F487796

General Info

Members Datasets Scaffolds Average Seq Length
997 263 1994 153

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10463004|Ga0157378_104630042
Length 154
Sequence VKRIHLAAINACAVLVMAGNANAEVTLNSVRVGARDTEALAKFYESAFGLKEVNRLTFPNGVEIFLNFGDNVDTAKTYSSAIFLIIQSEPAAKDTAAHLIFNVTDAAATAAAVKAAGGTMEREPMPFGNTGIVIGIAADPAGNRIELIQRPAQR

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 33.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10463004 3300013297 Bacteria 1260
2 JGI24746J21847_1011932 3300001977 Bacteria 1274
3 Ga0065714_10088727 3300005288 Bacteria 2005
4 Ga0065712_10109759 3300005290 Unclassified 1849
5 Ga0065715_10011352 3300005293 Bacteria 2809
6 Ga0065715_10234587 3300005293 Bacteria 1221
7 Ga0065707_10310514 3300005295 Unclassified 985
8 Ga0070676_10020201 3300005328 Unclassified 3715
9 Ga0070676_10063673 3300005328 Bacteria 2197
10 Ga0070683_100003820 3300005329 Bacteria 12307
11 Ga0070683_100013122 3300005329 Bacteria 7215
12 Ga0070683_100014850 3300005329 Bacteria 6827
13 Ga0070683_100108291 3300005329 Bacteria 2621
14 Ga0070683_100161615 3300005329 Bacteria 2125
15 Ga0070683_100654500 3300005329 Bacteria 1006
16 Ga0070690_100009014 3300005330 Bacteria 5767
17 Ga0070690_100015429 3300005330 Bacteria 4556
18 Ga0070690_100061146 3300005330 Bacteria 2426
19 Ga0070690_100166226 3300005330 Bacteria 1515
20 Ga0070690_101623865 3300005330 Unclassified 524
21 Ga0070670_100003296 3300005331 Bacteria 13358
22 Ga0070670_100004980 3300005331 Bacteria 11175
23 Ga0070670_100017524 3300005331 Bacteria 6146
24 Ga0070670_100032297 3300005331 Unclassified 4508
25 Ga0070670_100224053 3300005331 Bacteria 1636
26 Ga0070670_100866850 3300005331 Bacteria 817
27 Ga0070677_10001490 3300005333 Bacteria 7411
28 Ga0070677_10028179 3300005333 Bacteria 2120
29 Ga0070677_10480990 3300005333 Unclassified 670
30 Ga0068869_100003958 3300005334 Bacteria 9152
31 Ga0068869_100033652 3300005334 Unclassified 3619
32 Ga0068869_100035897 3300005334 Bacteria 3517
33 Ga0068869_100278196 3300005334 Bacteria 1345
34 Ga0068869_100369215 3300005334 Bacteria 1174
35 Ga0068869_100500235 3300005334 Bacteria 1015
36 Ga0068869_100609432 3300005334 Bacteria 923
37 Ga0068869_101020821 3300005334 Unclassified 721
38 Ga0070666_10001783 3300005335 Bacteria 13109
39 Ga0070666_10013165 3300005335 Bacteria 5242
40 Ga0070666_10019258 3300005335 Bacteria 4402
41 Ga0070666_10590373 3300005335 Bacteria 810
42 Ga0070666_10836318 3300005335 Unclassified 679
43 Ga0070666_10896808 3300005335 Unclassified 655
44 Ga0070680_100071737 3300005336 Unclassified 2846
45 Ga0070680_100125652 3300005336 Bacteria 2143
46 Ga0068868_100001436 3300005338 Bacteria 16442
47 Ga0068868_100052545 3300005338 Bacteria 3208
48 Ga0068868_100306057 3300005338 Bacteria 1351
49 Ga0068868_100746758 3300005338 Unclassified 879
50 Ga0070660_100083766 3300005339 Bacteria 2506
51 Ga0070660_100763472 3300005339 Unclassified 812
52 Ga0070689_100010802 3300005340 Bacteria 6525
53 Ga0070689_100100074 3300005340 Bacteria 2293
54 Ga0070689_100211050 3300005340 Viruses 1589
55 Ga0070689_100362450 3300005340 Unclassified 1218
56 Ga0070689_100408738 3300005340 Unclassified 1149
57 Ga0070689_100460162 3300005340 Bacteria 1084
58 Ga0070689_100481302 3300005340 Bacteria 1060
59 Ga0070689_101642406 3300005340 Bacteria 584
60 Ga0070691_10000461 3300005341 Bacteria 15100
61 Ga0070687_100047809 3300005343 Bacteria 2197
62 Ga0070661_100012248 3300005344 Bacteria 5998
63 Ga0070661_100126297 3300005344 Unclassified 1919
64 Ga0070661_100373545 3300005344 Unclassified 1123
65 Ga0070661_100817600 3300005344 Bacteria 765
66 Ga0070669_100003536 3300005353 Bacteria 11272
67 Ga0070669_100050418 3300005353 Bacteria 3040
68 Ga0070669_100089903 3300005353 Unclassified 2301
69 Ga0070669_101236637 3300005353 Unclassified 646
70 Ga0070675_100000718 3300005354 Bacteria 23035
71 Ga0070675_100006739 3300005354 Bacteria 8834
72 Ga0070675_100028050 3300005354 Unclassified 4528
73 Ga0070675_100087697 3300005354 Unclassified 2602
74 Ga0070675_100099830 3300005354 Bacteria 2444
75 Ga0070675_100163401 3300005354 Unclassified 1916
76 Ga0070675_100238891 3300005354 Unclassified 1587
77 Ga0070675_100254805 3300005354 Unclassified 1537
78 Ga0070675_101994907 3300005354 Bacteria 535
79 Ga0070671_100000815 3300005355 Bacteria 22608
80 Ga0070671_100001673 3300005355 Bacteria 16781
81 Ga0070671_100092885 3300005355 Bacteria 2529
82 Ga0070671_100404296 3300005355 Unclassified 1168
83 Ga0070671_100491971 3300005355 Bacteria 1055
84 Ga0070674_100000136 3300005356 Bacteria 33863
85 Ga0070674_100079654 3300005356 Unclassified 2337
86 Ga0070674_100318611 3300005356 Unclassified 1246
87 Ga0070673_100001421 3300005364 Bacteria 13991
88 Ga0070673_100001668 3300005364 Bacteria 13152
89 Ga0070673_100044570 3300005364 Bacteria 3435
90 Ga0070673_100107984 3300005364 Bacteria 2303
91 Ga0070673_100123993 3300005364 Bacteria 2159
92 Ga0070673_100239012 3300005364 Unclassified 1578
93 Ga0070673_101501780 3300005364 Unclassified 635
94 Ga0070688_100016420 3300005365 Bacteria 4233
95 Ga0070688_100039917 3300005365 Bacteria 2874
96 Ga0070688_100044971 3300005365 Bacteria 2726
97 Ga0070688_100069333 3300005365 Unclassified 2251
98 Ga0070688_100320761 3300005365 Unclassified 1126
99 Ga0070659_100021636 3300005366 Bacteria 4901
100 Ga0070659_100176496 3300005366 Bacteria 1752
101 Ga0070659_100196070 3300005366 Bacteria 1661
102 Ga0070659_100531172 3300005366 Unclassified 1005
103 Ga0070667_100000879 3300005367 Bacteria 27735
104 Ga0070667_100006545 3300005367 Bacteria 9683
105 Ga0070667_100771019 3300005367 Unclassified 892
106 Ga0070709_10153902 3300005434 Bacteria 1592
107 Ga0070709_10239363 3300005434 Bacteria 1303
108 Ga0070714_100228534 3300005435 Bacteria 1713
109 Ga0070714_100564125 3300005435 Unclassified 1091
110 Ga0070713_100002206 3300005436 Bacteria 12616
111 Ga0070713_100027183 3300005436 Bacteria 4502
112 Ga0070713_100489036 3300005436 Unclassified 1160
113 Ga0070713_100642978 3300005436 Unclassified 1010
114 Ga0070713_101434393 3300005436 Bacteria 670
115 Ga0070710_10476881 3300005437 Unclassified 850
116 Ga0070701_10009424 3300005438 Bacteria 4277
117 Ga0070701_10045330 3300005438 Unclassified 2256
118 Ga0070701_10367321 3300005438 Bacteria 903
119 Ga0070711_100216866 3300005439 Unclassified 1485
120 Ga0070711_100359885 3300005439 Unclassified 1172
121 Ga0070711_100399066 3300005439 Bacteria 1116
122 Ga0070711_101398542 3300005439 Unclassified 609
123 Ga0070705_100051158 3300005440 Bacteria 2407
124 Ga0070700_100125009 3300005441 Unclassified 1728
125 Ga0070694_100581348 3300005444 Bacteria 900
126 Ga0070708_100678642 3300005445 Unclassified 970
127 Ga0070708_101267198 3300005445 Unclassified 689
128 Ga0070708_101344392 3300005445 Bacteria 667
129 Ga0070678_100036605 3300005456 Bacteria 3437
130 Ga0070678_100071635 3300005456 Bacteria 2595
131 Ga0070678_100197101 3300005456 Bacteria 1659
132 Ga0070678_100566486 3300005456 Bacteria 1010
133 Ga0070678_100594498 3300005456 Unclassified 987
134 Ga0070662_100003010 3300005457 Bacteria 10486
135 Ga0070662_100073012 3300005457 Bacteria 2535
136 Ga0070662_100194198 3300005457 Bacteria 1607
137 Ga0070662_101251742 3300005457 Unclassified 638
138 Ga0070681_10038792 3300005458 Unclassified 4776
139 Ga0070681_10134325 3300005458 Unclassified 2405
140 Ga0070681_10735728 3300005458 Unclassified 903
141 Ga0070681_10741133 3300005458 Unclassified 899
142 Ga0068867_100011487 3300005459 Bacteria 6250
143 Ga0068867_100052703 3300005459 Unclassified 3003
144 Ga0068867_100071750 3300005459 Bacteria 2591
145 Ga0068867_100394111 3300005459 Unclassified 1166
146 Ga0068867_100682960 3300005459 Unclassified 904
147 Ga0070685_10032907 3300005466 Bacteria 2907
148 Ga0070685_10077281 3300005466 Bacteria 1987
149 Ga0070685_10524596 3300005466 Unclassified 842
150 Ga0070698_100528090 3300005471 Bacteria 1119
151 Ga0070679_100001188 3300005530 Bacteria 22870
152 Ga0070679_100324302 3300005530 Unclassified 1489
153 Ga0070679_100771593 3300005530 Unclassified 904
154 Ga0070684_100010259 3300005535 Bacteria 7416
155 Ga0070684_100023432 3300005535 Bacteria 5164
156 Ga0070684_100056132 3300005535 Unclassified 3435
157 Ga0070684_100192334 3300005535 Unclassified 1857
158 Ga0070684_100272839 3300005535 Bacteria 1549
159 Ga0070684_100985587 3300005535 Unclassified 791
160 Ga0070684_101572960 3300005535 Unclassified 620
161 Ga0070697_100727716 3300005536 Unclassified 876
162 Ga0068853_100010223 3300005539 Bacteria 7587
163 Ga0068853_100021030 3300005539 Bacteria 5432
164 Ga0068853_100055586 3300005539 Unclassified 3412
165 Ga0068853_100952804 3300005539 Unclassified 825
166 Ga0070672_100006309 3300005543 Bacteria 7952
167 Ga0070672_100010764 3300005543 Bacteria 6356
168 Ga0070672_100029556 3300005543 Bacteria 4111
169 Ga0070672_100065679 3300005543 Unclassified 2871
170 Ga0070686_100013527 3300005544 Unclassified 4677
171 Ga0070686_100021509 3300005544 Bacteria 3836
172 Ga0070686_100139923 3300005544 Bacteria 1684
173 Ga0070686_100881265 3300005544 Bacteria 727
174 Ga0070693_100151134 3300005547 Bacteria 1471
175 Ga0070693_100174230 3300005547 Unclassified 1380
176 Ga0070693_100442658 3300005547 Bacteria 910
177 Ga0070665_100087924 3300005548 Bacteria 3113
178 Ga0070665_100193801 3300005548 Bacteria 2033
179 Ga0068855_100012045 3300005563 Bacteria 10455
180 Ga0068855_100174888 3300005563 Unclassified 2430
181 Ga0068855_100248563 3300005563 Bacteria 1984
182 Ga0068855_100328950 3300005563 Bacteria 1687
183 Ga0068855_100781860 3300005563 Unclassified 1016
184 Ga0068855_100967147 3300005563 Unclassified 896
185 Ga0070664_100000235 3300005564 Bacteria 39833
186 Ga0070664_100006853 3300005564 Bacteria 9189
187 Ga0070664_100030588 3300005564 Bacteria 4493
188 Ga0070664_100075448 3300005564 Unclassified 2896
189 Ga0070664_100120349 3300005564 Bacteria 2298
190 Ga0070664_100121601 3300005564 Bacteria 2287
191 Ga0070664_100144431 3300005564 Bacteria 2097
192 Ga0070664_100180391 3300005564 Bacteria 1876
193 Ga0070664_100225393 3300005564 Bacteria 1678
194 Ga0068857_100004701 3300005577 Bacteria 11575
195 Ga0068857_100024770 3300005577 Bacteria 5285
196 Ga0068857_100113315 3300005577 Bacteria 2438
197 Ga0068857_100238399 3300005577 Bacteria 1665
198 Ga0068857_100382663 3300005577 Bacteria 1307
199 Ga0068857_100383204 3300005577 Bacteria 1306
200 Ga0068857_100840250 3300005577 Bacteria 878
201 Ga0068857_102118142 3300005577 Unclassified 552
202 Ga0068856_100001921 3300005614 Bacteria 21667
203 Ga0068856_100007110 3300005614 Bacteria 10928
204 Ga0068856_100017150 3300005614 Bacteria 7018
205 Ga0068856_100164252 3300005614 Unclassified 2231
206 Ga0068856_100492255 3300005614 Bacteria 1247
207 Ga0068856_100605397 3300005614 Unclassified 1117
208 Ga0070702_100106147 3300005615 Bacteria 1732
209 Ga0070702_100174271 3300005615 Unclassified 1402
210 Ga0070702_100372154 3300005615 Bacteria 1013
211 Ga0068852_100160148 3300005616 Bacteria 2101
212 Ga0068852_100164184 3300005616 Unclassified 2076
213 Ga0068852_100169912 3300005616 Bacteria 2043
214 Ga0068852_100802981 3300005616 Bacteria 955
215 Ga0068852_101473901 3300005616 Unclassified 703
216 Ga0068852_101678028 3300005616 Bacteria 658
217 Ga0068859_100049791 3300005617 Bacteria 4208
218 Ga0068859_100051573 3300005617 Bacteria 4136
219 Ga0068859_100062214 3300005617 Bacteria 3762
220 Ga0068859_100082479 3300005617 Bacteria 3258
221 Ga0068859_100102333 3300005617 Unclassified 2922
222 Ga0068859_100166241 3300005617 Bacteria 2286
223 Ga0068859_100226379 3300005617 Bacteria 1958
224 Ga0068859_100562054 3300005617 Archaea 1235
225 Ga0068859_101314596 3300005617 Bacteria 797
226 Ga0068864_100001078 3300005618 Bacteria 22915
227 Ga0068864_100011161 3300005618 Bacteria 7425
228 Ga0068864_100094603 3300005618 Bacteria 2641
229 Ga0068864_100097294 3300005618 Bacteria 2606
230 Ga0068864_100100023 3300005618 Bacteria 2570
231 Ga0068864_100137681 3300005618 Bacteria 2200
232 Ga0068864_100259847 3300005618 Bacteria 1615
233 Ga0068864_100323835 3300005618 Bacteria 1448
234 Ga0068864_100924939 3300005618 Unclassified 862
235 Ga0068866_10505484 3300005718 Unclassified 800
236 Ga0068866_10523886 3300005718 Unclassified 788
237 Ga0068861_100017953 3300005719 Bacteria 5031
238 Ga0068861_100086653 3300005719 Bacteria 2462
239 Ga0068861_100266423 3300005719 Unclassified 1469
240 Ga0068870_10016938 3300005840 Bacteria 3495
241 Ga0068870_10041555 3300005840 Unclassified 2389
242 Ga0068870_10065896 3300005840 Bacteria 1960
243 Ga0068870_10296514 3300005840 Bacteria 1019
244 Ga0068870_11293681 3300005840 Unclassified 531
245 Ga0068863_100000203 3300005841 Bacteria 63485
246 Ga0068863_100005293 3300005841 Bacteria 12739
247 Ga0068863_100052109 3300005841 Unclassified 3879
248 Ga0068863_100144428 3300005841 Bacteria 2275
249 Ga0068863_101289967 3300005841 Bacteria 737
250 Ga0068858_100004214 3300005842 Bacteria 14160
251 Ga0068858_100006302 3300005842 Bacteria 11552
252 Ga0068858_100014894 3300005842 Bacteria 7316
253 Ga0068858_100063106 3300005842 Bacteria 3428
254 Ga0068858_100103296 3300005842 Unclassified 2658
255 Ga0068858_100150728 3300005842 Bacteria 2186
256 Ga0068858_100179066 3300005842 Bacteria 2001
257 Ga0068858_100241994 3300005842 Bacteria 1712
258 Ga0068858_100290285 3300005842 Bacteria 1559
259 Ga0068858_100417231 3300005842 Bacteria 1290
260 Ga0068858_100646476 3300005842 Unclassified 1027
261 Ga0068858_101247594 3300005842 Unclassified 731
262 Ga0068858_101709800 3300005842 Unclassified 621
263 Ga0068860_100005469 3300005843 Bacteria 12874
264 Ga0068860_100110668 3300005843 Bacteria 2625
265 Ga0068860_100160581 3300005843 Unclassified 2167
266 Ga0068860_100172597 3300005843 Unclassified 2089
267 Ga0068860_100227840 3300005843 Unclassified 1811
268 Ga0068860_100232148 3300005843 Bacteria 1793
269 Ga0068860_100686454 3300005843 Unclassified 1033
270 Ga0068860_101496474 3300005843 Unclassified 697
271 Ga0068860_101574871 3300005843 Bacteria 679
272 Ga0068862_100098004 3300005844 Bacteria 2560
273 Ga0068862_100296294 3300005844 Unclassified 1487
274 Ga0068862_100395918 3300005844 Bacteria 1291
275 Ga0068862_100656361 3300005844 Unclassified 1012
276 Ga0068862_101089753 3300005844 Bacteria 793
277 Ga0068862_101326739 3300005844 Unclassified 721
278 Ga0070717_11172068 3300006028 Viruses 699
279 Ga0097621_100001830 3300006237 Bacteria 14576
280 Ga0097621_100002084 3300006237 Bacteria 13694
281 Ga0097621_100029776 3300006237 Bacteria 4315
282 Ga0097621_100058384 3300006237 Bacteria 3157
283 Ga0097621_100061435 3300006237 Bacteria 3082
284 Ga0097621_100064786 3300006237 Bacteria 3006
285 Ga0097621_100090394 3300006237 Bacteria 2562
286 Ga0097621_100133519 3300006237 Bacteria 2115
287 Ga0097621_100155547 3300006237 Bacteria 1962
288 Ga0097621_100183261 3300006237 Bacteria 1810
289 Ga0097621_100269127 3300006237 Unclassified 1497
290 Ga0097621_100969983 3300006237 Bacteria 794
291 Ga0097621_101029387 3300006237 Unclassified 771
292 Ga0068871_100008507 3300006358 Bacteria 7379
293 Ga0068871_100058391 3300006358 Bacteria 3141
294 Ga0068871_100108220 3300006358 Bacteria 2336
295 Ga0068871_100151994 3300006358 Bacteria 1975
296 Ga0068871_100183934 3300006358 Bacteria 1797
297 Ga0068871_100211209 3300006358 Bacteria 1679
298 Ga0068871_100635014 3300006358 Bacteria 974
299 Ga0068871_100812072 3300006358 Unclassified 863
300 Ga0068871_101062113 3300006358 Bacteria 756
301 Ga0075428_100000671 3300006844 Bacteria 35135
302 Ga0075428_100539933 3300006844 Unclassified 1247
303 Ga0075430_100002532 3300006846 Bacteria 15234
304 Ga0075431_100000502 3300006847 Bacteria 32691
305 Ga0075433_10001202 3300006852 Bacteria 18854
306 Ga0075433_10011307 3300006852 Bacteria 7183
307 Ga0075433_10441037 3300006852 Unclassified 1148
308 Ga0075433_10678203 3300006852 Unclassified 903
309 Ga0075434_100004206 3300006871 Bacteria 12902
310 Ga0075434_100005753 3300006871 Bacteria 11323
311 Ga0075434_100192151 3300006871 Bacteria 2062
312 Ga0075434_100579625 3300006871 Unclassified 1141
313 Ga0075429_100000848 3300006880 Bacteria 24008
314 Ga0075429_100082199 3300006880 Bacteria 2808
315 Ga0075429_100121463 3300006880 Unclassified 2283
316 Ga0075429_100134840 3300006880 Bacteria 2161
317 Ga0068865_100009472 3300006881 Bacteria 6041
318 Ga0068865_100032041 3300006881 Bacteria 3508
319 Ga0068865_100064136 3300006881 Bacteria 2585
320 Ga0068865_100186804 3300006881 Bacteria 1600
321 Ga0068865_101045187 3300006881 Unclassified 717
322 Ga0068865_101568618 3300006881 Unclassified 591
323 Ga0075436_100081982 3300006914 Bacteria 2237
324 Ga0097620_100049788 3300006931 Bacteria 4208
325 Ga0097620_100051573 3300006931 Bacteria 4136
326 Ga0097620_100062222 3300006931 Bacteria 3762
327 Ga0097620_100082480 3300006931 Bacteria 3258
328 Ga0097620_100102334 3300006931 Unclassified 2922
329 Ga0097620_100166227 3300006931 Bacteria 2286
330 Ga0097620_100226375 3300006931 Bacteria 1958
331 Ga0097620_100562055 3300006931 Archaea 1235
332 Ga0097620_100811675 3300006931 Unclassified 1023
333 Ga0097620_100867816 3300006931 Unclassified 988
334 Ga0097620_101314584 3300006931 Bacteria 797
335 Ga0075435_100069532 3300007076 Bacteria 2871
336 Ga0075435_100100364 3300007076 Bacteria 2398
337 Ga0099795_10388181 3300007788 Unclassified 632
338 Ga0105240_10001704 3300009093 Bacteria 37205
339 Ga0105240_10018605 3300009093 Bacteria 9316
340 Ga0105240_10042104 3300009093 Bacteria 5822
341 Ga0105240_10093132 3300009093 Unclassified 3678
342 Ga0105240_10377665 3300009093 Bacteria 1601
343 Ga0111539_10002873 3300009094 Bacteria 22857
344 Ga0111539_10020076 3300009094 Bacteria 8231
345 Ga0111539_10029192 3300009094 Bacteria 6723
346 Ga0111539_10186592 3300009094 Bacteria 2421
347 Ga0111539_10329487 3300009094 Unclassified 1777
348 Ga0111539_10350980 3300009094 Unclassified 1717
349 Ga0111539_10593033 3300009094 Unclassified 1290
350 Ga0105245_10000490 3300009098 Bacteria 36264
351 Ga0105245_10000522 3300009098 Bacteria 35144
352 Ga0105245_10004914 3300009098 Bacteria 11762
353 Ga0105245_10016271 3300009098 Bacteria 6485
354 Ga0105245_10027430 3300009098 Bacteria 5017
355 Ga0105245_10087626 3300009098 Unclassified 2858
356 Ga0105245_10467267 3300009098 Bacteria 1273
357 Ga0105245_10539698 3300009098 Unclassified 1187
358 Ga0105245_10695053 3300009098 Bacteria 1050
359 Ga0105245_11121376 3300009098 Bacteria 833
360 Ga0105247_10007933 3300009101 Bacteria 6490
361 Ga0105247_10011747 3300009101 Bacteria 5268
362 Ga0105247_10484155 3300009101 Bacteria 898
363 Ga0114129_10122424 3300009147 Bacteria 3579
364 Ga0105243_10053747 3300009148 Bacteria 3195
365 Ga0105243_10210299 3300009148 Bacteria 1712
366 Ga0105243_10948610 3300009148 Bacteria 859
367 Ga0105241_10002584 3300009174 Bacteria 13581
368 Ga0105241_10010673 3300009174 Bacteria 6738
369 Ga0105241_10103271 3300009174 Unclassified 2269
370 Ga0105241_10501724 3300009174 Unclassified 1082
371 Ga0105242_10005159 3300009176 Bacteria 10077
372 Ga0105242_10009827 3300009176 Bacteria 7329
373 Ga0105242_10012044 3300009176 Bacteria 6655
374 Ga0105242_10017966 3300009176 Bacteria 5524
375 Ga0105242_10029204 3300009176 Unclassified 4395
376 Ga0105242_10041982 3300009176 Bacteria 3691
377 Ga0105242_10054066 3300009176 Unclassified 3281
378 Ga0105242_10122919 3300009176 Unclassified 2230
379 Ga0105242_10308842 3300009176 Bacteria 1446
380 Ga0105242_10569550 3300009176 Bacteria 1089
381 Ga0105242_11242678 3300009176 Unclassified 766
382 Ga0105242_12939085 3300009176 Unclassified 527
383 Ga0105248_10000321 3300009177 Bacteria 56694
384 Ga0105248_10003317 3300009177 Bacteria 17871
385 Ga0105248_10020314 3300009177 Bacteria 7359
386 Ga0105248_10055910 3300009177 Bacteria 4427
387 Ga0105248_10066406 3300009177 Bacteria 4050
388 Ga0105248_10109309 3300009177 Unclassified 3117
389 Ga0105248_10116213 3300009177 Bacteria 3017
390 Ga0105248_10116594 3300009177 Unclassified 3012
391 Ga0105248_10116612 3300009177 Unclassified 3012
392 Ga0105248_10357496 3300009177 Bacteria 1644
393 Ga0105248_10402807 3300009177 Bacteria 1540
394 Ga0105248_10420054 3300009177 Unclassified 1506
395 Ga0105248_10516600 3300009177 Unclassified 1347
396 Ga0105248_10914857 3300009177 Unclassified 990
397 Ga0105248_11840596 3300009177 Bacteria 687
398 Ga0105248_12300244 3300009177 Unclassified 614
399 Ga0105237_10002911 3300009545 Bacteria 20738
400 Ga0105237_10022038 3300009545 Bacteria 6538
401 Ga0105237_10177892 3300009545 Unclassified 2128
402 Ga0105238_10002214 3300009551 Bacteria 19607
403 Ga0105238_10006206 3300009551 Bacteria 11867
404 Ga0105238_10040920 3300009551 Unclassified 4695
405 Ga0105238_10052733 3300009551 Unclassified 4088
406 Ga0105238_10078375 3300009551 Unclassified 3294
407 Ga0105249_10027034 3300009553 Bacteria 5176
408 Ga0105249_10036764 3300009553 Bacteria 4443
409 Ga0105249_11131549 3300009553 Bacteria 853
410 Ga0105249_12354371 3300009553 Unclassified 605
411 Ga0105239_10003103 3300010375 Bacteria 20606
412 Ga0105239_10030074 3300010375 Bacteria 5972
413 Ga0105239_10058815 3300010375 Bacteria 4218
414 Ga0105239_10242621 3300010375 Unclassified 2022
415 Ga0105246_10009739 3300011119 Bacteria 5923
416 Ga0105246_10030401 3300011119 Bacteria 3567
417 Ga0105246_10077096 3300011119 Bacteria 2363
418 Ga0105246_10762881 3300011119 Bacteria 854
419 Ga0105246_10789595 3300011119 Bacteria 841
420 Ga0105246_12039198 3300011119 Bacteria 554
421 Ga0157371_10402007 3300013102 Bacteria 1002
422 Ga0157371_10877454 3300013102 Unclassified 679
423 Ga0157370_10016223 3300013104 Bacteria 7550
424 Ga0157370_10041402 3300013104 Bacteria 4444
425 Ga0157369_10000876 3300013105 Bacteria 38431
426 Ga0157369_10014635 3300013105 Bacteria 8850
427 Ga0157369_10140840 3300013105 Unclassified 2552
428 Ga0157374_10005784 3300013296 Bacteria 10442
429 Ga0157374_10115853 3300013296 Bacteria 2582
430 Ga0157374_10252003 3300013296 Unclassified 1737
431 Ga0157374_10433913 3300013296 Bacteria 1313
432 Ga0157374_10505169 3300013296 Bacteria 1214
433 Ga0157378_10000308 3300013297 Bacteria 47674
434 Ga0157378_10014594 3300013297 Bacteria 6878
435 Ga0157378_10100836 3300013297 Bacteria 2636
436 Ga0157378_10217603 3300013297 Bacteria 1814
437 Ga0157378_10523663 3300013297 Unclassified 1187
438 Ga0163162_10003959 3300013306 Bacteria 14210
439 Ga0163162_10223272 3300013306 Unclassified 2014
440 Ga0163162_10660136 3300013306 Bacteria 1169
441 Ga0163162_11241604 3300013306 Bacteria 846
442 Ga0157372_10003294 3300013307 Bacteria 17440
443 Ga0157372_10004833 3300013307 Bacteria 14326
444 Ga0157372_10062346 3300013307 Bacteria 4177
445 Ga0157372_10114337 3300013307 Bacteria 3094
446 Ga0157372_10185733 3300013307 Unclassified 2407
447 Ga0157372_10353338 3300013307 Bacteria 1712
448 Ga0157375_10000347 3300013308 Bacteria 41857
449 Ga0157375_10003107 3300013308 Bacteria 14416
450 Ga0157375_10008198 3300013308 Bacteria 9150
451 Ga0157375_10021880 3300013308 Bacteria 5876
452 Ga0157375_10057166 3300013308 Bacteria 3855
453 Ga0157375_10066427 3300013308 Unclassified 3601
454 Ga0157375_10106500 3300013308 Unclassified 2895
455 Ga0157375_10252728 3300013308 Unclassified 1923
456 Ga0157375_10274903 3300013308 Bacteria 1847
457 Ga0157375_10363143 3300013308 Bacteria 1614
458 Ga0157375_10396524 3300013308 Unclassified 1547
459 Ga0157375_10758144 3300013308 Unclassified 1121
460 Ga0157375_11006411 3300013308 Bacteria 973
461 Ga0157375_11138633 3300013308 Unclassified 914
462 Ga0157375_11370937 3300013308 Bacteria 833
463 Ga0163163_10000939 3300014325 Bacteria 24726
464 Ga0163163_10011258 3300014325 Bacteria 8106
465 Ga0163163_10033586 3300014325 Unclassified 4964
466 Ga0163163_10038038 3300014325 Bacteria 4685
467 Ga0163163_10049213 3300014325 Bacteria 4147
468 Ga0163163_10052171 3300014325 Bacteria 4034
469 Ga0163163_10081373 3300014325 Bacteria 3240
470 Ga0163163_10176582 3300014325 Bacteria 2183
471 Ga0163163_10320310 3300014325 Bacteria 1604
472 Ga0163163_11499709 3300014325 Bacteria 736
473 Ga0157380_10000747 3300014326 Bacteria 20267
474 Ga0157380_10004399 3300014326 Bacteria 9766
475 Ga0157380_10020826 3300014326 Bacteria 4909
476 Ga0157380_11652493 3300014326 Bacteria 697
477 Ga0157377_10006322 3300014745 Bacteria 5640
478 Ga0157377_10068537 3300014745 Bacteria 2045
479 Ga0157377_10130884 3300014745 Unclassified 1532
480 Ga0157377_10204645 3300014745 Bacteria 1255
481 Ga0157377_10644502 3300014745 Unclassified 762
482 Ga0157379_10000069 3300014968 Bacteria 64939
483 Ga0157379_10033202 3300014968 Unclassified 4602
484 Ga0157379_10059158 3300014968 Bacteria 3426
485 Ga0157379_10131702 3300014968 Unclassified 2251
486 Ga0157379_10346451 3300014968 Unclassified 1359
487 Ga0157379_11910660 3300014968 Unclassified 585
488 Ga0157376_10055728 3300014969 Bacteria 3299
489 Ga0157376_10083130 3300014969 Bacteria 2753
490 Ga0157376_10095614 3300014969 Bacteria 2584
491 Ga0157376_10270348 3300014969 Bacteria 1596
492 Ga0157376_10300089 3300014969 Unclassified 1520
493 Ga0157376_10323717 3300014969 Unclassified 1466
494 Ga0157376_10402006 3300014969 Unclassified 1325
495 Ga0157376_10418717 3300014969 Bacteria 1299
496 Ga0157376_10540085 3300014969 Unclassified 1152
497 Ga0157376_11120896 3300014969 Bacteria 813
498 Ga0163161_10015899 3300017792 Bacteria 5250
499 Ga0163161_10061887 3300017792 Bacteria 2726
500 Ga0213876_10124532 3300021384 Bacteria 1369
501 Ga0213876_10149847 3300021384 Unclassified 1240
502 Ga0213876_10367694 3300021384 Unclassified 765
503 Ga0213875_10003847 3300021388 Bacteria 8428
504 Ga0213875_10019944 3300021388 Unclassified 3220
505 Ga0213875_10030113 3300021388 Unclassified 2571
506 Ga0213875_10075187 3300021388 Unclassified 1576
507 Ga0207697_10000680 3300025315 Bacteria 19332
508 Ga0207697_10020509 3300025315 Bacteria 2705
509 Ga0207656_10017509 3300025321 Unclassified 2809
510 Ga0207682_10002289 3300025893 Bacteria 8626
511 Ga0207682_10007390 3300025893 Bacteria 4379
512 Ga0207682_10072993 3300025893 Bacteria 1457
513 Ga0207642_10035791 3300025899 Unclassified 2125
514 Ga0207642_10639791 3300025899 Unclassified 665
515 Ga0207710_10010415 3300025900 Unclassified 3915
516 Ga0207710_10243436 3300025900 Bacteria 898
517 Ga0207688_10000268 3300025901 Bacteria 23725
518 Ga0207688_10226004 3300025901 Unclassified 1129
519 Ga0207680_10004745 3300025903 Bacteria 6469
520 Ga0207680_10042787 3300025903 Bacteria 2652
521 Ga0207680_10707935 3300025903 Unclassified 722
522 Ga0207699_10215083 3300025906 Bacteria 1309
523 Ga0207699_10352261 3300025906 Bacteria 1039
524 Ga0207645_10002877 3300025907 Bacteria 13319
525 Ga0207645_10012264 3300025907 Bacteria 5822
526 Ga0207645_10065050 3300025907 Unclassified 2330
527 Ga0207645_10211746 3300025907 Bacteria 1277
528 Ga0207643_10000708 3300025908 Bacteria 20702
529 Ga0207643_10011490 3300025908 Bacteria 4782
530 Ga0207643_10022495 3300025908 Bacteria 3471
531 Ga0207643_10055257 3300025908 Bacteria 2258
532 Ga0207643_10086373 3300025908 Unclassified 1823
533 Ga0207705_10238597 3300025909 Bacteria 1384
534 Ga0207654_10002411 3300025911 Bacteria 9551
535 Ga0207654_10004960 3300025911 Bacteria 6729
536 Ga0207654_10192375 3300025911 Bacteria 1338
537 Ga0207654_10423316 3300025911 Unclassified 930
538 Ga0207707_10000635 3300025912 Bacteria 34780
539 Ga0207707_10395146 3300025912 Bacteria 1188
540 Ga0207707_10604367 3300025912 Unclassified 928
541 Ga0207695_10002273 3300025913 Bacteria 28785
542 Ga0207695_10005994 3300025913 Bacteria 15896
543 Ga0207695_10201629 3300025913 Bacteria 1903
544 Ga0207695_10262397 3300025913 Bacteria 1625
545 Ga0207695_10302820 3300025913 Unclassified 1490
546 Ga0207695_11043779 3300025913 Unclassified 697
547 Ga0207695_11155704 3300025913 Unclassified 654
548 Ga0207671_10004044 3300025914 Bacteria 14220
549 Ga0207671_10027866 3300025914 Unclassified 4222
550 Ga0207663_10316061 3300025916 Unclassified 1172
551 Ga0207660_10018851 3300025917 Unclassified 4607
552 Ga0207662_10303829 3300025918 Bacteria 1061
553 Ga0207662_10318844 3300025918 Unclassified 1037
554 Ga0207657_10094716 3300025919 Bacteria 2486
555 Ga0207649_10127973 3300025920 Bacteria 1721
556 Ga0207649_10178096 3300025920 Unclassified 1486
557 Ga0207649_10572987 3300025920 Bacteria 866
558 Ga0207649_10587052 3300025920 Bacteria 856
559 Ga0207652_10004226 3300025921 Bacteria 11716
560 Ga0207652_11040624 3300025921 Bacteria 718
561 Ga0207681_10024487 3300025923 Bacteria 3875
562 Ga0207681_10092192 3300025923 Unclassified 2165
563 Ga0207681_10358030 3300025923 Unclassified 1169
564 Ga0207681_10669220 3300025923 Unclassified 861
565 Ga0207694_10006135 3300025924 Bacteria 9181
566 Ga0207694_10006183 3300025924 Bacteria 9144
567 Ga0207694_10021682 3300025924 Unclassified 4868
568 Ga0207694_10049781 3300025924 Bacteria 3243
569 Ga0207694_10064694 3300025924 Bacteria 2850
570 Ga0207694_10789128 3300025924 Unclassified 802
571 Ga0207650_10000669 3300025925 Bacteria 26940
572 Ga0207650_10014493 3300025925 Bacteria 5477
573 Ga0207650_10021187 3300025925 Bacteria 4595
574 Ga0207650_10026622 3300025925 Unclassified 4127
575 Ga0207659_10009983 3300025926 Bacteria 5946
576 Ga0207659_10021620 3300025926 Bacteria 4274
577 Ga0207659_10145347 3300025926 Bacteria 1846
578 Ga0207659_10165422 3300025926 Bacteria 1741
579 Ga0207659_10172113 3300025926 Bacteria 1709
580 Ga0207687_10001267 3300025927 Bacteria 17279
581 Ga0207687_10001373 3300025927 Bacteria 16634
582 Ga0207687_10006349 3300025927 Bacteria 7812
583 Ga0207687_10010444 3300025927 Bacteria 6066
584 Ga0207687_10024622 3300025927 Bacteria 4023
585 Ga0207687_10036743 3300025927 Unclassified 3337
586 Ga0207687_10641245 3300025927 Unclassified 898
587 Ga0207687_10680019 3300025927 Bacteria 872
588 Ga0207687_10699494 3300025927 Unclassified 860
589 Ga0207700_10025932 3300025928 Bacteria 4080
590 Ga0207700_10041492 3300025928 Unclassified 3367
591 Ga0207700_10056548 3300025928 Bacteria 2954
592 Ga0207700_10118778 3300025928 Bacteria 2140
593 Ga0207700_10123579 3300025928 Bacteria 2102
594 Ga0207700_10763668 3300025928 Unclassified 864
595 Ga0207664_10112471 3300025929 Bacteria 2267
596 Ga0207664_10492852 3300025929 Unclassified 1097
597 Ga0207644_10010085 3300025931 Bacteria 6222
598 Ga0207644_10018210 3300025931 Bacteria 4749
599 Ga0207644_10613032 3300025931 Bacteria 904
600 Ga0207690_10046273 3300025932 Bacteria 2881
601 Ga0207690_10161180 3300025932 Bacteria 1672
602 Ga0207690_10387051 3300025932 Bacteria 1112
603 Ga0207706_10026543 3300025933 Bacteria 5184
604 Ga0207706_10028531 3300025933 Bacteria 4984
605 Ga0207706_10171176 3300025933 Bacteria 1908
606 Ga0207706_10253596 3300025933 Bacteria 1536
607 Ga0207686_10005592 3300025934 Bacteria 6738
608 Ga0207686_10026596 3300025934 Unclassified 3377
609 Ga0207686_10040325 3300025934 Unclassified 2838
610 Ga0207686_10075747 3300025934 Unclassified 2179
611 Ga0207686_10140532 3300025934 Bacteria 1668
612 Ga0207686_10212577 3300025934 Bacteria 1391
613 Ga0207686_10243997 3300025934 Bacteria 1309
614 Ga0207686_10498818 3300025934 Unclassified 944
615 Ga0207686_10528170 3300025934 Bacteria 919
616 Ga0207686_10769060 3300025934 Unclassified 770
617 Ga0207709_10008144 3300025935 Bacteria 5804
618 Ga0207709_10219872 3300025935 Bacteria 1369
619 Ga0207670_10040975 3300025936 Bacteria 3043
620 Ga0207670_10091049 3300025936 Bacteria 2156
621 Ga0207670_10112716 3300025936 Bacteria 1963
622 Ga0207670_10255574 3300025936 Bacteria 1356
623 Ga0207670_10261196 3300025936 Bacteria 1342
624 Ga0207670_10326963 3300025936 Bacteria 1208
625 Ga0207670_10335117 3300025936 Unclassified 1194
626 Ga0207670_11063657 3300025936 Unclassified 682
627 Ga0207669_10028286 3300025937 Bacteria 3082
628 Ga0207669_10032274 3300025937 Bacteria 2939
629 Ga0207669_10475972 3300025937 Unclassified 994
630 Ga0207669_10533619 3300025937 Unclassified 944
631 Ga0207704_10006007 3300025938 Bacteria 5628
632 Ga0207704_10022147 3300025938 Bacteria 3398
633 Ga0207704_10034022 3300025938 Bacteria 2905
634 Ga0207704_10038267 3300025938 Bacteria 2780
635 Ga0207704_10126208 3300025938 Unclassified 1762
636 Ga0207704_10180555 3300025938 Bacteria 1525
637 Ga0207704_10631354 3300025938 Unclassified 880
638 Ga0207704_10644244 3300025938 Unclassified 872
639 Ga0207691_10000562 3300025940 Bacteria 37130
640 Ga0207691_10001885 3300025940 Bacteria 20498
641 Ga0207691_10080977 3300025940 Unclassified 2919
642 Ga0207691_10091658 3300025940 Unclassified 2723
643 Ga0207691_10113159 3300025940 Bacteria 2412
644 Ga0207691_10126468 3300025940 Bacteria 2261
645 Ga0207711_10001792 3300025941 Bacteria 19659
646 Ga0207711_10003178 3300025941 Bacteria 14324
647 Ga0207711_10008497 3300025941 Bacteria 8590
648 Ga0207711_10016304 3300025941 Bacteria 6172
649 Ga0207711_10029831 3300025941 Bacteria 4601
650 Ga0207711_10084682 3300025941 Bacteria 2776
651 Ga0207711_10201454 3300025941 Bacteria 1816
652 Ga0207711_10236279 3300025941 Bacteria 1675
653 Ga0207711_10299510 3300025941 Unclassified 1483
654 Ga0207711_10300216 3300025941 Unclassified 1481
655 Ga0207711_10652017 3300025941 Bacteria 982
656 Ga0207711_10849519 3300025941 Unclassified 849
657 Ga0207711_11648641 3300025941 Bacteria 585
658 Ga0207689_10003413 3300025942 Bacteria 14512
659 Ga0207689_10010340 3300025942 Bacteria 8039
660 Ga0207689_10038343 3300025942 Bacteria 3969
661 Ga0207689_10093831 3300025942 Bacteria 2465
662 Ga0207689_10201546 3300025942 Bacteria 1643
663 Ga0207689_10297012 3300025942 Bacteria 1339
664 Ga0207661_10005767 3300025944 Bacteria 8730
665 Ga0207661_10061986 3300025944 Bacteria 3024
666 Ga0207661_10062203 3300025944 Bacteria 3019
667 Ga0207661_10205014 3300025944 Bacteria 1735
668 Ga0207661_10221553 3300025944 Bacteria 1672
669 Ga0207661_11033166 3300025944 Unclassified 757
670 Ga0207679_10001709 3300025945 Bacteria 13694
671 Ga0207679_10007555 3300025945 Bacteria 6900
672 Ga0207679_10015089 3300025945 Bacteria 5095
673 Ga0207679_10032416 3300025945 Bacteria 3668
674 Ga0207679_10113247 3300025945 Bacteria 2145
675 Ga0207679_10115142 3300025945 Bacteria 2130
676 Ga0207679_10219413 3300025945 Unclassified 1599
677 Ga0207679_11417834 3300025945 Unclassified 637
678 Ga0207667_10002906 3300025949 Bacteria 21279
679 Ga0207667_10008651 3300025949 Bacteria 12071
680 Ga0207667_10017758 3300025949 Bacteria 8002
681 Ga0207667_10215396 3300025949 Bacteria 1968
682 Ga0207667_10321695 3300025949 Unclassified 1580
683 Ga0207651_10025209 3300025960 Bacteria 3694
684 Ga0207651_10057208 3300025960 Bacteria 2688
685 Ga0207651_10082478 3300025960 Unclassified 2321
686 Ga0207651_10221699 3300025960 Bacteria 1529
687 Ga0207651_10401136 3300025960 Bacteria 1166
688 Ga0207651_10518741 3300025960 Bacteria 1032
689 Ga0207712_10031838 3300025961 Unclassified 3556
690 Ga0207712_10168242 3300025961 Unclassified 1711
691 Ga0207668_10028073 3300025972 Bacteria 3675
692 Ga0207668_10761071 3300025972 Unclassified 855
693 Ga0207668_10770374 3300025972 Unclassified 850
694 Ga0207658_10006244 3300025986 Bacteria 8143
695 Ga0207658_10012202 3300025986 Bacteria 5864
696 Ga0207658_10543745 3300025986 Bacteria 1039
697 Ga0207658_11149168 3300025986 Bacteria 710
698 Ga0207658_11306128 3300025986 Unclassified 663
699 Ga0207677_10012860 3300026023 Bacteria 4832
700 Ga0207677_10122534 3300026023 Bacteria 1959
701 Ga0207677_11591547 3300026023 Unclassified 605
702 Ga0207703_10009873 3300026035 Bacteria 7487
703 Ga0207703_10053354 3300026035 Bacteria 3286
704 Ga0207703_10092763 3300026035 Bacteria 2542
705 Ga0207703_10149084 3300026035 Bacteria 2038
706 Ga0207703_10173058 3300026035 Unclassified 1900
707 Ga0207703_10192558 3300026035 Bacteria 1807
708 Ga0207703_10197336 3300026035 Unclassified 1786
709 Ga0207703_10278377 3300026035 Unclassified 1518
710 Ga0207703_10369674 3300026035 Unclassified 1324
711 Ga0207703_10461619 3300026035 Bacteria 1188
712 Ga0207703_10581362 3300026035 Bacteria 1058
713 Ga0207703_11058671 3300026035 Unclassified 779
714 Ga0207703_11395150 3300026035 Unclassified 674
715 Ga0207703_11476789 3300026035 Unclassified 654
716 Ga0207639_10012687 3300026041 Bacteria 5876
717 Ga0207639_10023802 3300026041 Unclassified 4425
718 Ga0207639_10226952 3300026041 Bacteria 1616
719 Ga0207678_10053034 3300026067 Bacteria 3496
720 Ga0207708_10021776 3300026075 Bacteria 4837
721 Ga0207708_10083182 3300026075 Unclassified 2460
722 Ga0207702_10008257 3300026078 Bacteria 8799
723 Ga0207702_10009009 3300026078 Bacteria 8403
724 Ga0207702_10068042 3300026078 Unclassified 3059
725 Ga0207702_10342219 3300026078 Bacteria 1429
726 Ga0207702_10349206 3300026078 Bacteria 1415
727 Ga0207641_10001413 3300026088 Bacteria 23683
728 Ga0207641_10075407 3300026088 Bacteria 2912
729 Ga0207641_10079521 3300026088 Bacteria 2842
730 Ga0207641_10080625 3300026088 Unclassified 2824
731 Ga0207648_10004726 3300026089 Bacteria 13912
732 Ga0207648_10040801 3300026089 Bacteria 4077
733 Ga0207648_10059754 3300026089 Unclassified 3325
734 Ga0207648_10171259 3300026089 Bacteria 1919
735 Ga0207648_10769211 3300026089 Bacteria 895
736 Ga0207648_10924021 3300026089 Bacteria 816
737 Ga0207676_10038566 3300026095 Unclassified 3648
738 Ga0207676_10052268 3300026095 Bacteria 3193
739 Ga0207676_10059984 3300026095 Bacteria 3006
740 Ga0207676_10282973 3300026095 Bacteria 1506
741 Ga0207676_11111832 3300026095 Unclassified 781
742 Ga0207674_10000657 3300026116 Bacteria 44932
743 Ga0207674_10014434 3300026116 Bacteria 8726
744 Ga0207674_10021150 3300026116 Bacteria 7013
745 Ga0207674_10413005 3300026116 Unclassified 1304
746 Ga0207674_10485023 3300026116 Bacteria 1195
747 Ga0207674_10622117 3300026116 Bacteria 1043
748 Ga0207675_100013958 3300026118 Bacteria 7489
749 Ga0207675_100093440 3300026118 Unclassified 2829
750 Ga0207675_100227230 3300026118 Unclassified 1800
751 Ga0207675_100324177 3300026118 Bacteria 1504
752 Ga0207675_100387380 3300026118 Bacteria 1375
753 Ga0207683_10042732 3300026121 Bacteria 3959
754 Ga0207683_10067607 3300026121 Bacteria 3153
755 Ga0207683_10245443 3300026121 Bacteria 1633
756 Ga0207683_10357595 3300026121 Bacteria 1341
757 Ga0207683_10426451 3300026121 Bacteria 1222
758 Ga0207683_10523042 3300026121 Unclassified 1096
759 Ga0207683_10788529 3300026121 Bacteria 882
760 Ga0207683_11125553 3300026121 Unclassified 728
761 Ga0207698_10048812 3300026142 Unclassified 3216
762 Ga0207698_10218529 3300026142 Bacteria 1720
763 Ga0207698_10904257 3300026142 Bacteria 890
764 Ga0207698_10993898 3300026142 Unclassified 849
765 Ga0207698_11560071 3300026142 Unclassified 676
766 Ga0207428_10064965 3300027907 Bacteria 2880
767 Ga0268266_10019693 3300028379 Bacteria 5750
768 Ga0268265_10108753 3300028380 Bacteria 2258
769 Ga0268265_10118832 3300028380 Unclassified 2174
770 Ga0268265_10338703 3300028380 Unclassified 1369
771 Ga0268265_10914844 3300028380 Unclassified 862
772 Ga0268265_11079732 3300028380 Bacteria 796
773 Ga0268264_10011988 3300028381 Bacteria 7139
774 Ga0268264_10131783 3300028381 Bacteria 2217
775 Ga0268264_10229241 3300028381 Unclassified 1714
776 Ga0268264_10329445 3300028381 Unclassified 1446
777 Ga0268264_10409493 3300028381 Unclassified 1305
778 Ga0268264_10457519 3300028381 Bacteria 1238
779 Ga0268264_11009834 3300028381 Bacteria 839
780 Ga0265338_10103399 3300028800 Bacteria 2314
781 Ga0265316_10873973 3300031344 Unclassified 629
782 Ga0265313_10001183 3300031595 Bacteria 24958
783 Ga0265314_10000503 3300031711 Bacteria 50401
784 Ga0265314_10171977 3300031711 Unclassified 1307
785 Ga0373928_0024123 3300035084 Unclassified 1302
786 Ga0373934_0005371 3300035086 Bacteria 4746
787 Ga0373934_0007079 3300035086 Bacteria 4163
788 Ga0373932_0127083 3300035112 Bacteria 856
789 Ga0373936_0141820 3300035113 Bacteria 1038
790 Ga0373953_0009327 3300035117 Bacteria 3371
791 Ga0373953_0022397 3300035117 Unclassified 2382
792 Ga0373953_0079172 3300035117 Bacteria 1364
793 Ga0373953_0352498 3300035117 Unclassified 645
794 Ga0373954_0001361 3300035118 Bacteria 9859
795 Ga0373954_0004614 3300035118 Bacteria 5937
796 Ga0373954_0059276 3300035118 Bacteria 1804
797 Ga0373956_0356171 3300035119 Unclassified 698
798 Ga0373957_0019616 3300035120 Unclassified 2382
799 Ga0373957_0090701 3300035120 Bacteria 1215
800 Ga0373943_0040004 3300035170 Bacteria 2262
801 Ga0373943_0235114 3300035170 Unclassified 1025
802 Ga0373943_0375344 3300035170 Unclassified 818
803 Ga0373955_0017079 3300035172 Bacteria 3584
804 Ga0373955_0199873 3300035172 Bacteria 1190
805 Ga0373955_0353018 3300035172 Unclassified 891
806 Ga0373955_0432788 3300035172 Unclassified 801
807 Ga0373962_0085847 3300035242 Bacteria 962
808 Ga0373924_0129949 3300035410 Bacteria 1096
809 Ga0373931_0358531 3300035691 Unclassified 914
810 Ga0373931_0386001 3300035691 Bacteria 884
811 Ga0373931_0701082 3300035691 Bacteria 669
812 Ga0373935_0298901 3300035692 Unclassified 1137
813 Ga0373927_0329918 3300035695 Bacteria 1005
814 Ga0373933_0065585 3300035724 Bacteria 2199
815 Ga0373933_0089691 3300035724 Bacteria 1896
816 Ga0373933_0097681 3300035724 Unclassified 1819
817 Ga0373933_0109497 3300035724 Bacteria 1722
818 Ga0373933_0275211 3300035724 Bacteria 1087
819 Ga0373947_0707656 3300035725 Unclassified 687
820 Ga0373937_0006723 3300036401 Bacteria 9919
821 Ga0373937_0019146 3300036401 Bacteria 6127
822 Ga0373937_0033755 3300036401 Bacteria 4650
823 Ga0373937_0045199 3300036401 Bacteria 4023
824 Ga0373937_0166293 3300036401 Bacteria 2068
825 Ga0373937_0187248 3300036401 Unclassified 1944
826 Ga0373937_0358356 3300036401 Unclassified 1382
827 Ga0373937_0389919 3300036401 Bacteria 1321
828 Ga0373937_0820900 3300036401 Bacteria 878
829 Ga0373937_1015101 3300036401 Bacteria 778
830 Ga0373925_0113445 3300037068 Unclassified 2096
831 Ga0373925_0116741 3300037068 Unclassified 2067
832 Ga0373925_0251595 3300037068 Bacteria 1417
833 Ga0436364_0352191 3300037853 Bacteria 3858
834 Ga0436364_0460607 3300037853 Bacteria 6700
835 Ga0436364_0488163 3300037853 Bacteria 13461
836 Ga0436365_0093359 3300039437 Bacteria 1718
837 Ga0436365_0424101 3300039437 Unclassified 1617
838 Ga0436365_1249443 3300039437 Bacteria 4183
839 Ga0436363_0897675 3300039450 Bacteria 1161
840 Ga0450905_083775 3300042142 Unclassified 557
841 Ga0439435_0194322 3300042436 Unclassified 667
842 Ga0453684_1802526 3300044712 Unclassified 622
843 Ga0451576_0145652 3300045051 Bacteria 2469
844 Ga0451576_0740932 3300045051 Bacteria 1032
845 Ga0495592_0011351 3300046454 Bacteria 6738
846 Ga0495592_0030371 3300046454 Unclassified 4088
847 Ga0495629_0346023 3300046459 Unclassified 1015
848 Ga0495629_0379356 3300046459 Unclassified 962
849 Ga0495629_0448070 3300046459 Bacteria 874
850 Ga0495629_0818158 3300046459 Bacteria 614
851 Ga0495651_0148029 3300046462 Bacteria 1696
852 Ga0495651_0699123 3300046462 Unclassified 632
853 Ga0495653_0351977 3300046463 Unclassified 947
854 Ga0495580_0053881 3300046472 Bacteria 2838
855 Ga0495580_0138395 3300046472 Unclassified 1688
856 Ga0495580_0150749 3300046472 Bacteria 1611
857 Ga0495580_0156132 3300046472 Unclassified 1580
858 Ga0495580_0622016 3300046472 Unclassified 712
859 Ga0495582_0011640 3300046473 Bacteria 4848
860 Ga0495582_0172643 3300046473 Bacteria 1231
861 Ga0495582_0223324 3300046473 Bacteria 1078
862 Ga0495582_0482769 3300046473 Unclassified 716
863 Ga0495639_0170245 3300046475 Bacteria 1057
864 Ga0495639_0324760 3300046475 Bacteria 770
865 Ga0495662_0595821 3300046476 Unclassified 540
866 Ga0495664_0222530 3300046477 Bacteria 1142
867 Ga0495664_0332404 3300046477 Unclassified 916
868 Ga0495608_0007616 3300046511 Bacteria 7634
869 Ga0495608_0043390 3300046511 Bacteria 3005
870 Ga0495608_0273985 3300046511 Unclassified 1049
871 Ga0495628_0292179 3300046516 Bacteria 1208
872 Ga0495628_0363134 3300046516 Bacteria 1063
873 Ga0495628_0429694 3300046516 Bacteria 961
874 Ga0495628_0429922 3300046516 Unclassified 961
875 Ga0495628_0718746 3300046516 Unclassified 704
876 Ga0495630_0006444 3300046517 Bacteria 8349
877 Ga0495630_0378823 3300046517 Unclassified 1084
878 Ga0495630_0498178 3300046517 Bacteria 934
879 Ga0495630_0525246 3300046517 Bacteria 908
880 Ga0495666_0327428 3300046526 Bacteria 691
881 Ga0495652_0017431 3300046529 Bacteria 6407
882 Ga0495652_0161497 3300046529 Bacteria 1739
883 Ga0495652_0375162 3300046529 Bacteria 1013
884 Ga0495652_0546356 3300046529 Unclassified 797
885 Ga0495652_0812104 3300046529 Unclassified 622
886 Ga0495665_0147732 3300046531 Bacteria 1227
887 Ga0495586_0065180 3300046535 Unclassified 1986
888 Ga0495586_0102994 3300046535 Bacteria 1585
889 Ga0495586_0241936 3300046535 Unclassified 1029
890 Ga0495586_0249521 3300046535 Bacteria 1012
891 Ga0495586_0587118 3300046535 Unclassified 643
892 Ga0495586_0877200 3300046535 Unclassified 517
893 Ga0495587_0000875 3300046536 Bacteria 19885
894 Ga0495587_0064199 3300046536 Bacteria 2146
895 Ga0495587_0142396 3300046536 Unclassified 1368
896 Ga0495598_0073910 3300046537 Unclassified 1080
897 Ga0495598_0245302 3300046537 Unclassified 662
898 Ga0495621_0242628 3300046539 Bacteria 734
899 Ga0495645_0015913 3300046543 Bacteria 5359
900 Ga0495645_0139178 3300046543 Bacteria 1695
901 Ga0495645_0195744 3300046543 Bacteria 1374
902 Ga0495645_0267162 3300046543 Bacteria 1130
903 Ga0495645_0274995 3300046543 Unclassified 1110
904 Ga0495633_0231877 3300046558 Unclassified 844
905 Ga0495667_0011414 3300046559 Bacteria 6013
906 Ga0495667_0016323 3300046559 Bacteria 5018
907 Ga0495667_0125960 3300046559 Bacteria 1653
908 Ga0495667_0176013 3300046559 Bacteria 1374
909 Ga0495667_0261254 3300046559 Unclassified 1101
910 Ga0495667_0785849 3300046559 Unclassified 587
911 Ga0495656_0155051 3300046615 Bacteria 1109
912 Ga0495634_0089145 3300046642 Unclassified 2006
913 Ga0495634_0110076 3300046642 Bacteria 1772
914 Ga0495635_0262410 3300046663 Bacteria 1163
915 Ga0495635_0323357 3300046663 Unclassified 1032
916 Ga0495635_0923272 3300046663 Bacteria 558
917 Ga0495657_0004492 3300046675 Bacteria 11149
918 Ga0495599_0048516 3300046678 Bacteria 2662
919 Ga0495599_0051044 3300046678 Bacteria 2592
920 Ga0495599_0438572 3300046678 Unclassified 774
921 Ga0495623_0350561 3300046679 Unclassified 804
922 Ga0495647_0227506 3300046681 Unclassified 825
923 Ga0495658_0034244 3300046683 Bacteria 2786
924 Ga0495613_0000412 3300046689 Bacteria 36659
925 Ga0495613_0041160 3300046689 Unclassified 3422
926 Ga0495613_0054144 3300046689 Bacteria 2950
927 Ga0495613_0276593 3300046689 Unclassified 1167
928 Ga0495600_0221257 3300046809 Unclassified 1211
929 Ga0495600_0600206 3300046809 Unclassified 669
930 Ga0495581_0248439 3300047315 Unclassified 1040
931 Ga0495636_0010186 3300047318 Unclassified 3709
932 Ga0495636_0038950 3300047318 Bacteria 1968
933 Ga0495674_0069412 3300047319 Bacteria 3047
934 Ga0495674_0078633 3300047319 Unclassified 2834
935 Ga0495674_0081647 3300047319 Bacteria 2773
936 Ga0495674_0162467 3300047319 Bacteria 1868
937 Ga0495674_0201016 3300047319 Bacteria 1653
938 Ga0495674_0618281 3300047319 Unclassified 857
939 Ga0495675_0037964 3300047444 Bacteria 3067
940 Ga0495675_0223337 3300047444 Unclassified 1139
941 Ga0495675_0338997 3300047444 Unclassified 886
942 Ga0495675_0369096 3300047444 Bacteria 841
943 Ga0495684_0001712 3300047471 Bacteria 17655
944 Ga0495684_0013588 3300047471 Bacteria 6269
945 Ga0495684_0066688 3300047471 Bacteria 2737
946 Ga0495684_0074027 3300047471 Bacteria 2587
947 Ga0495684_0078116 3300047471 Unclassified 2512
948 Ga0495684_0185651 3300047471 Unclassified 1539
949 Ga0495684_0432249 3300047471 Unclassified 918
950 Ga0495684_0527259 3300047471 Unclassified 808
951 Ga0495684_0765974 3300047471 Unclassified 634
952 Ga0495593_0273060 3300047673 Unclassified 846
953 Ga0495602_0004849 3300048088 Bacteria 14082
954 Ga0495602_0032555 3300048088 Bacteria 4907
955 Ga0495602_0101082 3300048088 Bacteria 2366
956 Ga0496104_0142370 3300048907 Bacteria 2304
957 Ga0496104_0162981 3300048907 Unclassified 2139
958 Ga0496104_0204919 3300048907 Unclassified 1884
959 Ga0496105_0348097 3300048908 Unclassified 1184
960 Ga0496105_0818044 3300048908 Bacteria 707
961 Ga0496106_0419215 3300048909 Bacteria 1076
962 Ga0496108_0709793 3300048911 Unclassified 872
963 Ga0496108_1385210 3300048911 Unclassified 589
964 Ga0496109_0690381 3300048912 Unclassified 958
965 Ga0496110_0156887 3300048913 Bacteria 2062
966 Ga0496110_0439066 3300048913 Bacteria 1190
967 Ga0496112_1090693 3300048915 Bacteria 717
968 Ga0496114_0099313 3300048917 Unclassified 2483
969 Ga0496114_1074345 3300048917 Unclassified 689
970 Ga0496115_0084893 3300048918 Unclassified 2582
971 nmdc:mga05p37_55458_c1 3300050507 Bacteria 4877
972 nmdc:mga05p37_621352_c1 3300050507 Unclassified 1216
973 nmdc:mga09592_2369_c2 3300050508 Bacteria 13505
974 nmdc:mga09592_76774_c1 3300050508 Bacteria 2841
975 nmdc:mga0qj67_5287_c1 3300050509 Bacteria 9416
976 nmdc:mga06r32_4210_c1 3300050510 Bacteria 12889
977 nmdc:mga08y16_1053182_c1 3300050511 Unclassified 791
978 nmdc:mga08y16_348872_c1 3300050511 Unclassified 1521
979 nmdc:mga08y16_479287_c1 3300050511 Bacteria 1266
980 nmdc:mga08y16_605972_c1 3300050511 Bacteria 1103
981 nmdc:mga08y16_643950_c1 3300050511 Bacteria 1065
982 nmdc:mga08y16_86868_c1 3300050511 Unclassified 3259
983 nmdc:mga0n895_192923_c1 3300050512 Bacteria 2068
984 nmdc:mga0n895_49344_c1 3300050512 Bacteria 4123
985 nmdc:mga0n895_550186_c1 3300050512 Unclassified 1160
986 nmdc:mga0n895_63470_c1 3300050512 Bacteria 3653
987 nmdc:mga0rr50_1028016_c1 3300050513 Bacteria 702
988 nmdc:mga0rr50_878879_c1 3300050513 Bacteria 764
989 nmdc:mga0a205_194793_c1 3300050515 Bacteria 1918
990 nmdc:mga0a205_26550_c1 3300050515 Bacteria 5525
991 Ga0495601_0002322 3300053077 Bacteria 10756
992 Ga0495601_0081500 3300053077 Bacteria 2077
993 Ga0495612_0275019 3300053078 Unclassified 752
994 Ga0495595_0288142 3300053084 Bacteria 825
995 Ga0495619_0000326 3300053085 Bacteria 33248
996 Ga0495619_0229903 3300053085 Bacteria 1285
997 Ga0495619_0945256 3300053085 Unclassified 578
998 Ga0157378_10463004
999 JGI24746J21847_1011932
1000 Ga0065714_10088727
1001 Ga0065712_10109759
1002 Ga0065715_10011352
1003 Ga0065715_10234587
1004 Ga0065707_10310514
1005 Ga0070676_10020201
1006 Ga0070676_10063673
1007 Ga0070683_100003820
1008 Ga0070683_100013122
1009 Ga0070683_100014850
1010 Ga0070683_100108291
1011 Ga0070683_100161615
1012 Ga0070683_100654500
1013 Ga0070690_100009014
1014 Ga0070690_100015429
1015 Ga0070690_100061146
1016 Ga0070690_100166226
1017 Ga0070690_101623865
1018 Ga0070670_100003296
1019 Ga0070670_100004980
1020 Ga0070670_100017524
1021 Ga0070670_100032297
1022 Ga0070670_100224053
1023 Ga0070670_100866850
1024 Ga0070677_10001490
1025 Ga0070677_10028179
1026 Ga0070677_10480990
1027 Ga0068869_100003958
1028 Ga0068869_100033652
1029 Ga0068869_100035897
1030 Ga0068869_100278196
1031 Ga0068869_100369215
1032 Ga0068869_100500235
1033 Ga0068869_100609432
1034 Ga0068869_101020821
1035 Ga0070666_10001783
1036 Ga0070666_10013165
1037 Ga0070666_10019258
1038 Ga0070666_10590373
1039 Ga0070666_10836318
1040 Ga0070666_10896808
1041 Ga0070680_100071737
1042 Ga0070680_100125652
1043 Ga0068868_100001436
1044 Ga0068868_100052545
1045 Ga0068868_100306057
1046 Ga0068868_100746758
1047 Ga0070660_100083766
1048 Ga0070660_100763472
1049 Ga0070689_100010802
1050 Ga0070689_100100074
1051 Ga0070689_100211050
1052 Ga0070689_100362450
1053 Ga0070689_100408738
1054 Ga0070689_100460162
1055 Ga0070689_100481302
1056 Ga0070689_101642406
1057 Ga0070691_10000461
1058 Ga0070687_100047809
1059 Ga0070661_100012248
1060 Ga0070661_100126297
1061 Ga0070661_100373545
1062 Ga0070661_100817600
1063 Ga0070669_100003536
1064 Ga0070669_100050418
1065 Ga0070669_100089903
1066 Ga0070669_101236637
1067 Ga0070675_100000718
1068 Ga0070675_100006739
1069 Ga0070675_100028050
1070 Ga0070675_100087697
1071 Ga0070675_100099830
1072 Ga0070675_100163401
1073 Ga0070675_100238891
1074 Ga0070675_100254805
1075 Ga0070675_101994907
1076 Ga0070671_100000815
1077 Ga0070671_100001673
1078 Ga0070671_100092885
1079 Ga0070671_100404296
1080 Ga0070671_100491971
1081 Ga0070674_100000136
1082 Ga0070674_100079654
1083 Ga0070674_100318611
1084 Ga0070673_100001421
1085 Ga0070673_100001668
1086 Ga0070673_100044570
1087 Ga0070673_100107984
1088 Ga0070673_100123993
1089 Ga0070673_100239012
1090 Ga0070673_101501780
1091 Ga0070688_100016420
1092 Ga0070688_100039917
1093 Ga0070688_100044971
1094 Ga0070688_100069333
1095 Ga0070688_100320761
1096 Ga0070659_100021636
1097 Ga0070659_100176496
1098 Ga0070659_100196070
1099 Ga0070659_100531172
1100 Ga0070667_100000879
1101 Ga0070667_100006545
1102 Ga0070667_100771019
1103 Ga0070709_10153902
1104 Ga0070709_10239363
1105 Ga0070714_100228534
1106 Ga0070714_100564125
1107 Ga0070713_100002206
1108 Ga0070713_100027183
1109 Ga0070713_100489036
1110 Ga0070713_100642978
1111 Ga0070713_101434393
1112 Ga0070710_10476881
1113 Ga0070701_10009424
1114 Ga0070701_10045330
1115 Ga0070701_10367321
1116 Ga0070711_100216866
1117 Ga0070711_100359885
1118 Ga0070711_100399066
1119 Ga0070711_101398542
1120 Ga0070705_100051158
1121 Ga0070700_100125009
1122 Ga0070694_100581348
1123 Ga0070708_100678642
1124 Ga0070708_101267198
1125 Ga0070708_101344392
1126 Ga0070678_100036605
1127 Ga0070678_100071635
1128 Ga0070678_100197101
1129 Ga0070678_100566486
1130 Ga0070678_100594498
1131 Ga0070662_100003010
1132 Ga0070662_100073012
1133 Ga0070662_100194198
1134 Ga0070662_101251742
1135 Ga0070681_10038792
1136 Ga0070681_10134325
1137 Ga0070681_10735728
1138 Ga0070681_10741133
1139 Ga0068867_100011487
1140 Ga0068867_100052703
1141 Ga0068867_100071750
1142 Ga0068867_100394111
1143 Ga0068867_100682960
1144 Ga0070685_10032907
1145 Ga0070685_10077281
1146 Ga0070685_10524596
1147 Ga0070698_100528090
1148 Ga0070679_100001188
1149 Ga0070679_100324302
1150 Ga0070679_100771593
1151 Ga0070684_100010259
1152 Ga0070684_100023432
1153 Ga0070684_100056132
1154 Ga0070684_100192334
1155 Ga0070684_100272839
1156 Ga0070684_100985587
1157 Ga0070684_101572960
1158 Ga0070697_100727716
1159 Ga0068853_100010223
1160 Ga0068853_100021030
1161 Ga0068853_100055586
1162 Ga0068853_100952804
1163 Ga0070672_100006309
1164 Ga0070672_100010764
1165 Ga0070672_100029556
1166 Ga0070672_100065679
1167 Ga0070686_100013527
1168 Ga0070686_100021509
1169 Ga0070686_100139923
1170 Ga0070686_100881265
1171 Ga0070693_100151134
1172 Ga0070693_100174230
1173 Ga0070693_100442658
1174 Ga0070665_100087924
1175 Ga0070665_100193801
1176 Ga0068855_100012045
1177 Ga0068855_100174888
1178 Ga0068855_100248563
1179 Ga0068855_100328950
1180 Ga0068855_100781860
1181 Ga0068855_100967147
1182 Ga0070664_100000235
1183 Ga0070664_100006853
1184 Ga0070664_100030588
1185 Ga0070664_100075448
1186 Ga0070664_100120349
1187 Ga0070664_100121601
1188 Ga0070664_100144431
1189 Ga0070664_100180391
1190 Ga0070664_100225393
1191 Ga0068857_100004701
1192 Ga0068857_100024770
1193 Ga0068857_100113315
1194 Ga0068857_100238399
1195 Ga0068857_100382663
1196 Ga0068857_100383204
1197 Ga0068857_100840250
1198 Ga0068857_102118142
1199 Ga0068856_100001921
1200 Ga0068856_100007110
1201 Ga0068856_100017150
1202 Ga0068856_100164252
1203 Ga0068856_100492255
1204 Ga0068856_100605397
1205 Ga0070702_100106147
1206 Ga0070702_100174271
1207 Ga0070702_100372154
1208 Ga0068852_100160148
1209 Ga0068852_100164184
1210 Ga0068852_100169912
1211 Ga0068852_100802981
1212 Ga0068852_101473901
1213 Ga0068852_101678028
1214 Ga0068859_100049791
1215 Ga0068859_100051573
1216 Ga0068859_100062214
1217 Ga0068859_100082479
1218 Ga0068859_100102333
1219 Ga0068859_100166241
1220 Ga0068859_100226379
1221 Ga0068859_100562054
1222 Ga0068859_101314596
1223 Ga0068864_100001078
1224 Ga0068864_100011161
1225 Ga0068864_100094603
1226 Ga0068864_100097294
1227 Ga0068864_100100023
1228 Ga0068864_100137681
1229 Ga0068864_100259847
1230 Ga0068864_100323835
1231 Ga0068864_100924939
1232 Ga0068866_10505484
1233 Ga0068866_10523886
1234 Ga0068861_100017953
1235 Ga0068861_100086653
1236 Ga0068861_100266423
1237 Ga0068870_10016938
1238 Ga0068870_10041555
1239 Ga0068870_10065896
1240 Ga0068870_10296514
1241 Ga0068870_11293681
1242 Ga0068863_100000203
1243 Ga0068863_100005293
1244 Ga0068863_100052109
1245 Ga0068863_100144428
1246 Ga0068863_101289967
1247 Ga0068858_100004214
1248 Ga0068858_100006302
1249 Ga0068858_100014894
1250 Ga0068858_100063106
1251 Ga0068858_100103296
1252 Ga0068858_100150728
1253 Ga0068858_100179066
1254 Ga0068858_100241994
1255 Ga0068858_100290285
1256 Ga0068858_100417231
1257 Ga0068858_100646476
1258 Ga0068858_101247594
1259 Ga0068858_101709800
1260 Ga0068860_100005469
1261 Ga0068860_100110668
1262 Ga0068860_100160581
1263 Ga0068860_100172597
1264 Ga0068860_100227840
1265 Ga0068860_100232148
1266 Ga0068860_100686454
1267 Ga0068860_101496474
1268 Ga0068860_101574871
1269 Ga0068862_100098004
1270 Ga0068862_100296294
1271 Ga0068862_100395918
1272 Ga0068862_100656361
1273 Ga0068862_101089753
1274 Ga0068862_101326739
1275 Ga0070717_11172068
1276 Ga0097621_100001830
1277 Ga0097621_100002084
1278 Ga0097621_100029776
1279 Ga0097621_100058384
1280 Ga0097621_100061435
1281 Ga0097621_100064786
1282 Ga0097621_100090394
1283 Ga0097621_100133519
1284 Ga0097621_100155547
1285 Ga0097621_100183261
1286 Ga0097621_100269127
1287 Ga0097621_100969983
1288 Ga0097621_101029387
1289 Ga0068871_100008507
1290 Ga0068871_100058391
1291 Ga0068871_100108220
1292 Ga0068871_100151994
1293 Ga0068871_100183934
1294 Ga0068871_100211209
1295 Ga0068871_100635014
1296 Ga0068871_100812072
1297 Ga0068871_101062113
1298 Ga0075428_100000671
1299 Ga0075428_100539933
1300 Ga0075430_100002532
1301 Ga0075431_100000502
1302 Ga0075433_10001202
1303 Ga0075433_10011307
1304 Ga0075433_10441037
1305 Ga0075433_10678203
1306 Ga0075434_100004206
1307 Ga0075434_100005753
1308 Ga0075434_100192151
1309 Ga0075434_100579625
1310 Ga0075429_100000848
1311 Ga0075429_100082199
1312 Ga0075429_100121463
1313 Ga0075429_100134840
1314 Ga0068865_100009472
1315 Ga0068865_100032041
1316 Ga0068865_100064136
1317 Ga0068865_100186804
1318 Ga0068865_101045187
1319 Ga0068865_101568618
1320 Ga0075436_100081982
1321 Ga0097620_100049788
1322 Ga0097620_100051573
1323 Ga0097620_100062222
1324 Ga0097620_100082480
1325 Ga0097620_100102334
1326 Ga0097620_100166227
1327 Ga0097620_100226375
1328 Ga0097620_100562055
1329 Ga0097620_100811675
1330 Ga0097620_100867816
1331 Ga0097620_101314584
1332 Ga0075435_100069532
1333 Ga0075435_100100364
1334 Ga0099795_10388181
1335 Ga0105240_10001704
1336 Ga0105240_10018605
1337 Ga0105240_10042104
1338 Ga0105240_10093132
1339 Ga0105240_10377665
1340 Ga0111539_10002873
1341 Ga0111539_10020076
1342 Ga0111539_10029192
1343 Ga0111539_10186592
1344 Ga0111539_10329487
1345 Ga0111539_10350980
1346 Ga0111539_10593033
1347 Ga0105245_10000490
1348 Ga0105245_10000522
1349 Ga0105245_10004914
1350 Ga0105245_10016271
1351 Ga0105245_10027430
1352 Ga0105245_10087626
1353 Ga0105245_10467267
1354 Ga0105245_10539698
1355 Ga0105245_10695053
1356 Ga0105245_11121376
1357 Ga0105247_10007933
1358 Ga0105247_10011747
1359 Ga0105247_10484155
1360 Ga0114129_10122424
1361 Ga0105243_10053747
1362 Ga0105243_10210299
1363 Ga0105243_10948610
1364 Ga0105241_10002584
1365 Ga0105241_10010673
1366 Ga0105241_10103271
1367 Ga0105241_10501724
1368 Ga0105242_10005159
1369 Ga0105242_10009827
1370 Ga0105242_10012044
1371 Ga0105242_10017966
1372 Ga0105242_10029204
1373 Ga0105242_10041982
1374 Ga0105242_10054066
1375 Ga0105242_10122919
1376 Ga0105242_10308842
1377 Ga0105242_10569550
1378 Ga0105242_11242678
1379 Ga0105242_12939085
1380 Ga0105248_10000321
1381 Ga0105248_10003317
1382 Ga0105248_10020314
1383 Ga0105248_10055910
1384 Ga0105248_10066406
1385 Ga0105248_10109309
1386 Ga0105248_10116213
1387 Ga0105248_10116594
1388 Ga0105248_10116612
1389 Ga0105248_10357496
1390 Ga0105248_10402807
1391 Ga0105248_10420054
1392 Ga0105248_10516600
1393 Ga0105248_10914857
1394 Ga0105248_11840596
1395 Ga0105248_12300244
1396 Ga0105237_10002911
1397 Ga0105237_10022038
1398 Ga0105237_10177892
1399 Ga0105238_10002214
1400 Ga0105238_10006206
1401 Ga0105238_10040920
1402 Ga0105238_10052733
1403 Ga0105238_10078375
1404 Ga0105249_10027034
1405 Ga0105249_10036764
1406 Ga0105249_11131549
1407 Ga0105249_12354371
1408 Ga0105239_10003103
1409 Ga0105239_10030074
1410 Ga0105239_10058815
1411 Ga0105239_10242621
1412 Ga0105246_10009739
1413 Ga0105246_10030401
1414 Ga0105246_10077096
1415 Ga0105246_10762881
1416 Ga0105246_10789595
1417 Ga0105246_12039198
1418 Ga0157371_10402007
1419 Ga0157371_10877454
1420 Ga0157370_10016223
1421 Ga0157370_10041402
1422 Ga0157369_10000876
1423 Ga0157369_10014635
1424 Ga0157369_10140840
1425 Ga0157374_10005784
1426 Ga0157374_10115853
1427 Ga0157374_10252003
1428 Ga0157374_10433913
1429 Ga0157374_10505169
1430 Ga0157378_10000308
1431 Ga0157378_10014594
1432 Ga0157378_10100836
1433 Ga0157378_10217603
1434 Ga0157378_10523663
1435 Ga0163162_10003959
1436 Ga0163162_10223272
1437 Ga0163162_10660136
1438 Ga0163162_11241604
1439 Ga0157372_10003294
1440 Ga0157372_10004833
1441 Ga0157372_10062346
1442 Ga0157372_10114337
1443 Ga0157372_10185733
1444 Ga0157372_10353338
1445 Ga0157375_10000347
1446 Ga0157375_10003107
1447 Ga0157375_10008198
1448 Ga0157375_10021880
1449 Ga0157375_10057166
1450 Ga0157375_10066427
1451 Ga0157375_10106500
1452 Ga0157375_10252728
1453 Ga0157375_10274903
1454 Ga0157375_10363143
1455 Ga0157375_10396524
1456 Ga0157375_10758144
1457 Ga0157375_11006411
1458 Ga0157375_11138633
1459 Ga0157375_11370937
1460 Ga0163163_10000939
1461 Ga0163163_10011258
1462 Ga0163163_10033586
1463 Ga0163163_10038038
1464 Ga0163163_10049213
1465 Ga0163163_10052171
1466 Ga0163163_10081373
1467 Ga0163163_10176582
1468 Ga0163163_10320310
1469 Ga0163163_11499709
1470 Ga0157380_10000747
1471 Ga0157380_10004399
1472 Ga0157380_10020826
1473 Ga0157380_11652493
1474 Ga0157377_10006322
1475 Ga0157377_10068537
1476 Ga0157377_10130884
1477 Ga0157377_10204645
1478 Ga0157377_10644502
1479 Ga0157379_10000069
1480 Ga0157379_10033202
1481 Ga0157379_10059158
1482 Ga0157379_10131702
1483 Ga0157379_10346451
1484 Ga0157379_11910660
1485 Ga0157376_10055728
1486 Ga0157376_10083130
1487 Ga0157376_10095614
1488 Ga0157376_10270348
1489 Ga0157376_10300089
1490 Ga0157376_10323717
1491 Ga0157376_10402006
1492 Ga0157376_10418717
1493 Ga0157376_10540085
1494 Ga0157376_11120896
1495 Ga0163161_10015899
1496 Ga0163161_10061887
1497 Ga0213876_10124532
1498 Ga0213876_10149847
1499 Ga0213876_10367694
1500 Ga0213875_10003847
1501 Ga0213875_10019944
1502 Ga0213875_10030113
1503 Ga0213875_10075187
1504 Ga0207697_10000680
1505 Ga0207697_10020509
1506 Ga0207656_10017509
1507 Ga0207682_10002289
1508 Ga0207682_10007390
1509 Ga0207682_10072993
1510 Ga0207642_10035791
1511 Ga0207642_10639791
1512 Ga0207710_10010415
1513 Ga0207710_10243436
1514 Ga0207688_10000268
1515 Ga0207688_10226004
1516 Ga0207680_10004745
1517 Ga0207680_10042787
1518 Ga0207680_10707935
1519 Ga0207699_10215083
1520 Ga0207699_10352261
1521 Ga0207645_10002877
1522 Ga0207645_10012264
1523 Ga0207645_10065050
1524 Ga0207645_10211746
1525 Ga0207643_10000708
1526 Ga0207643_10011490
1527 Ga0207643_10022495
1528 Ga0207643_10055257
1529 Ga0207643_10086373
1530 Ga0207705_10238597
1531 Ga0207654_10002411
1532 Ga0207654_10004960
1533 Ga0207654_10192375
1534 Ga0207654_10423316
1535 Ga0207707_10000635
1536 Ga0207707_10395146
1537 Ga0207707_10604367
1538 Ga0207695_10002273
1539 Ga0207695_10005994
1540 Ga0207695_10201629
1541 Ga0207695_10262397
1542 Ga0207695_10302820
1543 Ga0207695_11043779
1544 Ga0207695_11155704
1545 Ga0207671_10004044
1546 Ga0207671_10027866
1547 Ga0207663_10316061
1548 Ga0207660_10018851
1549 Ga0207662_10303829
1550 Ga0207662_10318844
1551 Ga0207657_10094716
1552 Ga0207649_10127973
1553 Ga0207649_10178096
1554 Ga0207649_10572987
1555 Ga0207649_10587052
1556 Ga0207652_10004226
1557 Ga0207652_11040624
1558 Ga0207681_10024487
1559 Ga0207681_10092192
1560 Ga0207681_10358030
1561 Ga0207681_10669220
1562 Ga0207694_10006135
1563 Ga0207694_10006183
1564 Ga0207694_10021682
1565 Ga0207694_10049781
1566 Ga0207694_10064694
1567 Ga0207694_10789128
1568 Ga0207650_10000669
1569 Ga0207650_10014493
1570 Ga0207650_10021187
1571 Ga0207650_10026622
1572 Ga0207659_10009983
1573 Ga0207659_10021620
1574 Ga0207659_10145347
1575 Ga0207659_10165422
1576 Ga0207659_10172113
1577 Ga0207687_10001267
1578 Ga0207687_10001373
1579 Ga0207687_10006349
1580 Ga0207687_10010444
1581 Ga0207687_10024622
1582 Ga0207687_10036743
1583 Ga0207687_10641245
1584 Ga0207687_10680019
1585 Ga0207687_10699494
1586 Ga0207700_10025932
1587 Ga0207700_10041492
1588 Ga0207700_10056548
1589 Ga0207700_10118778
1590 Ga0207700_10123579
1591 Ga0207700_10763668
1592 Ga0207664_10112471
1593 Ga0207664_10492852
1594 Ga0207644_10010085
1595 Ga0207644_10018210
1596 Ga0207644_10613032
1597 Ga0207690_10046273
1598 Ga0207690_10161180
1599 Ga0207690_10387051
1600 Ga0207706_10026543
1601 Ga0207706_10028531
1602 Ga0207706_10171176
1603 Ga0207706_10253596
1604 Ga0207686_10005592
1605 Ga0207686_10026596
1606 Ga0207686_10040325
1607 Ga0207686_10075747
1608 Ga0207686_10140532
1609 Ga0207686_10212577
1610 Ga0207686_10243997
1611 Ga0207686_10498818
1612 Ga0207686_10528170
1613 Ga0207686_10769060
1614 Ga0207709_10008144
1615 Ga0207709_10219872
1616 Ga0207670_10040975
1617 Ga0207670_10091049
1618 Ga0207670_10112716
1619 Ga0207670_10255574
1620 Ga0207670_10261196
1621 Ga0207670_10326963
1622 Ga0207670_10335117
1623 Ga0207670_11063657
1624 Ga0207669_10028286
1625 Ga0207669_10032274
1626 Ga0207669_10475972
1627 Ga0207669_10533619
1628 Ga0207704_10006007
1629 Ga0207704_10022147
1630 Ga0207704_10034022
1631 Ga0207704_10038267
1632 Ga0207704_10126208
1633 Ga0207704_10180555
1634 Ga0207704_10631354
1635 Ga0207704_10644244
1636 Ga0207691_10000562
1637 Ga0207691_10001885
1638 Ga0207691_10080977
1639 Ga0207691_10091658
1640 Ga0207691_10113159
1641 Ga0207691_10126468
1642 Ga0207711_10001792
1643 Ga0207711_10003178
1644 Ga0207711_10008497
1645 Ga0207711_10016304
1646 Ga0207711_10029831
1647 Ga0207711_10084682
1648 Ga0207711_10201454
1649 Ga0207711_10236279
1650 Ga0207711_10299510
1651 Ga0207711_10300216
1652 Ga0207711_10652017
1653 Ga0207711_10849519
1654 Ga0207711_11648641
1655 Ga0207689_10003413
1656 Ga0207689_10010340
1657 Ga0207689_10038343
1658 Ga0207689_10093831
1659 Ga0207689_10201546
1660 Ga0207689_10297012
1661 Ga0207661_10005767
1662 Ga0207661_10061986
1663 Ga0207661_10062203
1664 Ga0207661_10205014
1665 Ga0207661_10221553
1666 Ga0207661_11033166
1667 Ga0207679_10001709
1668 Ga0207679_10007555
1669 Ga0207679_10015089
1670 Ga0207679_10032416
1671 Ga0207679_10113247
1672 Ga0207679_10115142
1673 Ga0207679_10219413
1674 Ga0207679_11417834
1675 Ga0207667_10002906
1676 Ga0207667_10008651
1677 Ga0207667_10017758
1678 Ga0207667_10215396
1679 Ga0207667_10321695
1680 Ga0207651_10025209
1681 Ga0207651_10057208
1682 Ga0207651_10082478
1683 Ga0207651_10221699
1684 Ga0207651_10401136
1685 Ga0207651_10518741
1686 Ga0207712_10031838
1687 Ga0207712_10168242
1688 Ga0207668_10028073
1689 Ga0207668_10761071
1690 Ga0207668_10770374
1691 Ga0207658_10006244
1692 Ga0207658_10012202
1693 Ga0207658_10543745
1694 Ga0207658_11149168
1695 Ga0207658_11306128
1696 Ga0207677_10012860
1697 Ga0207677_10122534
1698 Ga0207677_11591547
1699 Ga0207703_10009873
1700 Ga0207703_10053354
1701 Ga0207703_10092763
1702 Ga0207703_10149084
1703 Ga0207703_10173058
1704 Ga0207703_10192558
1705 Ga0207703_10197336
1706 Ga0207703_10278377
1707 Ga0207703_10369674
1708 Ga0207703_10461619
1709 Ga0207703_10581362
1710 Ga0207703_11058671
1711 Ga0207703_11395150
1712 Ga0207703_11476789
1713 Ga0207639_10012687
1714 Ga0207639_10023802
1715 Ga0207639_10226952
1716 Ga0207678_10053034
1717 Ga0207708_10021776
1718 Ga0207708_10083182
1719 Ga0207702_10008257
1720 Ga0207702_10009009
1721 Ga0207702_10068042
1722 Ga0207702_10342219
1723 Ga0207702_10349206
1724 Ga0207641_10001413
1725 Ga0207641_10075407
1726 Ga0207641_10079521
1727 Ga0207641_10080625
1728 Ga0207648_10004726
1729 Ga0207648_10040801
1730 Ga0207648_10059754
1731 Ga0207648_10171259
1732 Ga0207648_10769211
1733 Ga0207648_10924021
1734 Ga0207676_10038566
1735 Ga0207676_10052268
1736 Ga0207676_10059984
1737 Ga0207676_10282973
1738 Ga0207676_11111832
1739 Ga0207674_10000657
1740 Ga0207674_10014434
1741 Ga0207674_10021150
1742 Ga0207674_10413005
1743 Ga0207674_10485023
1744 Ga0207674_10622117
1745 Ga0207675_100013958
1746 Ga0207675_100093440
1747 Ga0207675_100227230
1748 Ga0207675_100324177
1749 Ga0207675_100387380
1750 Ga0207683_10042732
1751 Ga0207683_10067607
1752 Ga0207683_10245443
1753 Ga0207683_10357595
1754 Ga0207683_10426451
1755 Ga0207683_10523042
1756 Ga0207683_10788529
1757 Ga0207683_11125553
1758 Ga0207698_10048812
1759 Ga0207698_10218529
1760 Ga0207698_10904257
1761 Ga0207698_10993898
1762 Ga0207698_11560071
1763 Ga0207428_10064965
1764 Ga0268266_10019693
1765 Ga0268265_10108753
1766 Ga0268265_10118832
1767 Ga0268265_10338703
1768 Ga0268265_10914844
1769 Ga0268265_11079732
1770 Ga0268264_10011988
1771 Ga0268264_10131783
1772 Ga0268264_10229241
1773 Ga0268264_10329445
1774 Ga0268264_10409493
1775 Ga0268264_10457519
1776 Ga0268264_11009834
1777 Ga0265338_10103399
1778 Ga0265316_10873973
1779 Ga0265313_10001183
1780 Ga0265314_10000503
1781 Ga0265314_10171977
1782 Ga0373928_0024123
1783 Ga0373934_0005371
1784 Ga0373934_0007079
1785 Ga0373932_0127083
1786 Ga0373936_0141820
1787 Ga0373953_0009327
1788 Ga0373953_0022397
1789 Ga0373953_0079172
1790 Ga0373953_0352498
1791 Ga0373954_0001361
1792 Ga0373954_0004614
1793 Ga0373954_0059276
1794 Ga0373956_0356171
1795 Ga0373957_0019616
1796 Ga0373957_0090701
1797 Ga0373943_0040004
1798 Ga0373943_0235114
1799 Ga0373943_0375344
1800 Ga0373955_0017079
1801 Ga0373955_0199873
1802 Ga0373955_0353018
1803 Ga0373955_0432788
1804 Ga0373962_0085847
1805 Ga0373924_0129949
1806 Ga0373931_0358531
1807 Ga0373931_0386001
1808 Ga0373931_0701082
1809 Ga0373935_0298901
1810 Ga0373927_0329918
1811 Ga0373933_0065585
1812 Ga0373933_0089691
1813 Ga0373933_0097681
1814 Ga0373933_0109497
1815 Ga0373933_0275211
1816 Ga0373947_0707656
1817 Ga0373937_0006723
1818 Ga0373937_0019146
1819 Ga0373937_0033755
1820 Ga0373937_0045199
1821 Ga0373937_0166293
1822 Ga0373937_0187248
1823 Ga0373937_0358356
1824 Ga0373937_0389919
1825 Ga0373937_0820900
1826 Ga0373937_1015101
1827 Ga0373925_0113445
1828 Ga0373925_0116741
1829 Ga0373925_0251595
1830 Ga0436364_0352191
1831 Ga0436364_0460607
1832 Ga0436364_0488163
1833 Ga0436365_0093359
1834 Ga0436365_0424101
1835 Ga0436365_1249443
1836 Ga0436363_0897675
1837 Ga0450905_083775
1838 Ga0439435_0194322
1839 Ga0453684_1802526
1840 Ga0451576_0145652
1841 Ga0451576_0740932
1842 Ga0495592_0011351
1843 Ga0495592_0030371
1844 Ga0495629_0346023
1845 Ga0495629_0379356
1846 Ga0495629_0448070
1847 Ga0495629_0818158
1848 Ga0495651_0148029
1849 Ga0495651_0699123
1850 Ga0495653_0351977
1851 Ga0495580_0053881
1852 Ga0495580_0138395
1853 Ga0495580_0150749
1854 Ga0495580_0156132
1855 Ga0495580_0622016
1856 Ga0495582_0011640
1857 Ga0495582_0172643
1858 Ga0495582_0223324
1859 Ga0495582_0482769
1860 Ga0495639_0170245
1861 Ga0495639_0324760
1862 Ga0495662_0595821
1863 Ga0495664_0222530
1864 Ga0495664_0332404
1865 Ga0495608_0007616
1866 Ga0495608_0043390
1867 Ga0495608_0273985
1868 Ga0495628_0292179
1869 Ga0495628_0363134
1870 Ga0495628_0429694
1871 Ga0495628_0429922
1872 Ga0495628_0718746
1873 Ga0495630_0006444
1874 Ga0495630_0378823
1875 Ga0495630_0498178
1876 Ga0495630_0525246
1877 Ga0495666_0327428
1878 Ga0495652_0017431
1879 Ga0495652_0161497
1880 Ga0495652_0375162
1881 Ga0495652_0546356
1882 Ga0495652_0812104
1883 Ga0495665_0147732
1884 Ga0495586_0065180
1885 Ga0495586_0102994
1886 Ga0495586_0241936
1887 Ga0495586_0249521
1888 Ga0495586_0587118
1889 Ga0495586_0877200
1890 Ga0495587_0000875
1891 Ga0495587_0064199
1892 Ga0495587_0142396
1893 Ga0495598_0073910
1894 Ga0495598_0245302
1895 Ga0495621_0242628
1896 Ga0495645_0015913
1897 Ga0495645_0139178
1898 Ga0495645_0195744
1899 Ga0495645_0267162
1900 Ga0495645_0274995
1901 Ga0495633_0231877
1902 Ga0495667_0011414
1903 Ga0495667_0016323
1904 Ga0495667_0125960
1905 Ga0495667_0176013
1906 Ga0495667_0261254
1907 Ga0495667_0785849
1908 Ga0495656_0155051
1909 Ga0495634_0089145
1910 Ga0495634_0110076
1911 Ga0495635_0262410
1912 Ga0495635_0323357
1913 Ga0495635_0923272
1914 Ga0495657_0004492
1915 Ga0495599_0048516
1916 Ga0495599_0051044
1917 Ga0495599_0438572
1918 Ga0495623_0350561
1919 Ga0495647_0227506
1920 Ga0495658_0034244
1921 Ga0495613_0000412
1922 Ga0495613_0041160
1923 Ga0495613_0054144
1924 Ga0495613_0276593
1925 Ga0495600_0221257
1926 Ga0495600_0600206
1927 Ga0495581_0248439
1928 Ga0495636_0010186
1929 Ga0495636_0038950
1930 Ga0495674_0069412
1931 Ga0495674_0078633
1932 Ga0495674_0081647
1933 Ga0495674_0162467
1934 Ga0495674_0201016
1935 Ga0495674_0618281
1936 Ga0495675_0037964
1937 Ga0495675_0223337
1938 Ga0495675_0338997
1939 Ga0495675_0369096
1940 Ga0495684_0001712
1941 Ga0495684_0013588
1942 Ga0495684_0066688
1943 Ga0495684_0074027
1944 Ga0495684_0078116
1945 Ga0495684_0185651
1946 Ga0495684_0432249
1947 Ga0495684_0527259
1948 Ga0495684_0765974
1949 Ga0495593_0273060
1950 Ga0495602_0004849
1951 Ga0495602_0032555
1952 Ga0495602_0101082
1953 Ga0496104_0142370
1954 Ga0496104_0162981
1955 Ga0496104_0204919
1956 Ga0496105_0348097
1957 Ga0496105_0818044
1958 Ga0496106_0419215
1959 Ga0496108_0709793
1960 Ga0496108_1385210
1961 Ga0496109_0690381
1962 Ga0496110_0156887
1963 Ga0496110_0439066
1964 Ga0496112_1090693
1965 Ga0496114_0099313
1966 Ga0496114_1074345
1967 Ga0496115_0084893
1968 nmdc:mga05p37_55458_c1
1969 nmdc:mga05p37_621352_c1
1970 nmdc:mga09592_2369_c2
1971 nmdc:mga09592_76774_c1
1972 nmdc:mga0qj67_5287_c1
1973 nmdc:mga06r32_4210_c1
1974 nmdc:mga08y16_1053182_c1
1975 nmdc:mga08y16_348872_c1
1976 nmdc:mga08y16_479287_c1
1977 nmdc:mga08y16_605972_c1
1978 nmdc:mga08y16_643950_c1
1979 nmdc:mga08y16_86868_c1
1980 nmdc:mga0n895_192923_c1
1981 nmdc:mga0n895_49344_c1
1982 nmdc:mga0n895_550186_c1
1983 nmdc:mga0n895_63470_c1
1984 nmdc:mga0rr50_1028016_c1
1985 nmdc:mga0rr50_878879_c1
1986 nmdc:mga0a205_194793_c1
1987 nmdc:mga0a205_26550_c1
1988 Ga0495601_0002322
1989 Ga0495601_0081500
1990 Ga0495612_0275019
1991 Ga0495595_0288142
1992 Ga0495619_0000326
1993 Ga0495619_0229903
1994 Ga0495619_0945256

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

25

148

0.88

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

147

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8336 24 149
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8326 25 152
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8253 25 147
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8219 24 152
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8219 25 147
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8324 99 150 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8299 95 154 3.30.720.110
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8222 24 152 3.10.180.10
af_P15179_25_134_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8124 118 148 2.40.50.140
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8086 28 149 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3WTK2-F1-model_v4 deleted 0.9284 15 154
AF-A0A1G0KCF0-F1-model_v4 VOC domain-containing protein 0.918 12 153
AF-A0A7C8H242-F1-model_v4 deleted 0.8913 99 156
AF-A0A7Y0BN36-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.891 30 150 GO:0051213
AF-A0A1Q7F0Z4-F1-model_v4 VOC domain-containing protein 0.8855 24 153

Map