F487798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 997 | 384 | 837 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10286104|Ga0163161_102861043 |
| Length | 161 |
| Sequence | MSACTLVLRSIGLLSVLALTGCATWFTGNYEDPQVHLVKVEVVKANLLQQRFILRFRIDNPNRRSLPVRGMSYSVRLEDMLLSEGETSDWFSVAGRSGEYYEVPVRTNLWQHVRELSKLLKHPDRPIRYELRGELRTGVLFGHDVVLNHTGEINARGLPGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 21 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 22 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 23 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 24 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 25 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 26 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 27 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 28 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 29 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 30 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 31 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 32 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 33 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 34 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 35 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 36 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 37 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 38 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 39 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 40 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 41 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 42 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 43 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 44 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 45 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 46 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 47 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 48 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 49 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 50 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 51 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 52 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 53 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 54 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 55 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 56 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 57 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 58 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 59 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 60 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 61 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 62 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 63 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 64 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 65 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 66 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 67 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 68 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 69 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 70 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 71 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 72 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 73 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 74 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 75 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 76 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 77 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 78 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 79 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 80 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 81 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 82 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 83 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 84 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 85 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 86 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 87 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 88 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 89 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 90 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 91 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 92 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 93 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 94 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 95 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 96 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 97 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 98 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 99 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 100 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 101 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 102 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 103 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 104 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 105 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 106 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 107 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 108 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 109 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 110 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 111 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 112 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 113 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 114 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 115 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 116 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 117 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 118 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 119 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 120 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 121 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 122 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 123 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 124 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 125 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 126 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 127 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 128 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 129 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 130 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 131 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 132 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 133 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 134 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 135 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 136 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 137 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 138 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 139 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 140 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 141 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 142 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 143 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 144 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 145 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 146 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 147 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 148 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 149 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 150 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 151 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 152 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 153 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 154 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 155 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 156 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 157 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 160 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 161 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 162 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 163 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 164 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 165 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 166 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 167 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 175 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 176 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 185 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 210 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 211 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 212 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 213 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 214 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 227 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 228 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 232 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 233 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 234 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 235 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 236 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 239 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 240 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 241 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 242 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 243 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 244 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 245 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 246 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 247 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 248 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 249 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 250 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 251 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 254 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 259 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 363 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 364 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 371 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 372 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 373 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 374 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 375 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 376 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 377 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 378 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 379 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 380 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 381 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 382 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 383 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 384 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.95 |
| Metatranscriptomes | 0 |
| Isolates | 16.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.71 |
| Nodule | 2.51 |
| Rhizoplane | 5.92 |
| Rhizosphere | 79.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_106 | 2124908027 | Bacteria | 15461 |
| 2 | MRS2a_Contig_720 | 2124908027 | Bacteria | 19927 |
| 3 | SwRhRL2b_contig_3419659 | 2162886007 | Bacteria | 4287 |
| 4 | JGI25162J39368_1000241 | 3300002737 | Bacteria | 54556 |
| 5 | JGI25163J39215_1000634 | 3300002771 | Bacteria | 9556 |
| 6 | JGI25164J39214_1000188 | 3300002772 | Bacteria | 54558 |
| 7 | JGI25165J46597_1000339 | 3300003214 | Bacteria | 54558 |
| 8 | Ga0055536_1000399 | 3300003781 | Bacteria | 31587 |
| 9 | Ga0055530_10000296 | 3300003791 | Bacteria | 45176 |
| 10 | Ga0055530_10011182 | 3300003791 | Bacteria | 3245 |
| 11 | Ga0055530_10023691 | 3300003791 | Bacteria | 1758 |
| 12 | Ga0055540_1000377 | 3300003792 | Bacteria | 37349 |
| 13 | Ga0055540_1001027 | 3300003792 | Bacteria | 17928 |
| 14 | Ga0055540_1004307 | 3300003792 | Bacteria | 6489 |
| 15 | Ga0055531_10001226 | 3300003794 | Bacteria | 19551 |
| 16 | Ga0065714_10002540 | 3300005288 | Bacteria | 29164 |
| 17 | Ga0065714_10002948 | 3300005288 | Bacteria | 9441 |
| 18 | Ga0065714_10004279 | 3300005288 | Bacteria | 8125 |
| 19 | Ga0065714_10007294 | 3300005288 | Bacteria | 3426 |
| 20 | Ga0065714_10019883 | 3300005288 | Bacteria | 1796 |
| 21 | Ga0065714_10094395 | 3300005288 | Bacteria | 1813 |
| 22 | Ga0065714_10099614 | 3300005288 | Bacteria | 1683 |
| 23 | Ga0065714_10103470 | 3300005288 | Bacteria | 1602 |
| 24 | Ga0065714_10134401 | 3300005288 | Bacteria | 1222 |
| 25 | Ga0065714_10138296 | 3300005288 | Bacteria | 1168 |
| 26 | Ga0065704_10070421 | 3300005289 | Bacteria | 25665 |
| 27 | Ga0065704_10081346 | 3300005289 | Bacteria | 3775 |
| 28 | Ga0065704_10255164 | 3300005289 | Bacteria | 979 |
| 29 | Ga0065712_10069868 | 3300005290 | Bacteria | 6596 |
| 30 | Ga0065715_10022161 | 3300005293 | Bacteria | 2146 |
| 31 | Ga0075364_10268850 | 3300006051 | Bacteria | 1159 |
| 32 | Ga0075364_10481150 | 3300006051 | Bacteria | 849 |
| 33 | Ga0075364_10496380 | 3300006051 | Bacteria | 834 |
| 34 | Ga0075432_10002541 | 3300006058 | Bacteria | 6087 |
| 35 | Ga0075432_10004673 | 3300006058 | Bacteria | 4662 |
| 36 | Ga0075432_10005880 | 3300006058 | Bacteria | 4174 |
| 37 | Ga0075432_10018819 | 3300006058 | Bacteria | 2357 |
| 38 | Ga0075432_10019681 | 3300006058 | Bacteria | 2308 |
| 39 | Ga0075432_10079590 | 3300006058 | Bacteria | 1186 |
| 40 | Ga0075432_10117174 | 3300006058 | Bacteria | 997 |
| 41 | Ga0075432_10144997 | 3300006058 | Bacteria | 908 |
| 42 | Ga0075432_10249389 | 3300006058 | Bacteria | 720 |
| 43 | Ga0075362_10049502 | 3300006177 | Bacteria | 1877 |
| 44 | Ga0075362_10059424 | 3300006177 | Bacteria | 1726 |
| 45 | Ga0075362_10115785 | 3300006177 | Bacteria | 1265 |
| 46 | Ga0075436_100188016 | 3300006914 | Bacteria | 1461 |
| 47 | Ga0075436_100214683 | 3300006914 | Bacteria | 1364 |
| 48 | Ga0075436_100289934 | 3300006914 | Bacteria | 1171 |
| 49 | Ga0079104_1000689 | 3300006946 | Bacteria | 30929 |
| 50 | Ga0079104_1034611 | 3300006946 | Bacteria | 1225 |
| 51 | Ga0099826_10032511 | 3300006948 | Bacteria | 3760 |
| 52 | Ga0105251_10014540 | 3300009011 | Bacteria | 4343 |
| 53 | Ga0105251_10029928 | 3300009011 | Bacteria | 2739 |
| 54 | Ga0105251_10252690 | 3300009011 | Bacteria | 795 |
| 55 | Ga0105244_10001071 | 3300009036 | Bacteria | 22821 |
| 56 | Ga0105244_10030138 | 3300009036 | Bacteria | 2889 |
| 57 | Ga0105244_10038550 | 3300009036 | Bacteria | 2492 |
| 58 | Ga0105244_10145656 | 3300009036 | Bacteria | 1137 |
| 59 | Ga0105244_10199829 | 3300009036 | Bacteria | 943 |
| 60 | Ga0105244_10260476 | 3300009036 | Bacteria | 807 |
| 61 | Ga0105250_10037295 | 3300009092 | Bacteria | 1951 |
| 62 | Ga0105250_10043734 | 3300009092 | Bacteria | 1796 |
| 63 | Ga0105250_10084649 | 3300009092 | Bacteria | 1287 |
| 64 | Ga0105243_10000586 | 3300009148 | Bacteria | 36575 |
| 65 | Ga0105243_10008101 | 3300009148 | Bacteria | 8065 |
| 66 | Ga0105243_10106625 | 3300009148 | Bacteria | 2336 |
| 67 | Ga0105242_10206729 | 3300009176 | Bacteria | 1747 |
| 68 | Ga0105249_10331643 | 3300009553 | Bacteria | 1535 |
| 69 | Ga0105246_10001208 | 3300011119 | Bacteria | 15112 |
| 70 | Ga0105246_10090943 | 3300011119 | Bacteria | 2199 |
| 71 | Ga0157345_1000963 | 3300012498 | Bacteria | 2120 |
| 72 | Ga0157347_1002410 | 3300012502 | Bacteria | 1597 |
| 73 | Ga0157373_10013301 | 3300013100 | Bacteria | 6038 |
| 74 | Ga0157373_10019482 | 3300013100 | Bacteria | 4937 |
| 75 | Ga0157373_10078808 | 3300013100 | Bacteria | 2323 |
| 76 | Ga0157373_10386778 | 3300013100 | Bacteria | 1001 |
| 77 | Ga0157371_10000885 | 3300013102 | Bacteria | 33767 |
| 78 | Ga0157371_10005098 | 3300013102 | Bacteria | 11204 |
| 79 | Ga0157371_10006075 | 3300013102 | Bacteria | 10045 |
| 80 | Ga0157371_10118713 | 3300013102 | Bacteria | 1880 |
| 81 | Ga0157370_10013230 | 3300013104 | Bacteria | 8503 |
| 82 | Ga0157370_10167167 | 3300013104 | Bacteria | 2045 |
| 83 | Ga0157370_10199760 | 3300013104 | Bacteria | 1855 |
| 84 | Ga0157370_10505524 | 3300013104 | Bacteria | 1110 |
| 85 | Ga0157369_10015038 | 3300013105 | Bacteria | 8733 |
| 86 | Ga0157369_10203228 | 3300013105 | Bacteria | 2079 |
| 87 | Ga0157369_10270853 | 3300013105 | Bacteria | 1769 |
| 88 | Ga0163162_10001282 | 3300013306 | Bacteria | 23512 |
| 89 | Ga0163162_10008097 | 3300013306 | Bacteria | 10258 |
| 90 | Ga0157372_10005224 | 3300013307 | Bacteria | 13803 |
| 91 | Ga0157375_10088960 | 3300013308 | Bacteria | 3143 |
| 92 | Ga0182008_10000338 | 3300014497 | Bacteria | 36590 |
| 93 | Ga0182008_10003138 | 3300014497 | Bacteria | 10109 |
| 94 | Ga0182008_10004581 | 3300014497 | Bacteria | 8046 |
| 95 | Ga0182008_10065183 | 3300014497 | Bacteria | 1792 |
| 96 | Ga0182008_10318160 | 3300014497 | Bacteria | 818 |
| 97 | Ga0182006_1001039 | 3300015261 | Bacteria | 18022 |
| 98 | Ga0182006_1002350 | 3300015261 | Bacteria | 10383 |
| 99 | Ga0182006_1006812 | 3300015261 | Bacteria | 5272 |
| 100 | Ga0182006_1008122 | 3300015261 | Bacteria | 4764 |
| 101 | Ga0182006_1008986 | 3300015261 | Bacteria | 4502 |
| 102 | Ga0182006_1032599 | 3300015261 | Bacteria | 2092 |
| 103 | Ga0182006_1117531 | 3300015261 | Bacteria | 927 |
| 104 | Ga0182007_10000531 | 3300015262 | Bacteria | 22530 |
| 105 | Ga0182005_1000391 | 3300015265 | Bacteria | 23860 |
| 106 | Ga0182005_1002318 | 3300015265 | Bacteria | 6934 |
| 107 | Ga0182005_1004961 | 3300015265 | Bacteria | 4215 |
| 108 | Ga0182005_1011182 | 3300015265 | Bacteria | 2565 |
| 109 | Ga0182005_1021687 | 3300015265 | Bacteria | 1761 |
| 110 | Ga0182005_1074826 | 3300015265 | Bacteria | 932 |
| 111 | Ga0182005_1175742 | 3300015265 | Bacteria | 634 |
| 112 | Ga0163161_10003870 | 3300017792 | Bacteria | 10496 |
| 113 | Ga0163161_10011775 | 3300017792 | Bacteria | 6065 |
| 114 | Ga0163161_10091297 | 3300017792 | Bacteria | 2254 |
| 115 | Ga0163161_10129951 | 3300017792 | Bacteria | 1899 |
| 116 | Ga0163161_10286104 | 3300017792 | Bacteria | 1294 |
| 117 | Ga0163161_10408239 | 3300017792 | Bacteria | 1090 |
| 118 | Ga0163161_11152063 | 3300017792 | Bacteria | 668 |
| 119 | Ga0209760_100099 | 3300025207 | Bacteria | 66726 |
| 120 | Ga0209563_100593 | 3300025230 | Bacteria | 11920 |
| 121 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 122 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 123 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 124 | Ga0209675_1002564 | 3300025291 | Bacteria | 9217 |
| 125 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 126 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 127 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 128 | Ga0209676_1005886 | 3300025292 | Bacteria | 6236 |
| 129 | Ga0209676_1006105 | 3300025292 | Bacteria | 6049 |
| 130 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 131 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 132 | Ga0209050_1000187 | 3300025298 | Bacteria | 139437 |
| 133 | Ga0209050_1001895 | 3300025298 | Bacteria | 20032 |
| 134 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 135 | Ga0209051_1000131 | 3300025303 | Bacteria | 139437 |
| 136 | Ga0209051_1001300 | 3300025303 | Bacteria | 21966 |
| 137 | Ga0209051_1003680 | 3300025303 | Bacteria | 9907 |
| 138 | Ga0209051_1100299 | 3300025303 | Bacteria | 781 |
| 139 | Ga0209257_1000173 | 3300025304 | Bacteria | 166678 |
| 140 | Ga0209257_1005683 | 3300025304 | Bacteria | 8592 |
| 141 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 142 | Ga0207696_1002110 | 3300025711 | Bacteria | 9988 |
| 143 | Ga0207696_1011128 | 3300025711 | Bacteria | 3256 |
| 144 | Ga0207696_1023231 | 3300025711 | Bacteria | 1958 |
| 145 | Ga0207696_1034639 | 3300025711 | Bacteria | 1507 |
| 146 | Ga0207696_1070395 | 3300025711 | Bacteria | 973 |
| 147 | Ga0207696_1171183 | 3300025711 | Bacteria | 576 |
| 148 | Ga0207655_1000896 | 3300025728 | Bacteria | 31326 |
| 149 | Ga0207655_1001618 | 3300025728 | Bacteria | 20023 |
| 150 | Ga0207655_1002914 | 3300025728 | Bacteria | 13182 |
| 151 | Ga0207655_1007603 | 3300025728 | Bacteria | 7008 |
| 152 | Ga0207655_1009084 | 3300025728 | Bacteria | 6220 |
| 153 | Ga0207655_1059240 | 3300025728 | Bacteria | 1492 |
| 154 | Ga0207655_1074462 | 3300025728 | Bacteria | 1249 |
| 155 | Ga0207713_1000689 | 3300025735 | Bacteria | 31727 |
| 156 | Ga0207713_1001389 | 3300025735 | Bacteria | 19633 |
| 157 | Ga0207713_1001940 | 3300025735 | Bacteria | 15644 |
| 158 | Ga0207713_1008663 | 3300025735 | Bacteria | 5817 |
| 159 | Ga0207713_1010616 | 3300025735 | Bacteria | 5081 |
| 160 | Ga0207713_1019697 | 3300025735 | Bacteria | 3293 |
| 161 | Ga0207681_10061653 | 3300025923 | Bacteria | 2579 |
| 162 | Ga0207686_10101637 | 3300025934 | Bacteria | 1921 |
| 163 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 164 | Ga0207709_10000517 | 3300025935 | Bacteria | 33655 |
| 165 | Ga0207709_10107691 | 3300025935 | Bacteria | 1857 |
| 166 | Ga0207712_10236672 | 3300025961 | Bacteria | 1469 |
| 167 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 168 | Ga0209281_1000202 | 3300027111 | Bacteria | 135240 |
| 169 | Ga0209281_1011153 | 3300027111 | Bacteria | 2022 |
| 170 | Ga0209281_1019925 | 3300027111 | Bacteria | 1319 |
| 171 | Ga0209974_10057430 | 3300027876 | Bacteria | 1314 |
| 172 | Ga0207428_10015030 | 3300027907 | Bacteria | 6707 |
| 173 | Ga0207428_10045078 | 3300027907 | Bacteria | 3555 |
| 174 | Ga0207428_10055312 | 3300027907 | Bacteria | 3156 |
| 175 | Ga0207428_10073102 | 3300027907 | Bacteria | 2691 |
| 176 | Ga0207428_10107728 | 3300027907 | Bacteria | 2147 |
| 177 | Ga0207428_10227391 | 3300027907 | Bacteria | 1397 |
| 178 | Ga0207428_10265778 | 3300027907 | Bacteria | 1277 |
| 179 | Ga0207428_10447791 | 3300027907 | Bacteria | 942 |
| 180 | Ga0207428_10609963 | 3300027907 | Bacteria | 786 |
| 181 | Ga0268266_10011767 | 3300028379 | Bacteria | 7587 |
| 182 | Ga0307511_10161596 | 3300030521 | Bacteria | 1256 |
| 183 | Ga0314311_1174749 | 3300030733 | Bacteria | 3224 |
| 184 | Ga0316178_1049075 | 3300030735 | Bacteria | 8388 |
| 185 | Ga0316180_1144020 | 3300030736 | Bacteria | 892 |
| 186 | Ga0316183_1074327 | 3300030742 | Bacteria | 3627 |
| 187 | Ga0316181_1243246 | 3300030744 | Bacteria | 3868 |
| 188 | Ga0307408_100022319 | 3300031548 | Bacteria | 4299 |
| 189 | Ga0307408_100066429 | 3300031548 | Bacteria | 2648 |
| 190 | Ga0307408_100103943 | 3300031548 | Bacteria | 2169 |
| 191 | Ga0307408_100187547 | 3300031548 | Bacteria | 1663 |
| 192 | Ga0307405_10000689 | 3300031731 | Bacteria | 13060 |
| 193 | Ga0307405_10050184 | 3300031731 | Bacteria | 2582 |
| 194 | Ga0307413_10004010 | 3300031824 | Bacteria | 6327 |
| 195 | Ga0307413_10016016 | 3300031824 | Bacteria | 3858 |
| 196 | Ga0307406_10009015 | 3300031901 | Bacteria | 5579 |
| 197 | Ga0307406_10010053 | 3300031901 | Bacteria | 5326 |
| 198 | Ga0307406_10503723 | 3300031901 | Bacteria | 982 |
| 199 | Ga0307407_10008536 | 3300031903 | Bacteria | 4710 |
| 200 | Ga0307407_10091846 | 3300031903 | Bacteria | 1863 |
| 201 | Ga0307407_10924193 | 3300031903 | Bacteria | 670 |
| 202 | Ga0307412_10001346 | 3300031911 | Bacteria | 13689 |
| 203 | Ga0307412_10005151 | 3300031911 | Bacteria | 7322 |
| 204 | Ga0307412_10007351 | 3300031911 | Bacteria | 6245 |
| 205 | Ga0307412_10105917 | 3300031911 | Bacteria | 1998 |
| 206 | Ga0307409_100157295 | 3300031995 | Bacteria | 1982 |
| 207 | Ga0307409_100410987 | 3300031995 | Bacteria | 1295 |
| 208 | Ga0307416_100009580 | 3300032002 | Bacteria | 6349 |
| 209 | Ga0307416_101421112 | 3300032002 | Bacteria | 799 |
| 210 | Ga0307414_10044133 | 3300032004 | Bacteria | 3041 |
| 211 | Ga0307414_10071613 | 3300032004 | Bacteria | 2501 |
| 212 | Ga0307414_10075402 | 3300032004 | Bacteria | 2447 |
| 213 | Ga0307414_10164506 | 3300032004 | Bacteria | 1766 |
| 214 | Ga0307411_10009789 | 3300032005 | Bacteria | 5065 |
| 215 | Ga0307411_10010618 | 3300032005 | Bacteria | 4919 |
| 216 | Ga0307411_10040007 | 3300032005 | Bacteria | 2970 |
| 217 | Ga0307510_10007066 | 3300033180 | Bacteria | 13382 |
| 218 | Ga0237819_02832 | 3300038705 | Bacteria | 3301 |
| 219 | Ga0439438_000622 | 3300041405 | Bacteria | 15975 |
| 220 | Ga0439438_001115 | 3300041405 | Bacteria | 11950 |
| 221 | Ga0439438_001130 | 3300041405 | Bacteria | 11875 |
| 222 | Ga0439438_008191 | 3300041405 | Bacteria | 3492 |
| 223 | Ga0439438_018232 | 3300041405 | Bacteria | 2003 |
| 224 | Ga0439438_018576 | 3300041405 | Bacteria | 1977 |
| 225 | Ga0439438_026197 | 3300041405 | Bacteria | 1582 |
| 226 | Ga0439438_053223 | 3300041405 | Bacteria | 1025 |
| 227 | Ga0439447_000562 | 3300041407 | Bacteria | 13807 |
| 228 | Ga0439447_001274 | 3300041407 | Bacteria | 9172 |
| 229 | Ga0439447_001610 | 3300041407 | Bacteria | 8274 |
| 230 | Ga0439447_002472 | 3300041407 | Bacteria | 6723 |
| 231 | Ga0439447_013606 | 3300041407 | Bacteria | 2303 |
| 232 | Ga0439447_035683 | 3300041407 | Bacteria | 1231 |
| 233 | Ga0439447_041230 | 3300041407 | Bacteria | 1124 |
| 234 | Ga0439466_0001323 | 3300041411 | Bacteria | 9652 |
| 235 | Ga0439466_0002331 | 3300041411 | Bacteria | 7448 |
| 236 | Ga0439466_0003049 | 3300041411 | Bacteria | 6528 |
| 237 | Ga0439466_0003571 | 3300041411 | Bacteria | 6010 |
| 238 | Ga0439466_0004648 | 3300041411 | Bacteria | 5272 |
| 239 | Ga0439466_0022710 | 3300041411 | Bacteria | 2212 |
| 240 | Ga0439466_0025087 | 3300041411 | Bacteria | 2083 |
| 241 | Ga0439466_0030367 | 3300041411 | Bacteria | 1854 |
| 242 | Ga0439466_0032338 | 3300041411 | Bacteria | 1784 |
| 243 | Ga0439466_0050348 | 3300041411 | Bacteria | 1366 |
| 244 | Ga0439465_0016881 | 3300041413 | Bacteria | 2278 |
| 245 | Ga0439465_0116620 | 3300041413 | Bacteria | 933 |
| 246 | Ga0439465_0168346 | 3300041413 | Bacteria | 788 |
| 247 | Ga0439465_0207111 | 3300041413 | Bacteria | 716 |
| 248 | Ga0439431_0000577 | 3300041997 | Bacteria | 7800 |
| 249 | Ga0439431_0163933 | 3300041997 | Bacteria | 636 |
| 250 | Ga0439445_0048581 | 3300042004 | Bacteria | 1141 |
| 251 | Ga0439432_001876 | 3300042006 | Bacteria | 7905 |
| 252 | Ga0439432_005177 | 3300042006 | Bacteria | 4711 |
| 253 | Ga0439432_005468 | 3300042006 | Bacteria | 4570 |
| 254 | Ga0439432_020304 | 3300042006 | Bacteria | 2209 |
| 255 | Ga0439432_022764 | 3300042006 | Bacteria | 2068 |
| 256 | Ga0439432_075889 | 3300042006 | Bacteria | 1021 |
| 257 | Ga0439451_000883 | 3300042009 | Bacteria | 5759 |
| 258 | Ga0439451_002436 | 3300042009 | Bacteria | 3769 |
| 259 | Ga0439451_003412 | 3300042009 | Bacteria | 3218 |
| 260 | Ga0439452_000336 | 3300042010 | Bacteria | 29226 |
| 261 | Ga0439452_000995 | 3300042010 | Bacteria | 12672 |
| 262 | Ga0439452_001056 | 3300042010 | Bacteria | 12156 |
| 263 | Ga0439452_001213 | 3300042010 | Bacteria | 11034 |
| 264 | Ga0439452_002534 | 3300042010 | Bacteria | 6721 |
| 265 | Ga0439452_002813 | 3300042010 | Bacteria | 6284 |
| 266 | Ga0439452_059732 | 3300042010 | Bacteria | 856 |
| 267 | Ga0439456_002709 | 3300042013 | Bacteria | 3572 |
| 268 | Ga0439456_024926 | 3300042013 | Bacteria | 1269 |
| 269 | Ga0439456_043770 | 3300042013 | Bacteria | 973 |
| 270 | Ga0439456_045940 | 3300042013 | Bacteria | 951 |
| 271 | Ga0439463_001283 | 3300042016 | Bacteria | 6684 |
| 272 | Ga0439463_002076 | 3300042016 | Bacteria | 5189 |
| 273 | Ga0439463_023968 | 3300042016 | Bacteria | 1528 |
| 274 | Ga0450911_000236 | 3300042115 | Bacteria | 20967 |
| 275 | Ga0450911_001170 | 3300042115 | Bacteria | 6438 |
| 276 | Ga0450911_002913 | 3300042115 | Bacteria | 3175 |
| 277 | Ga0450911_009374 | 3300042115 | Bacteria | 1372 |
| 278 | Ga0450919_000274 | 3300042121 | Bacteria | 5993 |
| 279 | Ga0450919_008559 | 3300042121 | Bacteria | 1182 |
| 280 | Ga0450920_000195 | 3300042122 | Bacteria | 8766 |
| 281 | Ga0450922_000235 | 3300042124 | Bacteria | 5950 |
| 282 | Ga0450922_000315 | 3300042124 | Bacteria | 5102 |
| 283 | Ga0450923_004163 | 3300042125 | Bacteria | 2252 |
| 284 | Ga0450890_000253 | 3300042127 | Bacteria | 7884 |
| 285 | Ga0450891_004145 | 3300042129 | Bacteria | 1364 |
| 286 | Ga0450902_001174 | 3300042137 | Bacteria | 3508 |
| 287 | Ga0450902_001667 | 3300042137 | Bacteria | 3062 |
| 288 | Ga0450902_011710 | 3300042137 | Bacteria | 1397 |
| 289 | Ga0450902_012096 | 3300042137 | Bacteria | 1378 |
| 290 | Ga0450902_028617 | 3300042137 | Bacteria | 935 |
| 291 | Ga0450902_031531 | 3300042137 | Bacteria | 893 |
| 292 | Ga0450903_000936 | 3300042138 | Bacteria | 5598 |
| 293 | Ga0450903_003047 | 3300042138 | Bacteria | 2921 |
| 294 | Ga0450903_040402 | 3300042138 | Bacteria | 691 |
| 295 | Ga0450903_044996 | 3300042138 | Bacteria | 650 |
| 296 | Ga0450904_031927 | 3300042139 | Bacteria | 552 |
| 297 | Ga0450905_005396 | 3300042142 | Bacteria | 1716 |
| 298 | Ga0450905_021358 | 3300042142 | Bacteria | 956 |
| 299 | Ga0450906_000867 | 3300042145 | Bacteria | 6661 |
| 300 | Ga0450906_001408 | 3300042145 | Bacteria | 5250 |
| 301 | Ga0450906_003874 | 3300042145 | Bacteria | 3178 |
| 302 | Ga0450907_000081 | 3300042146 | Bacteria | 37093 |
| 303 | Ga0450907_000598 | 3300042146 | Bacteria | 9613 |
| 304 | Ga0450907_007383 | 3300042146 | Bacteria | 1835 |
| 305 | Ga0450910_000174 | 3300042147 | Bacteria | 6998 |
| 306 | Ga0450910_001175 | 3300042147 | Bacteria | 3246 |
| 307 | Ga0450910_003075 | 3300042147 | Bacteria | 2201 |
| 308 | Ga0439446_0000876 | 3300042156 | Bacteria | 6467 |
| 309 | Ga0439446_0001332 | 3300042156 | Bacteria | 5567 |
| 310 | Ga0439446_0171698 | 3300042156 | Bacteria | 721 |
| 311 | Ga0450908_000376 | 3300042184 | Bacteria | 8622 |
| 312 | Ga0450908_018968 | 3300042184 | Bacteria | 1212 |
| 313 | Ga0450909_001944 | 3300042185 | Bacteria | 2918 |
| 314 | Ga0450909_002149 | 3300042185 | Bacteria | 2784 |
| 315 | Ga0439434_0000388 | 3300042435 | Bacteria | 12500 |
| 316 | Ga0439434_0051190 | 3300042435 | Bacteria | 1280 |
| 317 | Ga0439464_0034012 | 3300042439 | Bacteria | 1436 |
| 318 | Ga0439460_0000859 | 3300042461 | Bacteria | 6948 |
| 319 | Ga0439460_0166221 | 3300042461 | Bacteria | 741 |
| 320 | Ga0450918_004126 | 3300042531 | Bacteria | 2664 |
| 321 | Ga0450918_021634 | 3300042531 | Bacteria | 1123 |
| 322 | Ga0450918_023546 | 3300042531 | Bacteria | 1076 |
| 323 | Ga0439440_0000576 | 3300042993 | Bacteria | 6210 |
| 324 | Ga0495617_001218 | 3300046452 | Bacteria | 11597 |
| 325 | Ga0495617_005363 | 3300046452 | Bacteria | 4553 |
| 326 | Ga0495617_007102 | 3300046452 | Bacteria | 3905 |
| 327 | Ga0495617_010936 | 3300046452 | Bacteria | 3103 |
| 328 | Ga0495617_012573 | 3300046452 | Bacteria | 2885 |
| 329 | Ga0495617_020305 | 3300046452 | Bacteria | 2245 |
| 330 | Ga0495617_049747 | 3300046452 | Bacteria | 1394 |
| 331 | Ga0495627_001791 | 3300046453 | Bacteria | 11479 |
| 332 | Ga0495627_006194 | 3300046453 | Bacteria | 4713 |
| 333 | Ga0495627_006685 | 3300046453 | Bacteria | 4492 |
| 334 | Ga0495627_129309 | 3300046453 | Bacteria | 711 |
| 335 | Ga0495603_0003858 | 3300046455 | Bacteria | 8923 |
| 336 | Ga0495603_0092917 | 3300046455 | Bacteria | 1763 |
| 337 | Ga0495603_0194583 | 3300046455 | Bacteria | 1172 |
| 338 | Ga0495590_0000340 | 3300046457 | Bacteria | 24206 |
| 339 | Ga0495590_0001333 | 3300046457 | Bacteria | 10744 |
| 340 | Ga0495590_0002583 | 3300046457 | Bacteria | 7479 |
| 341 | Ga0495590_0004417 | 3300046457 | Bacteria | 5681 |
| 342 | Ga0495590_0019690 | 3300046457 | Bacteria | 2401 |
| 343 | Ga0495591_000633 | 3300046458 | Bacteria | 26111 |
| 344 | Ga0495591_002519 | 3300046458 | Bacteria | 10121 |
| 345 | Ga0495591_002584 | 3300046458 | Bacteria | 9935 |
| 346 | Ga0495591_008802 | 3300046458 | Bacteria | 4088 |
| 347 | Ga0495591_009585 | 3300046458 | Bacteria | 3831 |
| 348 | Ga0495591_012408 | 3300046458 | Bacteria | 3175 |
| 349 | Ga0495591_018098 | 3300046458 | Bacteria | 2398 |
| 350 | Ga0495591_023770 | 3300046458 | Bacteria | 1956 |
| 351 | Ga0495591_059646 | 3300046458 | Bacteria | 1017 |
| 352 | Ga0495591_077683 | 3300046458 | Bacteria | 851 |
| 353 | Ga0495629_0015028 | 3300046459 | Bacteria | 5564 |
| 354 | Ga0495638_0002645 | 3300046460 | Bacteria | 14417 |
| 355 | Ga0495638_0009148 | 3300046460 | Bacteria | 6966 |
| 356 | Ga0495638_0010758 | 3300046460 | Bacteria | 6332 |
| 357 | Ga0495638_0023996 | 3300046460 | Bacteria | 3982 |
| 358 | Ga0495638_0034364 | 3300046460 | Bacteria | 3236 |
| 359 | Ga0495638_0050089 | 3300046460 | Bacteria | 2609 |
| 360 | Ga0495638_0064290 | 3300046460 | Bacteria | 2260 |
| 361 | Ga0495638_0064486 | 3300046460 | Bacteria | 2256 |
| 362 | Ga0495638_0064956 | 3300046460 | Bacteria | 2247 |
| 363 | Ga0495638_0084009 | 3300046460 | Bacteria | 1927 |
| 364 | Ga0495638_0085556 | 3300046460 | Bacteria | 1906 |
| 365 | Ga0495638_0134542 | 3300046460 | Bacteria | 1449 |
| 366 | Ga0495638_0142437 | 3300046460 | Bacteria | 1397 |
| 367 | Ga0495638_0165470 | 3300046460 | Bacteria | 1272 |
| 368 | Ga0495653_0010482 | 3300046463 | Bacteria | 7584 |
| 369 | Ga0495653_0052221 | 3300046463 | Bacteria | 3133 |
| 370 | Ga0495653_0085405 | 3300046463 | Bacteria | 2321 |
| 371 | Ga0495653_0159743 | 3300046463 | Bacteria | 1565 |
| 372 | Ga0495650_0007966 | 3300046471 | Bacteria | 6272 |
| 373 | Ga0495650_0015573 | 3300046471 | Bacteria | 3893 |
| 374 | Ga0495650_0016047 | 3300046471 | Bacteria | 3813 |
| 375 | Ga0495650_0017444 | 3300046471 | Bacteria | 3600 |
| 376 | Ga0495650_0018746 | 3300046471 | Bacteria | 3430 |
| 377 | Ga0495650_0023955 | 3300046471 | Bacteria | 2893 |
| 378 | Ga0495650_0073164 | 3300046471 | Bacteria | 1339 |
| 379 | Ga0495650_0092021 | 3300046471 | Bacteria | 1152 |
| 380 | Ga0495580_0250074 | 3300046472 | Bacteria | 1214 |
| 381 | Ga0495582_0004449 | 3300046473 | Bacteria | 7884 |
| 382 | Ga0495605_0000700 | 3300046474 | Bacteria | 24891 |
| 383 | Ga0495605_0002331 | 3300046474 | Bacteria | 11830 |
| 384 | Ga0495605_0019673 | 3300046474 | Bacteria | 3602 |
| 385 | Ga0495605_0023230 | 3300046474 | Bacteria | 3265 |
| 386 | Ga0495605_0041057 | 3300046474 | Bacteria | 2305 |
| 387 | Ga0495605_0060777 | 3300046474 | Bacteria | 1810 |
| 388 | Ga0495605_0151194 | 3300046474 | Bacteria | 1036 |
| 389 | Ga0495639_0000127 | 3300046475 | Bacteria | 39107 |
| 390 | Ga0495639_0037026 | 3300046475 | Bacteria | 2186 |
| 391 | Ga0495664_0114421 | 3300046477 | Bacteria | 1630 |
| 392 | Ga0495584_0001750 | 3300046491 | Bacteria | 12669 |
| 393 | Ga0495584_0004667 | 3300046491 | Bacteria | 7342 |
| 394 | Ga0495584_0008797 | 3300046491 | Bacteria | 5221 |
| 395 | Ga0495584_0008873 | 3300046491 | Bacteria | 5200 |
| 396 | Ga0495584_0011359 | 3300046491 | Bacteria | 4561 |
| 397 | Ga0495584_0012377 | 3300046491 | Bacteria | 4354 |
| 398 | Ga0495584_0021299 | 3300046491 | Bacteria | 3294 |
| 399 | Ga0495584_0024745 | 3300046491 | Bacteria | 3044 |
| 400 | Ga0495584_0040868 | 3300046491 | Bacteria | 2341 |
| 401 | Ga0495584_0044151 | 3300046491 | Bacteria | 2249 |
| 402 | Ga0495584_0073468 | 3300046491 | Bacteria | 1718 |
| 403 | Ga0495584_0138481 | 3300046491 | Bacteria | 1235 |
| 404 | Ga0495585_0002826 | 3300046492 | Bacteria | 12104 |
| 405 | Ga0495585_0011764 | 3300046492 | Bacteria | 5170 |
| 406 | Ga0495585_0018754 | 3300046492 | Bacteria | 3991 |
| 407 | Ga0495585_0045695 | 3300046492 | Bacteria | 2443 |
| 408 | Ga0495585_0049598 | 3300046492 | Bacteria | 2330 |
| 409 | Ga0495585_0099235 | 3300046492 | Bacteria | 1559 |
| 410 | Ga0495585_0162603 | 3300046492 | Bacteria | 1157 |
| 411 | Ga0495585_0186226 | 3300046492 | Bacteria | 1064 |
| 412 | Ga0495585_0208205 | 3300046492 | Bacteria | 992 |
| 413 | Ga0495594_0016316 | 3300046499 | Bacteria | 3912 |
| 414 | Ga0495594_0060916 | 3300046499 | Bacteria | 2088 |
| 415 | Ga0495594_0075949 | 3300046499 | Bacteria | 1873 |
| 416 | Ga0495596_0000457 | 3300046500 | Bacteria | 25996 |
| 417 | Ga0495596_0019474 | 3300046500 | Bacteria | 2787 |
| 418 | Ga0495607_0001842 | 3300046501 | Bacteria | 18063 |
| 419 | Ga0495607_0002479 | 3300046501 | Bacteria | 14986 |
| 420 | Ga0495607_0005447 | 3300046501 | Bacteria | 9109 |
| 421 | Ga0495607_0005775 | 3300046501 | Bacteria | 8799 |
| 422 | Ga0495607_0013328 | 3300046501 | Bacteria | 5390 |
| 423 | Ga0495607_0013603 | 3300046501 | Bacteria | 5327 |
| 424 | Ga0495607_0016376 | 3300046501 | Bacteria | 4784 |
| 425 | Ga0495607_0061679 | 3300046501 | Bacteria | 2129 |
| 426 | Ga0495607_0077667 | 3300046501 | Bacteria | 1833 |
| 427 | Ga0495607_0084186 | 3300046501 | Bacteria | 1740 |
| 428 | Ga0495607_0137774 | 3300046501 | Bacteria | 1262 |
| 429 | Ga0495607_0148658 | 3300046501 | Bacteria | 1201 |
| 430 | Ga0495607_0179240 | 3300046501 | Bacteria | 1063 |
| 431 | Ga0495607_0203729 | 3300046501 | Bacteria | 977 |
| 432 | Ga0495583_0007690 | 3300046506 | Bacteria | 6716 |
| 433 | Ga0495583_0014015 | 3300046506 | Bacteria | 4439 |
| 434 | Ga0495583_0014566 | 3300046506 | Bacteria | 4330 |
| 435 | Ga0495583_0022404 | 3300046506 | Bacteria | 3223 |
| 436 | Ga0495583_0106411 | 3300046506 | Bacteria | 1192 |
| 437 | Ga0495583_0138743 | 3300046506 | Bacteria | 1013 |
| 438 | Ga0495606_0001929 | 3300046507 | Bacteria | 25724 |
| 439 | Ga0495606_0007990 | 3300046507 | Bacteria | 9303 |
| 440 | Ga0495606_0012463 | 3300046507 | Bacteria | 6812 |
| 441 | Ga0495606_0017049 | 3300046507 | Bacteria | 5508 |
| 442 | Ga0495606_0041100 | 3300046507 | Bacteria | 3102 |
| 443 | Ga0495610_0002647 | 3300046512 | Bacteria | 14796 |
| 444 | Ga0495610_0005392 | 3300046512 | Bacteria | 9113 |
| 445 | Ga0495610_0009009 | 3300046512 | Bacteria | 6369 |
| 446 | Ga0495610_0010638 | 3300046512 | Bacteria | 5698 |
| 447 | Ga0495610_0011594 | 3300046512 | Bacteria | 5375 |
| 448 | Ga0495610_0012442 | 3300046512 | Bacteria | 5122 |
| 449 | Ga0495610_0087769 | 3300046512 | Bacteria | 1415 |
| 450 | Ga0495610_0125868 | 3300046512 | Bacteria | 1117 |
| 451 | Ga0495610_0192625 | 3300046512 | Bacteria | 840 |
| 452 | Ga0495616_0005949 | 3300046513 | Bacteria | 7439 |
| 453 | Ga0495616_0006578 | 3300046513 | Bacteria | 7020 |
| 454 | Ga0495616_0010463 | 3300046513 | Bacteria | 5368 |
| 455 | Ga0495616_0011608 | 3300046513 | Bacteria | 5040 |
| 456 | Ga0495616_0024545 | 3300046513 | Bacteria | 3232 |
| 457 | Ga0495616_0069276 | 3300046513 | Bacteria | 1710 |
| 458 | Ga0495616_0073496 | 3300046513 | Bacteria | 1649 |
| 459 | Ga0495616_0100340 | 3300046513 | Bacteria | 1358 |
| 460 | Ga0495616_0105290 | 3300046513 | Bacteria | 1317 |
| 461 | Ga0495616_0156085 | 3300046513 | Bacteria | 1029 |
| 462 | Ga0495616_0180702 | 3300046513 | Bacteria | 937 |
| 463 | Ga0495620_0002168 | 3300046515 | Bacteria | 11412 |
| 464 | Ga0495620_0002462 | 3300046515 | Bacteria | 10729 |
| 465 | Ga0495620_0008445 | 3300046515 | Bacteria | 5529 |
| 466 | Ga0495620_0028806 | 3300046515 | Bacteria | 2577 |
| 467 | Ga0495620_0046241 | 3300046515 | Bacteria | 1880 |
| 468 | Ga0495620_0075737 | 3300046515 | Bacteria | 1368 |
| 469 | Ga0495620_0083338 | 3300046515 | Bacteria | 1291 |
| 470 | Ga0495628_0840388 | 3300046516 | Bacteria | 640 |
| 471 | Ga0495630_0078352 | 3300046517 | Bacteria | 2491 |
| 472 | Ga0495630_0091744 | 3300046517 | Bacteria | 2295 |
| 473 | Ga0495630_0466701 | 3300046517 | Bacteria | 967 |
| 474 | Ga0495631_0000294 | 3300046518 | Bacteria | 34947 |
| 475 | Ga0495631_0002372 | 3300046518 | Bacteria | 10702 |
| 476 | Ga0495631_0007666 | 3300046518 | Bacteria | 5481 |
| 477 | Ga0495631_0041905 | 3300046518 | Bacteria | 2024 |
| 478 | Ga0495631_0044994 | 3300046518 | Bacteria | 1944 |
| 479 | Ga0495632_0000183 | 3300046519 | Bacteria | 63981 |
| 480 | Ga0495632_0001201 | 3300046519 | Bacteria | 21985 |
| 481 | Ga0495632_0002627 | 3300046519 | Bacteria | 13526 |
| 482 | Ga0495632_0004421 | 3300046519 | Bacteria | 9556 |
| 483 | Ga0495632_0005950 | 3300046519 | Bacteria | 7946 |
| 484 | Ga0495632_0007805 | 3300046519 | Bacteria | 6666 |
| 485 | Ga0495632_0017318 | 3300046519 | Bacteria | 3981 |
| 486 | Ga0495632_0035099 | 3300046519 | Bacteria | 2561 |
| 487 | Ga0495632_0049023 | 3300046519 | Bacteria | 2089 |
| 488 | Ga0495632_0093532 | 3300046519 | Bacteria | 1422 |
| 489 | Ga0495637_0002968 | 3300046520 | Bacteria | 9127 |
| 490 | Ga0495637_0009266 | 3300046520 | Bacteria | 4805 |
| 491 | Ga0495637_0010088 | 3300046520 | Bacteria | 4583 |
| 492 | Ga0495637_0010262 | 3300046520 | Bacteria | 4536 |
| 493 | Ga0495637_0035167 | 3300046520 | Bacteria | 2189 |
| 494 | Ga0495637_0043001 | 3300046520 | Bacteria | 1930 |
| 495 | Ga0495637_0045602 | 3300046520 | Bacteria | 1858 |
| 496 | Ga0495637_0059646 | 3300046520 | Bacteria | 1569 |
| 497 | Ga0495637_0083973 | 3300046520 | Bacteria | 1265 |
| 498 | Ga0495637_0111711 | 3300046520 | Bacteria | 1058 |
| 499 | Ga0495637_0131342 | 3300046520 | Bacteria | 956 |
| 500 | Ga0495637_0161470 | 3300046520 | Bacteria | 840 |
| 501 | Ga0495637_0205299 | 3300046520 | Bacteria | 722 |
| 502 | Ga0495637_0295540 | 3300046520 | Bacteria | 575 |
| 503 | Ga0495643_0014649 | 3300046522 | Bacteria | 4659 |
| 504 | Ga0495643_0016933 | 3300046522 | Bacteria | 4272 |
| 505 | Ga0495643_0017538 | 3300046522 | Bacteria | 4182 |
| 506 | Ga0495643_0019098 | 3300046522 | Bacteria | 3968 |
| 507 | Ga0495643_0105656 | 3300046522 | Bacteria | 1437 |
| 508 | Ga0495644_0004258 | 3300046523 | Bacteria | 5618 |
| 509 | Ga0495644_0005826 | 3300046523 | Bacteria | 4812 |
| 510 | Ga0495644_0040476 | 3300046523 | Bacteria | 1757 |
| 511 | Ga0495644_0066275 | 3300046523 | Bacteria | 1356 |
| 512 | Ga0495644_0273253 | 3300046523 | Bacteria | 658 |
| 513 | Ga0495648_0000923 | 3300046524 | Bacteria | 30591 |
| 514 | Ga0495648_0002722 | 3300046524 | Bacteria | 15969 |
| 515 | Ga0495648_0036194 | 3300046524 | Bacteria | 3189 |
| 516 | Ga0495648_0079026 | 3300046524 | Bacteria | 1879 |
| 517 | Ga0495648_0095692 | 3300046524 | Bacteria | 1651 |
| 518 | Ga0495648_0099249 | 3300046524 | Bacteria | 1611 |
| 519 | Ga0495648_0203327 | 3300046524 | Bacteria | 989 |
| 520 | Ga0495648_0228193 | 3300046524 | Bacteria | 913 |
| 521 | Ga0495648_0275636 | 3300046524 | Bacteria | 799 |
| 522 | Ga0495666_0015745 | 3300046526 | Bacteria | 3767 |
| 523 | Ga0495666_0032703 | 3300046526 | Bacteria | 2544 |
| 524 | Ga0495642_0000312 | 3300046528 | Bacteria | 26988 |
| 525 | Ga0495642_0000897 | 3300046528 | Bacteria | 13984 |
| 526 | Ga0495642_0002322 | 3300046528 | Bacteria | 7760 |
| 527 | Ga0495652_0439226 | 3300046529 | Bacteria | 916 |
| 528 | Ga0495654_0002100 | 3300046530 | Bacteria | 13029 |
| 529 | Ga0495654_0002528 | 3300046530 | Bacteria | 11757 |
| 530 | Ga0495654_0007579 | 3300046530 | Bacteria | 6047 |
| 531 | Ga0495654_0007607 | 3300046530 | Bacteria | 6034 |
| 532 | Ga0495654_0012687 | 3300046530 | Bacteria | 4524 |
| 533 | Ga0495654_0021176 | 3300046530 | Bacteria | 3384 |
| 534 | Ga0495654_0021975 | 3300046530 | Bacteria | 3317 |
| 535 | Ga0495654_0024421 | 3300046530 | Bacteria | 3122 |
| 536 | Ga0495654_0027101 | 3300046530 | Bacteria | 2940 |
| 537 | Ga0495654_0028283 | 3300046530 | Bacteria | 2867 |
| 538 | Ga0495654_0031338 | 3300046530 | Bacteria | 2699 |
| 539 | Ga0495654_0031917 | 3300046530 | Bacteria | 2672 |
| 540 | Ga0495654_0110378 | 3300046530 | Bacteria | 1255 |
| 541 | Ga0495654_0175813 | 3300046530 | Bacteria | 930 |
| 542 | Ga0495586_0015830 | 3300046535 | Bacteria | 4011 |
| 543 | Ga0495587_0001908 | 3300046536 | Bacteria | 13882 |
| 544 | Ga0495587_0007201 | 3300046536 | Bacteria | 7218 |
| 545 | Ga0495609_0001932 | 3300046538 | Bacteria | 13181 |
| 546 | Ga0495609_0004194 | 3300046538 | Bacteria | 7993 |
| 547 | Ga0495609_0004674 | 3300046538 | Bacteria | 7422 |
| 548 | Ga0495609_0021438 | 3300046538 | Bacteria | 2980 |
| 549 | Ga0495609_0051376 | 3300046538 | Bacteria | 1835 |
| 550 | Ga0495609_0079690 | 3300046538 | Bacteria | 1432 |
| 551 | Ga0495609_0350620 | 3300046538 | Bacteria | 595 |
| 552 | Ga0495597_0003033 | 3300046542 | Bacteria | 10119 |
| 553 | Ga0495597_0009193 | 3300046542 | Bacteria | 4899 |
| 554 | Ga0495597_0010022 | 3300046542 | Bacteria | 4651 |
| 555 | Ga0495597_0014359 | 3300046542 | Bacteria | 3773 |
| 556 | Ga0495597_0020977 | 3300046542 | Bacteria | 3038 |
| 557 | Ga0495597_0029760 | 3300046542 | Bacteria | 2491 |
| 558 | Ga0495597_0050053 | 3300046542 | Bacteria | 1845 |
| 559 | Ga0495597_0061422 | 3300046542 | Bacteria | 1636 |
| 560 | Ga0495622_0001755 | 3300046557 | Bacteria | 10719 |
| 561 | Ga0495622_0015333 | 3300046557 | Bacteria | 3563 |
| 562 | Ga0495622_0019585 | 3300046557 | Bacteria | 3150 |
| 563 | Ga0495622_0020506 | 3300046557 | Bacteria | 3077 |
| 564 | Ga0495622_0258027 | 3300046557 | Bacteria | 765 |
| 565 | Ga0495622_0441280 | 3300046557 | Bacteria | 558 |
| 566 | Ga0495633_0003303 | 3300046558 | Bacteria | 10841 |
| 567 | Ga0495633_0011367 | 3300046558 | Bacteria | 4802 |
| 568 | Ga0495633_0065146 | 3300046558 | Bacteria | 1703 |
| 569 | Ga0495633_0135241 | 3300046558 | Bacteria | 1140 |
| 570 | Ga0495656_0000491 | 3300046615 | Bacteria | 12892 |
| 571 | Ga0495656_0032403 | 3300046615 | Bacteria | 2126 |
| 572 | Ga0495656_0052182 | 3300046615 | Bacteria | 1752 |
| 573 | Ga0495668_0004170 | 3300046616 | Bacteria | 10429 |
| 574 | Ga0495668_0027292 | 3300046616 | Bacteria | 3235 |
| 575 | Ga0495668_0032164 | 3300046616 | Bacteria | 2953 |
| 576 | Ga0495668_0106871 | 3300046616 | Bacteria | 1530 |
| 577 | Ga0495634_0002797 | 3300046642 | Bacteria | 14334 |
| 578 | Ga0495611_0000487 | 3300046648 | Bacteria | 23735 |
| 579 | Ga0495611_0054715 | 3300046648 | Bacteria | 1804 |
| 580 | Ga0495625_0007666 | 3300046660 | Bacteria | 9357 |
| 581 | Ga0495625_0014306 | 3300046660 | Bacteria | 6339 |
| 582 | Ga0495625_0014464 | 3300046660 | Bacteria | 6296 |
| 583 | Ga0495625_0015838 | 3300046660 | Bacteria | 5952 |
| 584 | Ga0495625_0016152 | 3300046660 | Bacteria | 5882 |
| 585 | Ga0495625_0106148 | 3300046660 | Bacteria | 1923 |
| 586 | Ga0495635_0002332 | 3300046663 | Bacteria | 12897 |
| 587 | Ga0495635_0031323 | 3300046663 | Bacteria | 3692 |
| 588 | Ga0495659_0000591 | 3300046664 | Bacteria | 13378 |
| 589 | Ga0495659_0001632 | 3300046664 | Bacteria | 7526 |
| 590 | Ga0495659_0010672 | 3300046664 | Bacteria | 2953 |
| 591 | Ga0495659_0064831 | 3300046664 | Bacteria | 1357 |
| 592 | Ga0495661_0008492 | 3300046665 | Bacteria | 7102 |
| 593 | Ga0495661_0009218 | 3300046665 | Bacteria | 6782 |
| 594 | Ga0495661_0017401 | 3300046665 | Bacteria | 4748 |
| 595 | Ga0495661_0051155 | 3300046665 | Bacteria | 2496 |
| 596 | Ga0495661_0057687 | 3300046665 | Bacteria | 2317 |
| 597 | Ga0495661_0066453 | 3300046665 | Bacteria | 2122 |
| 598 | Ga0495661_0070489 | 3300046665 | Bacteria | 2045 |
| 599 | Ga0495661_0095133 | 3300046665 | Bacteria | 1687 |
| 600 | Ga0495661_0139804 | 3300046665 | Bacteria | 1318 |
| 601 | Ga0495588_0023300 | 3300046674 | Bacteria | 3065 |
| 602 | Ga0495588_0027484 | 3300046674 | Bacteria | 2843 |
| 603 | Ga0495588_0046580 | 3300046674 | Bacteria | 2224 |
| 604 | Ga0495657_0050499 | 3300046675 | Bacteria | 2796 |
| 605 | Ga0495623_0002029 | 3300046679 | Bacteria | 13596 |
| 606 | Ga0495623_0009473 | 3300046679 | Bacteria | 6323 |
| 607 | Ga0495646_0010104 | 3300046680 | Bacteria | 6001 |
| 608 | Ga0495646_0047230 | 3300046680 | Bacteria | 2621 |
| 609 | Ga0495646_0086285 | 3300046680 | Bacteria | 1820 |
| 610 | Ga0495669_0004265 | 3300046684 | Bacteria | 5895 |
| 611 | Ga0495669_0165100 | 3300046684 | Bacteria | 1052 |
| 612 | Ga0495613_0020891 | 3300046689 | Bacteria | 4880 |
| 613 | Ga0495613_0022276 | 3300046689 | Bacteria | 4722 |
| 614 | Ga0495613_0042354 | 3300046689 | Bacteria | 3369 |
| 615 | Ga0495613_0561385 | 3300046689 | Bacteria | 763 |
| 616 | Ga0495624_0001085 | 3300046690 | Bacteria | 21505 |
| 617 | Ga0495670_0001055 | 3300046691 | Bacteria | 13357 |
| 618 | Ga0495670_0001104 | 3300046691 | Bacteria | 13098 |
| 619 | Ga0495670_0005125 | 3300046691 | Bacteria | 6442 |
| 620 | Ga0495670_0008302 | 3300046691 | Bacteria | 5105 |
| 621 | Ga0495670_0009909 | 3300046691 | Bacteria | 4684 |
| 622 | Ga0495670_0330820 | 3300046691 | Bacteria | 818 |
| 623 | Ga0495671_0004083 | 3300046692 | Bacteria | 8807 |
| 624 | Ga0495671_0007553 | 3300046692 | Bacteria | 6183 |
| 625 | Ga0495671_0012257 | 3300046692 | Bacteria | 4687 |
| 626 | Ga0495671_0015074 | 3300046692 | Bacteria | 4150 |
| 627 | Ga0495671_0015870 | 3300046692 | Bacteria | 4031 |
| 628 | Ga0495671_0027361 | 3300046692 | Bacteria | 2946 |
| 629 | Ga0495671_0030922 | 3300046692 | Bacteria | 2739 |
| 630 | Ga0495671_0031043 | 3300046692 | Bacteria | 2732 |
| 631 | Ga0495671_0035115 | 3300046692 | Bacteria | 2547 |
| 632 | Ga0495671_0055995 | 3300046692 | Bacteria | 1952 |
| 633 | Ga0495671_0057175 | 3300046692 | Bacteria | 1930 |
| 634 | Ga0495671_0060411 | 3300046692 | Bacteria | 1871 |
| 635 | Ga0495671_0076969 | 3300046692 | Bacteria | 1635 |
| 636 | Ga0495671_0079487 | 3300046692 | Bacteria | 1607 |
| 637 | Ga0495649_0001766 | 3300046694 | Bacteria | 15936 |
| 638 | Ga0495649_0004367 | 3300046694 | Bacteria | 9252 |
| 639 | Ga0495649_0005632 | 3300046694 | Bacteria | 7914 |
| 640 | Ga0495649_0016452 | 3300046694 | Bacteria | 4190 |
| 641 | Ga0495649_0020115 | 3300046694 | Bacteria | 3745 |
| 642 | Ga0495649_0020534 | 3300046694 | Bacteria | 3705 |
| 643 | Ga0495649_0032096 | 3300046694 | Bacteria | 2895 |
| 644 | Ga0495649_0049470 | 3300046694 | Bacteria | 2283 |
| 645 | Ga0495649_0071964 | 3300046694 | Bacteria | 1853 |
| 646 | Ga0495649_0095201 | 3300046694 | Bacteria | 1585 |
| 647 | Ga0495649_0177445 | 3300046694 | Bacteria | 1112 |
| 648 | Ga0495589_0001608 | 3300046794 | Bacteria | 12945 |
| 649 | Ga0495589_0001746 | 3300046794 | Bacteria | 12363 |
| 650 | Ga0495589_0005329 | 3300046794 | Bacteria | 6789 |
| 651 | Ga0495589_0005643 | 3300046794 | Bacteria | 6596 |
| 652 | Ga0495589_0015569 | 3300046794 | Bacteria | 3911 |
| 653 | Ga0495589_0016565 | 3300046794 | Bacteria | 3787 |
| 654 | Ga0495589_0033831 | 3300046794 | Bacteria | 2565 |
| 655 | Ga0495589_0057359 | 3300046794 | Bacteria | 1915 |
| 656 | Ga0495589_0086181 | 3300046794 | Bacteria | 1525 |
| 657 | Ga0495600_0160639 | 3300046809 | Bacteria | 1452 |
| 658 | Ga0495660_0003783 | 3300046810 | Bacteria | 9280 |
| 659 | Ga0495660_0003851 | 3300046810 | Bacteria | 9179 |
| 660 | Ga0495660_0011544 | 3300046810 | Bacteria | 5123 |
| 661 | Ga0495660_0012592 | 3300046810 | Bacteria | 4908 |
| 662 | Ga0495660_0021925 | 3300046810 | Bacteria | 3652 |
| 663 | Ga0495660_0029670 | 3300046810 | Bacteria | 3084 |
| 664 | Ga0495660_0030468 | 3300046810 | Bacteria | 3038 |
| 665 | Ga0495660_0047599 | 3300046810 | Bacteria | 2347 |
| 666 | Ga0495660_0053564 | 3300046810 | Bacteria | 2189 |
| 667 | Ga0495660_0058681 | 3300046810 | Bacteria | 2071 |
| 668 | Ga0495660_0103433 | 3300046810 | Bacteria | 1463 |
| 669 | Ga0495660_0117331 | 3300046810 | Bacteria | 1350 |
| 670 | Ga0495660_0289892 | 3300046810 | Bacteria | 745 |
| 671 | Ga0495581_0010307 | 3300047315 | Bacteria | 5406 |
| 672 | Ga0495581_0044694 | 3300047315 | Bacteria | 2561 |
| 673 | Ga0495604_0029265 | 3300047317 | Bacteria | 4381 |
| 674 | Ga0495604_0059325 | 3300047317 | Bacteria | 2933 |
| 675 | Ga0495604_0111279 | 3300047317 | Bacteria | 1996 |
| 676 | Ga0495636_0001055 | 3300047318 | Bacteria | 10355 |
| 677 | Ga0495636_0022025 | 3300047318 | Bacteria | 2575 |
| 678 | Ga0495674_0047960 | 3300047319 | Bacteria | 3783 |
| 679 | Ga0495672_0002383 | 3300047320 | Bacteria | 17353 |
| 680 | Ga0495672_0003039 | 3300047320 | Bacteria | 14728 |
| 681 | Ga0495672_0003187 | 3300047320 | Bacteria | 14263 |
| 682 | Ga0495672_0005960 | 3300047320 | Bacteria | 9549 |
| 683 | Ga0495672_0012445 | 3300047320 | Bacteria | 5937 |
| 684 | Ga0495672_0017745 | 3300047320 | Bacteria | 4749 |
| 685 | Ga0495672_0031915 | 3300047320 | Bacteria | 3283 |
| 686 | Ga0495672_0032209 | 3300047320 | Bacteria | 3265 |
| 687 | Ga0495672_0058391 | 3300047320 | Bacteria | 2236 |
| 688 | Ga0495672_0073928 | 3300047320 | Bacteria | 1921 |
| 689 | Ga0495672_0082572 | 3300047320 | Bacteria | 1786 |
| 690 | Ga0495672_0106604 | 3300047320 | Bacteria | 1510 |
| 691 | Ga0495676_0015978 | 3300047321 | Bacteria | 6668 |
| 692 | Ga0495676_0056136 | 3300047321 | Bacteria | 3116 |
| 693 | Ga0495680_0001587 | 3300047322 | Bacteria | 24283 |
| 694 | Ga0495680_0093522 | 3300047322 | Bacteria | 2250 |
| 695 | Ga0495680_0284472 | 3300047322 | Bacteria | 1164 |
| 696 | Ga0495680_0416067 | 3300047322 | Bacteria | 925 |
| 697 | Ga0495683_0000198 | 3300047323 | Bacteria | 56969 |
| 698 | Ga0495683_0000448 | 3300047323 | Bacteria | 32509 |
| 699 | Ga0495683_0000617 | 3300047323 | Bacteria | 26583 |
| 700 | Ga0495683_0000910 | 3300047323 | Bacteria | 20890 |
| 701 | Ga0495683_0009635 | 3300047323 | Bacteria | 5141 |
| 702 | Ga0495683_0012907 | 3300047323 | Bacteria | 4381 |
| 703 | Ga0495683_0013782 | 3300047323 | Bacteria | 4220 |
| 704 | Ga0495683_0027507 | 3300047323 | Bacteria | 2907 |
| 705 | Ga0495683_0056254 | 3300047323 | Bacteria | 1957 |
| 706 | Ga0495683_0086781 | 3300047323 | Bacteria | 1520 |
| 707 | Ga0495683_0123406 | 3300047323 | Bacteria | 1227 |
| 708 | Ga0495683_0162825 | 3300047323 | Bacteria | 1030 |
| 709 | Ga0495687_003790 | 3300047443 | Bacteria | 10669 |
| 710 | Ga0495687_013843 | 3300047443 | Bacteria | 4182 |
| 711 | Ga0495675_0030493 | 3300047444 | Bacteria | 3440 |
| 712 | Ga0495675_0117975 | 3300047444 | Bacteria | 1653 |
| 713 | Ga0495677_0001430 | 3300047445 | Bacteria | 9577 |
| 714 | Ga0495679_005361 | 3300047446 | Bacteria | 5694 |
| 715 | Ga0495679_011232 | 3300047446 | Bacteria | 3470 |
| 716 | Ga0495679_013436 | 3300047446 | Bacteria | 3075 |
| 717 | Ga0495679_145801 | 3300047446 | Bacteria | 637 |
| 718 | Ga0495685_160417 | 3300047447 | Bacteria | 728 |
| 719 | Ga0495673_0000383 | 3300047469 | Bacteria | 52691 |
| 720 | Ga0495673_0000472 | 3300047469 | Bacteria | 43659 |
| 721 | Ga0495673_0002062 | 3300047469 | Bacteria | 14697 |
| 722 | Ga0495673_0021691 | 3300047469 | Bacteria | 3165 |
| 723 | Ga0495673_0027958 | 3300047469 | Bacteria | 2676 |
| 724 | Ga0495673_0031306 | 3300047469 | Bacteria | 2491 |
| 725 | Ga0495673_0053895 | 3300047469 | Bacteria | 1751 |
| 726 | Ga0495673_0058980 | 3300047469 | Bacteria | 1651 |
| 727 | Ga0495673_0066051 | 3300047469 | Bacteria | 1534 |
| 728 | Ga0495673_0089684 | 3300047469 | Bacteria | 1258 |
| 729 | Ga0495673_0147903 | 3300047469 | Bacteria | 910 |
| 730 | Ga0495673_0180215 | 3300047469 | Bacteria | 800 |
| 731 | Ga0495681_0003553 | 3300047470 | Bacteria | 10852 |
| 732 | Ga0495681_0003948 | 3300047470 | Bacteria | 10223 |
| 733 | Ga0495681_0004564 | 3300047470 | Bacteria | 9433 |
| 734 | Ga0495681_0005637 | 3300047470 | Bacteria | 8344 |
| 735 | Ga0495681_0006128 | 3300047470 | Bacteria | 7940 |
| 736 | Ga0495681_0007283 | 3300047470 | Bacteria | 7100 |
| 737 | Ga0495681_0009958 | 3300047470 | Bacteria | 5797 |
| 738 | Ga0495681_0010065 | 3300047470 | Bacteria | 5757 |
| 739 | Ga0495681_0012873 | 3300047470 | Bacteria | 4890 |
| 740 | Ga0495681_0026846 | 3300047470 | Bacteria | 2988 |
| 741 | Ga0495681_0031297 | 3300047470 | Bacteria | 2695 |
| 742 | Ga0495681_0043211 | 3300047470 | Bacteria | 2175 |
| 743 | Ga0495681_0058497 | 3300047470 | Bacteria | 1785 |
| 744 | Ga0495684_0035067 | 3300047471 | Bacteria | 3849 |
| 745 | Ga0495684_0045783 | 3300047471 | Bacteria | 3347 |
| 746 | Ga0495686_0005610 | 3300047472 | Bacteria | 9853 |
| 747 | Ga0495686_0019160 | 3300047472 | Bacteria | 4576 |
| 748 | Ga0495686_0021948 | 3300047472 | Bacteria | 4228 |
| 749 | Ga0495686_0030929 | 3300047472 | Bacteria | 3474 |
| 750 | Ga0495686_0041748 | 3300047472 | Bacteria | 2919 |
| 751 | Ga0495593_0006783 | 3300047673 | Bacteria | 6703 |
| 752 | Ga0495593_0018799 | 3300047673 | Bacteria | 3879 |
| 753 | Ga0495593_0043944 | 3300047673 | Bacteria | 2392 |
| 754 | Ga0495602_0070938 | 3300048088 | Bacteria | 2977 |
| 755 | Ga0495602_0188766 | 3300048088 | Bacteria | 1582 |
| 756 | Ga0495626_0001604 | 3300048091 | Bacteria | 17630 |
| 757 | Ga0495626_0001676 | 3300048091 | Bacteria | 17098 |
| 758 | Ga0495626_0002209 | 3300048091 | Bacteria | 13951 |
| 759 | Ga0495626_0008122 | 3300048091 | Bacteria | 5784 |
| 760 | Ga0495626_0008334 | 3300048091 | Bacteria | 5693 |
| 761 | Ga0495626_0013008 | 3300048091 | Bacteria | 4338 |
| 762 | Ga0495626_0020492 | 3300048091 | Bacteria | 3293 |
| 763 | Ga0495626_0022725 | 3300048091 | Bacteria | 3095 |
| 764 | Ga0495626_0025322 | 3300048091 | Bacteria | 2902 |
| 765 | Ga0495626_0049594 | 3300048091 | Bacteria | 1943 |
| 766 | Ga0495626_0069544 | 3300048091 | Bacteria | 1585 |
| 767 | Ga0496102_0001399 | 3300048905 | Bacteria | 21432 |
| 768 | Ga0496103_0007572 | 3300048906 | Bacteria | 6470 |
| 769 | Ga0496104_0481991 | 3300048907 | Bacteria | 1152 |
| 770 | Ga0496110_0098252 | 3300048913 | Bacteria | 2623 |
| 771 | Ga0496111_0242925 | 3300048914 | Bacteria | 1337 |
| 772 | Ga0496113_0560729 | 3300048916 | Bacteria | 916 |
| 773 | Ga0496116_0000913 | 3300048919 | Bacteria | 36517 |
| 774 | Ga0496116_0001217 | 3300048919 | Bacteria | 29999 |
| 775 | Ga0496116_0002975 | 3300048919 | Bacteria | 17220 |
| 776 | Ga0496116_0010096 | 3300048919 | Bacteria | 7958 |
| 777 | Ga0496116_0158124 | 3300048919 | Bacteria | 1248 |
| 778 | Ga0496117_0001277 | 3300048920 | Bacteria | 37322 |
| 779 | Ga0496117_0019550 | 3300048920 | Bacteria | 5558 |
| 780 | Ga0496117_0043688 | 3300048920 | Bacteria | 3255 |
| 781 | Ga0496117_0091319 | 3300048920 | Bacteria | 1959 |
| 782 | Ga0496118_0025378 | 3300048921 | Bacteria | 5085 |
| 783 | Ga0496118_0042355 | 3300048921 | Bacteria | 3593 |
| 784 | Ga0496118_0047937 | 3300048921 | Bacteria | 3306 |
| 785 | Ga0496118_0069152 | 3300048921 | Bacteria | 2560 |
| 786 | Ga0496118_0103877 | 3300048921 | Bacteria | 1909 |
| 787 | Ga0496118_0247716 | 3300048921 | Bacteria | 1014 |
| 788 | Ga0496119_0090528 | 3300048922 | Bacteria | 1739 |
| 789 | Ga0496120_0181563 | 3300048923 | Bacteria | 1032 |
| 790 | Ga0496121_0002654 | 3300048924 | Bacteria | 26822 |
| 791 | Ga0496121_0025851 | 3300048924 | Bacteria | 5554 |
| 792 | Ga0496121_0067182 | 3300048924 | Bacteria | 2906 |
| 793 | Ga0496121_0115395 | 3300048924 | Bacteria | 2039 |
| 794 | Ga0496121_0328734 | 3300048924 | Bacteria | 1026 |
| 795 | Ga0496121_0431908 | 3300048924 | Bacteria | 854 |
| 796 | Ga0496122_0016792 | 3300048925 | Bacteria | 6895 |
| 797 | Ga0496122_0039712 | 3300048925 | Bacteria | 3749 |
| 798 | Ga0496122_0200246 | 3300048925 | Bacteria | 1168 |
| 799 | Ga0496123_0005030 | 3300048926 | Bacteria | 13527 |
| 800 | Ga0496123_0096379 | 3300048926 | Bacteria | 1737 |
| 801 | Ga0496123_0147422 | 3300048926 | Bacteria | 1275 |
| 802 | Ga0496124_0003331 | 3300048927 | Bacteria | 19787 |
| 803 | Ga0496124_0031392 | 3300048927 | Bacteria | 4703 |
| 804 | Ga0496124_0064800 | 3300048927 | Bacteria | 3049 |
| 805 | Ga0496124_0287735 | 3300048927 | Bacteria | 1194 |
| 806 | Ga0496124_0470892 | 3300048927 | Bacteria | 851 |
| 807 | Ga0496125_0014908 | 3300048928 | Bacteria | 7549 |
| 808 | Ga0496125_0059297 | 3300048928 | Bacteria | 3085 |
| 809 | Ga0496125_0101416 | 3300048928 | Bacteria | 2118 |
| 810 | Ga0496126_0339663 | 3300048929 | Bacteria | 1230 |
| 811 | Ga0495678_002163 | 3300049459 | Bacteria | 13858 |
| 812 | Ga0495678_003284 | 3300049459 | Bacteria | 10106 |
| 813 | Ga0495678_007151 | 3300049459 | Bacteria | 5828 |
| 814 | Ga0495678_019678 | 3300049459 | Bacteria | 3005 |
| 815 | Ga0495678_022710 | 3300049459 | Bacteria | 2738 |
| 816 | Ga0495678_039680 | 3300049459 | Bacteria | 1897 |
| 817 | Ga0495678_040966 | 3300049459 | Bacteria | 1857 |
| 818 | Ga0495682_0000153 | 3300049460 | Bacteria | 59021 |
| 819 | Ga0495682_0000633 | 3300049460 | Bacteria | 23509 |
| 820 | Ga0495682_0011152 | 3300049460 | Bacteria | 3463 |
| 821 | Ga0495682_0071470 | 3300049460 | Bacteria | 1249 |
| 822 | Ga0495682_0078256 | 3300049460 | Bacteria | 1189 |
| 823 | Ga0495682_0095920 | 3300049460 | Bacteria | 1064 |
| 824 | Ga0495682_0142704 | 3300049460 | Bacteria | 855 |
| 825 | Ga0495682_0163899 | 3300049460 | Bacteria | 791 |
| 826 | Ga0501259_089454 | 3300049688 | Bacteria | 690 |
| 827 | Ga0501241_001926 | 3300049758 | Bacteria | 4082 |
| 828 | Ga0501269_019566 | 3300049766 | Bacteria | 842 |
| 829 | nmdc:mga03n38_404361_c1 | 3300050490 | Bacteria | 752 |
| 830 | nmdc:mga00v17_224114_c1 | 3300050491 | Bacteria | 1218 |
| 831 | nmdc:mga00v17_27354_c1 | 3300050491 | Bacteria | 3329 |
| 832 | nmdc:mga00v17_89861_c1 | 3300050491 | Bacteria | 1928 |
| 833 | nmdc:mga07m45_302200_c1 | 3300050496 | Bacteria | 930 |
| 834 | nmdc:mga08x19_185715_c1 | 3300050514 | Bacteria | 1421 |
| 835 | nmdc:mga08x19_538098_c1 | 3300050514 | Bacteria | 826 |
| 836 | nmdc:mga0sz30_5614_c4 | 3300050516 | Bacteria | 2015 |
| 837 | Ga0500572_002744 | 3300053111 | Bacteria | 4156 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2511231004 | 2511257932 | 157 |
| 2 | iso_pu_bacteria | 2511231007 | 2511270636 | 157 |
| 3 | iso_pu_bacteria | 2511231010 | 2511290191 | 157 |
| 4 | iso_pu_bacteria | 2511231016 | 2511324042 | 157 |
| 5 | iso_pu_bacteria | 2511231022 | 2511363745 | 157 |
| 6 | iso_pu_bacteria | 2554235341 | 2555668249 | 157 |
| 7 | iso_pu_bacteria | 2599185160 | 2599355250 | 157 |
| 8 | iso_pu_bacteria | 2599185161 | 2599360927 | 157 |
| 9 | iso_pu_bacteria | 2599185162 | 2599367249 | 157 |
| 10 | iso_pu_bacteria | 2599185163 | 2599374039 | 157 |
| 11 | iso_pu_bacteria | 2599185164 | 2599380356 | 157 |
| 12 | iso_pu_bacteria | 2599185165 | 2599386803 | 157 |
| 13 | iso_pu_bacteria | 2599185166 | 2599392897 | 157 |
| 14 | iso_pu_bacteria | 2599185168 | 2599404664 | 157 |
| 15 | iso_pu_bacteria | 2599185181 | 2599462084 | 157 |
| 16 | iso_pu_bacteria | 2599185182 | 2599466873 | 157 |
| 17 | iso_pu_bacteria | 2599185186 | 2599490824 | 157 |
| 18 | iso_pu_bacteria | 2599185188 | 2599501342 | 157 |
| 19 | iso_pu_bacteria | 2599185212 | 2599616876 | 157 |
| 20 | iso_pu_bacteria | 2599185248 | 2599770591 | 157 |
| 21 | iso_pu_bacteria | 2599185289 | 2599886473 | 157 |
| 22 | iso_pu_bacteria | 2599185291 | 2599896838 | 157 |
| 23 | iso_pu_bacteria | 2599185300 | 2599931643 | 157 |
| 24 | iso_pu_bacteria | 2599185302 | 2599945648 | 157 |
| 25 | iso_pu_bacteria | 2599185304 | 2599957401 | 157 |
| 26 | iso_pu_bacteria | 2599185305 | 2599959627 | 157 |
| 27 | iso_pu_bacteria | 2599185306 | 2599966110 | 157 |
| 28 | iso_pu_bacteria | 2599185308 | 2599980775 | 157 |
| 29 | iso_pu_bacteria | 2599185309 | 2599986539 | 157 |
| 30 | iso_pu_bacteria | 2599185310 | 2599987060 | 157 |
| 31 | iso_pu_bacteria | 2599185311 | 2599996417 | 157 |
| 32 | iso_pu_bacteria | 2599185312 | 2600002648 | 157 |
| 33 | iso_pu_bacteria | 2599185313 | 2600006473 | 157 |
| 34 | iso_pu_bacteria | 2599185314 | 2600014686 | 157 |
| 35 | iso_pu_bacteria | 2599185315 | 2600016821 | 157 |
| 36 | iso_pu_bacteria | 2599185316 | 2600024143 | 157 |
| 37 | iso_pu_bacteria | 2599185317 | 2600031169 | 157 |
| 38 | iso_pu_bacteria | 2599185318 | 2600035326 | 157 |
| 39 | iso_pu_bacteria | 2599185319 | 2600042698 | 157 |
| 40 | iso_pu_bacteria | 2599185320 | 2600050565 | 157 |
| 41 | iso_pu_bacteria | 2599185321 | 2600053716 | 157 |
| 42 | iso_pu_bacteria | 2599185322 | 2600058279 | 157 |
| 43 | iso_pu_bacteria | 2599185323 | 2600064045 | 157 |
| 44 | iso_pu_bacteria | 2599185324 | 2600074756 | 157 |
| 45 | iso_pu_bacteria | 2599185325 | 2600078493 | 157 |
| 46 | iso_pu_bacteria | 2599185356 | 2600214706 | 157 |
| 47 | iso_pu_bacteria | 2600254930 | 2600360142 | 157 |
| 48 | iso_pu_bacteria | 2600255313 | 2601774589 | 157 |
| 49 | iso_pu_bacteria | 2600255318 | 2601800296 | 157 |
| 50 | iso_pu_bacteria | 2603880185 | 2606074438 | 157 |
| 51 | iso_pu_bacteria | 2603880199 | 2606127301 | 157 |
| 52 | iso_pu_bacteria | 2623620443 | 2624479048 | 157 |
| 53 | iso_pu_bacteria | 2623620446 | 2624493956 | 157 |
| 54 | iso_pu_bacteria | 2643221650 | 2644282298 | 157 |
| 55 | iso_pu_bacteria | 2651869719 | 2652548714 | 157 |
| 56 | iso_pu_bacteria | 2667528170 | 2671092194 | 157 |
| 57 | iso_pu_bacteria | 2667528171 | 2671097851 | 157 |
| 58 | iso_pu_bacteria | 2667528176 | 2671127582 | 157 |
| 59 | iso_pu_bacteria | 2675903515 | 2678261761 | 157 |
| 60 | iso_pu_bacteria | 2713897148 | 2715752955 | 157 |
| 61 | iso_pu_bacteria | 2713897149 | 2715758769 | 157 |
| 62 | iso_pu_bacteria | 2744054620 | 2745008110 | 157 |
| 63 | iso_pu_bacteria | 2791355520 | 2794594571 | 157 |
| 64 | iso_pu_bacteria | 2808606361 | 2808856452 | 157 |
| 65 | iso_pu_bacteria | 2808606376 | 2808924538 | 157 |
| 66 | iso_pu_bacteria | 2808606378 | 2808936400 | 157 |
| 67 | iso_pu_bacteria | 2808606380 | 2808946629 | 157 |
| 68 | iso_pu_bacteria | 2808606383 | 2808964821 | 157 |
| 69 | iso_pu_bacteria | 2808606389 | 2808999713 | 157 |
| 70 | iso_pu_bacteria | 2808606445 | 2809216022 | 157 |
| 71 | iso_pu_bacteria | 2818991464 | 2819702935 | 157 |
| 72 | iso_pu_bacteria | 2825651385 | 2825653512 | 157 |
| 73 | iso_pu_bacteria | 2842832357 | 2842833121 | 157 |
| 74 | iso_pu_bacteria | 2842843487 | 2842847233 | 157 |
| 75 | iso_pu_bacteria | 2842854478 | 2842857062 | 157 |
| 76 | iso_pu_bacteria | 2844665904 | 2844668771 | 157 |
| 77 | iso_pu_bacteria | 2878029506 | 2878031006 | 157 |
| 78 | iso_pu_bacteria | 2913036834 | 2913038109 | 157 |
| 79 | iso_pu_bacteria | 2917070673 | 2917072015 | 157 |
| 80 | iso_pu_bacteria | 2919063839 | 2919064480 | 157 |
| 81 | iso_pu_bacteria | 2919385768 | 2919386046 | 157 |
| 82 | iso_pu_bacteria | 2919481497 | 2919483022 | 157 |
| 83 | iso_pu_bacteria | 2919487758 | 2919490839 | 157 |
| 84 | iso_pu_bacteria | 2919697872 | 2919700126 | 157 |
| 85 | iso_pu_bacteria | 2923586266 | 2923590768 | 157 |
| 86 | iso_pu_bacteria | 2929144301 | 2929145553 | 157 |
| 87 | iso_pu_bacteria | 2931369376 | 2931371111 | 157 |
| 88 | iso_pu_bacteria | 2935353572 | 2935354187 | 157 |
| 89 | iso_pu_bacteria | 2974289157 | 2974292552 | 157 |
| 90 | iso_pu_bacteria | 2988728565 | 2988733105 | 157 |
| 91 | iso_pu_bacteria | 2998139840 | 2998141255 | 157 |
| 92 | iso_pu_bacteria | 3007718800 | 3007719430 | 157 |
| 93 | iso_pu_bacteria | 3007855910 | 3007860318 | 157 |
| 94 | iso_pu_bacteria | 3007866637 | 3007871608 | 157 |
| 95 | iso_pu_bacteria | 637000220 | 637318612 | 157 |
| 96 | iso_pu_bacteria | 8019769354 | 8019770812 | 157 |
| 97 | iso_pu_bacteria | 8019775933 | 8019776793 | 157 |
| 98 | iso_pu_bacteria | 8029995093 | 8029999492 | 157 |
| 99 | iso_pu_bacteria | 8056143049 | 8056147716 | 157 |
| 100 | iso_pu_bacteria | 8056155041 | 8056159520 | 157 |
| 101 | iso_pu_bacteria | 8056166840 | 8056169802 | 157 |
| 102 | iso_pu_bacteria | 8056172158 | 8056175914 | 157 |
| 103 | iso_pu_bacteria | 8056177738 | 8056180355 | 157 |
| 104 | iso_pu_bacteria | 8057798959 | 8057803565 | 157 |
| 105 | 3300005288 | Ga0065714_10138296 | Ga0065714_101382962 | 158 |
| 106 | 3300013104 | Ga0157370_10013230 | Ga0157370_100132309 | 158 |
| 107 | 3300013306 | Ga0163162_10008097 | Ga0163162_100080977 | 158 |
| 108 | 3300017792 | Ga0163161_10129951 | Ga0163161_101299514 | 158 |
| 109 | 3300046455 | Ga0495603_0092917 | Ga0495603_0092917_1226_1720 | 158 |
| 110 | 3300046499 | Ga0495594_0075949 | Ga0495594_0075949_1243_1737 | 158 |
| 111 | 3300046530 | Ga0495654_0031338 | Ga0495654_0031338_261_755 | 158 |
| 112 | 3300046538 | Ga0495609_0350620 | Ga0495609_0350620_49_543 | 158 |
| 113 | 3300046557 | Ga0495622_0258027 | Ga0495622_0258027_55_549 | 158 |
| 114 | 3300046689 | Ga0495613_0561385 | Ga0495613_0561385_28_522 | 158 |
| 115 | 3300046691 | Ga0495670_0008302 | Ga0495670_0008302_71_565 | 158 |
| 116 | 3300046692 | Ga0495671_0030922 | Ga0495671_0030922_224_718 | 158 |
| 117 | 3300046810 | Ga0495660_0047599 | Ga0495660_0047599_1260_1754 | 158 |
| 118 | 3300047323 | Ga0495683_0162825 | Ga0495683_0162825_153_647 | 158 |
| 119 | 3300048924 | Ga0496121_0115395 | Ga0496121_0115395_1180_1674 | 158 |
| 120 | 3300048928 | Ga0496125_0101416 | Ga0496125_0101416_468_962 | 158 |
| 121 | 3300009092 | Ga0105250_10037295 | Ga0105250_100372952 | 159 |
| 122 | 3300025711 | Ga0207696_1070395 | Ga0207696_10703951 | 159 |
| 123 | 3300015265 | Ga0182005_1004961 | Ga0182005_10049611 | 160 |
| 124 | 3300046457 | Ga0495590_0000340 | Ga0495590_0000340_22989_23471 | 160 |
| 125 | 3300049460 | Ga0495682_0000633 | Ga0495682_0000633_640_1122 | 160 |
| 126 | iso_pu_bacteria | 2511231006 | 2511264146 | 160 |
| 127 | iso_pu_bacteria | 2511231008 | 2511279058 | 160 |
| 128 | iso_pu_bacteria | 2511231011 | 2511294035 | 160 |
| 129 | iso_pu_bacteria | 2511231012 | 2511300044 | 160 |
| 130 | iso_pu_bacteria | 2511231014 | 2511316736 | 160 |
| 131 | iso_pu_bacteria | 2511231015 | 2511319572 | 160 |
| 132 | iso_pu_bacteria | 2511231017 | 2511330187 | 160 |
| 133 | iso_pu_bacteria | 2511231018 | 2511339716 | 160 |
| 134 | iso_pu_bacteria | 2511231019 | 2511344900 | 160 |
| 135 | iso_pu_bacteria | 2511231020 | 2511351746 | 160 |
| 136 | iso_pu_bacteria | 2511231021 | 2511355140 | 160 |
| 137 | iso_pu_bacteria | 2511231023 | 2511370298 | 160 |
| 138 | iso_pu_bacteria | 2511231031 | 2511415675 | 160 |
| 139 | iso_pu_bacteria | 2512047018 | 2512326345 | 160 |
| 140 | iso_pu_bacteria | 2582580891 | 2583790768 | 160 |
| 141 | iso_pu_bacteria | 2597489887 | 2597856466 | 160 |
| 142 | iso_pu_bacteria | 2599185185 | 2599483281 | 160 |
| 143 | iso_pu_bacteria | 2599185257 | 2599805181 | 160 |
| 144 | iso_pu_bacteria | 2600254931 | 2600363890 | 160 |
| 145 | iso_pu_bacteria | 2643221589 | 2643952100 | 160 |
| 146 | iso_pu_bacteria | 2643221602 | 2644024141 | 160 |
| 147 | iso_pu_bacteria | 2643221633 | 2644184828 | 160 |
| 148 | iso_pu_bacteria | 2671180172 | 2671768084 | 160 |
| 149 | iso_pu_bacteria | 2718217725 | 2718632933 | 160 |
| 150 | iso_pu_bacteria | 2738543004 | 2739198580 | 160 |
| 151 | iso_pu_bacteria | 2738543015 | 2739256657 | 160 |
| 152 | iso_pu_bacteria | 2738543025 | 2739313011 | 160 |
| 153 | iso_pu_bacteria | 2740892503 | 2743735881 | 160 |
| 154 | iso_pu_bacteria | 2773857670 | 2774121538 | 160 |
| 155 | iso_pu_bacteria | 2773857673 | 2774136157 | 160 |
| 156 | iso_pu_bacteria | 2784132063 | 2784260232 | 160 |
| 157 | iso_pu_bacteria | 2784132072 | 2784315575 | 160 |
| 158 | iso_pu_bacteria | 2808606377 | 2808929414 | 160 |
| 159 | iso_pu_bacteria | 2808606381 | 2808951478 | 160 |
| 160 | iso_pu_bacteria | 2808606382 | 2808960317 | 160 |
| 161 | iso_pu_bacteria | 2818991456 | 2819658598 | 160 |
| 162 | iso_pu_bacteria | 2852657418 | 2852658543 | 160 |
| 163 | iso_pu_bacteria | 2860339153 | 2860340442 | 160 |
| 164 | iso_pu_bacteria | 2880230671 | 2880231923 | 160 |
| 165 | iso_pu_bacteria | 2904518522 | 2904520961 | 160 |
| 166 | iso_pu_bacteria | 2904550169 | 2904551692 | 160 |
| 167 | iso_pu_bacteria | 2919456309 | 2919458100 | 160 |
| 168 | iso_pu_bacteria | 2923153595 | 2923154890 | 160 |
| 169 | iso_pu_bacteria | 2931396565 | 2931399654 | 160 |
| 170 | iso_pu_bacteria | 2939636861 | 2939637864 | 160 |
| 171 | iso_pu_bacteria | 2969304461 | 2969305833 | 160 |
| 172 | iso_pu_bacteria | 2984286254 | 2984291141 | 160 |
| 173 | iso_pu_bacteria | 3007395558 | 3007400410 | 160 |
| 174 | iso_pu_bacteria | 3007511990 | 3007512626 | 160 |
| 175 | iso_pu_bacteria | 3007614139 | 3007614998 | 160 |
| 176 | iso_pu_bacteria | 3007619802 | 3007623098 | 160 |
| 177 | iso_pu_bacteria | 3007861166 | 3007863510 | 160 |
| 178 | iso_pu_bacteria | 8015687852 | 8015689122 | 160 |
| 179 | iso_pu_bacteria | 8055770955 | 8055772241 | 160 |
| 180 | iso_pu_bacteria | 8056125926 | 8056127302 | 160 |
| 181 | iso_pu_bacteria | 8056569372 | 8056569916 | 160 |
| 182 | 2162886007 | SwRhRL2b_contig_3419659 | SwRhRL2b_0363.00002010 | 161 |
| 183 | 3300002737 | JGI25162J39368_1000241 | JGI25162J39368_100024113 | 161 |
| 184 | 3300002771 | JGI25163J39215_1000634 | JGI25163J39215_10006347 | 161 |
| 185 | 3300002772 | JGI25164J39214_1000188 | JGI25164J39214_100018813 | 161 |
| 186 | 3300003214 | JGI25165J46597_1000339 | JGI25165J46597_100033913 | 161 |
| 187 | 3300003781 | Ga0055536_1000399 | Ga0055536_100039926 | 161 |
| 188 | 3300003791 | Ga0055530_10011182 | Ga0055530_100111823 | 161 |
| 189 | 3300003792 | Ga0055540_1000377 | Ga0055540_100037715 | 161 |
| 190 | 3300003792 | Ga0055540_1001027 | Ga0055540_100102718 | 161 |
| 191 | 3300003794 | Ga0055531_10001226 | Ga0055531_1000122616 | 161 |
| 192 | 3300005288 | Ga0065714_10002540 | Ga0065714_1000254016 | 161 |
| 193 | 3300005288 | Ga0065714_10002948 | Ga0065714_100029482 | 161 |
| 194 | 3300005288 | Ga0065714_10004279 | Ga0065714_100042795 | 161 |
| 195 | 3300005289 | Ga0065704_10070421 | Ga0065704_1007042115 | 161 |
| 196 | 3300006051 | Ga0075364_10481150 | Ga0075364_104811502 | 161 |
| 197 | 3300006058 | Ga0075432_10002541 | Ga0075432_100025414 | 161 |
| 198 | 3300006058 | Ga0075432_10004673 | Ga0075432_100046735 | 161 |
| 199 | 3300006058 | Ga0075432_10005880 | Ga0075432_100058804 | 161 |
| 200 | 3300006058 | Ga0075432_10018819 | Ga0075432_100188194 | 161 |
| 201 | 3300006058 | Ga0075432_10249389 | Ga0075432_102493891 | 161 |
| 202 | 3300006177 | Ga0075362_10115785 | Ga0075362_101157853 | 161 |
| 203 | 3300006914 | Ga0075436_100188016 | Ga0075436_1001880163 | 161 |
| 204 | 3300006946 | Ga0079104_1034611 | Ga0079104_10346112 | 161 |
| 205 | 3300006948 | Ga0099826_10032511 | Ga0099826_100325115 | 161 |
| 206 | 3300009011 | Ga0105251_10014540 | Ga0105251_100145404 | 161 |
| 207 | 3300009011 | Ga0105251_10029928 | Ga0105251_100299283 | 161 |
| 208 | 3300009036 | Ga0105244_10001071 | Ga0105244_100010719 | 161 |
| 209 | 3300009036 | Ga0105244_10030138 | Ga0105244_100301383 | 161 |
| 210 | 3300009036 | Ga0105244_10038550 | Ga0105244_100385504 | 161 |
| 211 | 3300009092 | Ga0105250_10043734 | Ga0105250_100437343 | 161 |
| 212 | 3300009148 | Ga0105243_10000586 | Ga0105243_100005868 | 161 |
| 213 | 3300009553 | Ga0105249_10331643 | Ga0105249_103316433 | 161 |
| 214 | 3300011119 | Ga0105246_10001208 | Ga0105246_100012086 | 161 |
| 215 | 3300013100 | Ga0157373_10019482 | Ga0157373_100194822 | 161 |
| 216 | 3300013100 | Ga0157373_10078808 | Ga0157373_100788083 | 161 |
| 217 | 3300013102 | Ga0157371_10000885 | Ga0157371_1000088525 | 161 |
| 218 | 3300013102 | Ga0157371_10005098 | Ga0157371_100050987 | 161 |
| 219 | 3300013104 | Ga0157370_10505524 | Ga0157370_105055242 | 161 |
| 220 | 3300013105 | Ga0157369_10203228 | Ga0157369_102032284 | 161 |
| 221 | 3300014497 | Ga0182008_10000338 | Ga0182008_1000033828 | 161 |
| 222 | 3300014497 | Ga0182008_10003138 | Ga0182008_100031382 | 161 |
| 223 | 3300015261 | Ga0182006_1001039 | Ga0182006_10010399 | 161 |
| 224 | 3300015261 | Ga0182006_1002350 | Ga0182006_10023506 | 161 |
| 225 | 3300015261 | Ga0182006_1008986 | Ga0182006_10089867 | 161 |
| 226 | 3300015262 | Ga0182007_10000531 | Ga0182007_1000053114 | 161 |
| 227 | 3300015265 | Ga0182005_1000391 | Ga0182005_10003914 | 161 |
| 228 | 3300015265 | Ga0182005_1002318 | Ga0182005_10023189 | 161 |
| 229 | 3300017792 | Ga0163161_10011775 | Ga0163161_100117759 | 161 |
| 230 | 3300017792 | Ga0163161_10286104 | Ga0163161_102861043 | 161 |
| 231 | 3300025207 | Ga0209760_100099 | Ga0209760_10009921 | 161 |
| 232 | 3300025231 | Ga0207427_100001 | Ga0207427_100001440 | 161 |
| 233 | 3300025233 | Ga0209437_100003 | Ga0209437_100003932 | 161 |
| 234 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007440 | 161 |
| 235 | 3300025291 | Ga0209675_1002564 | Ga0209675_10025649 | 161 |
| 236 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016171 | 161 |
| 237 | 3300025292 | Ga0209676_1000033 | Ga0209676_100003315 | 161 |
| 238 | 3300025292 | Ga0209676_1006105 | Ga0209676_10061055 | 161 |
| 239 | 3300025298 | Ga0209050_1000036 | Ga0209050_1000036386 | 161 |
| 240 | 3300025298 | Ga0209050_1000187 | Ga0209050_100018715 | 161 |
| 241 | 3300025303 | Ga0209051_1000131 | Ga0209051_100013115 | 161 |
| 242 | 3300025303 | Ga0209051_1001300 | Ga0209051_10013009 | 161 |
| 243 | 3300025303 | Ga0209051_1100299 | Ga0209051_11002992 | 161 |
| 244 | 3300025304 | Ga0209257_1000173 | Ga0209257_100017316 | 161 |
| 245 | 3300025304 | Ga0209257_1005683 | Ga0209257_10056836 | 161 |
| 246 | 3300025711 | Ga0207696_1002110 | Ga0207696_10021108 | 161 |
| 247 | 3300025711 | Ga0207696_1171183 | Ga0207696_11711831 | 161 |
| 248 | 3300025728 | Ga0207655_1000896 | Ga0207655_100089618 | 161 |
| 249 | 3300025728 | Ga0207655_1001618 | Ga0207655_100161817 | 161 |
| 250 | 3300025728 | Ga0207655_1007603 | Ga0207655_10076034 | 161 |
| 251 | 3300025735 | Ga0207713_1000689 | Ga0207713_100068928 | 161 |
| 252 | 3300025735 | Ga0207713_1001389 | Ga0207713_10013897 | 161 |
| 253 | 3300025923 | Ga0207681_10061653 | Ga0207681_100616532 | 161 |
| 254 | 3300025935 | Ga0207709_10000036 | Ga0207709_1000003623 | 161 |
| 255 | 3300025935 | Ga0207709_10000517 | Ga0207709_1000051713 | 161 |
| 256 | 3300025961 | Ga0207712_10236672 | Ga0207712_102366721 | 161 |
| 257 | 3300027111 | Ga0209281_1000202 | Ga0209281_1000202116 | 161 |
| 258 | 3300027111 | Ga0209281_1019925 | Ga0209281_10199252 | 161 |
| 259 | 3300027907 | Ga0207428_10045078 | Ga0207428_100450784 | 161 |
| 260 | 3300027907 | Ga0207428_10055312 | Ga0207428_100553125 | 161 |
| 261 | 3300027907 | Ga0207428_10227391 | Ga0207428_102273912 | 161 |
| 262 | 3300027907 | Ga0207428_10265778 | Ga0207428_102657783 | 161 |
| 263 | 3300030733 | Ga0314311_1174749 | Ga0314311_11747493 | 161 |
| 264 | 3300030735 | Ga0316178_1049075 | Ga0316178_10490754 | 161 |
| 265 | 3300030736 | Ga0316180_1144020 | Ga0316180_11440202 | 161 |
| 266 | 3300030742 | Ga0316183_1074327 | Ga0316183_10743273 | 161 |
| 267 | 3300030744 | Ga0316181_1243246 | Ga0316181_12432462 | 161 |
| 268 | 3300031548 | Ga0307408_100066429 | Ga0307408_1000664293 | 161 |
| 269 | 3300031548 | Ga0307408_100103943 | Ga0307408_1001039432 | 161 |
| 270 | 3300031548 | Ga0307408_100187547 | Ga0307408_1001875471 | 161 |
| 271 | 3300031731 | Ga0307405_10000689 | Ga0307405_1000068910 | 161 |
| 272 | 3300031731 | Ga0307405_10050184 | Ga0307405_100501844 | 161 |
| 273 | 3300031824 | Ga0307413_10004010 | Ga0307413_100040104 | 161 |
| 274 | 3300031824 | Ga0307413_10016016 | Ga0307413_100160164 | 161 |
| 275 | 3300031901 | Ga0307406_10009015 | Ga0307406_100090157 | 161 |
| 276 | 3300031901 | Ga0307406_10010053 | Ga0307406_100100538 | 161 |
| 277 | 3300031901 | Ga0307406_10503723 | Ga0307406_105037231 | 161 |
| 278 | 3300031903 | Ga0307407_10008536 | Ga0307407_100085367 | 161 |
| 279 | 3300031903 | Ga0307407_10924193 | Ga0307407_109241931 | 161 |
| 280 | 3300031911 | Ga0307412_10001346 | Ga0307412_1000134611 | 161 |
| 281 | 3300031911 | Ga0307412_10005151 | Ga0307412_100051516 | 161 |
| 282 | 3300031911 | Ga0307412_10007351 | Ga0307412_100073514 | 161 |
| 283 | 3300031995 | Ga0307409_100157295 | Ga0307409_1001572952 | 161 |
| 284 | 3300031995 | Ga0307409_100410987 | Ga0307409_1004109873 | 161 |
| 285 | 3300032002 | Ga0307416_100009580 | Ga0307416_1000095806 | 161 |
| 286 | 3300032002 | Ga0307416_101421112 | Ga0307416_1014211122 | 161 |
| 287 | 3300032004 | Ga0307414_10044133 | Ga0307414_100441331 | 161 |
| 288 | 3300032004 | Ga0307414_10075402 | Ga0307414_100754024 | 161 |
| 289 | 3300032004 | Ga0307414_10164506 | Ga0307414_101645062 | 161 |
| 290 | 3300032005 | Ga0307411_10009789 | Ga0307411_100097895 | 161 |
| 291 | 3300032005 | Ga0307411_10010618 | Ga0307411_100106183 | 161 |
| 292 | 3300032005 | Ga0307411_10040007 | Ga0307411_100400074 | 161 |
| 293 | 3300038705 | Ga0237819_02832 | Ga0237819_02832_882_1367 | 161 |
| 294 | 3300041405 | Ga0439438_000622 | Ga0439438_000622_10961_11446 | 161 |
| 295 | 3300041405 | Ga0439438_001115 | Ga0439438_001115_4475_4960 | 161 |
| 296 | 3300041405 | Ga0439438_001130 | Ga0439438_001130_7099_7584 | 161 |
| 297 | 3300041405 | Ga0439438_008191 | Ga0439438_008191_1325_1810 | 161 |
| 298 | 3300041405 | Ga0439438_053223 | Ga0439438_053223_342_827 | 161 |
| 299 | 3300041407 | Ga0439447_002472 | Ga0439447_002472_2686_3171 | 161 |
| 300 | 3300041407 | Ga0439447_013606 | Ga0439447_013606_83_568 | 161 |
| 301 | 3300041407 | Ga0439447_035683 | Ga0439447_035683_72_557 | 161 |
| 302 | 3300041407 | Ga0439447_041230 | Ga0439447_041230_240_725 | 161 |
| 303 | 3300041411 | Ga0439466_0003571 | Ga0439466_0003571_5086_5571 | 161 |
| 304 | 3300041411 | Ga0439466_0004648 | Ga0439466_0004648_217_702 | 161 |
| 305 | 3300041411 | Ga0439466_0025087 | Ga0439466_0025087_205_690 | 161 |
| 306 | 3300041411 | Ga0439466_0032338 | Ga0439466_0032338_119_604 | 161 |
| 307 | 3300041997 | Ga0439431_0000577 | Ga0439431_0000577_4423_4908 | 161 |
| 308 | 3300042004 | Ga0439445_0048581 | Ga0439445_0048581_479_964 | 161 |
| 309 | 3300042006 | Ga0439432_001876 | Ga0439432_001876_4535_5020 | 161 |
| 310 | 3300042006 | Ga0439432_005177 | Ga0439432_005177_581_1066 | 161 |
| 311 | 3300042006 | Ga0439432_022764 | Ga0439432_022764_1341_1826 | 161 |
| 312 | 3300042009 | Ga0439451_000883 | Ga0439451_000883_2017_2502 | 161 |
| 313 | 3300042009 | Ga0439451_002436 | Ga0439451_002436_2154_2639 | 161 |
| 314 | 3300042010 | Ga0439452_001213 | Ga0439452_001213_7046_7531 | 161 |
| 315 | 3300042010 | Ga0439452_002534 | Ga0439452_002534_3550_4035 | 161 |
| 316 | 3300042013 | Ga0439456_024926 | Ga0439456_024926_135_620 | 161 |
| 317 | 3300042013 | Ga0439456_045940 | Ga0439456_045940_42_527 | 161 |
| 318 | 3300042016 | Ga0439463_023968 | Ga0439463_023968_561_1046 | 161 |
| 319 | 3300042115 | Ga0450911_000236 | Ga0450911_000236_15584_16069 | 161 |
| 320 | 3300042115 | Ga0450911_002913 | Ga0450911_002913_198_683 | 161 |
| 321 | 3300042127 | Ga0450890_000253 | Ga0450890_000253_1591_2076 | 161 |
| 322 | 3300042129 | Ga0450891_004145 | Ga0450891_004145_415_900 | 161 |
| 323 | 3300042137 | Ga0450902_012096 | Ga0450902_012096_454_939 | 161 |
| 324 | 3300042137 | Ga0450902_031531 | Ga0450902_031531_284_769 | 161 |
| 325 | 3300042138 | Ga0450903_000936 | Ga0450903_000936_2124_2609 | 161 |
| 326 | 3300042138 | Ga0450903_040402 | Ga0450903_040402_79_564 | 161 |
| 327 | 3300042139 | Ga0450904_031927 | Ga0450904_031927_13_498 | 161 |
| 328 | 3300042145 | Ga0450906_000867 | Ga0450906_000867_4725_5210 | 161 |
| 329 | 3300042146 | Ga0450907_007383 | Ga0450907_007383_1039_1524 | 161 |
| 330 | 3300042147 | Ga0450910_001175 | Ga0450910_001175_2312_2797 | 161 |
| 331 | 3300042156 | Ga0439446_0000876 | Ga0439446_0000876_3000_3485 | 161 |
| 332 | 3300042156 | Ga0439446_0171698 | Ga0439446_0171698_179_664 | 161 |
| 333 | 3300042184 | Ga0450908_000376 | Ga0450908_000376_3313_3798 | 161 |
| 334 | 3300042435 | Ga0439434_0051190 | Ga0439434_0051190_156_641 | 161 |
| 335 | 3300042439 | Ga0439464_0034012 | Ga0439464_0034012_330_815 | 161 |
| 336 | 3300042531 | Ga0450918_004126 | Ga0450918_004126_72_557 | 161 |
| 337 | 3300042531 | Ga0450918_023546 | Ga0450918_023546_66_551 | 161 |
| 338 | 3300046452 | Ga0495617_001218 | Ga0495617_001218_5777_6262 | 161 |
| 339 | 3300046452 | Ga0495617_005363 | Ga0495617_005363_3519_4004 | 161 |
| 340 | 3300046452 | Ga0495617_007102 | Ga0495617_007102_2717_3202 | 161 |
| 341 | 3300046453 | Ga0495627_006685 | Ga0495627_006685_414_899 | 161 |
| 342 | 3300046457 | Ga0495590_0002583 | Ga0495590_0002583_5090_5575 | 161 |
| 343 | 3300046457 | Ga0495590_0019690 | Ga0495590_0019690_1316_1801 | 161 |
| 344 | 3300046458 | Ga0495591_000633 | Ga0495591_000633_3997_4482 | 161 |
| 345 | 3300046458 | Ga0495591_059646 | Ga0495591_059646_16_501 | 161 |
| 346 | 3300046459 | Ga0495629_0015028 | Ga0495629_0015028_1376_1861 | 161 |
| 347 | 3300046460 | Ga0495638_0002645 | Ga0495638_0002645_7689_8174 | 161 |
| 348 | 3300046460 | Ga0495638_0009148 | Ga0495638_0009148_3894_4379 | 161 |
| 349 | 3300046460 | Ga0495638_0050089 | Ga0495638_0050089_1465_1950 | 161 |
| 350 | 3300046460 | Ga0495638_0084009 | Ga0495638_0084009_14_499 | 161 |
| 351 | 3300046460 | Ga0495638_0134542 | Ga0495638_0134542_919_1407 | 161 |
| 352 | 3300046460 | Ga0495638_0142437 | Ga0495638_0142437_359_844 | 161 |
| 353 | 3300046463 | Ga0495653_0010482 | Ga0495653_0010482_4574_5059 | 161 |
| 354 | 3300046463 | Ga0495653_0085405 | Ga0495653_0085405_844_1329 | 161 |
| 355 | 3300046471 | Ga0495650_0007966 | Ga0495650_0007966_1338_1823 | 161 |
| 356 | 3300046471 | Ga0495650_0017444 | Ga0495650_0017444_2183_2668 | 161 |
| 357 | 3300046471 | Ga0495650_0023955 | Ga0495650_0023955_2208_2693 | 161 |
| 358 | 3300046471 | Ga0495650_0092021 | Ga0495650_0092021_246_731 | 161 |
| 359 | 3300046472 | Ga0495580_0250074 | Ga0495580_0250074_200_688 | 161 |
| 360 | 3300046473 | Ga0495582_0004449 | Ga0495582_0004449_4778_5263 | 161 |
| 361 | 3300046474 | Ga0495605_0002331 | Ga0495605_0002331_1362_1847 | 161 |
| 362 | 3300046474 | Ga0495605_0023230 | Ga0495605_0023230_758_1246 | 161 |
| 363 | 3300046474 | Ga0495605_0041057 | Ga0495605_0041057_494_979 | 161 |
| 364 | 3300046475 | Ga0495639_0000127 | Ga0495639_0000127_26326_26814 | 161 |
| 365 | 3300046475 | Ga0495639_0037026 | Ga0495639_0037026_71_556 | 161 |
| 366 | 3300046477 | Ga0495664_0114421 | Ga0495664_0114421_859_1344 | 161 |
| 367 | 3300046491 | Ga0495584_0008797 | Ga0495584_0008797_3357_3842 | 161 |
| 368 | 3300046491 | Ga0495584_0012377 | Ga0495584_0012377_1471_1956 | 161 |
| 369 | 3300046491 | Ga0495584_0024745 | Ga0495584_0024745_664_1149 | 161 |
| 370 | 3300046491 | Ga0495584_0040868 | Ga0495584_0040868_95_580 | 161 |
| 371 | 3300046491 | Ga0495584_0044151 | Ga0495584_0044151_297_782 | 161 |
| 372 | 3300046492 | Ga0495585_0002826 | Ga0495585_0002826_6809_7294 | 161 |
| 373 | 3300046492 | Ga0495585_0018754 | Ga0495585_0018754_380_865 | 161 |
| 374 | 3300046499 | Ga0495594_0060916 | Ga0495594_0060916_1325_1813 | 161 |
| 375 | 3300046500 | Ga0495596_0000457 | Ga0495596_0000457_3980_4465 | 161 |
| 376 | 3300046501 | Ga0495607_0001842 | Ga0495607_0001842_5695_6180 | 161 |
| 377 | 3300046501 | Ga0495607_0005447 | Ga0495607_0005447_1258_1743 | 161 |
| 378 | 3300046501 | Ga0495607_0013328 | Ga0495607_0013328_4766_5257 | 161 |
| 379 | 3300046501 | Ga0495607_0016376 | Ga0495607_0016376_4091_4576 | 161 |
| 380 | 3300046501 | Ga0495607_0061679 | Ga0495607_0061679_211_696 | 161 |
| 381 | 3300046501 | Ga0495607_0148658 | Ga0495607_0148658_44_529 | 161 |
| 382 | 3300046501 | Ga0495607_0179240 | Ga0495607_0179240_559_1044 | 161 |
| 383 | 3300046506 | Ga0495583_0007690 | Ga0495583_0007690_1487_1975 | 161 |
| 384 | 3300046507 | Ga0495606_0012463 | Ga0495606_0012463_3430_3915 | 161 |
| 385 | 3300046512 | Ga0495610_0005392 | Ga0495610_0005392_4257_4742 | 161 |
| 386 | 3300046512 | Ga0495610_0011594 | Ga0495610_0011594_351_836 | 161 |
| 387 | 3300046513 | Ga0495616_0006578 | Ga0495616_0006578_1353_1838 | 161 |
| 388 | 3300046513 | Ga0495616_0011608 | Ga0495616_0011608_1255_1740 | 161 |
| 389 | 3300046513 | Ga0495616_0069276 | Ga0495616_0069276_204_689 | 161 |
| 390 | 3300046515 | Ga0495620_0002168 | Ga0495620_0002168_6937_7422 | 161 |
| 391 | 3300046516 | Ga0495628_0840388 | Ga0495628_0840388_114_599 | 161 |
| 392 | 3300046517 | Ga0495630_0078352 | Ga0495630_0078352_592_1077 | 161 |
| 393 | 3300046517 | Ga0495630_0091744 | Ga0495630_0091744_1369_1854 | 161 |
| 394 | 3300046518 | Ga0495631_0041905 | Ga0495631_0041905_811_1296 | 161 |
| 395 | 3300046519 | Ga0495632_0000183 | Ga0495632_0000183_56589_57074 | 161 |
| 396 | 3300046519 | Ga0495632_0004421 | Ga0495632_0004421_3881_4366 | 161 |
| 397 | 3300046519 | Ga0495632_0007805 | Ga0495632_0007805_2752_3237 | 161 |
| 398 | 3300046519 | Ga0495632_0017318 | Ga0495632_0017318_511_996 | 161 |
| 399 | 3300046519 | Ga0495632_0093532 | Ga0495632_0093532_619_1104 | 161 |
| 400 | 3300046520 | Ga0495637_0002968 | Ga0495637_0002968_4770_5255 | 161 |
| 401 | 3300046520 | Ga0495637_0035167 | Ga0495637_0035167_1109_1594 | 161 |
| 402 | 3300046520 | Ga0495637_0043001 | Ga0495637_0043001_1219_1704 | 161 |
| 403 | 3300046520 | Ga0495637_0045602 | Ga0495637_0045602_1229_1714 | 161 |
| 404 | 3300046520 | Ga0495637_0161470 | Ga0495637_0161470_33_518 | 161 |
| 405 | 3300046520 | Ga0495637_0205299 | Ga0495637_0205299_92_577 | 161 |
| 406 | 3300046522 | Ga0495643_0014649 | Ga0495643_0014649_491_976 | 161 |
| 407 | 3300046522 | Ga0495643_0019098 | Ga0495643_0019098_2816_3301 | 161 |
| 408 | 3300046522 | Ga0495643_0105656 | Ga0495643_0105656_939_1424 | 161 |
| 409 | 3300046523 | Ga0495644_0005826 | Ga0495644_0005826_3691_4176 | 161 |
| 410 | 3300046523 | Ga0495644_0040476 | Ga0495644_0040476_605_1090 | 161 |
| 411 | 3300046524 | Ga0495648_0036194 | Ga0495648_0036194_1015_1500 | 161 |
| 412 | 3300046524 | Ga0495648_0099249 | Ga0495648_0099249_554_1039 | 161 |
| 413 | 3300046524 | Ga0495648_0228193 | Ga0495648_0228193_43_528 | 161 |
| 414 | 3300046526 | Ga0495666_0015745 | Ga0495666_0015745_1963_2448 | 161 |
| 415 | 3300046526 | Ga0495666_0032703 | Ga0495666_0032703_605_1090 | 161 |
| 416 | 3300046528 | Ga0495642_0002322 | Ga0495642_0002322_4953_5438 | 161 |
| 417 | 3300046530 | Ga0495654_0002100 | Ga0495654_0002100_4690_5178 | 161 |
| 418 | 3300046530 | Ga0495654_0012687 | Ga0495654_0012687_366_851 | 161 |
| 419 | 3300046530 | Ga0495654_0021176 | Ga0495654_0021176_1173_1658 | 161 |
| 420 | 3300046530 | Ga0495654_0021975 | Ga0495654_0021975_1045_1530 | 161 |
| 421 | 3300046530 | Ga0495654_0110378 | Ga0495654_0110378_231_716 | 161 |
| 422 | 3300046535 | Ga0495586_0015830 | Ga0495586_0015830_2158_2643 | 161 |
| 423 | 3300046536 | Ga0495587_0007201 | Ga0495587_0007201_1375_1860 | 161 |
| 424 | 3300046538 | Ga0495609_0004194 | Ga0495609_0004194_2279_2764 | 161 |
| 425 | 3300046542 | Ga0495597_0003033 | Ga0495597_0003033_9302_9787 | 161 |
| 426 | 3300046542 | Ga0495597_0009193 | Ga0495597_0009193_1530_2015 | 161 |
| 427 | 3300046542 | Ga0495597_0010022 | Ga0495597_0010022_3619_4104 | 161 |
| 428 | 3300046542 | Ga0495597_0014359 | Ga0495597_0014359_888_1373 | 161 |
| 429 | 3300046542 | Ga0495597_0029760 | Ga0495597_0029760_856_1341 | 161 |
| 430 | 3300046557 | Ga0495622_0001755 | Ga0495622_0001755_1067_1555 | 161 |
| 431 | 3300046557 | Ga0495622_0015333 | Ga0495622_0015333_1386_1871 | 161 |
| 432 | 3300046558 | Ga0495633_0135241 | Ga0495633_0135241_507_992 | 161 |
| 433 | 3300046615 | Ga0495656_0032403 | Ga0495656_0032403_1227_1712 | 161 |
| 434 | 3300046616 | Ga0495668_0032164 | Ga0495668_0032164_1740_2225 | 161 |
| 435 | 3300046660 | Ga0495625_0014464 | Ga0495625_0014464_1199_1684 | 161 |
| 436 | 3300046660 | Ga0495625_0016152 | Ga0495625_0016152_1735_2220 | 161 |
| 437 | 3300046663 | Ga0495635_0031323 | Ga0495635_0031323_1375_1860 | 161 |
| 438 | 3300046664 | Ga0495659_0000591 | Ga0495659_0000591_7931_8419 | 161 |
| 439 | 3300046664 | Ga0495659_0064831 | Ga0495659_0064831_81_572 | 161 |
| 440 | 3300046665 | Ga0495661_0008492 | Ga0495661_0008492_2851_3336 | 161 |
| 441 | 3300046665 | Ga0495661_0009218 | Ga0495661_0009218_4812_5297 | 161 |
| 442 | 3300046665 | Ga0495661_0057687 | Ga0495661_0057687_1442_1927 | 161 |
| 443 | 3300046665 | Ga0495661_0070489 | Ga0495661_0070489_960_1445 | 161 |
| 444 | 3300046674 | Ga0495588_0023300 | Ga0495588_0023300_1306_1791 | 161 |
| 445 | 3300046675 | Ga0495657_0050499 | Ga0495657_0050499_1840_2325 | 161 |
| 446 | 3300046679 | Ga0495623_0002029 | Ga0495623_0002029_8910_9395 | 161 |
| 447 | 3300046680 | Ga0495646_0010104 | Ga0495646_0010104_4194_4679 | 161 |
| 448 | 3300046689 | Ga0495613_0020891 | Ga0495613_0020891_1876_2361 | 161 |
| 449 | 3300046691 | Ga0495670_0001055 | Ga0495670_0001055_7917_8402 | 161 |
| 450 | 3300046691 | Ga0495670_0009909 | Ga0495670_0009909_538_1023 | 161 |
| 451 | 3300046692 | Ga0495671_0004083 | Ga0495671_0004083_3635_4120 | 161 |
| 452 | 3300046692 | Ga0495671_0015870 | Ga0495671_0015870_2992_3477 | 161 |
| 453 | 3300046692 | Ga0495671_0035115 | Ga0495671_0035115_1041_1526 | 161 |
| 454 | 3300046692 | Ga0495671_0076969 | Ga0495671_0076969_198_683 | 161 |
| 455 | 3300046694 | Ga0495649_0001766 | Ga0495649_0001766_5257_5742 | 161 |
| 456 | 3300046694 | Ga0495649_0020534 | Ga0495649_0020534_415_903 | 161 |
| 457 | 3300046694 | Ga0495649_0032096 | Ga0495649_0032096_569_1054 | 161 |
| 458 | 3300046794 | Ga0495589_0001608 | Ga0495589_0001608_8395_8880 | 161 |
| 459 | 3300046794 | Ga0495589_0015569 | Ga0495589_0015569_1166_1651 | 161 |
| 460 | 3300046794 | Ga0495589_0033831 | Ga0495589_0033831_553_1041 | 161 |
| 461 | 3300046810 | Ga0495660_0012592 | Ga0495660_0012592_694_1179 | 161 |
| 462 | 3300046810 | Ga0495660_0021925 | Ga0495660_0021925_1790_2275 | 161 |
| 463 | 3300046810 | Ga0495660_0053564 | Ga0495660_0053564_953_1438 | 161 |
| 464 | 3300046810 | Ga0495660_0289892 | Ga0495660_0289892_20_505 | 161 |
| 465 | 3300047315 | Ga0495581_0010307 | Ga0495581_0010307_442_927 | 161 |
| 466 | 3300047315 | Ga0495581_0044694 | Ga0495581_0044694_537_1025 | 161 |
| 467 | 3300047317 | Ga0495604_0059325 | Ga0495604_0059325_1222_1707 | 161 |
| 468 | 3300047318 | Ga0495636_0001055 | Ga0495636_0001055_5103_5588 | 161 |
| 469 | 3300047320 | Ga0495672_0002383 | Ga0495672_0002383_10224_10709 | 161 |
| 470 | 3300047320 | Ga0495672_0032209 | Ga0495672_0032209_2246_2731 | 161 |
| 471 | 3300047320 | Ga0495672_0073928 | Ga0495672_0073928_1200_1685 | 161 |
| 472 | 3300047320 | Ga0495672_0106604 | Ga0495672_0106604_512_997 | 161 |
| 473 | 3300047322 | Ga0495680_0001587 | Ga0495680_0001587_14256_14741 | 161 |
| 474 | 3300047322 | Ga0495680_0416067 | Ga0495680_0416067_53_538 | 161 |
| 475 | 3300047323 | Ga0495683_0000198 | Ga0495683_0000198_107_592 | 161 |
| 476 | 3300047323 | Ga0495683_0000448 | Ga0495683_0000448_766_1254 | 161 |
| 477 | 3300047323 | Ga0495683_0012907 | Ga0495683_0012907_3436_3921 | 161 |
| 478 | 3300047323 | Ga0495683_0013782 | Ga0495683_0013782_1897_2382 | 161 |
| 479 | 3300047443 | Ga0495687_003790 | Ga0495687_003790_4910_5395 | 161 |
| 480 | 3300047443 | Ga0495687_013843 | Ga0495687_013843_1562_2050 | 161 |
| 481 | 3300047444 | Ga0495675_0030493 | Ga0495675_0030493_1205_1690 | 161 |
| 482 | 3300047444 | Ga0495675_0117975 | Ga0495675_0117975_1100_1585 | 161 |
| 483 | 3300047446 | Ga0495679_145801 | Ga0495679_145801_33_518 | 161 |
| 484 | 3300047469 | Ga0495673_0021691 | Ga0495673_0021691_1258_1743 | 161 |
| 485 | 3300047469 | Ga0495673_0053895 | Ga0495673_0053895_682_1167 | 161 |
| 486 | 3300047469 | Ga0495673_0066051 | Ga0495673_0066051_715_1200 | 161 |
| 487 | 3300047470 | Ga0495681_0006128 | Ga0495681_0006128_1350_1835 | 161 |
| 488 | 3300047470 | Ga0495681_0009958 | Ga0495681_0009958_3905_4390 | 161 |
| 489 | 3300047470 | Ga0495681_0012873 | Ga0495681_0012873_576_1061 | 161 |
| 490 | 3300047470 | Ga0495681_0026846 | Ga0495681_0026846_1910_2395 | 161 |
| 491 | 3300047470 | Ga0495681_0031297 | Ga0495681_0031297_628_1113 | 161 |
| 492 | 3300047471 | Ga0495684_0035067 | Ga0495684_0035067_1161_1646 | 161 |
| 493 | 3300047472 | Ga0495686_0019160 | Ga0495686_0019160_3844_4329 | 161 |
| 494 | 3300047472 | Ga0495686_0021948 | Ga0495686_0021948_60_545 | 161 |
| 495 | 3300047472 | Ga0495686_0041748 | Ga0495686_0041748_1873_2358 | 161 |
| 496 | 3300047673 | Ga0495593_0006783 | Ga0495593_0006783_1543_2031 | 161 |
| 497 | 3300047673 | Ga0495593_0018799 | Ga0495593_0018799_1210_1695 | 161 |
| 498 | 3300047673 | Ga0495593_0043944 | Ga0495593_0043944_1218_1703 | 161 |
| 499 | 3300048091 | Ga0495626_0001604 | Ga0495626_0001604_15798_16283 | 161 |
| 500 | 3300048091 | Ga0495626_0002209 | Ga0495626_0002209_7951_8439 | 161 |
| 501 | 3300048091 | Ga0495626_0008122 | Ga0495626_0008122_3892_4377 | 161 |
| 502 | 3300048091 | Ga0495626_0013008 | Ga0495626_0013008_2383_2868 | 161 |
| 503 | 3300048091 | Ga0495626_0049594 | Ga0495626_0049594_1380_1865 | 161 |
| 504 | 3300048916 | Ga0496113_0560729 | Ga0496113_0560729_265_750 | 161 |
| 505 | 3300048919 | Ga0496116_0000913 | Ga0496116_0000913_10105_10590 | 161 |
| 506 | 3300048919 | Ga0496116_0002975 | Ga0496116_0002975_12293_12781 | 161 |
| 507 | 3300048919 | Ga0496116_0158124 | Ga0496116_0158124_24_509 | 161 |
| 508 | 3300048920 | Ga0496117_0001277 | Ga0496117_0001277_24673_25158 | 161 |
| 509 | 3300048920 | Ga0496117_0043688 | Ga0496117_0043688_2210_2695 | 161 |
| 510 | 3300048921 | Ga0496118_0025378 | Ga0496118_0025378_828_1313 | 161 |
| 511 | 3300048921 | Ga0496118_0069152 | Ga0496118_0069152_23_508 | 161 |
| 512 | 3300048921 | Ga0496118_0247716 | Ga0496118_0247716_312_800 | 161 |
| 513 | 3300048924 | Ga0496121_0002654 | Ga0496121_0002654_16229_16714 | 161 |
| 514 | 3300048924 | Ga0496121_0067182 | Ga0496121_0067182_1939_2427 | 161 |
| 515 | 3300048925 | Ga0496122_0016792 | Ga0496122_0016792_4447_4932 | 161 |
| 516 | 3300048925 | Ga0496122_0039712 | Ga0496122_0039712_2705_3193 | 161 |
| 517 | 3300048925 | Ga0496122_0200246 | Ga0496122_0200246_50_535 | 161 |
| 518 | 3300048926 | Ga0496123_0005030 | Ga0496123_0005030_4680_5165 | 161 |
| 519 | 3300048926 | Ga0496123_0096379 | Ga0496123_0096379_897_1385 | 161 |
| 520 | 3300048927 | Ga0496124_0470892 | Ga0496124_0470892_50_538 | 161 |
| 521 | 3300049459 | Ga0495678_003284 | Ga0495678_003284_4718_5203 | 161 |
| 522 | 3300049459 | Ga0495678_007151 | Ga0495678_007151_5260_5745 | 161 |
| 523 | 3300049459 | Ga0495678_040966 | Ga0495678_040966_28_513 | 161 |
| 524 | 3300049460 | Ga0495682_0000153 | Ga0495682_0000153_33338_33823 | 161 |
| 525 | 3300049460 | Ga0495682_0071470 | Ga0495682_0071470_531_1019 | 161 |
| 526 | 3300049460 | Ga0495682_0142704 | Ga0495682_0142704_159_644 | 161 |
| 527 | 3300049460 | Ga0495682_0163899 | Ga0495682_0163899_148_633 | 161 |
| 528 | 3300049688 | Ga0501259_089454 | Ga0501259_089454_90_575 | 161 |
| 529 | 3300050514 | nmdc:mga08x19_538098_c1 | nmdc:mga08x19_538098_c1_67_552 | 161 |
| 530 | 3300047446 | Ga0495679_013436 | Ga0495679_013436_1320_1811 | 163 |
| 531 | 2124908027 | MRS2a_Contig_106 | MRS2a_00008410 | 164 |
| 532 | 2124908027 | MRS2a_Contig_720 | MRS2a_00577480 | 164 |
| 533 | 3300003791 | Ga0055530_10000296 | Ga0055530_1000029619 | 164 |
| 534 | 3300003791 | Ga0055530_10023691 | Ga0055530_100236913 | 164 |
| 535 | 3300003792 | Ga0055540_1004307 | Ga0055540_10043073 | 164 |
| 536 | 3300005288 | Ga0065714_10007294 | Ga0065714_100072943 | 164 |
| 537 | 3300005288 | Ga0065714_10019883 | Ga0065714_100198831 | 164 |
| 538 | 3300005288 | Ga0065714_10094395 | Ga0065714_100943953 | 164 |
| 539 | 3300005288 | Ga0065714_10099614 | Ga0065714_100996141 | 164 |
| 540 | 3300005288 | Ga0065714_10103470 | Ga0065714_101034701 | 164 |
| 541 | 3300005288 | Ga0065714_10134401 | Ga0065714_101344012 | 164 |
| 542 | 3300005289 | Ga0065704_10081346 | Ga0065704_100813465 | 164 |
| 543 | 3300005289 | Ga0065704_10255164 | Ga0065704_102551642 | 164 |
| 544 | 3300005290 | Ga0065712_10069868 | Ga0065712_100698689 | 164 |
| 545 | 3300005293 | Ga0065715_10022161 | Ga0065715_100221612 | 164 |
| 546 | 3300006051 | Ga0075364_10268850 | Ga0075364_102688502 | 164 |
| 547 | 3300006051 | Ga0075364_10496380 | Ga0075364_104963801 | 164 |
| 548 | 3300006058 | Ga0075432_10019681 | Ga0075432_100196813 | 164 |
| 549 | 3300006058 | Ga0075432_10079590 | Ga0075432_100795903 | 164 |
| 550 | 3300006058 | Ga0075432_10117174 | Ga0075432_101171742 | 164 |
| 551 | 3300006058 | Ga0075432_10144997 | Ga0075432_101449971 | 164 |
| 552 | 3300006177 | Ga0075362_10049502 | Ga0075362_100495023 | 164 |
| 553 | 3300006177 | Ga0075362_10059424 | Ga0075362_100594243 | 164 |
| 554 | 3300006914 | Ga0075436_100214683 | Ga0075436_1002146832 | 164 |
| 555 | 3300006914 | Ga0075436_100289934 | Ga0075436_1002899343 | 164 |
| 556 | 3300006946 | Ga0079104_1000689 | Ga0079104_100068922 | 164 |
| 557 | 3300009011 | Ga0105251_10252690 | Ga0105251_102526902 | 164 |
| 558 | 3300009036 | Ga0105244_10145656 | Ga0105244_101456562 | 164 |
| 559 | 3300009036 | Ga0105244_10199829 | Ga0105244_101998292 | 164 |
| 560 | 3300009036 | Ga0105244_10260476 | Ga0105244_102604762 | 164 |
| 561 | 3300009092 | Ga0105250_10084649 | Ga0105250_100846493 | 164 |
| 562 | 3300009148 | Ga0105243_10008101 | Ga0105243_100081011 | 164 |
| 563 | 3300009148 | Ga0105243_10106625 | Ga0105243_101066254 | 164 |
| 564 | 3300009176 | Ga0105242_10206729 | Ga0105242_102067293 | 164 |
| 565 | 3300011119 | Ga0105246_10090943 | Ga0105246_100909433 | 164 |
| 566 | 3300012498 | Ga0157345_1000963 | Ga0157345_10009631 | 164 |
| 567 | 3300012502 | Ga0157347_1002410 | Ga0157347_10024103 | 164 |
| 568 | 3300013100 | Ga0157373_10013301 | Ga0157373_100133019 | 164 |
| 569 | 3300013100 | Ga0157373_10386778 | Ga0157373_103867781 | 164 |
| 570 | 3300013102 | Ga0157371_10006075 | Ga0157371_100060754 | 164 |
| 571 | 3300013102 | Ga0157371_10118713 | Ga0157371_101187133 | 164 |
| 572 | 3300013104 | Ga0157370_10167167 | Ga0157370_101671673 | 164 |
| 573 | 3300013104 | Ga0157370_10199760 | Ga0157370_101997603 | 164 |
| 574 | 3300013105 | Ga0157369_10015038 | Ga0157369_100150386 | 164 |
| 575 | 3300013105 | Ga0157369_10270853 | Ga0157369_102708533 | 164 |
| 576 | 3300013306 | Ga0163162_10001282 | Ga0163162_1000128210 | 164 |
| 577 | 3300013307 | Ga0157372_10005224 | Ga0157372_100052249 | 164 |
| 578 | 3300013308 | Ga0157375_10088960 | Ga0157375_100889602 | 164 |
| 579 | 3300014497 | Ga0182008_10004581 | Ga0182008_100045812 | 164 |
| 580 | 3300014497 | Ga0182008_10065183 | Ga0182008_100651832 | 164 |
| 581 | 3300014497 | Ga0182008_10318160 | Ga0182008_103181602 | 164 |
| 582 | 3300015261 | Ga0182006_1006812 | Ga0182006_10068122 | 164 |
| 583 | 3300015261 | Ga0182006_1008122 | Ga0182006_10081225 | 164 |
| 584 | 3300015261 | Ga0182006_1032599 | Ga0182006_10325993 | 164 |
| 585 | 3300015261 | Ga0182006_1117531 | Ga0182006_11175312 | 164 |
| 586 | 3300015265 | Ga0182005_1011182 | Ga0182005_10111822 | 164 |
| 587 | 3300015265 | Ga0182005_1021687 | Ga0182005_10216873 | 164 |
| 588 | 3300015265 | Ga0182005_1074826 | Ga0182005_10748262 | 164 |
| 589 | 3300015265 | Ga0182005_1175742 | Ga0182005_11757421 | 164 |
| 590 | 3300017792 | Ga0163161_10003870 | Ga0163161_100038704 | 164 |
| 591 | 3300017792 | Ga0163161_10091297 | Ga0163161_100912973 | 164 |
| 592 | 3300017792 | Ga0163161_10408239 | Ga0163161_104082392 | 164 |
| 593 | 3300017792 | Ga0163161_11152063 | Ga0163161_111520632 | 164 |
| 594 | 3300025230 | Ga0209563_100593 | Ga0209563_1005935 | 164 |
| 595 | 3300025292 | Ga0209676_1000080 | Ga0209676_1000080207 | 164 |
| 596 | 3300025292 | Ga0209676_1005886 | Ga0209676_10058862 | 164 |
| 597 | 3300025298 | Ga0209050_1000117 | Ga0209050_1000117161 | 164 |
| 598 | 3300025298 | Ga0209050_1001895 | Ga0209050_10018953 | 164 |
| 599 | 3300025303 | Ga0209051_1000077 | Ga0209051_1000077161 | 164 |
| 600 | 3300025303 | Ga0209051_1003680 | Ga0209051_10036809 | 164 |
| 601 | 3300025711 | Ga0207696_1000083 | Ga0207696_100008316 | 164 |
| 602 | 3300025711 | Ga0207696_1011128 | Ga0207696_10111283 | 164 |
| 603 | 3300025711 | Ga0207696_1023231 | Ga0207696_10232313 | 164 |
| 604 | 3300025711 | Ga0207696_1034639 | Ga0207696_10346393 | 164 |
| 605 | 3300025728 | Ga0207655_1002914 | Ga0207655_10029144 | 164 |
| 606 | 3300025728 | Ga0207655_1009084 | Ga0207655_10090843 | 164 |
| 607 | 3300025728 | Ga0207655_1059240 | Ga0207655_10592402 | 164 |
| 608 | 3300025728 | Ga0207655_1074462 | Ga0207655_10744622 | 164 |
| 609 | 3300025735 | Ga0207713_1001940 | Ga0207713_10019405 | 164 |
| 610 | 3300025735 | Ga0207713_1008663 | Ga0207713_10086637 | 164 |
| 611 | 3300025735 | Ga0207713_1010616 | Ga0207713_10106168 | 164 |
| 612 | 3300025735 | Ga0207713_1019697 | Ga0207713_10196975 | 164 |
| 613 | 3300025934 | Ga0207686_10101637 | Ga0207686_101016373 | 164 |
| 614 | 3300025935 | Ga0207709_10107691 | Ga0207709_101076913 | 164 |
| 615 | 3300027111 | Ga0209281_1000013 | Ga0209281_1000013454 | 164 |
| 616 | 3300027111 | Ga0209281_1011153 | Ga0209281_10111533 | 164 |
| 617 | 3300027876 | Ga0209974_10057430 | Ga0209974_100574302 | 164 |
| 618 | 3300027907 | Ga0207428_10015030 | Ga0207428_100150302 | 164 |
| 619 | 3300027907 | Ga0207428_10073102 | Ga0207428_100731025 | 164 |
| 620 | 3300027907 | Ga0207428_10107728 | Ga0207428_101077284 | 164 |
| 621 | 3300027907 | Ga0207428_10447791 | Ga0207428_104477912 | 164 |
| 622 | 3300027907 | Ga0207428_10609963 | Ga0207428_106099631 | 164 |
| 623 | 3300028379 | Ga0268266_10011767 | Ga0268266_100117674 | 164 |
| 624 | 3300030521 | Ga0307511_10161596 | Ga0307511_101615962 | 164 |
| 625 | 3300031548 | Ga0307408_100022319 | Ga0307408_1000223196 | 164 |
| 626 | 3300031903 | Ga0307407_10091846 | Ga0307407_100918462 | 164 |
| 627 | 3300031911 | Ga0307412_10105917 | Ga0307412_101059172 | 164 |
| 628 | 3300032004 | Ga0307414_10071613 | Ga0307414_100716133 | 164 |
| 629 | 3300033180 | Ga0307510_10007066 | Ga0307510_100070669 | 164 |
| 630 | 3300041405 | Ga0439438_018232 | Ga0439438_018232_922_1416 | 164 |
| 631 | 3300041405 | Ga0439438_018576 | Ga0439438_018576_1202_1696 | 164 |
| 632 | 3300041405 | Ga0439438_026197 | Ga0439438_026197_227_721 | 164 |
| 633 | 3300041407 | Ga0439447_000562 | Ga0439447_000562_6403_6897 | 164 |
| 634 | 3300041407 | Ga0439447_001274 | Ga0439447_001274_3981_4475 | 164 |
| 635 | 3300041407 | Ga0439447_001610 | Ga0439447_001610_7581_8075 | 164 |
| 636 | 3300041411 | Ga0439466_0001323 | Ga0439466_0001323_4301_4795 | 164 |
| 637 | 3300041411 | Ga0439466_0002331 | Ga0439466_0002331_1690_2184 | 164 |
| 638 | 3300041411 | Ga0439466_0003049 | Ga0439466_0003049_366_860 | 164 |
| 639 | 3300041411 | Ga0439466_0022710 | Ga0439466_0022710_1326_1820 | 164 |
| 640 | 3300041411 | Ga0439466_0030367 | Ga0439466_0030367_783_1277 | 164 |
| 641 | 3300041411 | Ga0439466_0050348 | Ga0439466_0050348_627_1121 | 164 |
| 642 | 3300041413 | Ga0439465_0016881 | Ga0439465_0016881_764_1258 | 164 |
| 643 | 3300041413 | Ga0439465_0116620 | Ga0439465_0116620_263_757 | 164 |
| 644 | 3300041413 | Ga0439465_0168346 | Ga0439465_0168346_214_708 | 164 |
| 645 | 3300041413 | Ga0439465_0207111 | Ga0439465_0207111_202_696 | 164 |
| 646 | 3300041997 | Ga0439431_0163933 | Ga0439431_0163933_34_528 | 164 |
| 647 | 3300042006 | Ga0439432_005468 | Ga0439432_005468_1932_2426 | 164 |
| 648 | 3300042006 | Ga0439432_020304 | Ga0439432_020304_1319_1813 | 164 |
| 649 | 3300042006 | Ga0439432_075889 | Ga0439432_075889_47_541 | 164 |
| 650 | 3300042009 | Ga0439451_003412 | Ga0439451_003412_936_1430 | 164 |
| 651 | 3300042010 | Ga0439452_000336 | Ga0439452_000336_20957_21451 | 164 |
| 652 | 3300042010 | Ga0439452_000995 | Ga0439452_000995_11333_11827 | 164 |
| 653 | 3300042010 | Ga0439452_001056 | Ga0439452_001056_4502_4996 | 164 |
| 654 | 3300042010 | Ga0439452_002813 | Ga0439452_002813_1370_1864 | 164 |
| 655 | 3300042010 | Ga0439452_059732 | Ga0439452_059732_175_669 | 164 |
| 656 | 3300042013 | Ga0439456_002709 | Ga0439456_002709_1760_2254 | 164 |
| 657 | 3300042013 | Ga0439456_043770 | Ga0439456_043770_320_814 | 164 |
| 658 | 3300042016 | Ga0439463_001283 | Ga0439463_001283_5740_6234 | 164 |
| 659 | 3300042016 | Ga0439463_002076 | Ga0439463_002076_408_902 | 164 |
| 660 | 3300042115 | Ga0450911_001170 | Ga0450911_001170_3258_3752 | 164 |
| 661 | 3300042115 | Ga0450911_009374 | Ga0450911_009374_364_858 | 164 |
| 662 | 3300042121 | Ga0450919_000274 | Ga0450919_000274_3220_3714 | 164 |
| 663 | 3300042121 | Ga0450919_008559 | Ga0450919_008559_148_642 | 164 |
| 664 | 3300042122 | Ga0450920_000195 | Ga0450920_000195_4285_4779 | 164 |
| 665 | 3300042124 | Ga0450922_000235 | Ga0450922_000235_2889_3383 | 164 |
| 666 | 3300042124 | Ga0450922_000315 | Ga0450922_000315_2768_3262 | 164 |
| 667 | 3300042125 | Ga0450923_004163 | Ga0450923_004163_1341_1835 | 164 |
| 668 | 3300042137 | Ga0450902_001174 | Ga0450902_001174_1551_2045 | 164 |
| 669 | 3300042137 | Ga0450902_001667 | Ga0450902_001667_676_1170 | 164 |
| 670 | 3300042137 | Ga0450902_011710 | Ga0450902_011710_725_1219 | 164 |
| 671 | 3300042137 | Ga0450902_028617 | Ga0450902_028617_352_846 | 164 |
| 672 | 3300042138 | Ga0450903_003047 | Ga0450903_003047_563_1057 | 164 |
| 673 | 3300042138 | Ga0450903_044996 | Ga0450903_044996_89_583 | 164 |
| 674 | 3300042142 | Ga0450905_005396 | Ga0450905_005396_757_1251 | 164 |
| 675 | 3300042142 | Ga0450905_021358 | Ga0450905_021358_225_719 | 164 |
| 676 | 3300042145 | Ga0450906_001408 | Ga0450906_001408_1524_2018 | 164 |
| 677 | 3300042145 | Ga0450906_003874 | Ga0450906_003874_259_753 | 164 |
| 678 | 3300042146 | Ga0450907_000081 | Ga0450907_000081_23377_23871 | 164 |
| 679 | 3300042146 | Ga0450907_000598 | Ga0450907_000598_3959_4453 | 164 |
| 680 | 3300042147 | Ga0450910_000174 | Ga0450910_000174_1419_1913 | 164 |
| 681 | 3300042147 | Ga0450910_003075 | Ga0450910_003075_151_645 | 164 |
| 682 | 3300042156 | Ga0439446_0001332 | Ga0439446_0001332_4227_4721 | 164 |
| 683 | 3300042184 | Ga0450908_018968 | Ga0450908_018968_388_882 | 164 |
| 684 | 3300042185 | Ga0450909_001944 | Ga0450909_001944_434_928 | 164 |
| 685 | 3300042185 | Ga0450909_002149 | Ga0450909_002149_395_889 | 164 |
| 686 | 3300042435 | Ga0439434_0000388 | Ga0439434_0000388_5984_6478 | 164 |
| 687 | 3300042461 | Ga0439460_0000859 | Ga0439460_0000859_1563_2057 | 164 |
| 688 | 3300042461 | Ga0439460_0166221 | Ga0439460_0166221_117_611 | 164 |
| 689 | 3300042531 | Ga0450918_021634 | Ga0450918_021634_457_951 | 164 |
| 690 | 3300042993 | Ga0439440_0000576 | Ga0439440_0000576_2837_3331 | 164 |
| 691 | 3300046452 | Ga0495617_010936 | Ga0495617_010936_504_998 | 164 |
| 692 | 3300046452 | Ga0495617_012573 | Ga0495617_012573_158_652 | 164 |
| 693 | 3300046452 | Ga0495617_020305 | Ga0495617_020305_386_880 | 164 |
| 694 | 3300046452 | Ga0495617_049747 | Ga0495617_049747_683_1177 | 164 |
| 695 | 3300046453 | Ga0495627_001791 | Ga0495627_001791_8572_9066 | 164 |
| 696 | 3300046453 | Ga0495627_006194 | Ga0495627_006194_2915_3409 | 164 |
| 697 | 3300046453 | Ga0495627_129309 | Ga0495627_129309_55_549 | 164 |
| 698 | 3300046455 | Ga0495603_0003858 | Ga0495603_0003858_2085_2579 | 164 |
| 699 | 3300046455 | Ga0495603_0194583 | Ga0495603_0194583_295_789 | 164 |
| 700 | 3300046457 | Ga0495590_0001333 | Ga0495590_0001333_4981_5475 | 164 |
| 701 | 3300046457 | Ga0495590_0004417 | Ga0495590_0004417_3879_4373 | 164 |
| 702 | 3300046458 | Ga0495591_002519 | Ga0495591_002519_1312_1806 | 164 |
| 703 | 3300046458 | Ga0495591_002584 | Ga0495591_002584_8164_8658 | 164 |
| 704 | 3300046458 | Ga0495591_008802 | Ga0495591_008802_602_1096 | 164 |
| 705 | 3300046458 | Ga0495591_009585 | Ga0495591_009585_2293_2787 | 164 |
| 706 | 3300046458 | Ga0495591_012408 | Ga0495591_012408_2666_3160 | 164 |
| 707 | 3300046458 | Ga0495591_018098 | Ga0495591_018098_1275_1769 | 164 |
| 708 | 3300046458 | Ga0495591_023770 | Ga0495591_023770_86_580 | 164 |
| 709 | 3300046458 | Ga0495591_077683 | Ga0495591_077683_87_581 | 164 |
| 710 | 3300046460 | Ga0495638_0010758 | Ga0495638_0010758_4502_4996 | 164 |
| 711 | 3300046460 | Ga0495638_0023996 | Ga0495638_0023996_2041_2535 | 164 |
| 712 | 3300046460 | Ga0495638_0034364 | Ga0495638_0034364_978_1472 | 164 |
| 713 | 3300046460 | Ga0495638_0064290 | Ga0495638_0064290_1324_1818 | 164 |
| 714 | 3300046460 | Ga0495638_0064486 | Ga0495638_0064486_101_655 | 164 |
| 715 | 3300046460 | Ga0495638_0064956 | Ga0495638_0064956_518_1012 | 164 |
| 716 | 3300046460 | Ga0495638_0085556 | Ga0495638_0085556_602_1096 | 164 |
| 717 | 3300046460 | Ga0495638_0165470 | Ga0495638_0165470_219_713 | 164 |
| 718 | 3300046463 | Ga0495653_0052221 | Ga0495653_0052221_447_941 | 164 |
| 719 | 3300046463 | Ga0495653_0159743 | Ga0495653_0159743_462_956 | 164 |
| 720 | 3300046471 | Ga0495650_0015573 | Ga0495650_0015573_620_1114 | 164 |
| 721 | 3300046471 | Ga0495650_0016047 | Ga0495650_0016047_659_1153 | 164 |
| 722 | 3300046471 | Ga0495650_0018746 | Ga0495650_0018746_673_1167 | 164 |
| 723 | 3300046471 | Ga0495650_0073164 | Ga0495650_0073164_486_980 | 164 |
| 724 | 3300046474 | Ga0495605_0000700 | Ga0495605_0000700_5849_6343 | 164 |
| 725 | 3300046474 | Ga0495605_0019673 | Ga0495605_0019673_1665_2159 | 164 |
| 726 | 3300046474 | Ga0495605_0060777 | Ga0495605_0060777_80_574 | 164 |
| 727 | 3300046474 | Ga0495605_0151194 | Ga0495605_0151194_459_953 | 164 |
| 728 | 3300046491 | Ga0495584_0001750 | Ga0495584_0001750_4600_5094 | 164 |
| 729 | 3300046491 | Ga0495584_0004667 | Ga0495584_0004667_2197_2691 | 164 |
| 730 | 3300046491 | Ga0495584_0008873 | Ga0495584_0008873_1169_1663 | 164 |
| 731 | 3300046491 | Ga0495584_0011359 | Ga0495584_0011359_3336_3830 | 164 |
| 732 | 3300046491 | Ga0495584_0021299 | Ga0495584_0021299_657_1151 | 164 |
| 733 | 3300046491 | Ga0495584_0073468 | Ga0495584_0073468_428_922 | 164 |
| 734 | 3300046491 | Ga0495584_0138481 | Ga0495584_0138481_256_750 | 164 |
| 735 | 3300046492 | Ga0495585_0011764 | Ga0495585_0011764_3365_3859 | 164 |
| 736 | 3300046492 | Ga0495585_0045695 | Ga0495585_0045695_1405_1899 | 164 |
| 737 | 3300046492 | Ga0495585_0049598 | Ga0495585_0049598_1360_1854 | 164 |
| 738 | 3300046492 | Ga0495585_0099235 | Ga0495585_0099235_505_999 | 164 |
| 739 | 3300046492 | Ga0495585_0162603 | Ga0495585_0162603_119_613 | 164 |
| 740 | 3300046492 | Ga0495585_0186226 | Ga0495585_0186226_50_544 | 164 |
| 741 | 3300046492 | Ga0495585_0208205 | Ga0495585_0208205_28_522 | 164 |
| 742 | 3300046499 | Ga0495594_0016316 | Ga0495594_0016316_1488_1982 | 164 |
| 743 | 3300046500 | Ga0495596_0019474 | Ga0495596_0019474_652_1146 | 164 |
| 744 | 3300046501 | Ga0495607_0002479 | Ga0495607_0002479_4800_5294 | 164 |
| 745 | 3300046501 | Ga0495607_0005775 | Ga0495607_0005775_529_1023 | 164 |
| 746 | 3300046501 | Ga0495607_0013603 | Ga0495607_0013603_4591_5085 | 164 |
| 747 | 3300046501 | Ga0495607_0077667 | Ga0495607_0077667_1204_1698 | 164 |
| 748 | 3300046501 | Ga0495607_0084186 | Ga0495607_0084186_1034_1528 | 164 |
| 749 | 3300046501 | Ga0495607_0137774 | Ga0495607_0137774_632_1126 | 164 |
| 750 | 3300046501 | Ga0495607_0203729 | Ga0495607_0203729_382_876 | 164 |
| 751 | 3300046506 | Ga0495583_0014015 | Ga0495583_0014015_3733_4227 | 164 |
| 752 | 3300046506 | Ga0495583_0014566 | Ga0495583_0014566_3200_3694 | 164 |
| 753 | 3300046506 | Ga0495583_0022404 | Ga0495583_0022404_625_1119 | 164 |
| 754 | 3300046506 | Ga0495583_0106411 | Ga0495583_0106411_52_546 | 164 |
| 755 | 3300046506 | Ga0495583_0138743 | Ga0495583_0138743_413_907 | 164 |
| 756 | 3300046507 | Ga0495606_0001929 | Ga0495606_0001929_20680_21174 | 164 |
| 757 | 3300046507 | Ga0495606_0007990 | Ga0495606_0007990_8543_9037 | 164 |
| 758 | 3300046507 | Ga0495606_0017049 | Ga0495606_0017049_3668_4162 | 164 |
| 759 | 3300046507 | Ga0495606_0041100 | Ga0495606_0041100_832_1326 | 164 |
| 760 | 3300046512 | Ga0495610_0002647 | Ga0495610_0002647_6232_6726 | 164 |
| 761 | 3300046512 | Ga0495610_0009009 | Ga0495610_0009009_1146_1640 | 164 |
| 762 | 3300046512 | Ga0495610_0010638 | Ga0495610_0010638_4632_5126 | 164 |
| 763 | 3300046512 | Ga0495610_0012442 | Ga0495610_0012442_2383_2877 | 164 |
| 764 | 3300046512 | Ga0495610_0087769 | Ga0495610_0087769_260_754 | 164 |
| 765 | 3300046512 | Ga0495610_0125868 | Ga0495610_0125868_464_958 | 164 |
| 766 | 3300046512 | Ga0495610_0192625 | Ga0495610_0192625_222_716 | 164 |
| 767 | 3300046513 | Ga0495616_0005949 | Ga0495616_0005949_2289_2783 | 164 |
| 768 | 3300046513 | Ga0495616_0010463 | Ga0495616_0010463_295_789 | 164 |
| 769 | 3300046513 | Ga0495616_0024545 | Ga0495616_0024545_2069_2563 | 164 |
| 770 | 3300046513 | Ga0495616_0073496 | Ga0495616_0073496_519_1013 | 164 |
| 771 | 3300046513 | Ga0495616_0100340 | Ga0495616_0100340_130_624 | 164 |
| 772 | 3300046513 | Ga0495616_0105290 | Ga0495616_0105290_276_770 | 164 |
| 773 | 3300046513 | Ga0495616_0156085 | Ga0495616_0156085_130_624 | 164 |
| 774 | 3300046513 | Ga0495616_0180702 | Ga0495616_0180702_366_860 | 164 |
| 775 | 3300046515 | Ga0495620_0002462 | Ga0495620_0002462_5157_5651 | 164 |
| 776 | 3300046515 | Ga0495620_0008445 | Ga0495620_0008445_75_569 | 164 |
| 777 | 3300046515 | Ga0495620_0028806 | Ga0495620_0028806_477_971 | 164 |
| 778 | 3300046515 | Ga0495620_0046241 | Ga0495620_0046241_656_1150 | 164 |
| 779 | 3300046515 | Ga0495620_0075737 | Ga0495620_0075737_673_1167 | 164 |
| 780 | 3300046515 | Ga0495620_0083338 | Ga0495620_0083338_473_967 | 164 |
| 781 | 3300046517 | Ga0495630_0466701 | Ga0495630_0466701_404_898 | 164 |
| 782 | 3300046518 | Ga0495631_0000294 | Ga0495631_0000294_7733_8227 | 164 |
| 783 | 3300046518 | Ga0495631_0002372 | Ga0495631_0002372_1348_1842 | 164 |
| 784 | 3300046518 | Ga0495631_0007666 | Ga0495631_0007666_2571_3065 | 164 |
| 785 | 3300046518 | Ga0495631_0044994 | Ga0495631_0044994_796_1290 | 164 |
| 786 | 3300046519 | Ga0495632_0001201 | Ga0495632_0001201_8449_8943 | 164 |
| 787 | 3300046519 | Ga0495632_0002627 | Ga0495632_0002627_8205_8699 | 164 |
| 788 | 3300046519 | Ga0495632_0005950 | Ga0495632_0005950_604_1098 | 164 |
| 789 | 3300046519 | Ga0495632_0035099 | Ga0495632_0035099_1306_1800 | 164 |
| 790 | 3300046519 | Ga0495632_0049023 | Ga0495632_0049023_1229_1723 | 164 |
| 791 | 3300046520 | Ga0495637_0009266 | Ga0495637_0009266_1996_2490 | 164 |
| 792 | 3300046520 | Ga0495637_0010088 | Ga0495637_0010088_3885_4379 | 164 |
| 793 | 3300046520 | Ga0495637_0010262 | Ga0495637_0010262_3065_3559 | 164 |
| 794 | 3300046520 | Ga0495637_0059646 | Ga0495637_0059646_423_917 | 164 |
| 795 | 3300046520 | Ga0495637_0083973 | Ga0495637_0083973_24_518 | 164 |
| 796 | 3300046520 | Ga0495637_0111711 | Ga0495637_0111711_44_538 | 164 |
| 797 | 3300046520 | Ga0495637_0131342 | Ga0495637_0131342_17_511 | 164 |
| 798 | 3300046520 | Ga0495637_0295540 | Ga0495637_0295540_23_517 | 164 |
| 799 | 3300046522 | Ga0495643_0016933 | Ga0495643_0016933_3497_3991 | 164 |
| 800 | 3300046522 | Ga0495643_0017538 | Ga0495643_0017538_2858_3352 | 164 |
| 801 | 3300046523 | Ga0495644_0004258 | Ga0495644_0004258_3805_4299 | 164 |
| 802 | 3300046523 | Ga0495644_0066275 | Ga0495644_0066275_544_1038 | 164 |
| 803 | 3300046523 | Ga0495644_0273253 | Ga0495644_0273253_138_632 | 164 |
| 804 | 3300046524 | Ga0495648_0000923 | Ga0495648_0000923_1532_2026 | 164 |
| 805 | 3300046524 | Ga0495648_0002722 | Ga0495648_0002722_2033_2527 | 164 |
| 806 | 3300046524 | Ga0495648_0079026 | Ga0495648_0079026_1036_1530 | 164 |
| 807 | 3300046524 | Ga0495648_0095692 | Ga0495648_0095692_484_978 | 164 |
| 808 | 3300046524 | Ga0495648_0203327 | Ga0495648_0203327_346_840 | 164 |
| 809 | 3300046524 | Ga0495648_0275636 | Ga0495648_0275636_265_759 | 164 |
| 810 | 3300046528 | Ga0495642_0000312 | Ga0495642_0000312_20435_20929 | 164 |
| 811 | 3300046528 | Ga0495642_0000897 | Ga0495642_0000897_4839_5333 | 164 |
| 812 | 3300046529 | Ga0495652_0439226 | Ga0495652_0439226_370_864 | 164 |
| 813 | 3300046530 | Ga0495654_0002528 | Ga0495654_0002528_1047_1541 | 164 |
| 814 | 3300046530 | Ga0495654_0007579 | Ga0495654_0007579_1004_1498 | 164 |
| 815 | 3300046530 | Ga0495654_0007607 | Ga0495654_0007607_4742_5236 | 164 |
| 816 | 3300046530 | Ga0495654_0024421 | Ga0495654_0024421_1474_1968 | 164 |
| 817 | 3300046530 | Ga0495654_0027101 | Ga0495654_0027101_1009_1503 | 164 |
| 818 | 3300046530 | Ga0495654_0028283 | Ga0495654_0028283_1111_1605 | 164 |
| 819 | 3300046530 | Ga0495654_0031917 | Ga0495654_0031917_669_1163 | 164 |
| 820 | 3300046530 | Ga0495654_0175813 | Ga0495654_0175813_247_741 | 164 |
| 821 | 3300046536 | Ga0495587_0001908 | Ga0495587_0001908_11691_12185 | 164 |
| 822 | 3300046538 | Ga0495609_0001932 | Ga0495609_0001932_7823_8317 | 164 |
| 823 | 3300046538 | Ga0495609_0004674 | Ga0495609_0004674_6286_6780 | 164 |
| 824 | 3300046538 | Ga0495609_0021438 | Ga0495609_0021438_472_966 | 164 |
| 825 | 3300046538 | Ga0495609_0051376 | Ga0495609_0051376_870_1364 | 164 |
| 826 | 3300046538 | Ga0495609_0079690 | Ga0495609_0079690_767_1261 | 164 |
| 827 | 3300046542 | Ga0495597_0020977 | Ga0495597_0020977_1351_1845 | 164 |
| 828 | 3300046542 | Ga0495597_0050053 | Ga0495597_0050053_1292_1786 | 164 |
| 829 | 3300046542 | Ga0495597_0061422 | Ga0495597_0061422_689_1183 | 164 |
| 830 | 3300046557 | Ga0495622_0019585 | Ga0495622_0019585_505_999 | 164 |
| 831 | 3300046557 | Ga0495622_0020506 | Ga0495622_0020506_1333_1827 | 164 |
| 832 | 3300046557 | Ga0495622_0441280 | Ga0495622_0441280_22_516 | 164 |
| 833 | 3300046558 | Ga0495633_0003303 | Ga0495633_0003303_5480_5974 | 164 |
| 834 | 3300046558 | Ga0495633_0011367 | Ga0495633_0011367_1475_1969 | 164 |
| 835 | 3300046558 | Ga0495633_0065146 | Ga0495633_0065146_1069_1623 | 164 |
| 836 | 3300046615 | Ga0495656_0000491 | Ga0495656_0000491_5346_5840 | 164 |
| 837 | 3300046615 | Ga0495656_0052182 | Ga0495656_0052182_426_920 | 164 |
| 838 | 3300046616 | Ga0495668_0004170 | Ga0495668_0004170_8696_9190 | 164 |
| 839 | 3300046616 | Ga0495668_0027292 | Ga0495668_0027292_2127_2621 | 164 |
| 840 | 3300046616 | Ga0495668_0106871 | Ga0495668_0106871_434_928 | 164 |
| 841 | 3300046642 | Ga0495634_0002797 | Ga0495634_0002797_5942_6436 | 164 |
| 842 | 3300046648 | Ga0495611_0000487 | Ga0495611_0000487_18530_19024 | 164 |
| 843 | 3300046648 | Ga0495611_0054715 | Ga0495611_0054715_918_1412 | 164 |
| 844 | 3300046660 | Ga0495625_0007666 | Ga0495625_0007666_7634_8128 | 164 |
| 845 | 3300046660 | Ga0495625_0014306 | Ga0495625_0014306_1027_1521 | 164 |
| 846 | 3300046660 | Ga0495625_0015838 | Ga0495625_0015838_2946_3518 | 164 |
| 847 | 3300046660 | Ga0495625_0106148 | Ga0495625_0106148_524_1018 | 164 |
| 848 | 3300046663 | Ga0495635_0002332 | Ga0495635_0002332_7855_8349 | 164 |
| 849 | 3300046664 | Ga0495659_0001632 | Ga0495659_0001632_279_773 | 164 |
| 850 | 3300046664 | Ga0495659_0010672 | Ga0495659_0010672_1164_1658 | 164 |
| 851 | 3300046665 | Ga0495661_0017401 | Ga0495661_0017401_1684_2178 | 164 |
| 852 | 3300046665 | Ga0495661_0051155 | Ga0495661_0051155_1788_2282 | 164 |
| 853 | 3300046665 | Ga0495661_0066453 | Ga0495661_0066453_680_1174 | 164 |
| 854 | 3300046665 | Ga0495661_0095133 | Ga0495661_0095133_308_802 | 164 |
| 855 | 3300046665 | Ga0495661_0139804 | Ga0495661_0139804_438_932 | 164 |
| 856 | 3300046674 | Ga0495588_0027484 | Ga0495588_0027484_634_1128 | 164 |
| 857 | 3300046674 | Ga0495588_0046580 | Ga0495588_0046580_404_898 | 164 |
| 858 | 3300046679 | Ga0495623_0009473 | Ga0495623_0009473_1305_1799 | 164 |
| 859 | 3300046680 | Ga0495646_0047230 | Ga0495646_0047230_47_541 | 164 |
| 860 | 3300046680 | Ga0495646_0086285 | Ga0495646_0086285_405_899 | 164 |
| 861 | 3300046684 | Ga0495669_0004265 | Ga0495669_0004265_5189_5683 | 164 |
| 862 | 3300046684 | Ga0495669_0165100 | Ga0495669_0165100_117_611 | 164 |
| 863 | 3300046689 | Ga0495613_0022276 | Ga0495613_0022276_3989_4483 | 164 |
| 864 | 3300046689 | Ga0495613_0042354 | Ga0495613_0042354_489_983 | 164 |
| 865 | 3300046690 | Ga0495624_0001085 | Ga0495624_0001085_4629_5123 | 164 |
| 866 | 3300046691 | Ga0495670_0001104 | Ga0495670_0001104_4825_5319 | 164 |
| 867 | 3300046691 | Ga0495670_0005125 | Ga0495670_0005125_1373_1867 | 164 |
| 868 | 3300046691 | Ga0495670_0330820 | Ga0495670_0330820_186_680 | 164 |
| 869 | 3300046692 | Ga0495671_0007553 | Ga0495671_0007553_1304_1798 | 164 |
| 870 | 3300046692 | Ga0495671_0012257 | Ga0495671_0012257_251_745 | 164 |
| 871 | 3300046692 | Ga0495671_0015074 | Ga0495671_0015074_2362_2856 | 164 |
| 872 | 3300046692 | Ga0495671_0027361 | Ga0495671_0027361_402_896 | 164 |
| 873 | 3300046692 | Ga0495671_0031043 | Ga0495671_0031043_1261_1755 | 164 |
| 874 | 3300046692 | Ga0495671_0055995 | Ga0495671_0055995_1009_1503 | 164 |
| 875 | 3300046692 | Ga0495671_0057175 | Ga0495671_0057175_892_1386 | 164 |
| 876 | 3300046692 | Ga0495671_0060411 | Ga0495671_0060411_123_617 | 164 |
| 877 | 3300046692 | Ga0495671_0079487 | Ga0495671_0079487_588_1082 | 164 |
| 878 | 3300046694 | Ga0495649_0004367 | Ga0495649_0004367_1279_1773 | 164 |
| 879 | 3300046694 | Ga0495649_0005632 | Ga0495649_0005632_5100_5594 | 164 |
| 880 | 3300046694 | Ga0495649_0016452 | Ga0495649_0016452_453_947 | 164 |
| 881 | 3300046694 | Ga0495649_0020115 | Ga0495649_0020115_2687_3181 | 164 |
| 882 | 3300046694 | Ga0495649_0049470 | Ga0495649_0049470_1360_1854 | 164 |
| 883 | 3300046694 | Ga0495649_0071964 | Ga0495649_0071964_191_685 | 164 |
| 884 | 3300046694 | Ga0495649_0095201 | Ga0495649_0095201_24_518 | 164 |
| 885 | 3300046694 | Ga0495649_0177445 | Ga0495649_0177445_539_1033 | 164 |
| 886 | 3300046794 | Ga0495589_0001746 | Ga0495589_0001746_7821_8315 | 164 |
| 887 | 3300046794 | Ga0495589_0005329 | Ga0495589_0005329_4535_5029 | 164 |
| 888 | 3300046794 | Ga0495589_0005643 | Ga0495589_0005643_5269_5763 | 164 |
| 889 | 3300046794 | Ga0495589_0016565 | Ga0495589_0016565_3068_3562 | 164 |
| 890 | 3300046794 | Ga0495589_0057359 | Ga0495589_0057359_175_669 | 164 |
| 891 | 3300046794 | Ga0495589_0086181 | Ga0495589_0086181_512_1006 | 164 |
| 892 | 3300046809 | Ga0495600_0160639 | Ga0495600_0160639_416_910 | 164 |
| 893 | 3300046810 | Ga0495660_0003783 | Ga0495660_0003783_7826_8320 | 164 |
| 894 | 3300046810 | Ga0495660_0003851 | Ga0495660_0003851_8134_8628 | 164 |
| 895 | 3300046810 | Ga0495660_0011544 | Ga0495660_0011544_220_714 | 164 |
| 896 | 3300046810 | Ga0495660_0029670 | Ga0495660_0029670_2225_2719 | 164 |
| 897 | 3300046810 | Ga0495660_0030468 | Ga0495660_0030468_2000_2494 | 164 |
| 898 | 3300046810 | Ga0495660_0058681 | Ga0495660_0058681_1318_1812 | 164 |
| 899 | 3300046810 | Ga0495660_0103433 | Ga0495660_0103433_30_524 | 164 |
| 900 | 3300046810 | Ga0495660_0117331 | Ga0495660_0117331_601_1095 | 164 |
| 901 | 3300047317 | Ga0495604_0029265 | Ga0495604_0029265_3571_4065 | 164 |
| 902 | 3300047317 | Ga0495604_0111279 | Ga0495604_0111279_482_976 | 164 |
| 903 | 3300047318 | Ga0495636_0022025 | Ga0495636_0022025_134_628 | 164 |
| 904 | 3300047319 | Ga0495674_0047960 | Ga0495674_0047960_1332_1826 | 164 |
| 905 | 3300047320 | Ga0495672_0003039 | Ga0495672_0003039_9628_10122 | 164 |
| 906 | 3300047320 | Ga0495672_0003187 | Ga0495672_0003187_9665_10159 | 164 |
| 907 | 3300047320 | Ga0495672_0005960 | Ga0495672_0005960_4427_4921 | 164 |
| 908 | 3300047320 | Ga0495672_0012445 | Ga0495672_0012445_5376_5870 | 164 |
| 909 | 3300047320 | Ga0495672_0017745 | Ga0495672_0017745_3092_3586 | 164 |
| 910 | 3300047320 | Ga0495672_0031915 | Ga0495672_0031915_2233_2727 | 164 |
| 911 | 3300047320 | Ga0495672_0058391 | Ga0495672_0058391_1593_2087 | 164 |
| 912 | 3300047320 | Ga0495672_0082572 | Ga0495672_0082572_486_980 | 164 |
| 913 | 3300047321 | Ga0495676_0015978 | Ga0495676_0015978_1326_1820 | 164 |
| 914 | 3300047321 | Ga0495676_0056136 | Ga0495676_0056136_2268_2762 | 164 |
| 915 | 3300047322 | Ga0495680_0093522 | Ga0495680_0093522_1276_1770 | 164 |
| 916 | 3300047322 | Ga0495680_0284472 | Ga0495680_0284472_528_1022 | 164 |
| 917 | 3300047323 | Ga0495683_0000617 | Ga0495683_0000617_18358_18852 | 164 |
| 918 | 3300047323 | Ga0495683_0000910 | Ga0495683_0000910_15295_15789 | 164 |
| 919 | 3300047323 | Ga0495683_0009635 | Ga0495683_0009635_3646_4140 | 164 |
| 920 | 3300047323 | Ga0495683_0027507 | Ga0495683_0027507_965_1459 | 164 |
| 921 | 3300047323 | Ga0495683_0056254 | Ga0495683_0056254_1004_1498 | 164 |
| 922 | 3300047323 | Ga0495683_0086781 | Ga0495683_0086781_491_985 | 164 |
| 923 | 3300047323 | Ga0495683_0123406 | Ga0495683_0123406_106_600 | 164 |
| 924 | 3300047445 | Ga0495677_0001430 | Ga0495677_0001430_7890_8384 | 164 |
| 925 | 3300047446 | Ga0495679_005361 | Ga0495679_005361_3659_4153 | 164 |
| 926 | 3300047446 | Ga0495679_011232 | Ga0495679_011232_675_1169 | 164 |
| 927 | 3300047447 | Ga0495685_160417 | Ga0495685_160417_142_636 | 164 |
| 928 | 3300047469 | Ga0495673_0000383 | Ga0495673_0000383_3746_4240 | 164 |
| 929 | 3300047469 | Ga0495673_0000472 | Ga0495673_0000472_27055_27549 | 164 |
| 930 | 3300047469 | Ga0495673_0002062 | Ga0495673_0002062_8521_9015 | 164 |
| 931 | 3300047469 | Ga0495673_0027958 | Ga0495673_0027958_238_732 | 164 |
| 932 | 3300047469 | Ga0495673_0031306 | Ga0495673_0031306_638_1132 | 164 |
| 933 | 3300047469 | Ga0495673_0058980 | Ga0495673_0058980_119_613 | 164 |
| 934 | 3300047469 | Ga0495673_0089684 | Ga0495673_0089684_427_921 | 164 |
| 935 | 3300047469 | Ga0495673_0147903 | Ga0495673_0147903_32_526 | 164 |
| 936 | 3300047469 | Ga0495673_0180215 | Ga0495673_0180215_46_540 | 164 |
| 937 | 3300047470 | Ga0495681_0003553 | Ga0495681_0003553_4701_5195 | 164 |
| 938 | 3300047470 | Ga0495681_0003948 | Ga0495681_0003948_4829_5323 | 164 |
| 939 | 3300047470 | Ga0495681_0004564 | Ga0495681_0004564_4161_4655 | 164 |
| 940 | 3300047470 | Ga0495681_0005637 | Ga0495681_0005637_4796_5290 | 164 |
| 941 | 3300047470 | Ga0495681_0007283 | Ga0495681_0007283_4756_5250 | 164 |
| 942 | 3300047470 | Ga0495681_0010065 | Ga0495681_0010065_202_696 | 164 |
| 943 | 3300047470 | Ga0495681_0043211 | Ga0495681_0043211_454_948 | 164 |
| 944 | 3300047470 | Ga0495681_0058497 | Ga0495681_0058497_47_541 | 164 |
| 945 | 3300047471 | Ga0495684_0045783 | Ga0495684_0045783_2427_2921 | 164 |
| 946 | 3300047472 | Ga0495686_0005610 | Ga0495686_0005610_1352_1846 | 164 |
| 947 | 3300047472 | Ga0495686_0030929 | Ga0495686_0030929_2357_2851 | 164 |
| 948 | 3300048088 | Ga0495602_0070938 | Ga0495602_0070938_457_951 | 164 |
| 949 | 3300048088 | Ga0495602_0188766 | Ga0495602_0188766_579_1073 | 164 |
| 950 | 3300048091 | Ga0495626_0001676 | Ga0495626_0001676_8027_8521 | 164 |
| 951 | 3300048091 | Ga0495626_0008334 | Ga0495626_0008334_4859_5353 | 164 |
| 952 | 3300048091 | Ga0495626_0020492 | Ga0495626_0020492_712_1206 | 164 |
| 953 | 3300048091 | Ga0495626_0022725 | Ga0495626_0022725_656_1150 | 164 |
| 954 | 3300048091 | Ga0495626_0025322 | Ga0495626_0025322_1664_2158 | 164 |
| 955 | 3300048091 | Ga0495626_0069544 | Ga0495626_0069544_457_951 | 164 |
| 956 | 3300048905 | Ga0496102_0001399 | Ga0496102_0001399_13010_13504 | 164 |
| 957 | 3300048906 | Ga0496103_0007572 | Ga0496103_0007572_1510_2004 | 164 |
| 958 | 3300048907 | Ga0496104_0481991 | Ga0496104_0481991_212_706 | 164 |
| 959 | 3300048913 | Ga0496110_0098252 | Ga0496110_0098252_617_1111 | 164 |
| 960 | 3300048914 | Ga0496111_0242925 | Ga0496111_0242925_172_666 | 164 |
| 961 | 3300048919 | Ga0496116_0001217 | Ga0496116_0001217_9005_9499 | 164 |
| 962 | 3300048919 | Ga0496116_0010096 | Ga0496116_0010096_6884_7378 | 164 |
| 963 | 3300048920 | Ga0496117_0019550 | Ga0496117_0019550_4539_5033 | 164 |
| 964 | 3300048920 | Ga0496117_0091319 | Ga0496117_0091319_287_781 | 164 |
| 965 | 3300048921 | Ga0496118_0042355 | Ga0496118_0042355_820_1314 | 164 |
| 966 | 3300048921 | Ga0496118_0047937 | Ga0496118_0047937_562_1056 | 164 |
| 967 | 3300048921 | Ga0496118_0103877 | Ga0496118_0103877_1267_1761 | 164 |
| 968 | 3300048922 | Ga0496119_0090528 | Ga0496119_0090528_792_1286 | 164 |
| 969 | 3300048923 | Ga0496120_0181563 | Ga0496120_0181563_105_599 | 164 |
| 970 | 3300048924 | Ga0496121_0025851 | Ga0496121_0025851_403_897 | 164 |
| 971 | 3300048924 | Ga0496121_0328734 | Ga0496121_0328734_305_799 | 164 |
| 972 | 3300048924 | Ga0496121_0431908 | Ga0496121_0431908_264_758 | 164 |
| 973 | 3300048926 | Ga0496123_0147422 | Ga0496123_0147422_23_517 | 164 |
| 974 | 3300048927 | Ga0496124_0003331 | Ga0496124_0003331_4509_5003 | 164 |
| 975 | 3300048927 | Ga0496124_0031392 | Ga0496124_0031392_3816_4310 | 164 |
| 976 | 3300048927 | Ga0496124_0064800 | Ga0496124_0064800_1232_1726 | 164 |
| 977 | 3300048927 | Ga0496124_0287735 | Ga0496124_0287735_374_868 | 164 |
| 978 | 3300048928 | Ga0496125_0014908 | Ga0496125_0014908_5240_5734 | 164 |
| 979 | 3300048928 | Ga0496125_0059297 | Ga0496125_0059297_1200_1694 | 164 |
| 980 | 3300048929 | Ga0496126_0339663 | Ga0496126_0339663_109_603 | 164 |
| 981 | 3300049459 | Ga0495678_002163 | Ga0495678_002163_4902_5396 | 164 |
| 982 | 3300049459 | Ga0495678_019678 | Ga0495678_019678_633_1127 | 164 |
| 983 | 3300049459 | Ga0495678_022710 | Ga0495678_022710_1267_1761 | 164 |
| 984 | 3300049459 | Ga0495678_039680 | Ga0495678_039680_1265_1759 | 164 |
| 985 | 3300049460 | Ga0495682_0011152 | Ga0495682_0011152_787_1281 | 164 |
| 986 | 3300049460 | Ga0495682_0078256 | Ga0495682_0078256_557_1051 | 164 |
| 987 | 3300049460 | Ga0495682_0095920 | Ga0495682_0095920_14_508 | 164 |
| 988 | 3300049758 | Ga0501241_001926 | Ga0501241_001926_1214_1708 | 164 |
| 989 | 3300049766 | Ga0501269_019566 | Ga0501269_019566_291_785 | 164 |
| 990 | 3300050490 | nmdc:mga03n38_404361_c1 | nmdc:mga03n38_404361_c1_30_524 | 164 |
| 991 | 3300050491 | nmdc:mga00v17_224114_c1 | nmdc:mga00v17_224114_c1_534_1028 | 164 |
| 992 | 3300050491 | nmdc:mga00v17_27354_c1 | nmdc:mga00v17_27354_c1_1235_1729 | 164 |
| 993 | 3300050491 | nmdc:mga00v17_89861_c1 | nmdc:mga00v17_89861_c1_966_1460 | 164 |
| 994 | 3300050496 | nmdc:mga07m45_302200_c1 | nmdc:mga07m45_302200_c1_195_689 | 164 |
| 995 | 3300050514 | nmdc:mga08x19_185715_c1 | nmdc:mga08x19_185715_c1_531_1025 | 164 |
| 996 | 3300050516 | nmdc:mga0sz30_5614_c4 | nmdc:mga0sz30_5614_c4_1109_1603 | 164 |
| 997 | 3300053111 | Ga0500572_002744 | Ga0500572_002744_587_1081 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xo8-assembly1.cif.gz_A | solution structure of at1g01470 from arabidopsis thaliana | 0.6731 | 23 | 151 |
| 8dhe-assembly1.cif.gz_D | tannerella forsythia beta-glucuronidase (ml1) | 0.5945 | 37 | 148 |
| 1xo8-assembly1.cif.gz_A | solution structure of at1g01470 from arabidopsis thaliana | 0.5877 | 23 | 151 |
| 8b7d-assembly1.cif.gz_A | luminal domain of tmem106b | 0.5801 | 30 | 151 |
| 5t9g-assembly1.cif.gz_A | crystal structure of bugh2cwt in complex with galactoisofagomine | 0.5757 | 38 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0PIQ6_184_306_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7769 | 31 | 152 | 2.60.40.1820 |
| af_C0PIQ6_184_306_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.766 | 31 | 152 | 2.60.40.1820 |
| af_A0A0R0IUI6_98_233_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.705 | 28 | 151 | 2.60.40.1820 |
| 1xo8A00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6731 | 23 | 151 | 2.60.40.1820 |
| af_Q54XW0_47_140_2.60.40.290 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6664 | 30 | 105 | 2.60.40.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A270PEF7-F1-model_v4 | Water stress and hypersensitive response domain-containing protein | 0.8678 | 1 | 159 |
GO:0009269
|
| AF-A0A7T8BBX6-F1-model_v4 | LEA type 2 family protein | 0.8669 | 30 | 150 |
GO:0009269
|
| AF-A0A7T7XR06-F1-model_v4 | LEA type 2 family protein | 0.8637 | 29 | 151 |
GO:0009269
|
| AF-F5YQ41-F1-model_v4 | Water stress and hypersensitive response domain-containing protein | 0.8635 | 29 | 151 |
GO:0009269
|
| AF-A0A4R4BL77-F1-model_v4 | Late embryogenesis abundant protein LEA-2 subgroup domain-containing protein | 0.8609 | 30 | 151 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar