga0495626_0020492 3300048091 Bacteria 3293
763 Ga0495626_0022725 3300048091 Bacteria 3095
764 Ga0495626_0025322 3300048091 Bacteria 2902
765 Ga0495626_0049594 3300048091 Bacteria 1943
766 Ga0495626_0069544 3300048091 Bacteria 1585
767 Ga0496102_0001399 3300048905 Bacteria 21432
768 Ga0496103_0007572 3300048906 Bacteria 6470
769 Ga0496104_0481991 3300048907 Bacteria 1152
770 Ga0496110_0098252 3300048913 Bacteria 2623
771 Ga0496111_0242925 3300048914 Bacteria 1337
772 Ga0496113_0560729 3300048916 Bacteria 916
773 Ga0496116_0000913 3300048919 Bacteria 36517
774 Ga0496116_0001217 3300048919 Bacteria 29999
775 Ga0496116_0002975 3300048919 Bacteria 17220
776 Ga0496116_0010096 3300048919 Bacteria 7958
777 Ga0496116_0158124 3300048919 Bacteria 1248
778 Ga0496117_0001277 3300048920 Bacteria 37322
779 Ga0496117_0019550 3300048920 Bacteria 5558
780 Ga0496117_0043688 3300048920 Bacteria 3255
781 Ga0496117_0091319 3300048920 Bacteria 1959
782 Ga0496118_0025378 3300048921 Bacteria 5085
783 Ga0496118_0042355 3300048921 Bacteria 3593
784 Ga0496118_0047937 3300048921 Bacteria 3306
785 Ga0496118_0069152 3300048921 Bacteria 2560
786 Ga0496118_0103877 3300048921 Bacteria 1909
787 Ga0496118_0247716 3300048921 Bacteria 1014
788 Ga0496119_0090528 3300048922 Bacteria 1739
789 Ga0496120_0181563 3300048923 Bacteria 1032
790 Ga0496121_0002654 3300048924 Bacteria 26822
791 Ga0496121_0025851 3300048924 Bacteria 5554
792 Ga0496121_0067182 3300048924 Bacteria 2906
793 Ga0496121_0115395 3300048924 Bacteria 2039
794 Ga0496121_0328734 3300048924 Bacteria 1026
795 Ga0496121_0431908 3300048924 Bacteria 854
796 Ga0496122_0016792 3300048925 Bacteria 6895
797 Ga0496122_0039712 3300048925 Bacteria 3749
798 Ga0496122_0200246 3300048925 Bacteria 1168
799 Ga0496123_0005030 3300048926 Bacteria 13527
800 Ga0496123_0096379 3300048926 Bacteria 1737
801 Ga0496123_0147422 3300048926 Bacteria 1275
802 Ga0496124_0003331 3300048927 Bacteria 19787
803 Ga0496124_0031392 3300048927 Bacteria 4703
804 Ga0496124_0064800 3300048927 Bacteria 3049
805 Ga0496124_0287735 3300048927 Bacteria 1194
806 Ga0496124_0470892 3300048927 Bacteria 851
807 Ga0496125_0014908 3300048928 Bacteria 7549
808 Ga0496125_0059297 3300048928 Bacteria 3085
809 Ga0496125_0101416 3300048928 Bacteria 2118
810 Ga0496126_0339663 3300048929 Bacteria 1230
811 Ga0495678_002163 3300049459 Bacteria 13858
812 Ga0495678_003284 3300049459 Bacteria 10106
813 Ga0495678_007151 3300049459 Bacteria 5828
814 Ga0495678_019678 3300049459 Bacteria 3005
815 Ga0495678_022710 3300049459 Bacteria 2738
816 Ga0495678_039680 3300049459 Bacteria 1897
817 Ga0495678_040966 3300049459 Bacteria 1857
818 Ga0495682_0000153 3300049460 Bacteria 59021
819 Ga0495682_0000633 3300049460 Bacteria 23509
820 Ga0495682_0011152 3300049460 Bacteria 3463
821 Ga0495682_0071470 3300049460 Bacteria 1249
822 Ga0495682_0078256 3300049460 Bacteria 1189
823 Ga0495682_0095920 3300049460 Bacteria 1064
824 Ga0495682_0142704 3300049460 Bacteria 855
825 Ga0495682_0163899 3300049460 Bacteria 791
826 Ga0501259_089454 3300049688 Bacteria 690
827 Ga0501241_001926 3300049758 Bacteria 4082
828 Ga0501269_019566 3300049766 Bacteria 842
829 nmdc:mga03n38_404361_c1 3300050490 Bacteria 752
830 nmdc:mga00v17_224114_c1 3300050491 Bacteria 1218
831 nmdc:mga00v17_27354_c1 3300050491 Bacteria 3329
832 nmdc:mga00v17_89861_c1 3300050491 Bacteria 1928
833 nmdc:mga07m45_302200_c1 3300050496 Bacteria 930
834 nmdc:mga08x19_185715_c1 3300050514 Bacteria 1421
835 nmdc:mga08x19_538098_c1 3300050514 Bacteria 826
836 nmdc:mga0sz30_5614_c4 3300050516 Bacteria 2015
837 Ga0500572_002744 3300053111 Bacteria 4156

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231004 2511257932 157
2 iso_pu_bacteria 2511231007 2511270636 157
3 iso_pu_bacteria 2511231010 2511290191 157
4 iso_pu_bacteria 2511231016 2511324042 157
5 iso_pu_bacteria 2511231022 2511363745 157
6 iso_pu_bacteria 2554235341 2555668249 157
7 iso_pu_bacteria 2599185160 2599355250 157
8 iso_pu_bacteria 2599185161 2599360927 157
9 iso_pu_bacteria 2599185162 2599367249 157
10 iso_pu_bacteria 2599185163 2599374039 157
11 iso_pu_bacteria 2599185164 2599380356 157
12 iso_pu_bacteria 2599185165 2599386803 157
13 iso_pu_bacteria 2599185166 2599392897 157
14 iso_pu_bacteria 2599185168 2599404664 157
15 iso_pu_bacteria 2599185181 2599462084 157
16 iso_pu_bacteria 2599185182 2599466873 157
17 iso_pu_bacteria 2599185186 2599490824 157
18 iso_pu_bacteria 2599185188 2599501342 157
19 iso_pu_bacteria 2599185212 2599616876 157
20 iso_pu_bacteria 2599185248 2599770591 157
21 iso_pu_bacteria 2599185289 2599886473 157
22 iso_pu_bacteria 2599185291 2599896838 157
23 iso_pu_bacteria 2599185300 2599931643 157
24 iso_pu_bacteria 2599185302 2599945648 157
25 iso_pu_bacteria 2599185304 2599957401 157
26 iso_pu_bacteria 2599185305 2599959627 157
27 iso_pu_bacteria 2599185306 2599966110 157
28 iso_pu_bacteria 2599185308 2599980775 157
29 iso_pu_bacteria 2599185309 2599986539 157
30 iso_pu_bacteria 2599185310 2599987060 157
31 iso_pu_bacteria 2599185311 2599996417 157
32 iso_pu_bacteria 2599185312 2600002648 157
33 iso_pu_bacteria 2599185313 2600006473 157
34 iso_pu_bacteria 2599185314 2600014686 157
35 iso_pu_bacteria 2599185315 2600016821 157
36 iso_pu_bacteria 2599185316 2600024143 157
37 iso_pu_bacteria 2599185317 2600031169 157
38 iso_pu_bacteria 2599185318 2600035326 157
39 iso_pu_bacteria 2599185319 2600042698 157
40 iso_pu_bacteria 2599185320 2600050565 157
41 iso_pu_bacteria 2599185321 2600053716 157
42 iso_pu_bacteria 2599185322 2600058279 157
43 iso_pu_bacteria 2599185323 2600064045 157
44 iso_pu_bacteria 2599185324 2600074756 157
45 iso_pu_bacteria 2599185325 2600078493 157
46 iso_pu_bacteria 2599185356 2600214706 157
47 iso_pu_bacteria 2600254930 2600360142 157
48 iso_pu_bacteria 2600255313 2601774589 157
49 iso_pu_bacteria 2600255318 2601800296 157
50 iso_pu_bacteria 2603880185 2606074438 157
51 iso_pu_bacteria 2603880199 2606127301 157
52 iso_pu_bacteria 2623620443 2624479048 157
53 iso_pu_bacteria 2623620446 2624493956 157
54 iso_pu_bacteria 2643221650 2644282298 157
55 iso_pu_bacteria 2651869719 2652548714 157
56 iso_pu_bacteria 2667528170 2671092194 157
57 iso_pu_bacteria 2667528171 2671097851 157
58 iso_pu_bacteria 2667528176 2671127582 157
59 iso_pu_bacteria 2675903515 2678261761 157
60 iso_pu_bacteria 2713897148 2715752955 157
61 iso_pu_bacteria 2713897149 2715758769 157
62 iso_pu_bacteria 2744054620 2745008110 157
63 iso_pu_bacteria 2791355520 2794594571 157
64 iso_pu_bacteria 2808606361 2808856452 157
65 iso_pu_bacteria 2808606376 2808924538 157
66 iso_pu_bacteria 2808606378 2808936400 157
67 iso_pu_bacteria 2808606380 2808946629 157
68 iso_pu_bacteria 2808606383 2808964821 157
69 iso_pu_bacteria 2808606389 2808999713 157
70 iso_pu_bacteria 2808606445 2809216022 157
71 iso_pu_bacteria 2818991464 2819702935 157
72 iso_pu_bacteria 2825651385 2825653512 157
73 iso_pu_bacteria 2842832357 2842833121 157
74 iso_pu_bacteria 2842843487 2842847233 157
75 iso_pu_bacteria 2842854478 2842857062 157
76 iso_pu_bacteria 2844665904 2844668771 157
77 iso_pu_bacteria 2878029506 2878031006 157
78 iso_pu_bacteria 2913036834 2913038109 157
79 iso_pu_bacteria 2917070673 2917072015 157
80 iso_pu_bacteria 2919063839 2919064480 157
81 iso_pu_bacteria 2919385768 2919386046 157
82 iso_pu_bacteria 2919481497 2919483022 157
83 iso_pu_bacteria 2919487758 2919490839 157
84 iso_pu_bacteria 2919697872 2919700126 157
85 iso_pu_bacteria 2923586266 2923590768 157
86 iso_pu_bacteria 2929144301 2929145553 157
87 iso_pu_bacteria 2931369376 2931371111 157
88 iso_pu_bacteria 2935353572 2935354187 157
89 iso_pu_bacteria 2974289157 2974292552 157
90 iso_pu_bacteria 2988728565 2988733105 157
91 iso_pu_bacteria 2998139840 2998141255 157
92 iso_pu_bacteria 3007718800 3007719430 157
93 iso_pu_bacteria 3007855910 3007860318 157
94 iso_pu_bacteria 3007866637 3007871608 157
95 iso_pu_bacteria 637000220 637318612 157
96 iso_pu_bacteria 8019769354 8019770812 157
97 iso_pu_bacteria 8019775933 8019776793 157
98 iso_pu_bacteria 8029995093 8029999492 157
99 iso_pu_bacteria 8056143049 8056147716 157
100 iso_pu_bacteria 8056155041 8056159520 157
101 iso_pu_bacteria 8056166840 8056169802 157
102 iso_pu_bacteria 8056172158 8056175914 157
103 iso_pu_bacteria 8056177738 8056180355 157
104 iso_pu_bacteria 8057798959 8057803565 157
105 3300005288 Ga0065714_10138296 Ga0065714_101382962 158
106 3300013104 Ga0157370_10013230 Ga0157370_100132309 158
107 3300013306 Ga0163162_10008097 Ga0163162_100080977 158
108 3300017792 Ga0163161_10129951 Ga0163161_101299514 158
109 3300046455 Ga0495603_0092917 Ga0495603_0092917_1226_1720 158
110 3300046499 Ga0495594_0075949 Ga0495594_0075949_1243_1737 158
111 3300046530 Ga0495654_0031338 Ga0495654_0031338_261_755 158
112 3300046538 Ga0495609_0350620 Ga0495609_0350620_49_543 158
113 3300046557 Ga0495622_0258027 Ga0495622_0258027_55_549 158
114 3300046689 Ga0495613_0561385 Ga0495613_0561385_28_522 158
115 3300046691 Ga0495670_0008302 Ga0495670_0008302_71_565 158
116 3300046692 Ga0495671_0030922 Ga0495671_0030922_224_718 158
117 3300046810 Ga0495660_0047599 Ga0495660_0047599_1260_1754 158
118 3300047323 Ga0495683_0162825 Ga0495683_0162825_153_647 158
119 3300048924 Ga0496121_0115395 Ga0496121_0115395_1180_1674 158
120 3300048928 Ga0496125_0101416 Ga0496125_0101416_468_962 158
121 3300009092 Ga0105250_10037295 Ga0105250_100372952 159
122 3300025711 Ga0207696_1070395 Ga0207696_10703951 159
123 3300015265 Ga0182005_1004961 Ga0182005_10049611 160
124 3300046457 Ga0495590_0000340 Ga0495590_0000340_22989_23471 160
125 3300049460 Ga0495682_0000633 Ga0495682_0000633_640_1122 160
126 iso_pu_bacteria 2511231006 2511264146 160
127 iso_pu_bacteria 2511231008 2511279058 160
128 iso_pu_bacteria 2511231011 2511294035 160
129 iso_pu_bacteria 2511231012 2511300044 160
130 iso_pu_bacteria 2511231014 2511316736 160
131 iso_pu_bacteria 2511231015 2511319572 160
132 iso_pu_bacteria 2511231017 2511330187 160
133 iso_pu_bacteria 2511231018 2511339716 160
134 iso_pu_bacteria 2511231019 2511344900 160
135 iso_pu_bacteria 2511231020 2511351746 160
136 iso_pu_bacteria 2511231021 2511355140 160
137 iso_pu_bacteria 2511231023 2511370298 160
138 iso_pu_bacteria 2511231031 2511415675 160
139 iso_pu_bacteria 2512047018 2512326345 160
140 iso_pu_bacteria 2582580891 2583790768 160
141 iso_pu_bacteria 2597489887 2597856466 160
142 iso_pu_bacteria 2599185185 2599483281 160
143 iso_pu_bacteria 2599185257 2599805181 160
144 iso_pu_bacteria 2600254931 2600363890 160
145 iso_pu_bacteria 2643221589 2643952100 160
146 iso_pu_bacteria 2643221602 2644024141 160
147 iso_pu_bacteria 2643221633 2644184828 160
148 iso_pu_bacteria 2671180172 2671768084 160
149 iso_pu_bacteria 2718217725 2718632933 160
150 iso_pu_bacteria 2738543004 2739198580 160
151 iso_pu_bacteria 2738543015 2739256657 160
152 iso_pu_bacteria 2738543025 2739313011 160
153 iso_pu_bacteria 2740892503 2743735881 160
154 iso_pu_bacteria 2773857670 2774121538 160
155 iso_pu_bacteria 2773857673 2774136157 160
156 iso_pu_bacteria 2784132063 2784260232 160
157 iso_pu_bacteria 2784132072 2784315575 160
158 iso_pu_bacteria 2808606377 2808929414 160
159 iso_pu_bacteria 2808606381 2808951478 160
160 iso_pu_bacteria 2808606382 2808960317 160
161 iso_pu_bacteria 2818991456 2819658598 160
162 iso_pu_bacteria 2852657418 2852658543 160
163 iso_pu_bacteria 2860339153 2860340442 160
164 iso_pu_bacteria 2880230671 2880231923 160
165 iso_pu_bacteria 2904518522 2904520961 160
166 iso_pu_bacteria 2904550169 2904551692 160
167 iso_pu_bacteria 2919456309 2919458100 160
168 iso_pu_bacteria 2923153595 2923154890 160
169 iso_pu_bacteria 2931396565 2931399654 160
170 iso_pu_bacteria 2939636861 2939637864 160
171 iso_pu_bacteria 2969304461 2969305833 160
172 iso_pu_bacteria 2984286254 2984291141 160
173 iso_pu_bacteria 3007395558 3007400410 160
174 iso_pu_bacteria 3007511990 3007512626 160
175 iso_pu_bacteria 3007614139 3007614998 160
176 iso_pu_bacteria 3007619802 3007623098 160
177 iso_pu_bacteria 3007861166 3007863510 160
178 iso_pu_bacteria 8015687852 8015689122 160
179 iso_pu_bacteria 8055770955 8055772241 160
180 iso_pu_bacteria 8056125926 8056127302 160
181 iso_pu_bacteria 8056569372 8056569916 160
182 2162886007 SwRhRL2b_contig_3419659 SwRhRL2b_0363.00002010 161
183 3300002737 JGI25162J39368_1000241 JGI25162J39368_100024113 161
184 3300002771 JGI25163J39215_1000634 JGI25163J39215_10006347 161
185 3300002772 JGI25164J39214_1000188 JGI25164J39214_100018813 161
186 3300003214 JGI25165J46597_1000339 JGI25165J46597_100033913 161
187 3300003781 Ga0055536_1000399 Ga0055536_100039926 161
188 3300003791 Ga0055530_10011182 Ga0055530_100111823 161
189 3300003792 Ga0055540_1000377 Ga0055540_100037715 161
190 3300003792 Ga0055540_1001027 Ga0055540_100102718 161
191 3300003794 Ga0055531_10001226 Ga0055531_1000122616 161
192 3300005288 Ga0065714_10002540 Ga0065714_1000254016 161
193 3300005288 Ga0065714_10002948 Ga0065714_100029482 161
194 3300005288 Ga0065714_10004279 Ga0065714_100042795 161
195 3300005289 Ga0065704_10070421 Ga0065704_1007042115 161
196 3300006051 Ga0075364_10481150 Ga0075364_104811502 161
197 3300006058 Ga0075432_10002541 Ga0075432_100025414 161
198 3300006058 Ga0075432_10004673 Ga0075432_100046735 161
199 3300006058 Ga0075432_10005880 Ga0075432_100058804 161
200 3300006058 Ga0075432_10018819 Ga0075432_100188194 161
201 3300006058 Ga0075432_10249389 Ga0075432_102493891 161
202 3300006177 Ga0075362_10115785 Ga0075362_101157853 161
203 3300006914 Ga0075436_100188016 Ga0075436_1001880163 161
204 3300006946 Ga0079104_1034611 Ga0079104_10346112 161
205 3300006948 Ga0099826_10032511 Ga0099826_100325115 161
206 3300009011 Ga0105251_10014540 Ga0105251_100145404 161
207 3300009011 Ga0105251_10029928 Ga0105251_100299283 161
208 3300009036 Ga0105244_10001071 Ga0105244_100010719 161
209 3300009036 Ga0105244_10030138 Ga0105244_100301383 161
210 3300009036 Ga0105244_10038550 Ga0105244_100385504 161
211 3300009092 Ga0105250_10043734 Ga0105250_100437343 161
212 3300009148 Ga0105243_10000586 Ga0105243_100005868 161
213 3300009553 Ga0105249_10331643 Ga0105249_103316433 161
214 3300011119 Ga0105246_10001208 Ga0105246_100012086 161
215 3300013100 Ga0157373_10019482 Ga0157373_100194822 161
216 3300013100 Ga0157373_10078808 Ga0157373_100788083 161
217 3300013102 Ga0157371_10000885 Ga0157371_1000088525 161
218 3300013102 Ga0157371_10005098 Ga0157371_100050987 161
219 3300013104 Ga0157370_10505524 Ga0157370_105055242 161
220 3300013105 Ga0157369_10203228 Ga0157369_102032284 161
221 3300014497 Ga0182008_10000338 Ga0182008_1000033828 161
222 3300014497 Ga0182008_10003138 Ga0182008_100031382 161
223 3300015261 Ga0182006_1001039 Ga0182006_10010399 161
224 3300015261 Ga0182006_1002350 Ga0182006_10023506 161
225 3300015261 Ga0182006_1008986 Ga0182006_10089867 161
226 3300015262 Ga0182007_10000531 Ga0182007_1000053114 161
227 3300015265 Ga0182005_1000391 Ga0182005_10003914 161
228 3300015265 Ga0182005_1002318 Ga0182005_10023189 161
229 3300017792 Ga0163161_10011775 Ga0163161_100117759 161
230 3300017792 Ga0163161_10286104 Ga0163161_102861043 161
231 3300025207 Ga0209760_100099 Ga0209760_10009921 161
232 3300025231 Ga0207427_100001 Ga0207427_100001440 161
233 3300025233 Ga0209437_100003 Ga0209437_100003932 161
234 3300025261 Ga0209233_1000007 Ga0209233_1000007440 161
235 3300025291 Ga0209675_1002564 Ga0209675_10025649 161
236 3300025292 Ga0209676_1000016 Ga0209676_1000016171 161
237 3300025292 Ga0209676_1000033 Ga0209676_100003315 161
238 3300025292 Ga0209676_1006105 Ga0209676_10061055 161
239 3300025298 Ga0209050_1000036 Ga0209050_1000036386 161
240 3300025298 Ga0209050_1000187 Ga0209050_100018715 161
241 3300025303 Ga0209051_1000131 Ga0209051_100013115 161
242 3300025303 Ga0209051_1001300 Ga0209051_10013009 161
243 3300025303 Ga0209051_1100299 Ga0209051_11002992 161
244 3300025304 Ga0209257_1000173 Ga0209257_100017316 161
245 3300025304 Ga0209257_1005683 Ga0209257_10056836 161
246 3300025711 Ga0207696_1002110 Ga0207696_10021108 161
247 3300025711 Ga0207696_1171183 Ga0207696_11711831 161
248 3300025728 Ga0207655_1000896 Ga0207655_100089618 161
249 3300025728 Ga0207655_1001618 Ga0207655_100161817 161
250 3300025728 Ga0207655_1007603 Ga0207655_10076034 161
251 3300025735 Ga0207713_1000689 Ga0207713_100068928 161
252 3300025735 Ga0207713_1001389 Ga0207713_10013897 161
253 3300025923 Ga0207681_10061653 Ga0207681_100616532 161
254 3300025935 Ga0207709_10000036 Ga0207709_1000003623 161
255 3300025935 Ga0207709_10000517 Ga0207709_1000051713 161
256 3300025961 Ga0207712_10236672 Ga0207712_102366721 161
257 3300027111 Ga0209281_1000202 Ga0209281_1000202116 161
258 3300027111 Ga0209281_1019925 Ga0209281_10199252 161
259 3300027907 Ga0207428_10045078 Ga0207428_100450784 161
260 3300027907 Ga0207428_10055312 Ga0207428_100553125 161
261 3300027907 Ga0207428_10227391 Ga0207428_102273912 161
262 3300027907 Ga0207428_10265778 Ga0207428_102657783 161
263 3300030733 Ga0314311_1174749 Ga0314311_11747493 161
264 3300030735 Ga0316178_1049075 Ga0316178_10490754 161
265 3300030736 Ga0316180_1144020 Ga0316180_11440202 161
266 3300030742 Ga0316183_1074327 Ga0316183_10743273 161
267 3300030744 Ga0316181_1243246 Ga0316181_12432462 161
268 3300031548 Ga0307408_100066429 Ga0307408_1000664293 161
269 3300031548 Ga0307408_100103943 Ga0307408_1001039432 161
270 3300031548 Ga0307408_100187547 Ga0307408_1001875471 161
271 3300031731 Ga0307405_10000689 Ga0307405_1000068910 161
272 3300031731 Ga0307405_10050184 Ga0307405_100501844 161
273 3300031824 Ga0307413_10004010 Ga0307413_100040104 161
274 3300031824 Ga0307413_10016016 Ga0307413_100160164 161
275 3300031901 Ga0307406_10009015 Ga0307406_100090157 161
276 3300031901 Ga0307406_10010053 Ga0307406_100100538 161
277 3300031901 Ga0307406_10503723 Ga0307406_105037231 161
278 3300031903 Ga0307407_10008536 Ga0307407_100085367 161
279 3300031903 Ga0307407_10924193 Ga0307407_109241931 161
280 3300031911 Ga0307412_10001346 Ga0307412_1000134611 161
281 3300031911 Ga0307412_10005151 Ga0307412_100051516 161
282 3300031911 Ga0307412_10007351 Ga0307412_100073514 161
283 3300031995 Ga0307409_100157295 Ga0307409_1001572952 161
284 3300031995 Ga0307409_100410987 Ga0307409_1004109873 161
285 3300032002 Ga0307416_100009580 Ga0307416_1000095806 161
286 3300032002 Ga0307416_101421112 Ga0307416_1014211122 161
287 3300032004 Ga0307414_10044133 Ga0307414_100441331 161
288 3300032004 Ga0307414_10075402 Ga0307414_100754024 161
289 3300032004 Ga0307414_10164506 Ga0307414_101645062 161
290 3300032005 Ga0307411_10009789 Ga0307411_100097895 161
291 3300032005 Ga0307411_10010618 Ga0307411_100106183 161
292 3300032005 Ga0307411_10040007 Ga0307411_100400074 161
293 3300038705 Ga0237819_02832 Ga0237819_02832_882_1367 161
294 3300041405 Ga0439438_000622 Ga0439438_000622_10961_11446 161
295 3300041405 Ga0439438_001115 Ga0439438_001115_4475_4960 161
296 3300041405 Ga0439438_001130 Ga0439438_001130_7099_7584 161
297 3300041405 Ga0439438_008191 Ga0439438_008191_1325_1810 161
298 3300041405 Ga0439438_053223 Ga0439438_053223_342_827 161
299 3300041407 Ga0439447_002472 Ga0439447_002472_2686_3171 161
300 3300041407 Ga0439447_013606 Ga0439447_013606_83_568 161
301 3300041407 Ga0439447_035683 Ga0439447_035683_72_557 161
302 3300041407 Ga0439447_041230 Ga0439447_041230_240_725 161
303 3300041411 Ga0439466_0003571 Ga0439466_0003571_5086_5571 161
304 3300041411 Ga0439466_0004648 Ga0439466_0004648_217_702 161
305 3300041411 Ga0439466_0025087 Ga0439466_0025087_205_690 161
306 3300041411 Ga0439466_0032338 Ga0439466_0032338_119_604 161
307 3300041997 Ga0439431_0000577 Ga0439431_0000577_4423_4908 161
308 3300042004 Ga0439445_0048581 Ga0439445_0048581_479_964 161
309 3300042006 Ga0439432_001876 Ga0439432_001876_4535_5020 161
310 3300042006 Ga0439432_005177 Ga0439432_005177_581_1066 161
311 3300042006 Ga0439432_022764 Ga0439432_022764_1341_1826 161
312 3300042009 Ga0439451_000883 Ga0439451_000883_2017_2502 161
313 3300042009 Ga0439451_002436 Ga0439451_002436_2154_2639 161
314 3300042010 Ga0439452_001213 Ga0439452_001213_7046_7531 161
315 3300042010 Ga0439452_002534 Ga0439452_002534_3550_4035 161
316 3300042013 Ga0439456_024926 Ga0439456_024926_135_620 161
317 3300042013 Ga0439456_045940 Ga0439456_045940_42_527 161
318 3300042016 Ga0439463_023968 Ga0439463_023968_561_1046 161
319 3300042115 Ga0450911_000236 Ga0450911_000236_15584_16069 161
320 3300042115 Ga0450911_002913 Ga0450911_002913_198_683 161
321 3300042127 Ga0450890_000253 Ga0450890_000253_1591_2076 161
322 3300042129 Ga0450891_004145 Ga0450891_004145_415_900 161
323 3300042137 Ga0450902_012096 Ga0450902_012096_454_939 161
324 3300042137 Ga0450902_031531 Ga0450902_031531_284_769 161
325 3300042138 Ga0450903_000936 Ga0450903_000936_2124_2609 161
326 3300042138 Ga0450903_040402 Ga0450903_040402_79_564 161
327 3300042139 Ga0450904_031927 Ga0450904_031927_13_498 161
328 3300042145 Ga0450906_000867 Ga0450906_000867_4725_5210 161
329 3300042146 Ga0450907_007383 Ga0450907_007383_1039_1524 161
330 3300042147 Ga0450910_001175 Ga0450910_001175_2312_2797 161
331 3300042156 Ga0439446_0000876 Ga0439446_0000876_3000_3485 161
332 3300042156 Ga0439446_0171698 Ga0439446_0171698_179_664 161
333 3300042184 Ga0450908_000376 Ga0450908_000376_3313_3798 161
334 3300042435 Ga0439434_0051190 Ga0439434_0051190_156_641 161
335 3300042439 Ga0439464_0034012 Ga0439464_0034012_330_815 161
336 3300042531 Ga0450918_004126 Ga0450918_004126_72_557 161
337 3300042531 Ga0450918_023546 Ga0450918_023546_66_551 161
338 3300046452 Ga0495617_001218 Ga0495617_001218_5777_6262 161
339 3300046452 Ga0495617_005363 Ga0495617_005363_3519_4004 161
340 3300046452 Ga0495617_007102 Ga0495617_007102_2717_3202 161
341 3300046453 Ga0495627_006685 Ga0495627_006685_414_899 161
342 3300046457 Ga0495590_0002583 Ga0495590_0002583_5090_5575 161
343 3300046457 Ga0495590_0019690 Ga0495590_0019690_1316_1801 161
344 3300046458 Ga0495591_000633 Ga0495591_000633_3997_4482 161
345 3300046458 Ga0495591_059646 Ga0495591_059646_16_501 161
346 3300046459 Ga0495629_0015028 Ga0495629_0015028_1376_1861 161
347 3300046460 Ga0495638_0002645 Ga0495638_0002645_7689_8174 161
348 3300046460 Ga0495638_0009148 Ga0495638_0009148_3894_4379 161
349 3300046460 Ga0495638_0050089 Ga0495638_0050089_1465_1950 161
350 3300046460 Ga0495638_0084009 Ga0495638_0084009_14_499 161
351 3300046460 Ga0495638_0134542 Ga0495638_0134542_919_1407 161
352 3300046460 Ga0495638_0142437 Ga0495638_0142437_359_844 161
353 3300046463 Ga0495653_0010482 Ga0495653_0010482_4574_5059 161
354 3300046463 Ga0495653_0085405 Ga0495653_0085405_844_1329 161
355 3300046471 Ga0495650_0007966 Ga0495650_0007966_1338_1823 161
356 3300046471 Ga0495650_0017444 Ga0495650_0017444_2183_2668 161
357 3300046471 Ga0495650_0023955 Ga0495650_0023955_2208_2693 161
358 3300046471 Ga0495650_0092021 Ga0495650_0092021_246_731 161
359 3300046472 Ga0495580_0250074 Ga0495580_0250074_200_688 161
360 3300046473 Ga0495582_0004449 Ga0495582_0004449_4778_5263 161
361 3300046474 Ga0495605_0002331 Ga0495605_0002331_1362_1847 161
362 3300046474 Ga0495605_0023230 Ga0495605_0023230_758_1246 161
363 3300046474 Ga0495605_0041057 Ga0495605_0041057_494_979 161
364 3300046475 Ga0495639_0000127 Ga0495639_0000127_26326_26814 161
365 3300046475 Ga0495639_0037026 Ga0495639_0037026_71_556 161
366 3300046477 Ga0495664_0114421 Ga0495664_0114421_859_1344 161
367 3300046491 Ga0495584_0008797 Ga0495584_0008797_3357_3842 161
368 3300046491 Ga0495584_0012377 Ga0495584_0012377_1471_1956 161
369 3300046491 Ga0495584_0024745 Ga0495584_0024745_664_1149 161
370 3300046491 Ga0495584_0040868 Ga0495584_0040868_95_580 161
371 3300046491 Ga0495584_0044151 Ga0495584_0044151_297_782 161
372 3300046492 Ga0495585_0002826 Ga0495585_0002826_6809_7294 161
373 3300046492 Ga0495585_0018754 Ga0495585_0018754_380_865 161
374 3300046499 Ga0495594_0060916 Ga0495594_0060916_1325_1813 161
375 3300046500 Ga0495596_0000457 Ga0495596_0000457_3980_4465 161
376 3300046501 Ga0495607_0001842 Ga0495607_0001842_5695_6180 161
377 3300046501 Ga0495607_0005447 Ga0495607_0005447_1258_1743 161
378 3300046501 Ga0495607_0013328 Ga0495607_0013328_4766_5257 161
379 3300046501 Ga0495607_0016376 Ga0495607_0016376_4091_4576 161
380 3300046501 Ga0495607_0061679 Ga0495607_0061679_211_696 161
381 3300046501 Ga0495607_0148658 Ga0495607_0148658_44_529 161
382 3300046501 Ga0495607_0179240 Ga0495607_0179240_559_1044 161
383 3300046506 Ga0495583_0007690 Ga0495583_0007690_1487_1975 161
384 3300046507 Ga0495606_0012463 Ga0495606_0012463_3430_3915 161
385 3300046512 Ga0495610_0005392 Ga0495610_0005392_4257_4742 161
386 3300046512 Ga0495610_0011594 Ga0495610_0011594_351_836 161
387 3300046513 Ga0495616_0006578 Ga0495616_0006578_1353_1838 161
388 3300046513 Ga0495616_0011608 Ga0495616_0011608_1255_1740 161
389 3300046513 Ga0495616_0069276 Ga0495616_0069276_204_689 161
390 3300046515 Ga0495620_0002168 Ga0495620_0002168_6937_7422 161
391 3300046516 Ga0495628_0840388 Ga0495628_0840388_114_599 161
392 3300046517 Ga0495630_0078352 Ga0495630_0078352_592_1077 161
393 3300046517 Ga0495630_0091744 Ga0495630_0091744_1369_1854 161
394 3300046518 Ga0495631_0041905 Ga0495631_0041905_811_1296 161
395 3300046519 Ga0495632_0000183 Ga0495632_0000183_56589_57074 161
396 3300046519 Ga0495632_0004421 Ga0495632_0004421_3881_4366 161
397 3300046519 Ga0495632_0007805 Ga0495632_0007805_2752_3237 161
398 3300046519 Ga0495632_0017318 Ga0495632_0017318_511_996 161
399 3300046519 Ga0495632_0093532 Ga0495632_0093532_619_1104 161
400 3300046520 Ga0495637_0002968 Ga0495637_0002968_4770_5255 161
401 3300046520 Ga0495637_0035167 Ga0495637_0035167_1109_1594 161
402 3300046520 Ga0495637_0043001 Ga0495637_0043001_1219_1704 161
403 3300046520 Ga0495637_0045602 Ga0495637_0045602_1229_1714 161
404 3300046520 Ga0495637_0161470 Ga0495637_0161470_33_518 161
405 3300046520 Ga0495637_0205299 Ga0495637_0205299_92_577 161
406 3300046522 Ga0495643_0014649 Ga0495643_0014649_491_976 161
407 3300046522 Ga0495643_0019098 Ga0495643_0019098_2816_3301 161
408 3300046522 Ga0495643_0105656 Ga0495643_0105656_939_1424 161
409 3300046523 Ga0495644_0005826 Ga0495644_0005826_3691_4176 161
410 3300046523 Ga0495644_0040476 Ga0495644_0040476_605_1090 161
411 3300046524 Ga0495648_0036194 Ga0495648_0036194_1015_1500 161
412 3300046524 Ga0495648_0099249 Ga0495648_0099249_554_1039 161
413 3300046524 Ga0495648_0228193 Ga0495648_0228193_43_528 161
414 3300046526 Ga0495666_0015745 Ga0495666_0015745_1963_2448 161
415 3300046526 Ga0495666_0032703 Ga0495666_0032703_605_1090 161
416 3300046528 Ga0495642_0002322 Ga0495642_0002322_4953_5438 161
417 3300046530 Ga0495654_0002100 Ga0495654_0002100_4690_5178 161
418 3300046530 Ga0495654_0012687 Ga0495654_0012687_366_851 161
419 3300046530 Ga0495654_0021176 Ga0495654_0021176_1173_1658 161
420 3300046530 Ga0495654_0021975 Ga0495654_0021975_1045_1530 161
421 3300046530 Ga0495654_0110378 Ga0495654_0110378_231_716 161
422 3300046535 Ga0495586_0015830 Ga0495586_0015830_2158_2643 161
423 3300046536 Ga0495587_0007201 Ga0495587_0007201_1375_1860 161
424 3300046538 Ga0495609_0004194 Ga0495609_0004194_2279_2764 161
425 3300046542 Ga0495597_0003033 Ga0495597_0003033_9302_9787 161
426 3300046542 Ga0495597_0009193 Ga0495597_0009193_1530_2015 161
427 3300046542 Ga0495597_0010022 Ga0495597_0010022_3619_4104 161
428 3300046542 Ga0495597_0014359 Ga0495597_0014359_888_1373 161
429 3300046542 Ga0495597_0029760 Ga0495597_0029760_856_1341 161
430 3300046557 Ga0495622_0001755 Ga0495622_0001755_1067_1555 161
431 3300046557 Ga0495622_0015333 Ga0495622_0015333_1386_1871 161
432 3300046558 Ga0495633_0135241 Ga0495633_0135241_507_992 161
433 3300046615 Ga0495656_0032403 Ga0495656_0032403_1227_1712 161
434 3300046616 Ga0495668_0032164 Ga0495668_0032164_1740_2225 161
435 3300046660 Ga0495625_0014464 Ga0495625_0014464_1199_1684 161
436 3300046660 Ga0495625_0016152 Ga0495625_0016152_1735_2220 161
437 3300046663 Ga0495635_0031323 Ga0495635_0031323_1375_1860 161
438 3300046664 Ga0495659_0000591 Ga0495659_0000591_7931_8419 161
439 3300046664 Ga0495659_0064831 Ga0495659_0064831_81_572 161
440 3300046665 Ga0495661_0008492 Ga0495661_0008492_2851_3336 161
441 3300046665 Ga0495661_0009218 Ga0495661_0009218_4812_5297 161
442 3300046665 Ga0495661_0057687 Ga0495661_0057687_1442_1927 161
443 3300046665 Ga0495661_0070489 Ga0495661_0070489_960_1445 161
444 3300046674 Ga0495588_0023300 Ga0495588_0023300_1306_1791 161
445 3300046675 Ga0495657_0050499 Ga0495657_0050499_1840_2325 161
446 3300046679 Ga0495623_0002029 Ga0495623_0002029_8910_9395 161
447 3300046680 Ga0495646_0010104 Ga0495646_0010104_4194_4679 161
448 3300046689 Ga0495613_0020891 Ga0495613_0020891_1876_2361 161
449 3300046691 Ga0495670_0001055 Ga0495670_0001055_7917_8402 161
450 3300046691 Ga0495670_0009909 Ga0495670_0009909_538_1023 161
451 3300046692 Ga0495671_0004083 Ga0495671_0004083_3635_4120 161
452 3300046692 Ga0495671_0015870 Ga0495671_0015870_2992_3477 161
453 3300046692 Ga0495671_0035115 Ga0495671_0035115_1041_1526 161
454 3300046692 Ga0495671_0076969 Ga0495671_0076969_198_683 161
455 3300046694 Ga0495649_0001766 Ga0495649_0001766_5257_5742 161
456 3300046694 Ga0495649_0020534 Ga0495649_0020534_415_903 161
457 3300046694 Ga0495649_0032096 Ga0495649_0032096_569_1054 161
458 3300046794 Ga0495589_0001608 Ga0495589_0001608_8395_8880 161
459 3300046794 Ga0495589_0015569 Ga0495589_0015569_1166_1651 161
460 3300046794 Ga0495589_0033831 Ga0495589_0033831_553_1041 161
461 3300046810 Ga0495660_0012592 Ga0495660_0012592_694_1179 161
462 3300046810 Ga0495660_0021925 Ga0495660_0021925_1790_2275 161
463 3300046810 Ga0495660_0053564 Ga0495660_0053564_953_1438 161
464 3300046810 Ga0495660_0289892 Ga0495660_0289892_20_505 161
465 3300047315 Ga0495581_0010307 Ga0495581_0010307_442_927 161
466 3300047315 Ga0495581_0044694 Ga0495581_0044694_537_1025 161
467 3300047317 Ga0495604_0059325 Ga0495604_0059325_1222_1707 161
468 3300047318 Ga0495636_0001055 Ga0495636_0001055_5103_5588 161
469 3300047320 Ga0495672_0002383 Ga0495672_0002383_10224_10709 161
470 3300047320 Ga0495672_0032209 Ga0495672_0032209_2246_2731 161
471 3300047320 Ga0495672_0073928 Ga0495672_0073928_1200_1685 161
472 3300047320 Ga0495672_0106604 Ga0495672_0106604_512_997 161
473 3300047322 Ga0495680_0001587 Ga0495680_0001587_14256_14741 161
474 3300047322 Ga0495680_0416067 Ga0495680_0416067_53_538 161
475 3300047323 Ga0495683_0000198 Ga0495683_0000198_107_592 161
476 3300047323 Ga0495683_0000448 Ga0495683_0000448_766_1254 161
477 3300047323 Ga0495683_0012907 Ga0495683_0012907_3436_3921 161
478 3300047323 Ga0495683_0013782 Ga0495683_0013782_1897_2382 161
479 3300047443 Ga0495687_003790 Ga0495687_003790_4910_5395 161
480 3300047443 Ga0495687_013843 Ga0495687_013843_1562_2050 161
481 3300047444 Ga0495675_0030493 Ga0495675_0030493_1205_1690 161
482 3300047444 Ga0495675_0117975 Ga0495675_0117975_1100_1585 161
483 3300047446 Ga0495679_145801 Ga0495679_145801_33_518 161
484 3300047469 Ga0495673_0021691 Ga0495673_0021691_1258_1743 161
485 3300047469 Ga0495673_0053895 Ga0495673_0053895_682_1167 161
486 3300047469 Ga0495673_0066051 Ga0495673_0066051_715_1200 161
487 3300047470 Ga0495681_0006128 Ga0495681_0006128_1350_1835 161
488 3300047470 Ga0495681_0009958 Ga0495681_0009958_3905_4390 161
489 3300047470 Ga0495681_0012873 Ga0495681_0012873_576_1061 161
490 3300047470 Ga0495681_0026846 Ga0495681_0026846_1910_2395 161
491 3300047470 Ga0495681_0031297 Ga0495681_0031297_628_1113 161
492 3300047471 Ga0495684_0035067 Ga0495684_0035067_1161_1646 161
493 3300047472 Ga0495686_0019160 Ga0495686_0019160_3844_4329 161
494 3300047472 Ga0495686_0021948 Ga0495686_0021948_60_545 161
495 3300047472 Ga0495686_0041748 Ga0495686_0041748_1873_2358 161
496 3300047673 Ga0495593_0006783 Ga0495593_0006783_1543_2031 161
497 3300047673 Ga0495593_0018799 Ga0495593_0018799_1210_1695 161
498 3300047673 Ga0495593_0043944 Ga0495593_0043944_1218_1703 161
499 3300048091 Ga0495626_0001604 Ga0495626_0001604_15798_16283 161
500 3300048091 Ga0495626_0002209 Ga0495626_0002209_7951_8439 161
501 3300048091 Ga0495626_0008122 Ga0495626_0008122_3892_4377 161
502 3300048091 Ga0495626_0013008 Ga0495626_0013008_2383_2868 161
503 3300048091 Ga0495626_0049594 Ga0495626_0049594_1380_1865 161
504 3300048916 Ga0496113_0560729 Ga0496113_0560729_265_750 161
505 3300048919 Ga0496116_0000913 Ga0496116_0000913_10105_10590 161
506 3300048919 Ga0496116_0002975 Ga0496116_0002975_12293_12781 161
507 3300048919 Ga0496116_0158124 Ga0496116_0158124_24_509 161
508 3300048920 Ga0496117_0001277 Ga0496117_0001277_24673_25158 161
509 3300048920 Ga0496117_0043688 Ga0496117_0043688_2210_2695 161
510 3300048921 Ga0496118_0025378 Ga0496118_0025378_828_1313 161
511 3300048921 Ga0496118_0069152 Ga0496118_0069152_23_508 161
512 3300048921 Ga0496118_0247716 Ga0496118_0247716_312_800 161
513 3300048924 Ga0496121_0002654 Ga0496121_0002654_16229_16714 161
514 3300048924 Ga0496121_0067182 Ga0496121_0067182_1939_2427 161
515 3300048925 Ga0496122_0016792 Ga0496122_0016792_4447_4932 161
516 3300048925 Ga0496122_0039712 Ga0496122_0039712_2705_3193 161
517 3300048925 Ga0496122_0200246 Ga0496122_0200246_50_535 161
518 3300048926 Ga0496123_0005030 Ga0496123_0005030_4680_5165 161
519 3300048926 Ga0496123_0096379 Ga0496123_0096379_897_1385 161
520 3300048927 Ga0496124_0470892 Ga0496124_0470892_50_538 161
521 3300049459 Ga0495678_003284 Ga0495678_003284_4718_5203 161
522 3300049459 Ga0495678_007151 Ga0495678_007151_5260_5745 161
523 3300049459 Ga0495678_040966 Ga0495678_040966_28_513 161
524 3300049460 Ga0495682_0000153 Ga0495682_0000153_33338_33823 161
525 3300049460 Ga0495682_0071470 Ga0495682_0071470_531_1019 161
526 3300049460 Ga0495682_0142704 Ga0495682_0142704_159_644 161
527 3300049460 Ga0495682_0163899 Ga0495682_0163899_148_633 161
528 3300049688 Ga0501259_089454 Ga0501259_089454_90_575 161
529 3300050514 nmdc:mga08x19_538098_c1 nmdc:mga08x19_538098_c1_67_552 161
530 3300047446 Ga0495679_013436 Ga0495679_013436_1320_1811 163
531 2124908027 MRS2a_Contig_106 MRS2a_00008410 164
532 2124908027 MRS2a_Contig_720 MRS2a_00577480 164
533 3300003791 Ga0055530_10000296 Ga0055530_1000029619 164
534 3300003791 Ga0055530_10023691 Ga0055530_100236913 164
535 3300003792 Ga0055540_1004307 Ga0055540_10043073 164
536 3300005288 Ga0065714_10007294 Ga0065714_100072943 164
537 3300005288 Ga0065714_10019883 Ga0065714_100198831 164
538 3300005288 Ga0065714_10094395 Ga0065714_100943953 164
539 3300005288 Ga0065714_10099614 Ga0065714_100996141 164
540 3300005288 Ga0065714_10103470 Ga0065714_101034701 164
541 3300005288 Ga0065714_10134401 Ga0065714_101344012 164
542 3300005289 Ga0065704_10081346 Ga0065704_100813465 164
543 3300005289 Ga0065704_10255164 Ga0065704_102551642 164
544 3300005290 Ga0065712_10069868 Ga0065712_100698689 164
545 3300005293 Ga0065715_10022161 Ga0065715_100221612 164
546 3300006051 Ga0075364_10268850 Ga0075364_102688502 164
547 3300006051 Ga0075364_10496380 Ga0075364_104963801 164
548 3300006058 Ga0075432_10019681 Ga0075432_100196813 164
549 3300006058 Ga0075432_10079590 Ga0075432_100795903 164
550 3300006058 Ga0075432_10117174 Ga0075432_101171742 164
551 3300006058 Ga0075432_10144997 Ga0075432_101449971 164
552 3300006177 Ga0075362_10049502 Ga0075362_100495023 164
553 3300006177 Ga0075362_10059424 Ga0075362_100594243 164
554 3300006914 Ga0075436_100214683 Ga0075436_1002146832 164
555 3300006914 Ga0075436_100289934 Ga0075436_1002899343 164
556 3300006946 Ga0079104_1000689 Ga0079104_100068922 164
557 3300009011 Ga0105251_10252690 Ga0105251_102526902 164
558 3300009036 Ga0105244_10145656 Ga0105244_101456562 164
559 3300009036 Ga0105244_10199829 Ga0105244_101998292 164
560 3300009036 Ga0105244_10260476 Ga0105244_102604762 164
561 3300009092 Ga0105250_10084649 Ga0105250_100846493 164
562 3300009148 Ga0105243_10008101 Ga0105243_100081011 164
563 3300009148 Ga0105243_10106625 Ga0105243_101066254 164
564 3300009176 Ga0105242_10206729 Ga0105242_102067293 164
565 3300011119 Ga0105246_10090943 Ga0105246_100909433 164
566 3300012498 Ga0157345_1000963 Ga0157345_10009631 164
567 3300012502 Ga0157347_1002410 Ga0157347_10024103 164
568 3300013100 Ga0157373_10013301 Ga0157373_100133019 164
569 3300013100 Ga0157373_10386778 Ga0157373_103867781 164
570 3300013102 Ga0157371_10006075 Ga0157371_100060754 164
571 3300013102 Ga0157371_10118713 Ga0157371_101187133 164
572 3300013104 Ga0157370_10167167 Ga0157370_101671673 164
573 3300013104 Ga0157370_10199760 Ga0157370_101997603 164
574 3300013105 Ga0157369_10015038 Ga0157369_100150386 164
575 3300013105 Ga0157369_10270853 Ga0157369_102708533 164
576 3300013306 Ga0163162_10001282 Ga0163162_1000128210 164
577 3300013307 Ga0157372_10005224 Ga0157372_100052249 164
578 3300013308 Ga0157375_10088960 Ga0157375_100889602 164
579 3300014497 Ga0182008_10004581 Ga0182008_100045812 164
580 3300014497 Ga0182008_10065183 Ga0182008_100651832 164
581 3300014497 Ga0182008_10318160 Ga0182008_103181602 164
582 3300015261 Ga0182006_1006812 Ga0182006_10068122 164
583 3300015261 Ga0182006_1008122 Ga0182006_10081225 164
584 3300015261 Ga0182006_1032599 Ga0182006_10325993 164
585 3300015261 Ga0182006_1117531 Ga0182006_11175312 164
586 3300015265 Ga0182005_1011182 Ga0182005_10111822 164
587 3300015265 Ga0182005_1021687 Ga0182005_10216873 164
588 3300015265 Ga0182005_1074826 Ga0182005_10748262 164
589 3300015265 Ga0182005_1175742 Ga0182005_11757421 164
590 3300017792 Ga0163161_10003870 Ga0163161_100038704 164
591 3300017792 Ga0163161_10091297 Ga0163161_100912973 164
592 3300017792 Ga0163161_10408239 Ga0163161_104082392 164
593 3300017792 Ga0163161_11152063 Ga0163161_111520632 164
594 3300025230 Ga0209563_100593 Ga0209563_1005935 164
595 3300025292 Ga0209676_1000080 Ga0209676_1000080207 164
596 3300025292 Ga0209676_1005886 Ga0209676_10058862 164
597 3300025298 Ga0209050_1000117 Ga0209050_1000117161 164
598 3300025298 Ga0209050_1001895 Ga0209050_10018953 164
599 3300025303 Ga0209051_1000077 Ga0209051_1000077161 164
600 3300025303 Ga0209051_1003680 Ga0209051_10036809 164
601 3300025711 Ga0207696_1000083 Ga0207696_100008316 164
602 3300025711 Ga0207696_1011128 Ga0207696_10111283 164
603 3300025711 Ga0207696_1023231 Ga0207696_10232313 164
604 3300025711 Ga0207696_1034639 Ga0207696_10346393 164
605 3300025728 Ga0207655_1002914 Ga0207655_10029144 164
606 3300025728 Ga0207655_1009084 Ga0207655_10090843 164
607 3300025728 Ga0207655_1059240 Ga0207655_10592402 164
608 3300025728 Ga0207655_1074462 Ga0207655_10744622 164
609 3300025735 Ga0207713_1001940 Ga0207713_10019405 164
610 3300025735 Ga0207713_1008663 Ga0207713_10086637 164
611 3300025735 Ga0207713_1010616 Ga0207713_10106168 164
612 3300025735 Ga0207713_1019697 Ga0207713_10196975 164
613 3300025934 Ga0207686_10101637 Ga0207686_101016373 164
614 3300025935 Ga0207709_10107691 Ga0207709_101076913 164
615 3300027111 Ga0209281_1000013 Ga0209281_1000013454 164
616 3300027111 Ga0209281_1011153 Ga0209281_10111533 164
617 3300027876 Ga0209974_10057430 Ga0209974_100574302 164
618 3300027907 Ga0207428_10015030 Ga0207428_100150302 164
619 3300027907 Ga0207428_10073102 Ga0207428_100731025 164
620 3300027907 Ga0207428_10107728 Ga0207428_101077284 164
621 3300027907 Ga0207428_10447791 Ga0207428_104477912 164
622 3300027907 Ga0207428_10609963 Ga0207428_106099631 164
623 3300028379 Ga0268266_10011767 Ga0268266_100117674 164
624 3300030521 Ga0307511_10161596 Ga0307511_101615962 164
625 3300031548 Ga0307408_100022319 Ga0307408_1000223196 164
626 3300031903 Ga0307407_10091846 Ga0307407_100918462 164
627 3300031911 Ga0307412_10105917 Ga0307412_101059172 164
628 3300032004 Ga0307414_10071613 Ga0307414_100716133 164
629 3300033180 Ga0307510_10007066 Ga0307510_100070669 164
630 3300041405 Ga0439438_018232 Ga0439438_018232_922_1416 164
631 3300041405 Ga0439438_018576 Ga0439438_018576_1202_1696 164
632 3300041405 Ga0439438_026197 Ga0439438_026197_227_721 164
633 3300041407 Ga0439447_000562 Ga0439447_000562_6403_6897 164
634 3300041407 Ga0439447_001274 Ga0439447_001274_3981_4475 164
635 3300041407 Ga0439447_001610 Ga0439447_001610_7581_8075 164
636 3300041411 Ga0439466_0001323 Ga0439466_0001323_4301_4795 164
637 3300041411 Ga0439466_0002331 Ga0439466_0002331_1690_2184 164
638 3300041411 Ga0439466_0003049 Ga0439466_0003049_366_860 164
639 3300041411 Ga0439466_0022710 Ga0439466_0022710_1326_1820 164
640 3300041411 Ga0439466_0030367 Ga0439466_0030367_783_1277 164
641 3300041411 Ga0439466_0050348 Ga0439466_0050348_627_1121 164
642 3300041413 Ga0439465_0016881 Ga0439465_0016881_764_1258 164
643 3300041413 Ga0439465_0116620 Ga0439465_0116620_263_757 164
644 3300041413 Ga0439465_0168346 Ga0439465_0168346_214_708 164
645 3300041413 Ga0439465_0207111 Ga0439465_0207111_202_696 164
646 3300041997 Ga0439431_0163933 Ga0439431_0163933_34_528 164
647 3300042006 Ga0439432_005468 Ga0439432_005468_1932_2426 164
648 3300042006 Ga0439432_020304 Ga0439432_020304_1319_1813 164
649 3300042006 Ga0439432_075889 Ga0439432_075889_47_541 164
650 3300042009 Ga0439451_003412 Ga0439451_003412_936_1430 164
651 3300042010 Ga0439452_000336 Ga0439452_000336_20957_21451 164
652 3300042010 Ga0439452_000995 Ga0439452_000995_11333_11827 164
653 3300042010 Ga0439452_001056 Ga0439452_001056_4502_4996 164
654 3300042010 Ga0439452_002813 Ga0439452_002813_1370_1864 164
655 3300042010 Ga0439452_059732 Ga0439452_059732_175_669 164
656 3300042013 Ga0439456_002709 Ga0439456_002709_1760_2254 164
657 3300042013 Ga0439456_043770 Ga0439456_043770_320_814 164
658 3300042016 Ga0439463_001283 Ga0439463_001283_5740_6234 164
659 3300042016 Ga0439463_002076 Ga0439463_002076_408_902 164
660 3300042115 Ga0450911_001170 Ga0450911_001170_3258_3752 164
661 3300042115 Ga0450911_009374 Ga0450911_009374_364_858 164
662 3300042121 Ga0450919_000274 Ga0450919_000274_3220_3714 164
663 3300042121 Ga0450919_008559 Ga0450919_008559_148_642 164
664 3300042122 Ga0450920_000195 Ga0450920_000195_4285_4779 164
665 3300042124 Ga0450922_000235 Ga0450922_000235_2889_3383 164
666 3300042124 Ga0450922_000315 Ga0450922_000315_2768_3262 164
667 3300042125 Ga0450923_004163 Ga0450923_004163_1341_1835 164
668 3300042137 Ga0450902_001174 Ga0450902_001174_1551_2045 164
669 3300042137 Ga0450902_001667 Ga0450902_001667_676_1170 164
670 3300042137 Ga0450902_011710 Ga0450902_011710_725_1219 164
671 3300042137 Ga0450902_028617 Ga0450902_028617_352_846 164
672 3300042138 Ga0450903_003047 Ga0450903_003047_563_1057 164
673 3300042138 Ga0450903_044996 Ga0450903_044996_89_583 164
674 3300042142 Ga0450905_005396 Ga0450905_005396_757_1251 164
675 3300042142 Ga0450905_021358 Ga0450905_021358_225_719 164
676 3300042145 Ga0450906_001408 Ga0450906_001408_1524_2018 164
677 3300042145 Ga0450906_003874 Ga0450906_003874_259_753 164
678 3300042146 Ga0450907_000081 Ga0450907_000081_23377_23871 164
679 3300042146 Ga0450907_000598 Ga0450907_000598_3959_4453 164
680 3300042147 Ga0450910_000174 Ga0450910_000174_1419_1913 164
681 3300042147 Ga0450910_003075 Ga0450910_003075_151_645 164
682 3300042156 Ga0439446_0001332 Ga0439446_0001332_4227_4721 164
683 3300042184 Ga0450908_018968 Ga0450908_018968_388_882 164
684 3300042185 Ga0450909_001944 Ga0450909_001944_434_928 164
685 3300042185 Ga0450909_002149 Ga0450909_002149_395_889 164
686 3300042435 Ga0439434_0000388 Ga0439434_0000388_5984_6478 164
687 3300042461 Ga0439460_0000859 Ga0439460_0000859_1563_2057 164
688 3300042461 Ga0439460_0166221 Ga0439460_0166221_117_611 164
689 3300042531 Ga0450918_021634 Ga0450918_021634_457_951 164
690 3300042993 Ga0439440_0000576 Ga0439440_0000576_2837_3331 164
691 3300046452 Ga0495617_010936 Ga0495617_010936_504_998 164
692 3300046452 Ga0495617_012573 Ga0495617_012573_158_652 164
693 3300046452 Ga0495617_020305 Ga0495617_020305_386_880 164
694 3300046452 Ga0495617_049747 Ga0495617_049747_683_1177 164
695 3300046453 Ga0495627_001791 Ga0495627_001791_8572_9066 164
696 3300046453 Ga0495627_006194 Ga0495627_006194_2915_3409 164
697 3300046453 Ga0495627_129309 Ga0495627_129309_55_549 164
698 3300046455 Ga0495603_0003858 Ga0495603_0003858_2085_2579 164
699 3300046455 Ga0495603_0194583 Ga0495603_0194583_295_789 164
700 3300046457 Ga0495590_0001333 Ga0495590_0001333_4981_5475 164
701 3300046457 Ga0495590_0004417 Ga0495590_0004417_3879_4373 164
702 3300046458 Ga0495591_002519 Ga0495591_002519_1312_1806 164
703 3300046458 Ga0495591_002584 Ga0495591_002584_8164_8658 164
704 3300046458 Ga0495591_008802 Ga0495591_008802_602_1096 164
705 3300046458 Ga0495591_009585 Ga0495591_009585_2293_2787 164
706 3300046458 Ga0495591_012408 Ga0495591_012408_2666_3160 164
707 3300046458 Ga0495591_018098 Ga0495591_018098_1275_1769 164
708 3300046458 Ga0495591_023770 Ga0495591_023770_86_580 164
709 3300046458 Ga0495591_077683 Ga0495591_077683_87_581 164
710 3300046460 Ga0495638_0010758 Ga0495638_0010758_4502_4996 164
711 3300046460 Ga0495638_0023996 Ga0495638_0023996_2041_2535 164
712 3300046460 Ga0495638_0034364 Ga0495638_0034364_978_1472 164
713 3300046460 Ga0495638_0064290 Ga0495638_0064290_1324_1818 164
714 3300046460 Ga0495638_0064486 Ga0495638_0064486_101_655 164
715 3300046460 Ga0495638_0064956 Ga0495638_0064956_518_1012 164
716 3300046460 Ga0495638_0085556 Ga0495638_0085556_602_1096 164
717 3300046460 Ga0495638_0165470 Ga0495638_0165470_219_713 164
718 3300046463 Ga0495653_0052221 Ga0495653_0052221_447_941 164
719 3300046463 Ga0495653_0159743 Ga0495653_0159743_462_956 164
720 3300046471 Ga0495650_0015573 Ga0495650_0015573_620_1114 164
721 3300046471 Ga0495650_0016047 Ga0495650_0016047_659_1153 164
722 3300046471 Ga0495650_0018746 Ga0495650_0018746_673_1167 164
723 3300046471 Ga0495650_0073164 Ga0495650_0073164_486_980 164
724 3300046474 Ga0495605_0000700 Ga0495605_0000700_5849_6343 164
725 3300046474 Ga0495605_0019673 Ga0495605_0019673_1665_2159 164
726 3300046474 Ga0495605_0060777 Ga0495605_0060777_80_574 164
727 3300046474 Ga0495605_0151194 Ga0495605_0151194_459_953 164
728 3300046491 Ga0495584_0001750 Ga0495584_0001750_4600_5094 164
729 3300046491 Ga0495584_0004667 Ga0495584_0004667_2197_2691 164
730 3300046491 Ga0495584_0008873 Ga0495584_0008873_1169_1663 164
731 3300046491 Ga0495584_0011359 Ga0495584_0011359_3336_3830 164
732 3300046491 Ga0495584_0021299 Ga0495584_0021299_657_1151 164
733 3300046491 Ga0495584_0073468 Ga0495584_0073468_428_922 164
734 3300046491 Ga0495584_0138481 Ga0495584_0138481_256_750 164
735 3300046492 Ga0495585_0011764 Ga0495585_0011764_3365_3859 164
736 3300046492 Ga0495585_0045695 Ga0495585_0045695_1405_1899 164
737 3300046492 Ga0495585_0049598 Ga0495585_0049598_1360_1854 164
738 3300046492 Ga0495585_0099235 Ga0495585_0099235_505_999 164
739 3300046492 Ga0495585_0162603 Ga0495585_0162603_119_613 164
740 3300046492 Ga0495585_0186226 Ga0495585_0186226_50_544 164
741 3300046492 Ga0495585_0208205 Ga0495585_0208205_28_522 164
742 3300046499 Ga0495594_0016316 Ga0495594_0016316_1488_1982 164
743 3300046500 Ga0495596_0019474 Ga0495596_0019474_652_1146 164
744 3300046501 Ga0495607_0002479 Ga0495607_0002479_4800_5294 164
745 3300046501 Ga0495607_0005775 Ga0495607_0005775_529_1023 164
746 3300046501 Ga0495607_0013603 Ga0495607_0013603_4591_5085 164
747 3300046501 Ga0495607_0077667 Ga0495607_0077667_1204_1698 164
748 3300046501 Ga0495607_0084186 Ga0495607_0084186_1034_1528 164
749 3300046501 Ga0495607_0137774 Ga0495607_0137774_632_1126 164
750 3300046501 Ga0495607_0203729 Ga0495607_0203729_382_876 164
751 3300046506 Ga0495583_0014015 Ga0495583_0014015_3733_4227 164
752 3300046506 Ga0495583_0014566 Ga0495583_0014566_3200_3694 164
753 3300046506 Ga0495583_0022404 Ga0495583_0022404_625_1119 164
754 3300046506 Ga0495583_0106411 Ga0495583_0106411_52_546 164
755 3300046506 Ga0495583_0138743 Ga0495583_0138743_413_907 164
756 3300046507 Ga0495606_0001929 Ga0495606_0001929_20680_21174 164
757 3300046507 Ga0495606_0007990 Ga0495606_0007990_8543_9037 164
758 3300046507 Ga0495606_0017049 Ga0495606_0017049_3668_4162 164
759 3300046507 Ga0495606_0041100 Ga0495606_0041100_832_1326 164
760 3300046512 Ga0495610_0002647 Ga0495610_0002647_6232_6726 164
761 3300046512 Ga0495610_0009009 Ga0495610_0009009_1146_1640 164
762 3300046512 Ga0495610_0010638 Ga0495610_0010638_4632_5126 164
763 3300046512 Ga0495610_0012442 Ga0495610_0012442_2383_2877 164
764 3300046512 Ga0495610_0087769 Ga0495610_0087769_260_754 164
765 3300046512 Ga0495610_0125868 Ga0495610_0125868_464_958 164
766 3300046512 Ga0495610_0192625 Ga0495610_0192625_222_716 164
767 3300046513 Ga0495616_0005949 Ga0495616_0005949_2289_2783 164
768 3300046513 Ga0495616_0010463 Ga0495616_0010463_295_789 164
769 3300046513 Ga0495616_0024545 Ga0495616_0024545_2069_2563 164
770 3300046513 Ga0495616_0073496 Ga0495616_0073496_519_1013 164
771 3300046513 Ga0495616_0100340 Ga0495616_0100340_130_624 164
772 3300046513 Ga0495616_0105290 Ga0495616_0105290_276_770 164
773 3300046513 Ga0495616_0156085 Ga0495616_0156085_130_624 164
774 3300046513 Ga0495616_0180702 Ga0495616_0180702_366_860 164
775 3300046515 Ga0495620_0002462 Ga0495620_0002462_5157_5651 164
776 3300046515 Ga0495620_0008445 Ga0495620_0008445_75_569 164
777 3300046515 Ga0495620_0028806 Ga0495620_0028806_477_971 164
778 3300046515 Ga0495620_0046241 Ga0495620_0046241_656_1150 164
779 3300046515 Ga0495620_0075737 Ga0495620_0075737_673_1167 164
780 3300046515 Ga0495620_0083338 Ga0495620_0083338_473_967 164
781 3300046517 Ga0495630_0466701 Ga0495630_0466701_404_898 164
782 3300046518 Ga0495631_0000294 Ga0495631_0000294_7733_8227 164
783 3300046518 Ga0495631_0002372 Ga0495631_0002372_1348_1842 164
784 3300046518 Ga0495631_0007666 Ga0495631_0007666_2571_3065 164
785 3300046518 Ga0495631_0044994 Ga0495631_0044994_796_1290 164
786 3300046519 Ga0495632_0001201 Ga0495632_0001201_8449_8943 164
787 3300046519 Ga0495632_0002627 Ga0495632_0002627_8205_8699 164
788 3300046519 Ga0495632_0005950 Ga0495632_0005950_604_1098 164
789 3300046519 Ga0495632_0035099 Ga0495632_0035099_1306_1800 164
790 3300046519 Ga0495632_0049023 Ga0495632_0049023_1229_1723 164
791 3300046520 Ga0495637_0009266 Ga0495637_0009266_1996_2490 164
792 3300046520 Ga0495637_0010088 Ga0495637_0010088_3885_4379 164
793 3300046520 Ga0495637_0010262 Ga0495637_0010262_3065_3559 164
794 3300046520 Ga0495637_0059646 Ga0495637_0059646_423_917 164
795 3300046520 Ga0495637_0083973 Ga0495637_0083973_24_518 164
796 3300046520 Ga0495637_0111711 Ga0495637_0111711_44_538 164
797 3300046520 Ga0495637_0131342 Ga0495637_0131342_17_511 164
798 3300046520 Ga0495637_0295540 Ga0495637_0295540_23_517 164
799 3300046522 Ga0495643_0016933 Ga0495643_0016933_3497_3991 164
800 3300046522 Ga0495643_0017538 Ga0495643_0017538_2858_3352 164
801 3300046523 Ga0495644_0004258 Ga0495644_0004258_3805_4299 164
802 3300046523 Ga0495644_0066275 Ga0495644_0066275_544_1038 164
803 3300046523 Ga0495644_0273253 Ga0495644_0273253_138_632 164
804 3300046524 Ga0495648_0000923 Ga0495648_0000923_1532_2026 164
805 3300046524 Ga0495648_0002722 Ga0495648_0002722_2033_2527 164
806 3300046524 Ga0495648_0079026 Ga0495648_0079026_1036_1530 164
807 3300046524 Ga0495648_0095692 Ga0495648_0095692_484_978 164
808 3300046524 Ga0495648_0203327 Ga0495648_0203327_346_840 164
809 3300046524 Ga0495648_0275636 Ga0495648_0275636_265_759 164
810 3300046528 Ga0495642_0000312 Ga0495642_0000312_20435_20929 164
811 3300046528 Ga0495642_0000897 Ga0495642_0000897_4839_5333 164
812 3300046529 Ga0495652_0439226 Ga0495652_0439226_370_864 164
813 3300046530 Ga0495654_0002528 Ga0495654_0002528_1047_1541 164
814 3300046530 Ga0495654_0007579 Ga0495654_0007579_1004_1498 164
815 3300046530 Ga0495654_0007607 Ga0495654_0007607_4742_5236 164
816 3300046530 Ga0495654_0024421 Ga0495654_0024421_1474_1968 164
817 3300046530 Ga0495654_0027101 Ga0495654_0027101_1009_1503 164
818 3300046530 Ga0495654_0028283 Ga0495654_0028283_1111_1605 164
819 3300046530 Ga0495654_0031917 Ga0495654_0031917_669_1163 164
820 3300046530 Ga0495654_0175813 Ga0495654_0175813_247_741 164
821 3300046536 Ga0495587_0001908 Ga0495587_0001908_11691_12185 164
822 3300046538 Ga0495609_0001932 Ga0495609_0001932_7823_8317 164
823 3300046538 Ga0495609_0004674 Ga0495609_0004674_6286_6780 164
824 3300046538 Ga0495609_0021438 Ga0495609_0021438_472_966 164
825 3300046538 Ga0495609_0051376 Ga0495609_0051376_870_1364 164
826 3300046538 Ga0495609_0079690 Ga0495609_0079690_767_1261 164
827 3300046542 Ga0495597_0020977 Ga0495597_0020977_1351_1845 164
828 3300046542 Ga0495597_0050053 Ga0495597_0050053_1292_1786 164
829 3300046542 Ga0495597_0061422 Ga0495597_0061422_689_1183 164
830 3300046557 Ga0495622_0019585 Ga0495622_0019585_505_999 164
831 3300046557 Ga0495622_0020506 Ga0495622_0020506_1333_1827 164
832 3300046557 Ga0495622_0441280 Ga0495622_0441280_22_516 164
833 3300046558 Ga0495633_0003303 Ga0495633_0003303_5480_5974 164
834 3300046558 Ga0495633_0011367 Ga0495633_0011367_1475_1969 164
835 3300046558 Ga0495633_0065146 Ga0495633_0065146_1069_1623 164
836 3300046615 Ga0495656_0000491 Ga0495656_0000491_5346_5840 164
837 3300046615 Ga0495656_0052182 Ga0495656_0052182_426_920 164
838 3300046616 Ga0495668_0004170 Ga0495668_0004170_8696_9190 164
839 3300046616 Ga0495668_0027292 Ga0495668_0027292_2127_2621 164
840 3300046616 Ga0495668_0106871 Ga0495668_0106871_434_928 164
841 3300046642 Ga0495634_0002797 Ga0495634_0002797_5942_6436 164
842 3300046648 Ga0495611_0000487 Ga0495611_0000487_18530_19024 164
843 3300046648 Ga0495611_0054715 Ga0495611_0054715_918_1412 164
844 3300046660 Ga0495625_0007666 Ga0495625_0007666_7634_8128 164
845 3300046660 Ga0495625_0014306 Ga0495625_0014306_1027_1521 164
846 3300046660 Ga0495625_0015838 Ga0495625_0015838_2946_3518 164
847 3300046660 Ga0495625_0106148 Ga0495625_0106148_524_1018 164
848 3300046663 Ga0495635_0002332 Ga0495635_0002332_7855_8349 164
849 3300046664 Ga0495659_0001632 Ga0495659_0001632_279_773 164
850 3300046664 Ga0495659_0010672 Ga0495659_0010672_1164_1658 164
851 3300046665 Ga0495661_0017401 Ga0495661_0017401_1684_2178 164
852 3300046665 Ga0495661_0051155 Ga0495661_0051155_1788_2282 164
853 3300046665 Ga0495661_0066453 Ga0495661_0066453_680_1174 164
854 3300046665 Ga0495661_0095133 Ga0495661_0095133_308_802 164
855 3300046665 Ga0495661_0139804 Ga0495661_0139804_438_932 164
856 3300046674 Ga0495588_0027484 Ga0495588_0027484_634_1128 164
857 3300046674 Ga0495588_0046580 Ga0495588_0046580_404_898 164
858 3300046679 Ga0495623_0009473 Ga0495623_0009473_1305_1799 164
859 3300046680 Ga0495646_0047230 Ga0495646_0047230_47_541 164
860 3300046680 Ga0495646_0086285 Ga0495646_0086285_405_899 164
861 3300046684 Ga0495669_0004265 Ga0495669_0004265_5189_5683 164
862 3300046684 Ga0495669_0165100 Ga0495669_0165100_117_611 164
863 3300046689 Ga0495613_0022276 Ga0495613_0022276_3989_4483 164
864 3300046689 Ga0495613_0042354 Ga0495613_0042354_489_983 164
865 3300046690 Ga0495624_0001085 Ga0495624_0001085_4629_5123 164
866 3300046691 Ga0495670_0001104 Ga0495670_0001104_4825_5319 164
867 3300046691 Ga0495670_0005125 Ga0495670_0005125_1373_1867 164
868 3300046691 Ga0495670_0330820 Ga0495670_0330820_186_680 164
869 3300046692 Ga0495671_0007553 Ga0495671_0007553_1304_1798 164
870 3300046692 Ga0495671_0012257 Ga0495671_0012257_251_745 164
871 3300046692 Ga0495671_0015074 Ga0495671_0015074_2362_2856 164
872 3300046692 Ga0495671_0027361 Ga0495671_0027361_402_896 164
873 3300046692 Ga0495671_0031043 Ga0495671_0031043_1261_1755 164
874 3300046692 Ga0495671_0055995 Ga0495671_0055995_1009_1503 164
875 3300046692 Ga0495671_0057175 Ga0495671_0057175_892_1386 164
876 3300046692 Ga0495671_0060411 Ga0495671_0060411_123_617 164
877 3300046692 Ga0495671_0079487 Ga0495671_0079487_588_1082 164
878 3300046694 Ga0495649_0004367 Ga0495649_0004367_1279_1773 164
879 3300046694 Ga0495649_0005632 Ga0495649_0005632_5100_5594 164
880 3300046694 Ga0495649_0016452 Ga0495649_0016452_453_947 164
881 3300046694 Ga0495649_0020115 Ga0495649_0020115_2687_3181 164
882 3300046694 Ga0495649_0049470 Ga0495649_0049470_1360_1854 164
883 3300046694 Ga0495649_0071964 Ga0495649_0071964_191_685 164
884 3300046694 Ga0495649_0095201 Ga0495649_0095201_24_518 164
885 3300046694 Ga0495649_0177445 Ga0495649_0177445_539_1033 164
886 3300046794 Ga0495589_0001746 Ga0495589_0001746_7821_8315 164
887 3300046794 Ga0495589_0005329 Ga0495589_0005329_4535_5029 164
888 3300046794 Ga0495589_0005643 Ga0495589_0005643_5269_5763 164
889 3300046794 Ga0495589_0016565 Ga0495589_0016565_3068_3562 164
890 3300046794 Ga0495589_0057359 Ga0495589_0057359_175_669 164
891 3300046794 Ga0495589_0086181 Ga0495589_0086181_512_1006 164
892 3300046809 Ga0495600_0160639 Ga0495600_0160639_416_910 164
893 3300046810 Ga0495660_0003783 Ga0495660_0003783_7826_8320 164
894 3300046810 Ga0495660_0003851 Ga0495660_0003851_8134_8628 164
895 3300046810 Ga0495660_0011544 Ga0495660_0011544_220_714 164
896 3300046810 Ga0495660_0029670 Ga0495660_0029670_2225_2719 164
897 3300046810 Ga0495660_0030468 Ga0495660_0030468_2000_2494 164
898 3300046810 Ga0495660_0058681 Ga0495660_0058681_1318_1812 164
899 3300046810 Ga0495660_0103433 Ga0495660_0103433_30_524 164
900 3300046810 Ga0495660_0117331 Ga0495660_0117331_601_1095 164
901 3300047317 Ga0495604_0029265 Ga0495604_0029265_3571_4065 164
902 3300047317 Ga0495604_0111279 Ga0495604_0111279_482_976 164
903 3300047318 Ga0495636_0022025 Ga0495636_0022025_134_628 164
904 3300047319 Ga0495674_0047960 Ga0495674_0047960_1332_1826 164
905 3300047320 Ga0495672_0003039 Ga0495672_0003039_9628_10122 164
906 3300047320 Ga0495672_0003187 Ga0495672_0003187_9665_10159 164
907 3300047320 Ga0495672_0005960 Ga0495672_0005960_4427_4921 164
908 3300047320 Ga0495672_0012445 Ga0495672_0012445_5376_5870 164
909 3300047320 Ga0495672_0017745 Ga0495672_0017745_3092_3586 164
910 3300047320 Ga0495672_0031915 Ga0495672_0031915_2233_2727 164
911 3300047320 Ga0495672_0058391 Ga0495672_0058391_1593_2087 164
912 3300047320 Ga0495672_0082572 Ga0495672_0082572_486_980 164
913 3300047321 Ga0495676_0015978 Ga0495676_0015978_1326_1820 164
914 3300047321 Ga0495676_0056136 Ga0495676_0056136_2268_2762 164
915 3300047322 Ga0495680_0093522 Ga0495680_0093522_1276_1770 164
916 3300047322 Ga0495680_0284472 Ga0495680_0284472_528_1022 164
917 3300047323 Ga0495683_0000617 Ga0495683_0000617_18358_18852 164
918 3300047323 Ga0495683_0000910 Ga0495683_0000910_15295_15789 164
919 3300047323 Ga0495683_0009635 Ga0495683_0009635_3646_4140 164
920 3300047323 Ga0495683_0027507 Ga0495683_0027507_965_1459 164
921 3300047323 Ga0495683_0056254 Ga0495683_0056254_1004_1498 164
922 3300047323 Ga0495683_0086781 Ga0495683_0086781_491_985 164
923 3300047323 Ga0495683_0123406 Ga0495683_0123406_106_600 164
924 3300047445 Ga0495677_0001430 Ga0495677_0001430_7890_8384 164
925 3300047446 Ga0495679_005361 Ga0495679_005361_3659_4153 164
926 3300047446 Ga0495679_011232 Ga0495679_011232_675_1169 164
927 3300047447 Ga0495685_160417 Ga0495685_160417_142_636 164
928 3300047469 Ga0495673_0000383 Ga0495673_0000383_3746_4240 164
929 3300047469 Ga0495673_0000472 Ga0495673_0000472_27055_27549 164
930 3300047469 Ga0495673_0002062 Ga0495673_0002062_8521_9015 164
931 3300047469 Ga0495673_0027958 Ga0495673_0027958_238_732 164
932 3300047469 Ga0495673_0031306 Ga0495673_0031306_638_1132 164
933 3300047469 Ga0495673_0058980 Ga0495673_0058980_119_613 164
934 3300047469 Ga0495673_0089684 Ga0495673_0089684_427_921 164
935 3300047469 Ga0495673_0147903 Ga0495673_0147903_32_526 164
936 3300047469 Ga0495673_0180215 Ga0495673_0180215_46_540 164
937 3300047470 Ga0495681_0003553 Ga0495681_0003553_4701_5195 164
938 3300047470 Ga0495681_0003948 Ga0495681_0003948_4829_5323 164
939 3300047470 Ga0495681_0004564 Ga0495681_0004564_4161_4655 164
940 3300047470 Ga0495681_0005637 Ga0495681_0005637_4796_5290 164
941 3300047470 Ga0495681_0007283 Ga0495681_0007283_4756_5250 164
942 3300047470 Ga0495681_0010065 Ga0495681_0010065_202_696 164
943 3300047470 Ga0495681_0043211 Ga0495681_0043211_454_948 164
944 3300047470 Ga0495681_0058497 Ga0495681_0058497_47_541 164
945 3300047471 Ga0495684_0045783 Ga0495684_0045783_2427_2921 164
946 3300047472 Ga0495686_0005610 Ga0495686_0005610_1352_1846 164
947 3300047472 Ga0495686_0030929 Ga0495686_0030929_2357_2851 164
948 3300048088 Ga0495602_0070938 Ga0495602_0070938_457_951 164
949 3300048088 Ga0495602_0188766 Ga0495602_0188766_579_1073 164
950 3300048091 Ga0495626_0001676 Ga0495626_0001676_8027_8521 164
951 3300048091 Ga0495626_0008334 Ga0495626_0008334_4859_5353 164
952 3300048091 Ga0495626_0020492 Ga0495626_0020492_712_1206 164
953 3300048091 Ga0495626_0022725 Ga0495626_0022725_656_1150 164
954 3300048091 Ga0495626_0025322 Ga0495626_0025322_1664_2158 164
955 3300048091 Ga0495626_0069544 Ga0495626_0069544_457_951 164
956 3300048905 Ga0496102_0001399 Ga0496102_0001399_13010_13504 164
957 3300048906 Ga0496103_0007572 Ga0496103_0007572_1510_2004 164
958 3300048907 Ga0496104_0481991 Ga0496104_0481991_212_706 164
959 3300048913 Ga0496110_0098252 Ga0496110_0098252_617_1111 164
960 3300048914 Ga0496111_0242925 Ga0496111_0242925_172_666 164
961 3300048919 Ga0496116_0001217 Ga0496116_0001217_9005_9499 164
962 3300048919 Ga0496116_0010096 Ga0496116_0010096_6884_7378 164
963 3300048920 Ga0496117_0019550 Ga0496117_0019550_4539_5033 164
964 3300048920 Ga0496117_0091319 Ga0496117_0091319_287_781 164
965 3300048921 Ga0496118_0042355 Ga0496118_0042355_820_1314 164
966 3300048921 Ga0496118_0047937 Ga0496118_0047937_562_1056 164
967 3300048921 Ga0496118_0103877 Ga0496118_0103877_1267_1761 164
968 3300048922 Ga0496119_0090528 Ga0496119_0090528_792_1286 164
969 3300048923 Ga0496120_0181563 Ga0496120_0181563_105_599 164
970 3300048924 Ga0496121_0025851 Ga0496121_0025851_403_897 164
971 3300048924 Ga0496121_0328734 Ga0496121_0328734_305_799 164
972 3300048924 Ga0496121_0431908 Ga0496121_0431908_264_758 164
973 3300048926 Ga0496123_0147422 Ga0496123_0147422_23_517 164
974 3300048927 Ga0496124_0003331 Ga0496124_0003331_4509_5003 164
975 3300048927 Ga0496124_0031392 Ga0496124_0031392_3816_4310 164
976 3300048927 Ga0496124_0064800 Ga0496124_0064800_1232_1726 164
977 3300048927 Ga0496124_0287735 Ga0496124_0287735_374_868 164
978 3300048928 Ga0496125_0014908 Ga0496125_0014908_5240_5734 164
979 3300048928 Ga0496125_0059297 Ga0496125_0059297_1200_1694 164
980 3300048929 Ga0496126_0339663 Ga0496126_0339663_109_603 164
981 3300049459 Ga0495678_002163 Ga0495678_002163_4902_5396 164
982 3300049459 Ga0495678_019678 Ga0495678_019678_633_1127 164
983 3300049459 Ga0495678_022710 Ga0495678_022710_1267_1761 164
984 3300049459 Ga0495678_039680 Ga0495678_039680_1265_1759 164
985 3300049460 Ga0495682_0011152 Ga0495682_0011152_787_1281 164
986 3300049460 Ga0495682_0078256 Ga0495682_0078256_557_1051 164
987 3300049460 Ga0495682_0095920 Ga0495682_0095920_14_508 164
988 3300049758 Ga0501241_001926 Ga0501241_001926_1214_1708 164
989 3300049766 Ga0501269_019566 Ga0501269_019566_291_785 164
990 3300050490 nmdc:mga03n38_404361_c1 nmdc:mga03n38_404361_c1_30_524 164
991 3300050491 nmdc:mga00v17_224114_c1 nmdc:mga00v17_224114_c1_534_1028 164
992 3300050491 nmdc:mga00v17_27354_c1 nmdc:mga00v17_27354_c1_1235_1729 164
993 3300050491 nmdc:mga00v17_89861_c1 nmdc:mga00v17_89861_c1_966_1460 164
994 3300050496 nmdc:mga07m45_302200_c1 nmdc:mga07m45_302200_c1_195_689 164
995 3300050514 nmdc:mga08x19_185715_c1 nmdc:mga08x19_185715_c1_531_1025 164
996 3300050516 nmdc:mga0sz30_5614_c4 nmdc:mga0sz30_5614_c4_1109_1603 164
997 3300053111 Ga0500572_002744 Ga0500572_002744_587_1081 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03168

LEA_2

Late embryogenesis abundant protein

55

151

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xo8-assembly1.cif.gz_A solution structure of at1g01470 from arabidopsis thaliana 0.6731 23 151
8dhe-assembly1.cif.gz_D tannerella forsythia beta-glucuronidase (ml1) 0.5945 37 148
1xo8-assembly1.cif.gz_A solution structure of at1g01470 from arabidopsis thaliana 0.5877 23 151
8b7d-assembly1.cif.gz_A luminal domain of tmem106b 0.5801 30 151
5t9g-assembly1.cif.gz_A crystal structure of bugh2cwt in complex with galactoisofagomine 0.5757 38 151
ID Description Score Start End Superfamily
af_C0PIQ6_184_306_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7769 31 152 2.60.40.1820
af_C0PIQ6_184_306_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.766 31 152 2.60.40.1820
af_A0A0R0IUI6_98_233_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.705 28 151 2.60.40.1820
1xo8A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6731 23 151 2.60.40.1820
af_Q54XW0_47_140_2.60.40.290 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6664 30 105 2.60.40.290
ID Description Score Start End GO Terms
AF-A0A270PEF7-F1-model_v4 Water stress and hypersensitive response domain-containing protein 0.8678 1 159 GO:0009269
AF-A0A7T8BBX6-F1-model_v4 LEA type 2 family protein 0.8669 30 150 GO:0009269
AF-A0A7T7XR06-F1-model_v4 LEA type 2 family protein 0.8637 29 151 GO:0009269
AF-F5YQ41-F1-model_v4 Water stress and hypersensitive response domain-containing protein 0.8635 29 151 GO:0009269
AF-A0A4R4BL77-F1-model_v4 Late embryogenesis abundant protein LEA-2 subgroup domain-containing protein 0.8609 30 151

Feature Viewer

pLDDT pTM Quality
86.35 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map