F487796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 997 | 263 | 1994 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10463004|Ga0157378_104630042 |
| Length | 154 |
| Sequence | VKRIHLAAINACAVLVMAGNANAEVTLNSVRVGARDTEALAKFYESAFGLKEVNRLTFPNGVEIFLNFGDNVDTAKTYSSAIFLIIQSEPAAKDTAAHLIFNVTDAAATAAAVKAAGGTMEREPMPFGNTGIVIGIAADPAGNRIELIQRPAQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 201 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 97.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10463004 | 3300013297 | Bacteria | 1260 |
| 2 | JGI24746J21847_1011932 | 3300001977 | Bacteria | 1274 |
| 3 | Ga0065714_10088727 | 3300005288 | Bacteria | 2005 |
| 4 | Ga0065712_10109759 | 3300005290 | Unclassified | 1849 |
| 5 | Ga0065715_10011352 | 3300005293 | Bacteria | 2809 |
| 6 | Ga0065715_10234587 | 3300005293 | Bacteria | 1221 |
| 7 | Ga0065707_10310514 | 3300005295 | Unclassified | 985 |
| 8 | Ga0070676_10020201 | 3300005328 | Unclassified | 3715 |
| 9 | Ga0070676_10063673 | 3300005328 | Bacteria | 2197 |
| 10 | Ga0070683_100003820 | 3300005329 | Bacteria | 12307 |
| 11 | Ga0070683_100013122 | 3300005329 | Bacteria | 7215 |
| 12 | Ga0070683_100014850 | 3300005329 | Bacteria | 6827 |
| 13 | Ga0070683_100108291 | 3300005329 | Bacteria | 2621 |
| 14 | Ga0070683_100161615 | 3300005329 | Bacteria | 2125 |
| 15 | Ga0070683_100654500 | 3300005329 | Bacteria | 1006 |
| 16 | Ga0070690_100009014 | 3300005330 | Bacteria | 5767 |
| 17 | Ga0070690_100015429 | 3300005330 | Bacteria | 4556 |
| 18 | Ga0070690_100061146 | 3300005330 | Bacteria | 2426 |
| 19 | Ga0070690_100166226 | 3300005330 | Bacteria | 1515 |
| 20 | Ga0070690_101623865 | 3300005330 | Unclassified | 524 |
| 21 | Ga0070670_100003296 | 3300005331 | Bacteria | 13358 |
| 22 | Ga0070670_100004980 | 3300005331 | Bacteria | 11175 |
| 23 | Ga0070670_100017524 | 3300005331 | Bacteria | 6146 |
| 24 | Ga0070670_100032297 | 3300005331 | Unclassified | 4508 |
| 25 | Ga0070670_100224053 | 3300005331 | Bacteria | 1636 |
| 26 | Ga0070670_100866850 | 3300005331 | Bacteria | 817 |
| 27 | Ga0070677_10001490 | 3300005333 | Bacteria | 7411 |
| 28 | Ga0070677_10028179 | 3300005333 | Bacteria | 2120 |
| 29 | Ga0070677_10480990 | 3300005333 | Unclassified | 670 |
| 30 | Ga0068869_100003958 | 3300005334 | Bacteria | 9152 |
| 31 | Ga0068869_100033652 | 3300005334 | Unclassified | 3619 |
| 32 | Ga0068869_100035897 | 3300005334 | Bacteria | 3517 |
| 33 | Ga0068869_100278196 | 3300005334 | Bacteria | 1345 |
| 34 | Ga0068869_100369215 | 3300005334 | Bacteria | 1174 |
| 35 | Ga0068869_100500235 | 3300005334 | Bacteria | 1015 |
| 36 | Ga0068869_100609432 | 3300005334 | Bacteria | 923 |
| 37 | Ga0068869_101020821 | 3300005334 | Unclassified | 721 |
| 38 | Ga0070666_10001783 | 3300005335 | Bacteria | 13109 |
| 39 | Ga0070666_10013165 | 3300005335 | Bacteria | 5242 |
| 40 | Ga0070666_10019258 | 3300005335 | Bacteria | 4402 |
| 41 | Ga0070666_10590373 | 3300005335 | Bacteria | 810 |
| 42 | Ga0070666_10836318 | 3300005335 | Unclassified | 679 |
| 43 | Ga0070666_10896808 | 3300005335 | Unclassified | 655 |
| 44 | Ga0070680_100071737 | 3300005336 | Unclassified | 2846 |
| 45 | Ga0070680_100125652 | 3300005336 | Bacteria | 2143 |
| 46 | Ga0068868_100001436 | 3300005338 | Bacteria | 16442 |
| 47 | Ga0068868_100052545 | 3300005338 | Bacteria | 3208 |
| 48 | Ga0068868_100306057 | 3300005338 | Bacteria | 1351 |
| 49 | Ga0068868_100746758 | 3300005338 | Unclassified | 879 |
| 50 | Ga0070660_100083766 | 3300005339 | Bacteria | 2506 |
| 51 | Ga0070660_100763472 | 3300005339 | Unclassified | 812 |
| 52 | Ga0070689_100010802 | 3300005340 | Bacteria | 6525 |
| 53 | Ga0070689_100100074 | 3300005340 | Bacteria | 2293 |
| 54 | Ga0070689_100211050 | 3300005340 | Viruses | 1589 |
| 55 | Ga0070689_100362450 | 3300005340 | Unclassified | 1218 |
| 56 | Ga0070689_100408738 | 3300005340 | Unclassified | 1149 |
| 57 | Ga0070689_100460162 | 3300005340 | Bacteria | 1084 |
| 58 | Ga0070689_100481302 | 3300005340 | Bacteria | 1060 |
| 59 | Ga0070689_101642406 | 3300005340 | Bacteria | 584 |
| 60 | Ga0070691_10000461 | 3300005341 | Bacteria | 15100 |
| 61 | Ga0070687_100047809 | 3300005343 | Bacteria | 2197 |
| 62 | Ga0070661_100012248 | 3300005344 | Bacteria | 5998 |
| 63 | Ga0070661_100126297 | 3300005344 | Unclassified | 1919 |
| 64 | Ga0070661_100373545 | 3300005344 | Unclassified | 1123 |
| 65 | Ga0070661_100817600 | 3300005344 | Bacteria | 765 |
| 66 | Ga0070669_100003536 | 3300005353 | Bacteria | 11272 |
| 67 | Ga0070669_100050418 | 3300005353 | Bacteria | 3040 |
| 68 | Ga0070669_100089903 | 3300005353 | Unclassified | 2301 |
| 69 | Ga0070669_101236637 | 3300005353 | Unclassified | 646 |
| 70 | Ga0070675_100000718 | 3300005354 | Bacteria | 23035 |
| 71 | Ga0070675_100006739 | 3300005354 | Bacteria | 8834 |
| 72 | Ga0070675_100028050 | 3300005354 | Unclassified | 4528 |
| 73 | Ga0070675_100087697 | 3300005354 | Unclassified | 2602 |
| 74 | Ga0070675_100099830 | 3300005354 | Bacteria | 2444 |
| 75 | Ga0070675_100163401 | 3300005354 | Unclassified | 1916 |
| 76 | Ga0070675_100238891 | 3300005354 | Unclassified | 1587 |
| 77 | Ga0070675_100254805 | 3300005354 | Unclassified | 1537 |
| 78 | Ga0070675_101994907 | 3300005354 | Bacteria | 535 |
| 79 | Ga0070671_100000815 | 3300005355 | Bacteria | 22608 |
| 80 | Ga0070671_100001673 | 3300005355 | Bacteria | 16781 |
| 81 | Ga0070671_100092885 | 3300005355 | Bacteria | 2529 |
| 82 | Ga0070671_100404296 | 3300005355 | Unclassified | 1168 |
| 83 | Ga0070671_100491971 | 3300005355 | Bacteria | 1055 |
| 84 | Ga0070674_100000136 | 3300005356 | Bacteria | 33863 |
| 85 | Ga0070674_100079654 | 3300005356 | Unclassified | 2337 |
| 86 | Ga0070674_100318611 | 3300005356 | Unclassified | 1246 |
| 87 | Ga0070673_100001421 | 3300005364 | Bacteria | 13991 |
| 88 | Ga0070673_100001668 | 3300005364 | Bacteria | 13152 |
| 89 | Ga0070673_100044570 | 3300005364 | Bacteria | 3435 |
| 90 | Ga0070673_100107984 | 3300005364 | Bacteria | 2303 |
| 91 | Ga0070673_100123993 | 3300005364 | Bacteria | 2159 |
| 92 | Ga0070673_100239012 | 3300005364 | Unclassified | 1578 |
| 93 | Ga0070673_101501780 | 3300005364 | Unclassified | 635 |
| 94 | Ga0070688_100016420 | 3300005365 | Bacteria | 4233 |
| 95 | Ga0070688_100039917 | 3300005365 | Bacteria | 2874 |
| 96 | Ga0070688_100044971 | 3300005365 | Bacteria | 2726 |
| 97 | Ga0070688_100069333 | 3300005365 | Unclassified | 2251 |
| 98 | Ga0070688_100320761 | 3300005365 | Unclassified | 1126 |
| 99 | Ga0070659_100021636 | 3300005366 | Bacteria | 4901 |
| 100 | Ga0070659_100176496 | 3300005366 | Bacteria | 1752 |
| 101 | Ga0070659_100196070 | 3300005366 | Bacteria | 1661 |
| 102 | Ga0070659_100531172 | 3300005366 | Unclassified | 1005 |
| 103 | Ga0070667_100000879 | 3300005367 | Bacteria | 27735 |
| 104 | Ga0070667_100006545 | 3300005367 | Bacteria | 9683 |
| 105 | Ga0070667_100771019 | 3300005367 | Unclassified | 892 |
| 106 | Ga0070709_10153902 | 3300005434 | Bacteria | 1592 |
| 107 | Ga0070709_10239363 | 3300005434 | Bacteria | 1303 |
| 108 | Ga0070714_100228534 | 3300005435 | Bacteria | 1713 |
| 109 | Ga0070714_100564125 | 3300005435 | Unclassified | 1091 |
| 110 | Ga0070713_100002206 | 3300005436 | Bacteria | 12616 |
| 111 | Ga0070713_100027183 | 3300005436 | Bacteria | 4502 |
| 112 | Ga0070713_100489036 | 3300005436 | Unclassified | 1160 |
| 113 | Ga0070713_100642978 | 3300005436 | Unclassified | 1010 |
| 114 | Ga0070713_101434393 | 3300005436 | Bacteria | 670 |
| 115 | Ga0070710_10476881 | 3300005437 | Unclassified | 850 |
| 116 | Ga0070701_10009424 | 3300005438 | Bacteria | 4277 |
| 117 | Ga0070701_10045330 | 3300005438 | Unclassified | 2256 |
| 118 | Ga0070701_10367321 | 3300005438 | Bacteria | 903 |
| 119 | Ga0070711_100216866 | 3300005439 | Unclassified | 1485 |
| 120 | Ga0070711_100359885 | 3300005439 | Unclassified | 1172 |
| 121 | Ga0070711_100399066 | 3300005439 | Bacteria | 1116 |
| 122 | Ga0070711_101398542 | 3300005439 | Unclassified | 609 |
| 123 | Ga0070705_100051158 | 3300005440 | Bacteria | 2407 |
| 124 | Ga0070700_100125009 | 3300005441 | Unclassified | 1728 |
| 125 | Ga0070694_100581348 | 3300005444 | Bacteria | 900 |
| 126 | Ga0070708_100678642 | 3300005445 | Unclassified | 970 |
| 127 | Ga0070708_101267198 | 3300005445 | Unclassified | 689 |
| 128 | Ga0070708_101344392 | 3300005445 | Bacteria | 667 |
| 129 | Ga0070678_100036605 | 3300005456 | Bacteria | 3437 |
| 130 | Ga0070678_100071635 | 3300005456 | Bacteria | 2595 |
| 131 | Ga0070678_100197101 | 3300005456 | Bacteria | 1659 |
| 132 | Ga0070678_100566486 | 3300005456 | Bacteria | 1010 |
| 133 | Ga0070678_100594498 | 3300005456 | Unclassified | 987 |
| 134 | Ga0070662_100003010 | 3300005457 | Bacteria | 10486 |
| 135 | Ga0070662_100073012 | 3300005457 | Bacteria | 2535 |
| 136 | Ga0070662_100194198 | 3300005457 | Bacteria | 1607 |
| 137 | Ga0070662_101251742 | 3300005457 | Unclassified | 638 |
| 138 | Ga0070681_10038792 | 3300005458 | Unclassified | 4776 |
| 139 | Ga0070681_10134325 | 3300005458 | Unclassified | 2405 |
| 140 | Ga0070681_10735728 | 3300005458 | Unclassified | 903 |
| 141 | Ga0070681_10741133 | 3300005458 | Unclassified | 899 |
| 142 | Ga0068867_100011487 | 3300005459 | Bacteria | 6250 |
| 143 | Ga0068867_100052703 | 3300005459 | Unclassified | 3003 |
| 144 | Ga0068867_100071750 | 3300005459 | Bacteria | 2591 |
| 145 | Ga0068867_100394111 | 3300005459 | Unclassified | 1166 |
| 146 | Ga0068867_100682960 | 3300005459 | Unclassified | 904 |
| 147 | Ga0070685_10032907 | 3300005466 | Bacteria | 2907 |
| 148 | Ga0070685_10077281 | 3300005466 | Bacteria | 1987 |
| 149 | Ga0070685_10524596 | 3300005466 | Unclassified | 842 |
| 150 | Ga0070698_100528090 | 3300005471 | Bacteria | 1119 |
| 151 | Ga0070679_100001188 | 3300005530 | Bacteria | 22870 |
| 152 | Ga0070679_100324302 | 3300005530 | Unclassified | 1489 |
| 153 | Ga0070679_100771593 | 3300005530 | Unclassified | 904 |
| 154 | Ga0070684_100010259 | 3300005535 | Bacteria | 7416 |
| 155 | Ga0070684_100023432 | 3300005535 | Bacteria | 5164 |
| 156 | Ga0070684_100056132 | 3300005535 | Unclassified | 3435 |
| 157 | Ga0070684_100192334 | 3300005535 | Unclassified | 1857 |
| 158 | Ga0070684_100272839 | 3300005535 | Bacteria | 1549 |
| 159 | Ga0070684_100985587 | 3300005535 | Unclassified | 791 |
| 160 | Ga0070684_101572960 | 3300005535 | Unclassified | 620 |
| 161 | Ga0070697_100727716 | 3300005536 | Unclassified | 876 |
| 162 | Ga0068853_100010223 | 3300005539 | Bacteria | 7587 |
| 163 | Ga0068853_100021030 | 3300005539 | Bacteria | 5432 |
| 164 | Ga0068853_100055586 | 3300005539 | Unclassified | 3412 |
| 165 | Ga0068853_100952804 | 3300005539 | Unclassified | 825 |
| 166 | Ga0070672_100006309 | 3300005543 | Bacteria | 7952 |
| 167 | Ga0070672_100010764 | 3300005543 | Bacteria | 6356 |
| 168 | Ga0070672_100029556 | 3300005543 | Bacteria | 4111 |
| 169 | Ga0070672_100065679 | 3300005543 | Unclassified | 2871 |
| 170 | Ga0070686_100013527 | 3300005544 | Unclassified | 4677 |
| 171 | Ga0070686_100021509 | 3300005544 | Bacteria | 3836 |
| 172 | Ga0070686_100139923 | 3300005544 | Bacteria | 1684 |
| 173 | Ga0070686_100881265 | 3300005544 | Bacteria | 727 |
| 174 | Ga0070693_100151134 | 3300005547 | Bacteria | 1471 |
| 175 | Ga0070693_100174230 | 3300005547 | Unclassified | 1380 |
| 176 | Ga0070693_100442658 | 3300005547 | Bacteria | 910 |
| 177 | Ga0070665_100087924 | 3300005548 | Bacteria | 3113 |
| 178 | Ga0070665_100193801 | 3300005548 | Bacteria | 2033 |
| 179 | Ga0068855_100012045 | 3300005563 | Bacteria | 10455 |
| 180 | Ga0068855_100174888 | 3300005563 | Unclassified | 2430 |
| 181 | Ga0068855_100248563 | 3300005563 | Bacteria | 1984 |
| 182 | Ga0068855_100328950 | 3300005563 | Bacteria | 1687 |
| 183 | Ga0068855_100781860 | 3300005563 | Unclassified | 1016 |
| 184 | Ga0068855_100967147 | 3300005563 | Unclassified | 896 |
| 185 | Ga0070664_100000235 | 3300005564 | Bacteria | 39833 |
| 186 | Ga0070664_100006853 | 3300005564 | Bacteria | 9189 |
| 187 | Ga0070664_100030588 | 3300005564 | Bacteria | 4493 |
| 188 | Ga0070664_100075448 | 3300005564 | Unclassified | 2896 |
| 189 | Ga0070664_100120349 | 3300005564 | Bacteria | 2298 |
| 190 | Ga0070664_100121601 | 3300005564 | Bacteria | 2287 |
| 191 | Ga0070664_100144431 | 3300005564 | Bacteria | 2097 |
| 192 | Ga0070664_100180391 | 3300005564 | Bacteria | 1876 |
| 193 | Ga0070664_100225393 | 3300005564 | Bacteria | 1678 |
| 194 | Ga0068857_100004701 | 3300005577 | Bacteria | 11575 |
| 195 | Ga0068857_100024770 | 3300005577 | Bacteria | 5285 |
| 196 | Ga0068857_100113315 | 3300005577 | Bacteria | 2438 |
| 197 | Ga0068857_100238399 | 3300005577 | Bacteria | 1665 |
| 198 | Ga0068857_100382663 | 3300005577 | Bacteria | 1307 |
| 199 | Ga0068857_100383204 | 3300005577 | Bacteria | 1306 |
| 200 | Ga0068857_100840250 | 3300005577 | Bacteria | 878 |
| 201 | Ga0068857_102118142 | 3300005577 | Unclassified | 552 |
| 202 | Ga0068856_100001921 | 3300005614 | Bacteria | 21667 |
| 203 | Ga0068856_100007110 | 3300005614 | Bacteria | 10928 |
| 204 | Ga0068856_100017150 | 3300005614 | Bacteria | 7018 |
| 205 | Ga0068856_100164252 | 3300005614 | Unclassified | 2231 |
| 206 | Ga0068856_100492255 | 3300005614 | Bacteria | 1247 |
| 207 | Ga0068856_100605397 | 3300005614 | Unclassified | 1117 |
| 208 | Ga0070702_100106147 | 3300005615 | Bacteria | 1732 |
| 209 | Ga0070702_100174271 | 3300005615 | Unclassified | 1402 |
| 210 | Ga0070702_100372154 | 3300005615 | Bacteria | 1013 |
| 211 | Ga0068852_100160148 | 3300005616 | Bacteria | 2101 |
| 212 | Ga0068852_100164184 | 3300005616 | Unclassified | 2076 |
| 213 | Ga0068852_100169912 | 3300005616 | Bacteria | 2043 |
| 214 | Ga0068852_100802981 | 3300005616 | Bacteria | 955 |
| 215 | Ga0068852_101473901 | 3300005616 | Unclassified | 703 |
| 216 | Ga0068852_101678028 | 3300005616 | Bacteria | 658 |
| 217 | Ga0068859_100049791 | 3300005617 | Bacteria | 4208 |
| 218 | Ga0068859_100051573 | 3300005617 | Bacteria | 4136 |
| 219 | Ga0068859_100062214 | 3300005617 | Bacteria | 3762 |
| 220 | Ga0068859_100082479 | 3300005617 | Bacteria | 3258 |
| 221 | Ga0068859_100102333 | 3300005617 | Unclassified | 2922 |
| 222 | Ga0068859_100166241 | 3300005617 | Bacteria | 2286 |
| 223 | Ga0068859_100226379 | 3300005617 | Bacteria | 1958 |
| 224 | Ga0068859_100562054 | 3300005617 | Archaea | 1235 |
| 225 | Ga0068859_101314596 | 3300005617 | Bacteria | 797 |
| 226 | Ga0068864_100001078 | 3300005618 | Bacteria | 22915 |
| 227 | Ga0068864_100011161 | 3300005618 | Bacteria | 7425 |
| 228 | Ga0068864_100094603 | 3300005618 | Bacteria | 2641 |
| 229 | Ga0068864_100097294 | 3300005618 | Bacteria | 2606 |
| 230 | Ga0068864_100100023 | 3300005618 | Bacteria | 2570 |
| 231 | Ga0068864_100137681 | 3300005618 | Bacteria | 2200 |
| 232 | Ga0068864_100259847 | 3300005618 | Bacteria | 1615 |
| 233 | Ga0068864_100323835 | 3300005618 | Bacteria | 1448 |
| 234 | Ga0068864_100924939 | 3300005618 | Unclassified | 862 |
| 235 | Ga0068866_10505484 | 3300005718 | Unclassified | 800 |
| 236 | Ga0068866_10523886 | 3300005718 | Unclassified | 788 |
| 237 | Ga0068861_100017953 | 3300005719 | Bacteria | 5031 |
| 238 | Ga0068861_100086653 | 3300005719 | Bacteria | 2462 |
| 239 | Ga0068861_100266423 | 3300005719 | Unclassified | 1469 |
| 240 | Ga0068870_10016938 | 3300005840 | Bacteria | 3495 |
| 241 | Ga0068870_10041555 | 3300005840 | Unclassified | 2389 |
| 242 | Ga0068870_10065896 | 3300005840 | Bacteria | 1960 |
| 243 | Ga0068870_10296514 | 3300005840 | Bacteria | 1019 |
| 244 | Ga0068870_11293681 | 3300005840 | Unclassified | 531 |
| 245 | Ga0068863_100000203 | 3300005841 | Bacteria | 63485 |
| 246 | Ga0068863_100005293 | 3300005841 | Bacteria | 12739 |
| 247 | Ga0068863_100052109 | 3300005841 | Unclassified | 3879 |
| 248 | Ga0068863_100144428 | 3300005841 | Bacteria | 2275 |
| 249 | Ga0068863_101289967 | 3300005841 | Bacteria | 737 |
| 250 | Ga0068858_100004214 | 3300005842 | Bacteria | 14160 |
| 251 | Ga0068858_100006302 | 3300005842 | Bacteria | 11552 |
| 252 | Ga0068858_100014894 | 3300005842 | Bacteria | 7316 |
| 253 | Ga0068858_100063106 | 3300005842 | Bacteria | 3428 |
| 254 | Ga0068858_100103296 | 3300005842 | Unclassified | 2658 |
| 255 | Ga0068858_100150728 | 3300005842 | Bacteria | 2186 |
| 256 | Ga0068858_100179066 | 3300005842 | Bacteria | 2001 |
| 257 | Ga0068858_100241994 | 3300005842 | Bacteria | 1712 |
| 258 | Ga0068858_100290285 | 3300005842 | Bacteria | 1559 |
| 259 | Ga0068858_100417231 | 3300005842 | Bacteria | 1290 |
| 260 | Ga0068858_100646476 | 3300005842 | Unclassified | 1027 |
| 261 | Ga0068858_101247594 | 3300005842 | Unclassified | 731 |
| 262 | Ga0068858_101709800 | 3300005842 | Unclassified | 621 |
| 263 | Ga0068860_100005469 | 3300005843 | Bacteria | 12874 |
| 264 | Ga0068860_100110668 | 3300005843 | Bacteria | 2625 |
| 265 | Ga0068860_100160581 | 3300005843 | Unclassified | 2167 |
| 266 | Ga0068860_100172597 | 3300005843 | Unclassified | 2089 |
| 267 | Ga0068860_100227840 | 3300005843 | Unclassified | 1811 |
| 268 | Ga0068860_100232148 | 3300005843 | Bacteria | 1793 |
| 269 | Ga0068860_100686454 | 3300005843 | Unclassified | 1033 |
| 270 | Ga0068860_101496474 | 3300005843 | Unclassified | 697 |
| 271 | Ga0068860_101574871 | 3300005843 | Bacteria | 679 |
| 272 | Ga0068862_100098004 | 3300005844 | Bacteria | 2560 |
| 273 | Ga0068862_100296294 | 3300005844 | Unclassified | 1487 |
| 274 | Ga0068862_100395918 | 3300005844 | Bacteria | 1291 |
| 275 | Ga0068862_100656361 | 3300005844 | Unclassified | 1012 |
| 276 | Ga0068862_101089753 | 3300005844 | Bacteria | 793 |
| 277 | Ga0068862_101326739 | 3300005844 | Unclassified | 721 |
| 278 | Ga0070717_11172068 | 3300006028 | Viruses | 699 |
| 279 | Ga0097621_100001830 | 3300006237 | Bacteria | 14576 |
| 280 | Ga0097621_100002084 | 3300006237 | Bacteria | 13694 |
| 281 | Ga0097621_100029776 | 3300006237 | Bacteria | 4315 |
| 282 | Ga0097621_100058384 | 3300006237 | Bacteria | 3157 |
| 283 | Ga0097621_100061435 | 3300006237 | Bacteria | 3082 |
| 284 | Ga0097621_100064786 | 3300006237 | Bacteria | 3006 |
| 285 | Ga0097621_100090394 | 3300006237 | Bacteria | 2562 |
| 286 | Ga0097621_100133519 | 3300006237 | Bacteria | 2115 |
| 287 | Ga0097621_100155547 | 3300006237 | Bacteria | 1962 |
| 288 | Ga0097621_100183261 | 3300006237 | Bacteria | 1810 |
| 289 | Ga0097621_100269127 | 3300006237 | Unclassified | 1497 |
| 290 | Ga0097621_100969983 | 3300006237 | Bacteria | 794 |
| 291 | Ga0097621_101029387 | 3300006237 | Unclassified | 771 |
| 292 | Ga0068871_100008507 | 3300006358 | Bacteria | 7379 |
| 293 | Ga0068871_100058391 | 3300006358 | Bacteria | 3141 |
| 294 | Ga0068871_100108220 | 3300006358 | Bacteria | 2336 |
| 295 | Ga0068871_100151994 | 3300006358 | Bacteria | 1975 |
| 296 | Ga0068871_100183934 | 3300006358 | Bacteria | 1797 |
| 297 | Ga0068871_100211209 | 3300006358 | Bacteria | 1679 |
| 298 | Ga0068871_100635014 | 3300006358 | Bacteria | 974 |
| 299 | Ga0068871_100812072 | 3300006358 | Unclassified | 863 |
| 300 | Ga0068871_101062113 | 3300006358 | Bacteria | 756 |
| 301 | Ga0075428_100000671 | 3300006844 | Bacteria | 35135 |
| 302 | Ga0075428_100539933 | 3300006844 | Unclassified | 1247 |
| 303 | Ga0075430_100002532 | 3300006846 | Bacteria | 15234 |
| 304 | Ga0075431_100000502 | 3300006847 | Bacteria | 32691 |
| 305 | Ga0075433_10001202 | 3300006852 | Bacteria | 18854 |
| 306 | Ga0075433_10011307 | 3300006852 | Bacteria | 7183 |
| 307 | Ga0075433_10441037 | 3300006852 | Unclassified | 1148 |
| 308 | Ga0075433_10678203 | 3300006852 | Unclassified | 903 |
| 309 | Ga0075434_100004206 | 3300006871 | Bacteria | 12902 |
| 310 | Ga0075434_100005753 | 3300006871 | Bacteria | 11323 |
| 311 | Ga0075434_100192151 | 3300006871 | Bacteria | 2062 |
| 312 | Ga0075434_100579625 | 3300006871 | Unclassified | 1141 |
| 313 | Ga0075429_100000848 | 3300006880 | Bacteria | 24008 |
| 314 | Ga0075429_100082199 | 3300006880 | Bacteria | 2808 |
| 315 | Ga0075429_100121463 | 3300006880 | Unclassified | 2283 |
| 316 | Ga0075429_100134840 | 3300006880 | Bacteria | 2161 |
| 317 | Ga0068865_100009472 | 3300006881 | Bacteria | 6041 |
| 318 | Ga0068865_100032041 | 3300006881 | Bacteria | 3508 |
| 319 | Ga0068865_100064136 | 3300006881 | Bacteria | 2585 |
| 320 | Ga0068865_100186804 | 3300006881 | Bacteria | 1600 |
| 321 | Ga0068865_101045187 | 3300006881 | Unclassified | 717 |
| 322 | Ga0068865_101568618 | 3300006881 | Unclassified | 591 |
| 323 | Ga0075436_100081982 | 3300006914 | Bacteria | 2237 |
| 324 | Ga0097620_100049788 | 3300006931 | Bacteria | 4208 |
| 325 | Ga0097620_100051573 | 3300006931 | Bacteria | 4136 |
| 326 | Ga0097620_100062222 | 3300006931 | Bacteria | 3762 |
| 327 | Ga0097620_100082480 | 3300006931 | Bacteria | 3258 |
| 328 | Ga0097620_100102334 | 3300006931 | Unclassified | 2922 |
| 329 | Ga0097620_100166227 | 3300006931 | Bacteria | 2286 |
| 330 | Ga0097620_100226375 | 3300006931 | Bacteria | 1958 |
| 331 | Ga0097620_100562055 | 3300006931 | Archaea | 1235 |
| 332 | Ga0097620_100811675 | 3300006931 | Unclassified | 1023 |
| 333 | Ga0097620_100867816 | 3300006931 | Unclassified | 988 |
| 334 | Ga0097620_101314584 | 3300006931 | Bacteria | 797 |
| 335 | Ga0075435_100069532 | 3300007076 | Bacteria | 2871 |
| 336 | Ga0075435_100100364 | 3300007076 | Bacteria | 2398 |
| 337 | Ga0099795_10388181 | 3300007788 | Unclassified | 632 |
| 338 | Ga0105240_10001704 | 3300009093 | Bacteria | 37205 |
| 339 | Ga0105240_10018605 | 3300009093 | Bacteria | 9316 |
| 340 | Ga0105240_10042104 | 3300009093 | Bacteria | 5822 |
| 341 | Ga0105240_10093132 | 3300009093 | Unclassified | 3678 |
| 342 | Ga0105240_10377665 | 3300009093 | Bacteria | 1601 |
| 343 | Ga0111539_10002873 | 3300009094 | Bacteria | 22857 |
| 344 | Ga0111539_10020076 | 3300009094 | Bacteria | 8231 |
| 345 | Ga0111539_10029192 | 3300009094 | Bacteria | 6723 |
| 346 | Ga0111539_10186592 | 3300009094 | Bacteria | 2421 |
| 347 | Ga0111539_10329487 | 3300009094 | Unclassified | 1777 |
| 348 | Ga0111539_10350980 | 3300009094 | Unclassified | 1717 |
| 349 | Ga0111539_10593033 | 3300009094 | Unclassified | 1290 |
| 350 | Ga0105245_10000490 | 3300009098 | Bacteria | 36264 |
| 351 | Ga0105245_10000522 | 3300009098 | Bacteria | 35144 |
| 352 | Ga0105245_10004914 | 3300009098 | Bacteria | 11762 |
| 353 | Ga0105245_10016271 | 3300009098 | Bacteria | 6485 |
| 354 | Ga0105245_10027430 | 3300009098 | Bacteria | 5017 |
| 355 | Ga0105245_10087626 | 3300009098 | Unclassified | 2858 |
| 356 | Ga0105245_10467267 | 3300009098 | Bacteria | 1273 |
| 357 | Ga0105245_10539698 | 3300009098 | Unclassified | 1187 |
| 358 | Ga0105245_10695053 | 3300009098 | Bacteria | 1050 |
| 359 | Ga0105245_11121376 | 3300009098 | Bacteria | 833 |
| 360 | Ga0105247_10007933 | 3300009101 | Bacteria | 6490 |
| 361 | Ga0105247_10011747 | 3300009101 | Bacteria | 5268 |
| 362 | Ga0105247_10484155 | 3300009101 | Bacteria | 898 |
| 363 | Ga0114129_10122424 | 3300009147 | Bacteria | 3579 |
| 364 | Ga0105243_10053747 | 3300009148 | Bacteria | 3195 |
| 365 | Ga0105243_10210299 | 3300009148 | Bacteria | 1712 |
| 366 | Ga0105243_10948610 | 3300009148 | Bacteria | 859 |
| 367 | Ga0105241_10002584 | 3300009174 | Bacteria | 13581 |
| 368 | Ga0105241_10010673 | 3300009174 | Bacteria | 6738 |
| 369 | Ga0105241_10103271 | 3300009174 | Unclassified | 2269 |
| 370 | Ga0105241_10501724 | 3300009174 | Unclassified | 1082 |
| 371 | Ga0105242_10005159 | 3300009176 | Bacteria | 10077 |
| 372 | Ga0105242_10009827 | 3300009176 | Bacteria | 7329 |
| 373 | Ga0105242_10012044 | 3300009176 | Bacteria | 6655 |
| 374 | Ga0105242_10017966 | 3300009176 | Bacteria | 5524 |
| 375 | Ga0105242_10029204 | 3300009176 | Unclassified | 4395 |
| 376 | Ga0105242_10041982 | 3300009176 | Bacteria | 3691 |
| 377 | Ga0105242_10054066 | 3300009176 | Unclassified | 3281 |
| 378 | Ga0105242_10122919 | 3300009176 | Unclassified | 2230 |
| 379 | Ga0105242_10308842 | 3300009176 | Bacteria | 1446 |
| 380 | Ga0105242_10569550 | 3300009176 | Bacteria | 1089 |
| 381 | Ga0105242_11242678 | 3300009176 | Unclassified | 766 |
| 382 | Ga0105242_12939085 | 3300009176 | Unclassified | 527 |
| 383 | Ga0105248_10000321 | 3300009177 | Bacteria | 56694 |
| 384 | Ga0105248_10003317 | 3300009177 | Bacteria | 17871 |
| 385 | Ga0105248_10020314 | 3300009177 | Bacteria | 7359 |
| 386 | Ga0105248_10055910 | 3300009177 | Bacteria | 4427 |
| 387 | Ga0105248_10066406 | 3300009177 | Bacteria | 4050 |
| 388 | Ga0105248_10109309 | 3300009177 | Unclassified | 3117 |
| 389 | Ga0105248_10116213 | 3300009177 | Bacteria | 3017 |
| 390 | Ga0105248_10116594 | 3300009177 | Unclassified | 3012 |
| 391 | Ga0105248_10116612 | 3300009177 | Unclassified | 3012 |
| 392 | Ga0105248_10357496 | 3300009177 | Bacteria | 1644 |
| 393 | Ga0105248_10402807 | 3300009177 | Bacteria | 1540 |
| 394 | Ga0105248_10420054 | 3300009177 | Unclassified | 1506 |
| 395 | Ga0105248_10516600 | 3300009177 | Unclassified | 1347 |
| 396 | Ga0105248_10914857 | 3300009177 | Unclassified | 990 |
| 397 | Ga0105248_11840596 | 3300009177 | Bacteria | 687 |
| 398 | Ga0105248_12300244 | 3300009177 | Unclassified | 614 |
| 399 | Ga0105237_10002911 | 3300009545 | Bacteria | 20738 |
| 400 | Ga0105237_10022038 | 3300009545 | Bacteria | 6538 |
| 401 | Ga0105237_10177892 | 3300009545 | Unclassified | 2128 |
| 402 | Ga0105238_10002214 | 3300009551 | Bacteria | 19607 |
| 403 | Ga0105238_10006206 | 3300009551 | Bacteria | 11867 |
| 404 | Ga0105238_10040920 | 3300009551 | Unclassified | 4695 |
| 405 | Ga0105238_10052733 | 3300009551 | Unclassified | 4088 |
| 406 | Ga0105238_10078375 | 3300009551 | Unclassified | 3294 |
| 407 | Ga0105249_10027034 | 3300009553 | Bacteria | 5176 |
| 408 | Ga0105249_10036764 | 3300009553 | Bacteria | 4443 |
| 409 | Ga0105249_11131549 | 3300009553 | Bacteria | 853 |
| 410 | Ga0105249_12354371 | 3300009553 | Unclassified | 605 |
| 411 | Ga0105239_10003103 | 3300010375 | Bacteria | 20606 |
| 412 | Ga0105239_10030074 | 3300010375 | Bacteria | 5972 |
| 413 | Ga0105239_10058815 | 3300010375 | Bacteria | 4218 |
| 414 | Ga0105239_10242621 | 3300010375 | Unclassified | 2022 |
| 415 | Ga0105246_10009739 | 3300011119 | Bacteria | 5923 |
| 416 | Ga0105246_10030401 | 3300011119 | Bacteria | 3567 |
| 417 | Ga0105246_10077096 | 3300011119 | Bacteria | 2363 |
| 418 | Ga0105246_10762881 | 3300011119 | Bacteria | 854 |
| 419 | Ga0105246_10789595 | 3300011119 | Bacteria | 841 |
| 420 | Ga0105246_12039198 | 3300011119 | Bacteria | 554 |
| 421 | Ga0157371_10402007 | 3300013102 | Bacteria | 1002 |
| 422 | Ga0157371_10877454 | 3300013102 | Unclassified | 679 |
| 423 | Ga0157370_10016223 | 3300013104 | Bacteria | 7550 |
| 424 | Ga0157370_10041402 | 3300013104 | Bacteria | 4444 |
| 425 | Ga0157369_10000876 | 3300013105 | Bacteria | 38431 |
| 426 | Ga0157369_10014635 | 3300013105 | Bacteria | 8850 |
| 427 | Ga0157369_10140840 | 3300013105 | Unclassified | 2552 |
| 428 | Ga0157374_10005784 | 3300013296 | Bacteria | 10442 |
| 429 | Ga0157374_10115853 | 3300013296 | Bacteria | 2582 |
| 430 | Ga0157374_10252003 | 3300013296 | Unclassified | 1737 |
| 431 | Ga0157374_10433913 | 3300013296 | Bacteria | 1313 |
| 432 | Ga0157374_10505169 | 3300013296 | Bacteria | 1214 |
| 433 | Ga0157378_10000308 | 3300013297 | Bacteria | 47674 |
| 434 | Ga0157378_10014594 | 3300013297 | Bacteria | 6878 |
| 435 | Ga0157378_10100836 | 3300013297 | Bacteria | 2636 |
| 436 | Ga0157378_10217603 | 3300013297 | Bacteria | 1814 |
| 437 | Ga0157378_10523663 | 3300013297 | Unclassified | 1187 |
| 438 | Ga0163162_10003959 | 3300013306 | Bacteria | 14210 |
| 439 | Ga0163162_10223272 | 3300013306 | Unclassified | 2014 |
| 440 | Ga0163162_10660136 | 3300013306 | Bacteria | 1169 |
| 441 | Ga0163162_11241604 | 3300013306 | Bacteria | 846 |
| 442 | Ga0157372_10003294 | 3300013307 | Bacteria | 17440 |
| 443 | Ga0157372_10004833 | 3300013307 | Bacteria | 14326 |
| 444 | Ga0157372_10062346 | 3300013307 | Bacteria | 4177 |
| 445 | Ga0157372_10114337 | 3300013307 | Bacteria | 3094 |
| 446 | Ga0157372_10185733 | 3300013307 | Unclassified | 2407 |
| 447 | Ga0157372_10353338 | 3300013307 | Bacteria | 1712 |
| 448 | Ga0157375_10000347 | 3300013308 | Bacteria | 41857 |
| 449 | Ga0157375_10003107 | 3300013308 | Bacteria | 14416 |
| 450 | Ga0157375_10008198 | 3300013308 | Bacteria | 9150 |
| 451 | Ga0157375_10021880 | 3300013308 | Bacteria | 5876 |
| 452 | Ga0157375_10057166 | 3300013308 | Bacteria | 3855 |
| 453 | Ga0157375_10066427 | 3300013308 | Unclassified | 3601 |
| 454 | Ga0157375_10106500 | 3300013308 | Unclassified | 2895 |
| 455 | Ga0157375_10252728 | 3300013308 | Unclassified | 1923 |
| 456 | Ga0157375_10274903 | 3300013308 | Bacteria | 1847 |
| 457 | Ga0157375_10363143 | 3300013308 | Bacteria | 1614 |
| 458 | Ga0157375_10396524 | 3300013308 | Unclassified | 1547 |
| 459 | Ga0157375_10758144 | 3300013308 | Unclassified | 1121 |
| 460 | Ga0157375_11006411 | 3300013308 | Bacteria | 973 |
| 461 | Ga0157375_11138633 | 3300013308 | Unclassified | 914 |
| 462 | Ga0157375_11370937 | 3300013308 | Bacteria | 833 |
| 463 | Ga0163163_10000939 | 3300014325 | Bacteria | 24726 |
| 464 | Ga0163163_10011258 | 3300014325 | Bacteria | 8106 |
| 465 | Ga0163163_10033586 | 3300014325 | Unclassified | 4964 |
| 466 | Ga0163163_10038038 | 3300014325 | Bacteria | 4685 |
| 467 | Ga0163163_10049213 | 3300014325 | Bacteria | 4147 |
| 468 | Ga0163163_10052171 | 3300014325 | Bacteria | 4034 |
| 469 | Ga0163163_10081373 | 3300014325 | Bacteria | 3240 |
| 470 | Ga0163163_10176582 | 3300014325 | Bacteria | 2183 |
| 471 | Ga0163163_10320310 | 3300014325 | Bacteria | 1604 |
| 472 | Ga0163163_11499709 | 3300014325 | Bacteria | 736 |
| 473 | Ga0157380_10000747 | 3300014326 | Bacteria | 20267 |
| 474 | Ga0157380_10004399 | 3300014326 | Bacteria | 9766 |
| 475 | Ga0157380_10020826 | 3300014326 | Bacteria | 4909 |
| 476 | Ga0157380_11652493 | 3300014326 | Bacteria | 697 |
| 477 | Ga0157377_10006322 | 3300014745 | Bacteria | 5640 |
| 478 | Ga0157377_10068537 | 3300014745 | Bacteria | 2045 |
| 479 | Ga0157377_10130884 | 3300014745 | Unclassified | 1532 |
| 480 | Ga0157377_10204645 | 3300014745 | Bacteria | 1255 |
| 481 | Ga0157377_10644502 | 3300014745 | Unclassified | 762 |
| 482 | Ga0157379_10000069 | 3300014968 | Bacteria | 64939 |
| 483 | Ga0157379_10033202 | 3300014968 | Unclassified | 4602 |
| 484 | Ga0157379_10059158 | 3300014968 | Bacteria | 3426 |
| 485 | Ga0157379_10131702 | 3300014968 | Unclassified | 2251 |
| 486 | Ga0157379_10346451 | 3300014968 | Unclassified | 1359 |
| 487 | Ga0157379_11910660 | 3300014968 | Unclassified | 585 |
| 488 | Ga0157376_10055728 | 3300014969 | Bacteria | 3299 |
| 489 | Ga0157376_10083130 | 3300014969 | Bacteria | 2753 |
| 490 | Ga0157376_10095614 | 3300014969 | Bacteria | 2584 |
| 491 | Ga0157376_10270348 | 3300014969 | Bacteria | 1596 |
| 492 | Ga0157376_10300089 | 3300014969 | Unclassified | 1520 |
| 493 | Ga0157376_10323717 | 3300014969 | Unclassified | 1466 |
| 494 | Ga0157376_10402006 | 3300014969 | Unclassified | 1325 |
| 495 | Ga0157376_10418717 | 3300014969 | Bacteria | 1299 |
| 496 | Ga0157376_10540085 | 3300014969 | Unclassified | 1152 |
| 497 | Ga0157376_11120896 | 3300014969 | Bacteria | 813 |
| 498 | Ga0163161_10015899 | 3300017792 | Bacteria | 5250 |
| 499 | Ga0163161_10061887 | 3300017792 | Bacteria | 2726 |
| 500 | Ga0213876_10124532 | 3300021384 | Bacteria | 1369 |
| 501 | Ga0213876_10149847 | 3300021384 | Unclassified | 1240 |
| 502 | Ga0213876_10367694 | 3300021384 | Unclassified | 765 |
| 503 | Ga0213875_10003847 | 3300021388 | Bacteria | 8428 |
| 504 | Ga0213875_10019944 | 3300021388 | Unclassified | 3220 |
| 505 | Ga0213875_10030113 | 3300021388 | Unclassified | 2571 |
| 506 | Ga0213875_10075187 | 3300021388 | Unclassified | 1576 |
| 507 | Ga0207697_10000680 | 3300025315 | Bacteria | 19332 |
| 508 | Ga0207697_10020509 | 3300025315 | Bacteria | 2705 |
| 509 | Ga0207656_10017509 | 3300025321 | Unclassified | 2809 |
| 510 | Ga0207682_10002289 | 3300025893 | Bacteria | 8626 |
| 511 | Ga0207682_10007390 | 3300025893 | Bacteria | 4379 |
| 512 | Ga0207682_10072993 | 3300025893 | Bacteria | 1457 |
| 513 | Ga0207642_10035791 | 3300025899 | Unclassified | 2125 |
| 514 | Ga0207642_10639791 | 3300025899 | Unclassified | 665 |
| 515 | Ga0207710_10010415 | 3300025900 | Unclassified | 3915 |
| 516 | Ga0207710_10243436 | 3300025900 | Bacteria | 898 |
| 517 | Ga0207688_10000268 | 3300025901 | Bacteria | 23725 |
| 518 | Ga0207688_10226004 | 3300025901 | Unclassified | 1129 |
| 519 | Ga0207680_10004745 | 3300025903 | Bacteria | 6469 |
| 520 | Ga0207680_10042787 | 3300025903 | Bacteria | 2652 |
| 521 | Ga0207680_10707935 | 3300025903 | Unclassified | 722 |
| 522 | Ga0207699_10215083 | 3300025906 | Bacteria | 1309 |
| 523 | Ga0207699_10352261 | 3300025906 | Bacteria | 1039 |
| 524 | Ga0207645_10002877 | 3300025907 | Bacteria | 13319 |
| 525 | Ga0207645_10012264 | 3300025907 | Bacteria | 5822 |
| 526 | Ga0207645_10065050 | 3300025907 | Unclassified | 2330 |
| 527 | Ga0207645_10211746 | 3300025907 | Bacteria | 1277 |
| 528 | Ga0207643_10000708 | 3300025908 | Bacteria | 20702 |
| 529 | Ga0207643_10011490 | 3300025908 | Bacteria | 4782 |
| 530 | Ga0207643_10022495 | 3300025908 | Bacteria | 3471 |
| 531 | Ga0207643_10055257 | 3300025908 | Bacteria | 2258 |
| 532 | Ga0207643_10086373 | 3300025908 | Unclassified | 1823 |
| 533 | Ga0207705_10238597 | 3300025909 | Bacteria | 1384 |
| 534 | Ga0207654_10002411 | 3300025911 | Bacteria | 9551 |
| 535 | Ga0207654_10004960 | 3300025911 | Bacteria | 6729 |
| 536 | Ga0207654_10192375 | 3300025911 | Bacteria | 1338 |
| 537 | Ga0207654_10423316 | 3300025911 | Unclassified | 930 |
| 538 | Ga0207707_10000635 | 3300025912 | Bacteria | 34780 |
| 539 | Ga0207707_10395146 | 3300025912 | Bacteria | 1188 |
| 540 | Ga0207707_10604367 | 3300025912 | Unclassified | 928 |
| 541 | Ga0207695_10002273 | 3300025913 | Bacteria | 28785 |
| 542 | Ga0207695_10005994 | 3300025913 | Bacteria | 15896 |
| 543 | Ga0207695_10201629 | 3300025913 | Bacteria | 1903 |
| 544 | Ga0207695_10262397 | 3300025913 | Bacteria | 1625 |
| 545 | Ga0207695_10302820 | 3300025913 | Unclassified | 1490 |
| 546 | Ga0207695_11043779 | 3300025913 | Unclassified | 697 |
| 547 | Ga0207695_11155704 | 3300025913 | Unclassified | 654 |
| 548 | Ga0207671_10004044 | 3300025914 | Bacteria | 14220 |
| 549 | Ga0207671_10027866 | 3300025914 | Unclassified | 4222 |
| 550 | Ga0207663_10316061 | 3300025916 | Unclassified | 1172 |
| 551 | Ga0207660_10018851 | 3300025917 | Unclassified | 4607 |
| 552 | Ga0207662_10303829 | 3300025918 | Bacteria | 1061 |
| 553 | Ga0207662_10318844 | 3300025918 | Unclassified | 1037 |
| 554 | Ga0207657_10094716 | 3300025919 | Bacteria | 2486 |
| 555 | Ga0207649_10127973 | 3300025920 | Bacteria | 1721 |
| 556 | Ga0207649_10178096 | 3300025920 | Unclassified | 1486 |
| 557 | Ga0207649_10572987 | 3300025920 | Bacteria | 866 |
| 558 | Ga0207649_10587052 | 3300025920 | Bacteria | 856 |
| 559 | Ga0207652_10004226 | 3300025921 | Bacteria | 11716 |
| 560 | Ga0207652_11040624 | 3300025921 | Bacteria | 718 |
| 561 | Ga0207681_10024487 | 3300025923 | Bacteria | 3875 |
| 562 | Ga0207681_10092192 | 3300025923 | Unclassified | 2165 |
| 563 | Ga0207681_10358030 | 3300025923 | Unclassified | 1169 |
| 564 | Ga0207681_10669220 | 3300025923 | Unclassified | 861 |
| 565 | Ga0207694_10006135 | 3300025924 | Bacteria | 9181 |
| 566 | Ga0207694_10006183 | 3300025924 | Bacteria | 9144 |
| 567 | Ga0207694_10021682 | 3300025924 | Unclassified | 4868 |
| 568 | Ga0207694_10049781 | 3300025924 | Bacteria | 3243 |
| 569 | Ga0207694_10064694 | 3300025924 | Bacteria | 2850 |
| 570 | Ga0207694_10789128 | 3300025924 | Unclassified | 802 |
| 571 | Ga0207650_10000669 | 3300025925 | Bacteria | 26940 |
| 572 | Ga0207650_10014493 | 3300025925 | Bacteria | 5477 |
| 573 | Ga0207650_10021187 | 3300025925 | Bacteria | 4595 |
| 574 | Ga0207650_10026622 | 3300025925 | Unclassified | 4127 |
| 575 | Ga0207659_10009983 | 3300025926 | Bacteria | 5946 |
| 576 | Ga0207659_10021620 | 3300025926 | Bacteria | 4274 |
| 577 | Ga0207659_10145347 | 3300025926 | Bacteria | 1846 |
| 578 | Ga0207659_10165422 | 3300025926 | Bacteria | 1741 |
| 579 | Ga0207659_10172113 | 3300025926 | Bacteria | 1709 |
| 580 | Ga0207687_10001267 | 3300025927 | Bacteria | 17279 |
| 581 | Ga0207687_10001373 | 3300025927 | Bacteria | 16634 |
| 582 | Ga0207687_10006349 | 3300025927 | Bacteria | 7812 |
| 583 | Ga0207687_10010444 | 3300025927 | Bacteria | 6066 |
| 584 | Ga0207687_10024622 | 3300025927 | Bacteria | 4023 |
| 585 | Ga0207687_10036743 | 3300025927 | Unclassified | 3337 |
| 586 | Ga0207687_10641245 | 3300025927 | Unclassified | 898 |
| 587 | Ga0207687_10680019 | 3300025927 | Bacteria | 872 |
| 588 | Ga0207687_10699494 | 3300025927 | Unclassified | 860 |
| 589 | Ga0207700_10025932 | 3300025928 | Bacteria | 4080 |
| 590 | Ga0207700_10041492 | 3300025928 | Unclassified | 3367 |
| 591 | Ga0207700_10056548 | 3300025928 | Bacteria | 2954 |
| 592 | Ga0207700_10118778 | 3300025928 | Bacteria | 2140 |
| 593 | Ga0207700_10123579 | 3300025928 | Bacteria | 2102 |
| 594 | Ga0207700_10763668 | 3300025928 | Unclassified | 864 |
| 595 | Ga0207664_10112471 | 3300025929 | Bacteria | 2267 |
| 596 | Ga0207664_10492852 | 3300025929 | Unclassified | 1097 |
| 597 | Ga0207644_10010085 | 3300025931 | Bacteria | 6222 |
| 598 | Ga0207644_10018210 | 3300025931 | Bacteria | 4749 |
| 599 | Ga0207644_10613032 | 3300025931 | Bacteria | 904 |
| 600 | Ga0207690_10046273 | 3300025932 | Bacteria | 2881 |
| 601 | Ga0207690_10161180 | 3300025932 | Bacteria | 1672 |
| 602 | Ga0207690_10387051 | 3300025932 | Bacteria | 1112 |
| 603 | Ga0207706_10026543 | 3300025933 | Bacteria | 5184 |
| 604 | Ga0207706_10028531 | 3300025933 | Bacteria | 4984 |
| 605 | Ga0207706_10171176 | 3300025933 | Bacteria | 1908 |
| 606 | Ga0207706_10253596 | 3300025933 | Bacteria | 1536 |
| 607 | Ga0207686_10005592 | 3300025934 | Bacteria | 6738 |
| 608 | Ga0207686_10026596 | 3300025934 | Unclassified | 3377 |
| 609 | Ga0207686_10040325 | 3300025934 | Unclassified | 2838 |
| 610 | Ga0207686_10075747 | 3300025934 | Unclassified | 2179 |
| 611 | Ga0207686_10140532 | 3300025934 | Bacteria | 1668 |
| 612 | Ga0207686_10212577 | 3300025934 | Bacteria | 1391 |
| 613 | Ga0207686_10243997 | 3300025934 | Bacteria | 1309 |
| 614 | Ga0207686_10498818 | 3300025934 | Unclassified | 944 |
| 615 | Ga0207686_10528170 | 3300025934 | Bacteria | 919 |
| 616 | Ga0207686_10769060 | 3300025934 | Unclassified | 770 |
| 617 | Ga0207709_10008144 | 3300025935 | Bacteria | 5804 |
| 618 | Ga0207709_10219872 | 3300025935 | Bacteria | 1369 |
| 619 | Ga0207670_10040975 | 3300025936 | Bacteria | 3043 |
| 620 | Ga0207670_10091049 | 3300025936 | Bacteria | 2156 |
| 621 | Ga0207670_10112716 | 3300025936 | Bacteria | 1963 |
| 622 | Ga0207670_10255574 | 3300025936 | Bacteria | 1356 |
| 623 | Ga0207670_10261196 | 3300025936 | Bacteria | 1342 |
| 624 | Ga0207670_10326963 | 3300025936 | Bacteria | 1208 |
| 625 | Ga0207670_10335117 | 3300025936 | Unclassified | 1194 |
| 626 | Ga0207670_11063657 | 3300025936 | Unclassified | 682 |
| 627 | Ga0207669_10028286 | 3300025937 | Bacteria | 3082 |
| 628 | Ga0207669_10032274 | 3300025937 | Bacteria | 2939 |
| 629 | Ga0207669_10475972 | 3300025937 | Unclassified | 994 |
| 630 | Ga0207669_10533619 | 3300025937 | Unclassified | 944 |
| 631 | Ga0207704_10006007 | 3300025938 | Bacteria | 5628 |
| 632 | Ga0207704_10022147 | 3300025938 | Bacteria | 3398 |
| 633 | Ga0207704_10034022 | 3300025938 | Bacteria | 2905 |
| 634 | Ga0207704_10038267 | 3300025938 | Bacteria | 2780 |
| 635 | Ga0207704_10126208 | 3300025938 | Unclassified | 1762 |
| 636 | Ga0207704_10180555 | 3300025938 | Bacteria | 1525 |
| 637 | Ga0207704_10631354 | 3300025938 | Unclassified | 880 |
| 638 | Ga0207704_10644244 | 3300025938 | Unclassified | 872 |
| 639 | Ga0207691_10000562 | 3300025940 | Bacteria | 37130 |
| 640 | Ga0207691_10001885 | 3300025940 | Bacteria | 20498 |
| 641 | Ga0207691_10080977 | 3300025940 | Unclassified | 2919 |
| 642 | Ga0207691_10091658 | 3300025940 | Unclassified | 2723 |
| 643 | Ga0207691_10113159 | 3300025940 | Bacteria | 2412 |
| 644 | Ga0207691_10126468 | 3300025940 | Bacteria | 2261 |
| 645 | Ga0207711_10001792 | 3300025941 | Bacteria | 19659 |
| 646 | Ga0207711_10003178 | 3300025941 | Bacteria | 14324 |
| 647 | Ga0207711_10008497 | 3300025941 | Bacteria | 8590 |
| 648 | Ga0207711_10016304 | 3300025941 | Bacteria | 6172 |
| 649 | Ga0207711_10029831 | 3300025941 | Bacteria | 4601 |
| 650 | Ga0207711_10084682 | 3300025941 | Bacteria | 2776 |
| 651 | Ga0207711_10201454 | 3300025941 | Bacteria | 1816 |
| 652 | Ga0207711_10236279 | 3300025941 | Bacteria | 1675 |
| 653 | Ga0207711_10299510 | 3300025941 | Unclassified | 1483 |
| 654 | Ga0207711_10300216 | 3300025941 | Unclassified | 1481 |
| 655 | Ga0207711_10652017 | 3300025941 | Bacteria | 982 |
| 656 | Ga0207711_10849519 | 3300025941 | Unclassified | 849 |
| 657 | Ga0207711_11648641 | 3300025941 | Bacteria | 585 |
| 658 | Ga0207689_10003413 | 3300025942 | Bacteria | 14512 |
| 659 | Ga0207689_10010340 | 3300025942 | Bacteria | 8039 |
| 660 | Ga0207689_10038343 | 3300025942 | Bacteria | 3969 |
| 661 | Ga0207689_10093831 | 3300025942 | Bacteria | 2465 |
| 662 | Ga0207689_10201546 | 3300025942 | Bacteria | 1643 |
| 663 | Ga0207689_10297012 | 3300025942 | Bacteria | 1339 |
| 664 | Ga0207661_10005767 | 3300025944 | Bacteria | 8730 |
| 665 | Ga0207661_10061986 | 3300025944 | Bacteria | 3024 |
| 666 | Ga0207661_10062203 | 3300025944 | Bacteria | 3019 |
| 667 | Ga0207661_10205014 | 3300025944 | Bacteria | 1735 |
| 668 | Ga0207661_10221553 | 3300025944 | Bacteria | 1672 |
| 669 | Ga0207661_11033166 | 3300025944 | Unclassified | 757 |
| 670 | Ga0207679_10001709 | 3300025945 | Bacteria | 13694 |
| 671 | Ga0207679_10007555 | 3300025945 | Bacteria | 6900 |
| 672 | Ga0207679_10015089 | 3300025945 | Bacteria | 5095 |
| 673 | Ga0207679_10032416 | 3300025945 | Bacteria | 3668 |
| 674 | Ga0207679_10113247 | 3300025945 | Bacteria | 2145 |
| 675 | Ga0207679_10115142 | 3300025945 | Bacteria | 2130 |
| 676 | Ga0207679_10219413 | 3300025945 | Unclassified | 1599 |
| 677 | Ga0207679_11417834 | 3300025945 | Unclassified | 637 |
| 678 | Ga0207667_10002906 | 3300025949 | Bacteria | 21279 |
| 679 | Ga0207667_10008651 | 3300025949 | Bacteria | 12071 |
| 680 | Ga0207667_10017758 | 3300025949 | Bacteria | 8002 |
| 681 | Ga0207667_10215396 | 3300025949 | Bacteria | 1968 |
| 682 | Ga0207667_10321695 | 3300025949 | Unclassified | 1580 |
| 683 | Ga0207651_10025209 | 3300025960 | Bacteria | 3694 |
| 684 | Ga0207651_10057208 | 3300025960 | Bacteria | 2688 |
| 685 | Ga0207651_10082478 | 3300025960 | Unclassified | 2321 |
| 686 | Ga0207651_10221699 | 3300025960 | Bacteria | 1529 |
| 687 | Ga0207651_10401136 | 3300025960 | Bacteria | 1166 |
| 688 | Ga0207651_10518741 | 3300025960 | Bacteria | 1032 |
| 689 | Ga0207712_10031838 | 3300025961 | Unclassified | 3556 |
| 690 | Ga0207712_10168242 | 3300025961 | Unclassified | 1711 |
| 691 | Ga0207668_10028073 | 3300025972 | Bacteria | 3675 |
| 692 | Ga0207668_10761071 | 3300025972 | Unclassified | 855 |
| 693 | Ga0207668_10770374 | 3300025972 | Unclassified | 850 |
| 694 | Ga0207658_10006244 | 3300025986 | Bacteria | 8143 |
| 695 | Ga0207658_10012202 | 3300025986 | Bacteria | 5864 |
| 696 | Ga0207658_10543745 | 3300025986 | Bacteria | 1039 |
| 697 | Ga0207658_11149168 | 3300025986 | Bacteria | 710 |
| 698 | Ga0207658_11306128 | 3300025986 | Unclassified | 663 |
| 699 | Ga0207677_10012860 | 3300026023 | Bacteria | 4832 |
| 700 | Ga0207677_10122534 | 3300026023 | Bacteria | 1959 |
| 701 | Ga0207677_11591547 | 3300026023 | Unclassified | 605 |
| 702 | Ga0207703_10009873 | 3300026035 | Bacteria | 7487 |
| 703 | Ga0207703_10053354 | 3300026035 | Bacteria | 3286 |
| 704 | Ga0207703_10092763 | 3300026035 | Bacteria | 2542 |
| 705 | Ga0207703_10149084 | 3300026035 | Bacteria | 2038 |
| 706 | Ga0207703_10173058 | 3300026035 | Unclassified | 1900 |
| 707 | Ga0207703_10192558 | 3300026035 | Bacteria | 1807 |
| 708 | Ga0207703_10197336 | 3300026035 | Unclassified | 1786 |
| 709 | Ga0207703_10278377 | 3300026035 | Unclassified | 1518 |
| 710 | Ga0207703_10369674 | 3300026035 | Unclassified | 1324 |
| 711 | Ga0207703_10461619 | 3300026035 | Bacteria | 1188 |
| 712 | Ga0207703_10581362 | 3300026035 | Bacteria | 1058 |
| 713 | Ga0207703_11058671 | 3300026035 | Unclassified | 779 |
| 714 | Ga0207703_11395150 | 3300026035 | Unclassified | 674 |
| 715 | Ga0207703_11476789 | 3300026035 | Unclassified | 654 |
| 716 | Ga0207639_10012687 | 3300026041 | Bacteria | 5876 |
| 717 | Ga0207639_10023802 | 3300026041 | Unclassified | 4425 |
| 718 | Ga0207639_10226952 | 3300026041 | Bacteria | 1616 |
| 719 | Ga0207678_10053034 | 3300026067 | Bacteria | 3496 |
| 720 | Ga0207708_10021776 | 3300026075 | Bacteria | 4837 |
| 721 | Ga0207708_10083182 | 3300026075 | Unclassified | 2460 |
| 722 | Ga0207702_10008257 | 3300026078 | Bacteria | 8799 |
| 723 | Ga0207702_10009009 | 3300026078 | Bacteria | 8403 |
| 724 | Ga0207702_10068042 | 3300026078 | Unclassified | 3059 |
| 725 | Ga0207702_10342219 | 3300026078 | Bacteria | 1429 |
| 726 | Ga0207702_10349206 | 3300026078 | Bacteria | 1415 |
| 727 | Ga0207641_10001413 | 3300026088 | Bacteria | 23683 |
| 728 | Ga0207641_10075407 | 3300026088 | Bacteria | 2912 |
| 729 | Ga0207641_10079521 | 3300026088 | Bacteria | 2842 |
| 730 | Ga0207641_10080625 | 3300026088 | Unclassified | 2824 |
| 731 | Ga0207648_10004726 | 3300026089 | Bacteria | 13912 |
| 732 | Ga0207648_10040801 | 3300026089 | Bacteria | 4077 |
| 733 | Ga0207648_10059754 | 3300026089 | Unclassified | 3325 |
| 734 | Ga0207648_10171259 | 3300026089 | Bacteria | 1919 |
| 735 | Ga0207648_10769211 | 3300026089 | Bacteria | 895 |
| 736 | Ga0207648_10924021 | 3300026089 | Bacteria | 816 |
| 737 | Ga0207676_10038566 | 3300026095 | Unclassified | 3648 |
| 738 | Ga0207676_10052268 | 3300026095 | Bacteria | 3193 |
| 739 | Ga0207676_10059984 | 3300026095 | Bacteria | 3006 |
| 740 | Ga0207676_10282973 | 3300026095 | Bacteria | 1506 |
| 741 | Ga0207676_11111832 | 3300026095 | Unclassified | 781 |
| 742 | Ga0207674_10000657 | 3300026116 | Bacteria | 44932 |
| 743 | Ga0207674_10014434 | 3300026116 | Bacteria | 8726 |
| 744 | Ga0207674_10021150 | 3300026116 | Bacteria | 7013 |
| 745 | Ga0207674_10413005 | 3300026116 | Unclassified | 1304 |
| 746 | Ga0207674_10485023 | 3300026116 | Bacteria | 1195 |
| 747 | Ga0207674_10622117 | 3300026116 | Bacteria | 1043 |
| 748 | Ga0207675_100013958 | 3300026118 | Bacteria | 7489 |
| 749 | Ga0207675_100093440 | 3300026118 | Unclassified | 2829 |
| 750 | Ga0207675_100227230 | 3300026118 | Unclassified | 1800 |
| 751 | Ga0207675_100324177 | 3300026118 | Bacteria | 1504 |
| 752 | Ga0207675_100387380 | 3300026118 | Bacteria | 1375 |
| 753 | Ga0207683_10042732 | 3300026121 | Bacteria | 3959 |
| 754 | Ga0207683_10067607 | 3300026121 | Bacteria | 3153 |
| 755 | Ga0207683_10245443 | 3300026121 | Bacteria | 1633 |
| 756 | Ga0207683_10357595 | 3300026121 | Bacteria | 1341 |
| 757 | Ga0207683_10426451 | 3300026121 | Bacteria | 1222 |
| 758 | Ga0207683_10523042 | 3300026121 | Unclassified | 1096 |
| 759 | Ga0207683_10788529 | 3300026121 | Bacteria | 882 |
| 760 | Ga0207683_11125553 | 3300026121 | Unclassified | 728 |
| 761 | Ga0207698_10048812 | 3300026142 | Unclassified | 3216 |
| 762 | Ga0207698_10218529 | 3300026142 | Bacteria | 1720 |
| 763 | Ga0207698_10904257 | 3300026142 | Bacteria | 890 |
| 764 | Ga0207698_10993898 | 3300026142 | Unclassified | 849 |
| 765 | Ga0207698_11560071 | 3300026142 | Unclassified | 676 |
| 766 | Ga0207428_10064965 | 3300027907 | Bacteria | 2880 |
| 767 | Ga0268266_10019693 | 3300028379 | Bacteria | 5750 |
| 768 | Ga0268265_10108753 | 3300028380 | Bacteria | 2258 |
| 769 | Ga0268265_10118832 | 3300028380 | Unclassified | 2174 |
| 770 | Ga0268265_10338703 | 3300028380 | Unclassified | 1369 |
| 771 | Ga0268265_10914844 | 3300028380 | Unclassified | 862 |
| 772 | Ga0268265_11079732 | 3300028380 | Bacteria | 796 |
| 773 | Ga0268264_10011988 | 3300028381 | Bacteria | 7139 |
| 774 | Ga0268264_10131783 | 3300028381 | Bacteria | 2217 |
| 775 | Ga0268264_10229241 | 3300028381 | Unclassified | 1714 |
| 776 | Ga0268264_10329445 | 3300028381 | Unclassified | 1446 |
| 777 | Ga0268264_10409493 | 3300028381 | Unclassified | 1305 |
| 778 | Ga0268264_10457519 | 3300028381 | Bacteria | 1238 |
| 779 | Ga0268264_11009834 | 3300028381 | Bacteria | 839 |
| 780 | Ga0265338_10103399 | 3300028800 | Bacteria | 2314 |
| 781 | Ga0265316_10873973 | 3300031344 | Unclassified | 629 |
| 782 | Ga0265313_10001183 | 3300031595 | Bacteria | 24958 |
| 783 | Ga0265314_10000503 | 3300031711 | Bacteria | 50401 |
| 784 | Ga0265314_10171977 | 3300031711 | Unclassified | 1307 |
| 785 | Ga0373928_0024123 | 3300035084 | Unclassified | 1302 |
| 786 | Ga0373934_0005371 | 3300035086 | Bacteria | 4746 |
| 787 | Ga0373934_0007079 | 3300035086 | Bacteria | 4163 |
| 788 | Ga0373932_0127083 | 3300035112 | Bacteria | 856 |
| 789 | Ga0373936_0141820 | 3300035113 | Bacteria | 1038 |
| 790 | Ga0373953_0009327 | 3300035117 | Bacteria | 3371 |
| 791 | Ga0373953_0022397 | 3300035117 | Unclassified | 2382 |
| 792 | Ga0373953_0079172 | 3300035117 | Bacteria | 1364 |
| 793 | Ga0373953_0352498 | 3300035117 | Unclassified | 645 |
| 794 | Ga0373954_0001361 | 3300035118 | Bacteria | 9859 |
| 795 | Ga0373954_0004614 | 3300035118 | Bacteria | 5937 |
| 796 | Ga0373954_0059276 | 3300035118 | Bacteria | 1804 |
| 797 | Ga0373956_0356171 | 3300035119 | Unclassified | 698 |
| 798 | Ga0373957_0019616 | 3300035120 | Unclassified | 2382 |
| 799 | Ga0373957_0090701 | 3300035120 | Bacteria | 1215 |
| 800 | Ga0373943_0040004 | 3300035170 | Bacteria | 2262 |
| 801 | Ga0373943_0235114 | 3300035170 | Unclassified | 1025 |
| 802 | Ga0373943_0375344 | 3300035170 | Unclassified | 818 |
| 803 | Ga0373955_0017079 | 3300035172 | Bacteria | 3584 |
| 804 | Ga0373955_0199873 | 3300035172 | Bacteria | 1190 |
| 805 | Ga0373955_0353018 | 3300035172 | Unclassified | 891 |
| 806 | Ga0373955_0432788 | 3300035172 | Unclassified | 801 |
| 807 | Ga0373962_0085847 | 3300035242 | Bacteria | 962 |
| 808 | Ga0373924_0129949 | 3300035410 | Bacteria | 1096 |
| 809 | Ga0373931_0358531 | 3300035691 | Unclassified | 914 |
| 810 | Ga0373931_0386001 | 3300035691 | Bacteria | 884 |
| 811 | Ga0373931_0701082 | 3300035691 | Bacteria | 669 |
| 812 | Ga0373935_0298901 | 3300035692 | Unclassified | 1137 |
| 813 | Ga0373927_0329918 | 3300035695 | Bacteria | 1005 |
| 814 | Ga0373933_0065585 | 3300035724 | Bacteria | 2199 |
| 815 | Ga0373933_0089691 | 3300035724 | Bacteria | 1896 |
| 816 | Ga0373933_0097681 | 3300035724 | Unclassified | 1819 |
| 817 | Ga0373933_0109497 | 3300035724 | Bacteria | 1722 |
| 818 | Ga0373933_0275211 | 3300035724 | Bacteria | 1087 |
| 819 | Ga0373947_0707656 | 3300035725 | Unclassified | 687 |
| 820 | Ga0373937_0006723 | 3300036401 | Bacteria | 9919 |
| 821 | Ga0373937_0019146 | 3300036401 | Bacteria | 6127 |
| 822 | Ga0373937_0033755 | 3300036401 | Bacteria | 4650 |
| 823 | Ga0373937_0045199 | 3300036401 | Bacteria | 4023 |
| 824 | Ga0373937_0166293 | 3300036401 | Bacteria | 2068 |
| 825 | Ga0373937_0187248 | 3300036401 | Unclassified | 1944 |
| 826 | Ga0373937_0358356 | 3300036401 | Unclassified | 1382 |
| 827 | Ga0373937_0389919 | 3300036401 | Bacteria | 1321 |
| 828 | Ga0373937_0820900 | 3300036401 | Bacteria | 878 |
| 829 | Ga0373937_1015101 | 3300036401 | Bacteria | 778 |
| 830 | Ga0373925_0113445 | 3300037068 | Unclassified | 2096 |
| 831 | Ga0373925_0116741 | 3300037068 | Unclassified | 2067 |
| 832 | Ga0373925_0251595 | 3300037068 | Bacteria | 1417 |
| 833 | Ga0436364_0352191 | 3300037853 | Bacteria | 3858 |
| 834 | Ga0436364_0460607 | 3300037853 | Bacteria | 6700 |
| 835 | Ga0436364_0488163 | 3300037853 | Bacteria | 13461 |
| 836 | Ga0436365_0093359 | 3300039437 | Bacteria | 1718 |
| 837 | Ga0436365_0424101 | 3300039437 | Unclassified | 1617 |
| 838 | Ga0436365_1249443 | 3300039437 | Bacteria | 4183 |
| 839 | Ga0436363_0897675 | 3300039450 | Bacteria | 1161 |
| 840 | Ga0450905_083775 | 3300042142 | Unclassified | 557 |
| 841 | Ga0439435_0194322 | 3300042436 | Unclassified | 667 |
| 842 | Ga0453684_1802526 | 3300044712 | Unclassified | 622 |
| 843 | Ga0451576_0145652 | 3300045051 | Bacteria | 2469 |
| 844 | Ga0451576_0740932 | 3300045051 | Bacteria | 1032 |
| 845 | Ga0495592_0011351 | 3300046454 | Bacteria | 6738 |
| 846 | Ga0495592_0030371 | 3300046454 | Unclassified | 4088 |
| 847 | Ga0495629_0346023 | 3300046459 | Unclassified | 1015 |
| 848 | Ga0495629_0379356 | 3300046459 | Unclassified | 962 |
| 849 | Ga0495629_0448070 | 3300046459 | Bacteria | 874 |
| 850 | Ga0495629_0818158 | 3300046459 | Bacteria | 614 |
| 851 | Ga0495651_0148029 | 3300046462 | Bacteria | 1696 |
| 852 | Ga0495651_0699123 | 3300046462 | Unclassified | 632 |
| 853 | Ga0495653_0351977 | 3300046463 | Unclassified | 947 |
| 854 | Ga0495580_0053881 | 3300046472 | Bacteria | 2838 |
| 855 | Ga0495580_0138395 | 3300046472 | Unclassified | 1688 |
| 856 | Ga0495580_0150749 | 3300046472 | Bacteria | 1611 |
| 857 | Ga0495580_0156132 | 3300046472 | Unclassified | 1580 |
| 858 | Ga0495580_0622016 | 3300046472 | Unclassified | 712 |
| 859 | Ga0495582_0011640 | 3300046473 | Bacteria | 4848 |
| 860 | Ga0495582_0172643 | 3300046473 | Bacteria | 1231 |
| 861 | Ga0495582_0223324 | 3300046473 | Bacteria | 1078 |
| 862 | Ga0495582_0482769 | 3300046473 | Unclassified | 716 |
| 863 | Ga0495639_0170245 | 3300046475 | Bacteria | 1057 |
| 864 | Ga0495639_0324760 | 3300046475 | Bacteria | 770 |
| 865 | Ga0495662_0595821 | 3300046476 | Unclassified | 540 |
| 866 | Ga0495664_0222530 | 3300046477 | Bacteria | 1142 |
| 867 | Ga0495664_0332404 | 3300046477 | Unclassified | 916 |
| 868 | Ga0495608_0007616 | 3300046511 | Bacteria | 7634 |
| 869 | Ga0495608_0043390 | 3300046511 | Bacteria | 3005 |
| 870 | Ga0495608_0273985 | 3300046511 | Unclassified | 1049 |
| 871 | Ga0495628_0292179 | 3300046516 | Bacteria | 1208 |
| 872 | Ga0495628_0363134 | 3300046516 | Bacteria | 1063 |
| 873 | Ga0495628_0429694 | 3300046516 | Bacteria | 961 |
| 874 | Ga0495628_0429922 | 3300046516 | Unclassified | 961 |
| 875 | Ga0495628_0718746 | 3300046516 | Unclassified | 704 |
| 876 | Ga0495630_0006444 | 3300046517 | Bacteria | 8349 |
| 877 | Ga0495630_0378823 | 3300046517 | Unclassified | 1084 |
| 878 | Ga0495630_0498178 | 3300046517 | Bacteria | 934 |
| 879 | Ga0495630_0525246 | 3300046517 | Bacteria | 908 |
| 880 | Ga0495666_0327428 | 3300046526 | Bacteria | 691 |
| 881 | Ga0495652_0017431 | 3300046529 | Bacteria | 6407 |
| 882 | Ga0495652_0161497 | 3300046529 | Bacteria | 1739 |
| 883 | Ga0495652_0375162 | 3300046529 | Bacteria | 1013 |
| 884 | Ga0495652_0546356 | 3300046529 | Unclassified | 797 |
| 885 | Ga0495652_0812104 | 3300046529 | Unclassified | 622 |
| 886 | Ga0495665_0147732 | 3300046531 | Bacteria | 1227 |
| 887 | Ga0495586_0065180 | 3300046535 | Unclassified | 1986 |
| 888 | Ga0495586_0102994 | 3300046535 | Bacteria | 1585 |
| 889 | Ga0495586_0241936 | 3300046535 | Unclassified | 1029 |
| 890 | Ga0495586_0249521 | 3300046535 | Bacteria | 1012 |
| 891 | Ga0495586_0587118 | 3300046535 | Unclassified | 643 |
| 892 | Ga0495586_0877200 | 3300046535 | Unclassified | 517 |
| 893 | Ga0495587_0000875 | 3300046536 | Bacteria | 19885 |
| 894 | Ga0495587_0064199 | 3300046536 | Bacteria | 2146 |
| 895 | Ga0495587_0142396 | 3300046536 | Unclassified | 1368 |
| 896 | Ga0495598_0073910 | 3300046537 | Unclassified | 1080 |
| 897 | Ga0495598_0245302 | 3300046537 | Unclassified | 662 |
| 898 | Ga0495621_0242628 | 3300046539 | Bacteria | 734 |
| 899 | Ga0495645_0015913 | 3300046543 | Bacteria | 5359 |
| 900 | Ga0495645_0139178 | 3300046543 | Bacteria | 1695 |
| 901 | Ga0495645_0195744 | 3300046543 | Bacteria | 1374 |
| 902 | Ga0495645_0267162 | 3300046543 | Bacteria | 1130 |
| 903 | Ga0495645_0274995 | 3300046543 | Unclassified | 1110 |
| 904 | Ga0495633_0231877 | 3300046558 | Unclassified | 844 |
| 905 | Ga0495667_0011414 | 3300046559 | Bacteria | 6013 |
| 906 | Ga0495667_0016323 | 3300046559 | Bacteria | 5018 |
| 907 | Ga0495667_0125960 | 3300046559 | Bacteria | 1653 |
| 908 | Ga0495667_0176013 | 3300046559 | Bacteria | 1374 |
| 909 | Ga0495667_0261254 | 3300046559 | Unclassified | 1101 |
| 910 | Ga0495667_0785849 | 3300046559 | Unclassified | 587 |
| 911 | Ga0495656_0155051 | 3300046615 | Bacteria | 1109 |
| 912 | Ga0495634_0089145 | 3300046642 | Unclassified | 2006 |
| 913 | Ga0495634_0110076 | 3300046642 | Bacteria | 1772 |
| 914 | Ga0495635_0262410 | 3300046663 | Bacteria | 1163 |
| 915 | Ga0495635_0323357 | 3300046663 | Unclassified | 1032 |
| 916 | Ga0495635_0923272 | 3300046663 | Bacteria | 558 |
| 917 | Ga0495657_0004492 | 3300046675 | Bacteria | 11149 |
| 918 | Ga0495599_0048516 | 3300046678 | Bacteria | 2662 |
| 919 | Ga0495599_0051044 | 3300046678 | Bacteria | 2592 |
| 920 | Ga0495599_0438572 | 3300046678 | Unclassified | 774 |
| 921 | Ga0495623_0350561 | 3300046679 | Unclassified | 804 |
| 922 | Ga0495647_0227506 | 3300046681 | Unclassified | 825 |
| 923 | Ga0495658_0034244 | 3300046683 | Bacteria | 2786 |
| 924 | Ga0495613_0000412 | 3300046689 | Bacteria | 36659 |
| 925 | Ga0495613_0041160 | 3300046689 | Unclassified | 3422 |
| 926 | Ga0495613_0054144 | 3300046689 | Bacteria | 2950 |
| 927 | Ga0495613_0276593 | 3300046689 | Unclassified | 1167 |
| 928 | Ga0495600_0221257 | 3300046809 | Unclassified | 1211 |
| 929 | Ga0495600_0600206 | 3300046809 | Unclassified | 669 |
| 930 | Ga0495581_0248439 | 3300047315 | Unclassified | 1040 |
| 931 | Ga0495636_0010186 | 3300047318 | Unclassified | 3709 |
| 932 | Ga0495636_0038950 | 3300047318 | Bacteria | 1968 |
| 933 | Ga0495674_0069412 | 3300047319 | Bacteria | 3047 |
| 934 | Ga0495674_0078633 | 3300047319 | Unclassified | 2834 |
| 935 | Ga0495674_0081647 | 3300047319 | Bacteria | 2773 |
| 936 | Ga0495674_0162467 | 3300047319 | Bacteria | 1868 |
| 937 | Ga0495674_0201016 | 3300047319 | Bacteria | 1653 |
| 938 | Ga0495674_0618281 | 3300047319 | Unclassified | 857 |
| 939 | Ga0495675_0037964 | 3300047444 | Bacteria | 3067 |
| 940 | Ga0495675_0223337 | 3300047444 | Unclassified | 1139 |
| 941 | Ga0495675_0338997 | 3300047444 | Unclassified | 886 |
| 942 | Ga0495675_0369096 | 3300047444 | Bacteria | 841 |
| 943 | Ga0495684_0001712 | 3300047471 | Bacteria | 17655 |
| 944 | Ga0495684_0013588 | 3300047471 | Bacteria | 6269 |
| 945 | Ga0495684_0066688 | 3300047471 | Bacteria | 2737 |
| 946 | Ga0495684_0074027 | 3300047471 | Bacteria | 2587 |
| 947 | Ga0495684_0078116 | 3300047471 | Unclassified | 2512 |
| 948 | Ga0495684_0185651 | 3300047471 | Unclassified | 1539 |
| 949 | Ga0495684_0432249 | 3300047471 | Unclassified | 918 |
| 950 | Ga0495684_0527259 | 3300047471 | Unclassified | 808 |
| 951 | Ga0495684_0765974 | 3300047471 | Unclassified | 634 |
| 952 | Ga0495593_0273060 | 3300047673 | Unclassified | 846 |
| 953 | Ga0495602_0004849 | 3300048088 | Bacteria | 14082 |
| 954 | Ga0495602_0032555 | 3300048088 | Bacteria | 4907 |
| 955 | Ga0495602_0101082 | 3300048088 | Bacteria | 2366 |
| 956 | Ga0496104_0142370 | 3300048907 | Bacteria | 2304 |
| 957 | Ga0496104_0162981 | 3300048907 | Unclassified | 2139 |
| 958 | Ga0496104_0204919 | 3300048907 | Unclassified | 1884 |
| 959 | Ga0496105_0348097 | 3300048908 | Unclassified | 1184 |
| 960 | Ga0496105_0818044 | 3300048908 | Bacteria | 707 |
| 961 | Ga0496106_0419215 | 3300048909 | Bacteria | 1076 |
| 962 | Ga0496108_0709793 | 3300048911 | Unclassified | 872 |
| 963 | Ga0496108_1385210 | 3300048911 | Unclassified | 589 |
| 964 | Ga0496109_0690381 | 3300048912 | Unclassified | 958 |
| 965 | Ga0496110_0156887 | 3300048913 | Bacteria | 2062 |
| 966 | Ga0496110_0439066 | 3300048913 | Bacteria | 1190 |
| 967 | Ga0496112_1090693 | 3300048915 | Bacteria | 717 |
| 968 | Ga0496114_0099313 | 3300048917 | Unclassified | 2483 |
| 969 | Ga0496114_1074345 | 3300048917 | Unclassified | 689 |
| 970 | Ga0496115_0084893 | 3300048918 | Unclassified | 2582 |
| 971 | nmdc:mga05p37_55458_c1 | 3300050507 | Bacteria | 4877 |
| 972 | nmdc:mga05p37_621352_c1 | 3300050507 | Unclassified | 1216 |
| 973 | nmdc:mga09592_2369_c2 | 3300050508 | Bacteria | 13505 |
| 974 | nmdc:mga09592_76774_c1 | 3300050508 | Bacteria | 2841 |
| 975 | nmdc:mga0qj67_5287_c1 | 3300050509 | Bacteria | 9416 |
| 976 | nmdc:mga06r32_4210_c1 | 3300050510 | Bacteria | 12889 |
| 977 | nmdc:mga08y16_1053182_c1 | 3300050511 | Unclassified | 791 |
| 978 | nmdc:mga08y16_348872_c1 | 3300050511 | Unclassified | 1521 |
| 979 | nmdc:mga08y16_479287_c1 | 3300050511 | Bacteria | 1266 |
| 980 | nmdc:mga08y16_605972_c1 | 3300050511 | Bacteria | 1103 |
| 981 | nmdc:mga08y16_643950_c1 | 3300050511 | Bacteria | 1065 |
| 982 | nmdc:mga08y16_86868_c1 | 3300050511 | Unclassified | 3259 |
| 983 | nmdc:mga0n895_192923_c1 | 3300050512 | Bacteria | 2068 |
| 984 | nmdc:mga0n895_49344_c1 | 3300050512 | Bacteria | 4123 |
| 985 | nmdc:mga0n895_550186_c1 | 3300050512 | Unclassified | 1160 |
| 986 | nmdc:mga0n895_63470_c1 | 3300050512 | Bacteria | 3653 |
| 987 | nmdc:mga0rr50_1028016_c1 | 3300050513 | Bacteria | 702 |
| 988 | nmdc:mga0rr50_878879_c1 | 3300050513 | Bacteria | 764 |
| 989 | nmdc:mga0a205_194793_c1 | 3300050515 | Bacteria | 1918 |
| 990 | nmdc:mga0a205_26550_c1 | 3300050515 | Bacteria | 5525 |
| 991 | Ga0495601_0002322 | 3300053077 | Bacteria | 10756 |
| 992 | Ga0495601_0081500 | 3300053077 | Bacteria | 2077 |
| 993 | Ga0495612_0275019 | 3300053078 | Unclassified | 752 |
| 994 | Ga0495595_0288142 | 3300053084 | Bacteria | 825 |
| 995 | Ga0495619_0000326 | 3300053085 | Bacteria | 33248 |
| 996 | Ga0495619_0229903 | 3300053085 | Bacteria | 1285 |
| 997 | Ga0495619_0945256 | 3300053085 | Unclassified | 578 |
| 998 | Ga0157378_10463004 | |||
| 999 | JGI24746J21847_1011932 | |||
| 1000 | Ga0065714_10088727 | |||
| 1001 | Ga0065712_10109759 | |||
| 1002 | Ga0065715_10011352 | |||
| 1003 | Ga0065715_10234587 | |||
| 1004 | Ga0065707_10310514 | |||
| 1005 | Ga0070676_10020201 | |||
| 1006 | Ga0070676_10063673 | |||
| 1007 | Ga0070683_100003820 | |||
| 1008 | Ga0070683_100013122 | |||
| 1009 | Ga0070683_100014850 | |||
| 1010 | Ga0070683_100108291 | |||
| 1011 | Ga0070683_100161615 | |||
| 1012 | Ga0070683_100654500 | |||
| 1013 | Ga0070690_100009014 | |||
| 1014 | Ga0070690_100015429 | |||
| 1015 | Ga0070690_100061146 | |||
| 1016 | Ga0070690_100166226 | |||
| 1017 | Ga0070690_101623865 | |||
| 1018 | Ga0070670_100003296 | |||
| 1019 | Ga0070670_100004980 | |||
| 1020 | Ga0070670_100017524 | |||
| 1021 | Ga0070670_100032297 | |||
| 1022 | Ga0070670_100224053 | |||
| 1023 | Ga0070670_100866850 | |||
| 1024 | Ga0070677_10001490 | |||
| 1025 | Ga0070677_10028179 | |||
| 1026 | Ga0070677_10480990 | |||
| 1027 | Ga0068869_100003958 | |||
| 1028 | Ga0068869_100033652 | |||
| 1029 | Ga0068869_100035897 | |||
| 1030 | Ga0068869_100278196 | |||
| 1031 | Ga0068869_100369215 | |||
| 1032 | Ga0068869_100500235 | |||
| 1033 | Ga0068869_100609432 | |||
| 1034 | Ga0068869_101020821 | |||
| 1035 | Ga0070666_10001783 | |||
| 1036 | Ga0070666_10013165 | |||
| 1037 | Ga0070666_10019258 | |||
| 1038 | Ga0070666_10590373 | |||
| 1039 | Ga0070666_10836318 | |||
| 1040 | Ga0070666_10896808 | |||
| 1041 | Ga0070680_100071737 | |||
| 1042 | Ga0070680_100125652 | |||
| 1043 | Ga0068868_100001436 | |||
| 1044 | Ga0068868_100052545 | |||
| 1045 | Ga0068868_100306057 | |||
| 1046 | Ga0068868_100746758 | |||
| 1047 | Ga0070660_100083766 | |||
| 1048 | Ga0070660_100763472 | |||
| 1049 | Ga0070689_100010802 | |||
| 1050 | Ga0070689_100100074 | |||
| 1051 | Ga0070689_100211050 | |||
| 1052 | Ga0070689_100362450 | |||
| 1053 | Ga0070689_100408738 | |||
| 1054 | Ga0070689_100460162 | |||
| 1055 | Ga0070689_100481302 | |||
| 1056 | Ga0070689_101642406 | |||
| 1057 | Ga0070691_10000461 | |||
| 1058 | Ga0070687_100047809 | |||
| 1059 | Ga0070661_100012248 | |||
| 1060 | Ga0070661_100126297 | |||
| 1061 | Ga0070661_100373545 | |||
| 1062 | Ga0070661_100817600 | |||
| 1063 | Ga0070669_100003536 | |||
| 1064 | Ga0070669_100050418 | |||
| 1065 | Ga0070669_100089903 | |||
| 1066 | Ga0070669_101236637 | |||
| 1067 | Ga0070675_100000718 | |||
| 1068 | Ga0070675_100006739 | |||
| 1069 | Ga0070675_100028050 | |||
| 1070 | Ga0070675_100087697 | |||
| 1071 | Ga0070675_100099830 | |||
| 1072 | Ga0070675_100163401 | |||
| 1073 | Ga0070675_100238891 | |||
| 1074 | Ga0070675_100254805 | |||
| 1075 | Ga0070675_101994907 | |||
| 1076 | Ga0070671_100000815 | |||
| 1077 | Ga0070671_100001673 | |||
| 1078 | Ga0070671_100092885 | |||
| 1079 | Ga0070671_100404296 | |||
| 1080 | Ga0070671_100491971 | |||
| 1081 | Ga0070674_100000136 | |||
| 1082 | Ga0070674_100079654 | |||
| 1083 | Ga0070674_100318611 | |||
| 1084 | Ga0070673_100001421 | |||
| 1085 | Ga0070673_100001668 | |||
| 1086 | Ga0070673_100044570 | |||
| 1087 | Ga0070673_100107984 | |||
| 1088 | Ga0070673_100123993 | |||
| 1089 | Ga0070673_100239012 | |||
| 1090 | Ga0070673_101501780 | |||
| 1091 | Ga0070688_100016420 | |||
| 1092 | Ga0070688_100039917 | |||
| 1093 | Ga0070688_100044971 | |||
| 1094 | Ga0070688_100069333 | |||
| 1095 | Ga0070688_100320761 | |||
| 1096 | Ga0070659_100021636 | |||
| 1097 | Ga0070659_100176496 | |||
| 1098 | Ga0070659_100196070 | |||
| 1099 | Ga0070659_100531172 | |||
| 1100 | Ga0070667_100000879 | |||
| 1101 | Ga0070667_100006545 | |||
| 1102 | Ga0070667_100771019 | |||
| 1103 | Ga0070709_10153902 | |||
| 1104 | Ga0070709_10239363 | |||
| 1105 | Ga0070714_100228534 | |||
| 1106 | Ga0070714_100564125 | |||
| 1107 | Ga0070713_100002206 | |||
| 1108 | Ga0070713_100027183 | |||
| 1109 | Ga0070713_100489036 | |||
| 1110 | Ga0070713_100642978 | |||
| 1111 | Ga0070713_101434393 | |||
| 1112 | Ga0070710_10476881 | |||
| 1113 | Ga0070701_10009424 | |||
| 1114 | Ga0070701_10045330 | |||
| 1115 | Ga0070701_10367321 | |||
| 1116 | Ga0070711_100216866 | |||
| 1117 | Ga0070711_100359885 | |||
| 1118 | Ga0070711_100399066 | |||
| 1119 | Ga0070711_101398542 | |||
| 1120 | Ga0070705_100051158 | |||
| 1121 | Ga0070700_100125009 | |||
| 1122 | Ga0070694_100581348 | |||
| 1123 | Ga0070708_100678642 | |||
| 1124 | Ga0070708_101267198 | |||
| 1125 | Ga0070708_101344392 | |||
| 1126 | Ga0070678_100036605 | |||
| 1127 | Ga0070678_100071635 | |||
| 1128 | Ga0070678_100197101 | |||
| 1129 | Ga0070678_100566486 | |||
| 1130 | Ga0070678_100594498 | |||
| 1131 | Ga0070662_100003010 | |||
| 1132 | Ga0070662_100073012 | |||
| 1133 | Ga0070662_100194198 | |||
| 1134 | Ga0070662_101251742 | |||
| 1135 | Ga0070681_10038792 | |||
| 1136 | Ga0070681_10134325 | |||
| 1137 | Ga0070681_10735728 | |||
| 1138 | Ga0070681_10741133 | |||
| 1139 | Ga0068867_100011487 | |||
| 1140 | Ga0068867_100052703 | |||
| 1141 | Ga0068867_100071750 | |||
| 1142 | Ga0068867_100394111 | |||
| 1143 | Ga0068867_100682960 | |||
| 1144 | Ga0070685_10032907 | |||
| 1145 | Ga0070685_10077281 | |||
| 1146 | Ga0070685_10524596 | |||
| 1147 | Ga0070698_100528090 | |||
| 1148 | Ga0070679_100001188 | |||
| 1149 | Ga0070679_100324302 | |||
| 1150 | Ga0070679_100771593 | |||
| 1151 | Ga0070684_100010259 | |||
| 1152 | Ga0070684_100023432 | |||
| 1153 | Ga0070684_100056132 | |||
| 1154 | Ga0070684_100192334 | |||
| 1155 | Ga0070684_100272839 | |||
| 1156 | Ga0070684_100985587 | |||
| 1157 | Ga0070684_101572960 | |||
| 1158 | Ga0070697_100727716 | |||
| 1159 | Ga0068853_100010223 | |||
| 1160 | Ga0068853_100021030 | |||
| 1161 | Ga0068853_100055586 | |||
| 1162 | Ga0068853_100952804 | |||
| 1163 | Ga0070672_100006309 | |||
| 1164 | Ga0070672_100010764 | |||
| 1165 | Ga0070672_100029556 | |||
| 1166 | Ga0070672_100065679 | |||
| 1167 | Ga0070686_100013527 | |||
| 1168 | Ga0070686_100021509 | |||
| 1169 | Ga0070686_100139923 | |||
| 1170 | Ga0070686_100881265 | |||
| 1171 | Ga0070693_100151134 | |||
| 1172 | Ga0070693_100174230 | |||
| 1173 | Ga0070693_100442658 | |||
| 1174 | Ga0070665_100087924 | |||
| 1175 | Ga0070665_100193801 | |||
| 1176 | Ga0068855_100012045 | |||
| 1177 | Ga0068855_100174888 | |||
| 1178 | Ga0068855_100248563 | |||
| 1179 | Ga0068855_100328950 | |||
| 1180 | Ga0068855_100781860 | |||
| 1181 | Ga0068855_100967147 | |||
| 1182 | Ga0070664_100000235 | |||
| 1183 | Ga0070664_100006853 | |||
| 1184 | Ga0070664_100030588 | |||
| 1185 | Ga0070664_100075448 | |||
| 1186 | Ga0070664_100120349 | |||
| 1187 | Ga0070664_100121601 | |||
| 1188 | Ga0070664_100144431 | |||
| 1189 | Ga0070664_100180391 | |||
| 1190 | Ga0070664_100225393 | |||
| 1191 | Ga0068857_100004701 | |||
| 1192 | Ga0068857_100024770 | |||
| 1193 | Ga0068857_100113315 | |||
| 1194 | Ga0068857_100238399 | |||
| 1195 | Ga0068857_100382663 | |||
| 1196 | Ga0068857_100383204 | |||
| 1197 | Ga0068857_100840250 | |||
| 1198 | Ga0068857_102118142 | |||
| 1199 | Ga0068856_100001921 | |||
| 1200 | Ga0068856_100007110 | |||
| 1201 | Ga0068856_100017150 | |||
| 1202 | Ga0068856_100164252 | |||
| 1203 | Ga0068856_100492255 | |||
| 1204 | Ga0068856_100605397 | |||
| 1205 | Ga0070702_100106147 | |||
| 1206 | Ga0070702_100174271 | |||
| 1207 | Ga0070702_100372154 | |||
| 1208 | Ga0068852_100160148 | |||
| 1209 | Ga0068852_100164184 | |||
| 1210 | Ga0068852_100169912 | |||
| 1211 | Ga0068852_100802981 | |||
| 1212 | Ga0068852_101473901 | |||
| 1213 | Ga0068852_101678028 | |||
| 1214 | Ga0068859_100049791 | |||
| 1215 | Ga0068859_100051573 | |||
| 1216 | Ga0068859_100062214 | |||
| 1217 | Ga0068859_100082479 | |||
| 1218 | Ga0068859_100102333 | |||
| 1219 | Ga0068859_100166241 | |||
| 1220 | Ga0068859_100226379 | |||
| 1221 | Ga0068859_100562054 | |||
| 1222 | Ga0068859_101314596 | |||
| 1223 | Ga0068864_100001078 | |||
| 1224 | Ga0068864_100011161 | |||
| 1225 | Ga0068864_100094603 | |||
| 1226 | Ga0068864_100097294 | |||
| 1227 | Ga0068864_100100023 | |||
| 1228 | Ga0068864_100137681 | |||
| 1229 | Ga0068864_100259847 | |||
| 1230 | Ga0068864_100323835 | |||
| 1231 | Ga0068864_100924939 | |||
| 1232 | Ga0068866_10505484 | |||
| 1233 | Ga0068866_10523886 | |||
| 1234 | Ga0068861_100017953 | |||
| 1235 | Ga0068861_100086653 | |||
| 1236 | Ga0068861_100266423 | |||
| 1237 | Ga0068870_10016938 | |||
| 1238 | Ga0068870_10041555 | |||
| 1239 | Ga0068870_10065896 | |||
| 1240 | Ga0068870_10296514 | |||
| 1241 | Ga0068870_11293681 | |||
| 1242 | Ga0068863_100000203 | |||
| 1243 | Ga0068863_100005293 | |||
| 1244 | Ga0068863_100052109 | |||
| 1245 | Ga0068863_100144428 | |||
| 1246 | Ga0068863_101289967 | |||
| 1247 | Ga0068858_100004214 | |||
| 1248 | Ga0068858_100006302 | |||
| 1249 | Ga0068858_100014894 | |||
| 1250 | Ga0068858_100063106 | |||
| 1251 | Ga0068858_100103296 | |||
| 1252 | Ga0068858_100150728 | |||
| 1253 | Ga0068858_100179066 | |||
| 1254 | Ga0068858_100241994 | |||
| 1255 | Ga0068858_100290285 | |||
| 1256 | Ga0068858_100417231 | |||
| 1257 | Ga0068858_100646476 | |||
| 1258 | Ga0068858_101247594 | |||
| 1259 | Ga0068858_101709800 | |||
| 1260 | Ga0068860_100005469 | |||
| 1261 | Ga0068860_100110668 | |||
| 1262 | Ga0068860_100160581 | |||
| 1263 | Ga0068860_100172597 | |||
| 1264 | Ga0068860_100227840 | |||
| 1265 | Ga0068860_100232148 | |||
| 1266 | Ga0068860_100686454 | |||
| 1267 | Ga0068860_101496474 | |||
| 1268 | Ga0068860_101574871 | |||
| 1269 | Ga0068862_100098004 | |||
| 1270 | Ga0068862_100296294 | |||
| 1271 | Ga0068862_100395918 | |||
| 1272 | Ga0068862_100656361 | |||
| 1273 | Ga0068862_101089753 | |||
| 1274 | Ga0068862_101326739 | |||
| 1275 | Ga0070717_11172068 | |||
| 1276 | Ga0097621_100001830 | |||
| 1277 | Ga0097621_100002084 | |||
| 1278 | Ga0097621_100029776 | |||
| 1279 | Ga0097621_100058384 | |||
| 1280 | Ga0097621_100061435 | |||
| 1281 | Ga0097621_100064786 | |||
| 1282 | Ga0097621_100090394 | |||
| 1283 | Ga0097621_100133519 | |||
| 1284 | Ga0097621_100155547 | |||
| 1285 | Ga0097621_100183261 | |||
| 1286 | Ga0097621_100269127 | |||
| 1287 | Ga0097621_100969983 | |||
| 1288 | Ga0097621_101029387 | |||
| 1289 | Ga0068871_100008507 | |||
| 1290 | Ga0068871_100058391 | |||
| 1291 | Ga0068871_100108220 | |||
| 1292 | Ga0068871_100151994 | |||
| 1293 | Ga0068871_100183934 | |||
| 1294 | Ga0068871_100211209 | |||
| 1295 | Ga0068871_100635014 | |||
| 1296 | Ga0068871_100812072 | |||
| 1297 | Ga0068871_101062113 | |||
| 1298 | Ga0075428_100000671 | |||
| 1299 | Ga0075428_100539933 | |||
| 1300 | Ga0075430_100002532 | |||
| 1301 | Ga0075431_100000502 | |||
| 1302 | Ga0075433_10001202 | |||
| 1303 | Ga0075433_10011307 | |||
| 1304 | Ga0075433_10441037 | |||
| 1305 | Ga0075433_10678203 | |||
| 1306 | Ga0075434_100004206 | |||
| 1307 | Ga0075434_100005753 | |||
| 1308 | Ga0075434_100192151 | |||
| 1309 | Ga0075434_100579625 | |||
| 1310 | Ga0075429_100000848 | |||
| 1311 | Ga0075429_100082199 | |||
| 1312 | Ga0075429_100121463 | |||
| 1313 | Ga0075429_100134840 | |||
| 1314 | Ga0068865_100009472 | |||
| 1315 | Ga0068865_100032041 | |||
| 1316 | Ga0068865_100064136 | |||
| 1317 | Ga0068865_100186804 | |||
| 1318 | Ga0068865_101045187 | |||
| 1319 | Ga0068865_101568618 | |||
| 1320 | Ga0075436_100081982 | |||
| 1321 | Ga0097620_100049788 | |||
| 1322 | Ga0097620_100051573 | |||
| 1323 | Ga0097620_100062222 | |||
| 1324 | Ga0097620_100082480 | |||
| 1325 | Ga0097620_100102334 | |||
| 1326 | Ga0097620_100166227 | |||
| 1327 | Ga0097620_100226375 | |||
| 1328 | Ga0097620_100562055 | |||
| 1329 | Ga0097620_100811675 | |||
| 1330 | Ga0097620_100867816 | |||
| 1331 | Ga0097620_101314584 | |||
| 1332 | Ga0075435_100069532 | |||
| 1333 | Ga0075435_100100364 | |||
| 1334 | Ga0099795_10388181 | |||
| 1335 | Ga0105240_10001704 | |||
| 1336 | Ga0105240_10018605 | |||
| 1337 | Ga0105240_10042104 | |||
| 1338 | Ga0105240_10093132 | |||
| 1339 | Ga0105240_10377665 | |||
| 1340 | Ga0111539_10002873 | |||
| 1341 | Ga0111539_10020076 | |||
| 1342 | Ga0111539_10029192 | |||
| 1343 | Ga0111539_10186592 | |||
| 1344 | Ga0111539_10329487 | |||
| 1345 | Ga0111539_10350980 | |||
| 1346 | Ga0111539_10593033 | |||
| 1347 | Ga0105245_10000490 | |||
| 1348 | Ga0105245_10000522 | |||
| 1349 | Ga0105245_10004914 | |||
| 1350 | Ga0105245_10016271 | |||
| 1351 | Ga0105245_10027430 | |||
| 1352 | Ga0105245_10087626 | |||
| 1353 | Ga0105245_10467267 | |||
| 1354 | Ga0105245_10539698 | |||
| 1355 | Ga0105245_10695053 | |||
| 1356 | Ga0105245_11121376 | |||
| 1357 | Ga0105247_10007933 | |||
| 1358 | Ga0105247_10011747 | |||
| 1359 | Ga0105247_10484155 | |||
| 1360 | Ga0114129_10122424 | |||
| 1361 | Ga0105243_10053747 | |||
| 1362 | Ga0105243_10210299 | |||
| 1363 | Ga0105243_10948610 | |||
| 1364 | Ga0105241_10002584 | |||
| 1365 | Ga0105241_10010673 | |||
| 1366 | Ga0105241_10103271 | |||
| 1367 | Ga0105241_10501724 | |||
| 1368 | Ga0105242_10005159 | |||
| 1369 | Ga0105242_10009827 | |||
| 1370 | Ga0105242_10012044 | |||
| 1371 | Ga0105242_10017966 | |||
| 1372 | Ga0105242_10029204 | |||
| 1373 | Ga0105242_10041982 | |||
| 1374 | Ga0105242_10054066 | |||
| 1375 | Ga0105242_10122919 | |||
| 1376 | Ga0105242_10308842 | |||
| 1377 | Ga0105242_10569550 | |||
| 1378 | Ga0105242_11242678 | |||
| 1379 | Ga0105242_12939085 | |||
| 1380 | Ga0105248_10000321 | |||
| 1381 | Ga0105248_10003317 | |||
| 1382 | Ga0105248_10020314 | |||
| 1383 | Ga0105248_10055910 | |||
| 1384 | Ga0105248_10066406 | |||
| 1385 | Ga0105248_10109309 | |||
| 1386 | Ga0105248_10116213 | |||
| 1387 | Ga0105248_10116594 | |||
| 1388 | Ga0105248_10116612 | |||
| 1389 | Ga0105248_10357496 | |||
| 1390 | Ga0105248_10402807 | |||
| 1391 | Ga0105248_10420054 | |||
| 1392 | Ga0105248_10516600 | |||
| 1393 | Ga0105248_10914857 | |||
| 1394 | Ga0105248_11840596 | |||
| 1395 | Ga0105248_12300244 | |||
| 1396 | Ga0105237_10002911 | |||
| 1397 | Ga0105237_10022038 | |||
| 1398 | Ga0105237_10177892 | |||
| 1399 | Ga0105238_10002214 | |||
| 1400 | Ga0105238_10006206 | |||
| 1401 | Ga0105238_10040920 | |||
| 1402 | Ga0105238_10052733 | |||
| 1403 | Ga0105238_10078375 | |||
| 1404 | Ga0105249_10027034 | |||
| 1405 | Ga0105249_10036764 | |||
| 1406 | Ga0105249_11131549 | |||
| 1407 | Ga0105249_12354371 | |||
| 1408 | Ga0105239_10003103 | |||
| 1409 | Ga0105239_10030074 | |||
| 1410 | Ga0105239_10058815 | |||
| 1411 | Ga0105239_10242621 | |||
| 1412 | Ga0105246_10009739 | |||
| 1413 | Ga0105246_10030401 | |||
| 1414 | Ga0105246_10077096 | |||
| 1415 | Ga0105246_10762881 | |||
| 1416 | Ga0105246_10789595 | |||
| 1417 | Ga0105246_12039198 | |||
| 1418 | Ga0157371_10402007 | |||
| 1419 | Ga0157371_10877454 | |||
| 1420 | Ga0157370_10016223 | |||
| 1421 | Ga0157370_10041402 | |||
| 1422 | Ga0157369_10000876 | |||
| 1423 | Ga0157369_10014635 | |||
| 1424 | Ga0157369_10140840 | |||
| 1425 | Ga0157374_10005784 | |||
| 1426 | Ga0157374_10115853 | |||
| 1427 | Ga0157374_10252003 | |||
| 1428 | Ga0157374_10433913 | |||
| 1429 | Ga0157374_10505169 | |||
| 1430 | Ga0157378_10000308 | |||
| 1431 | Ga0157378_10014594 | |||
| 1432 | Ga0157378_10100836 | |||
| 1433 | Ga0157378_10217603 | |||
| 1434 | Ga0157378_10523663 | |||
| 1435 | Ga0163162_10003959 | |||
| 1436 | Ga0163162_10223272 | |||
| 1437 | Ga0163162_10660136 | |||
| 1438 | Ga0163162_11241604 | |||
| 1439 | Ga0157372_10003294 | |||
| 1440 | Ga0157372_10004833 | |||
| 1441 | Ga0157372_10062346 | |||
| 1442 | Ga0157372_10114337 | |||
| 1443 | Ga0157372_10185733 | |||
| 1444 | Ga0157372_10353338 | |||
| 1445 | Ga0157375_10000347 | |||
| 1446 | Ga0157375_10003107 | |||
| 1447 | Ga0157375_10008198 | |||
| 1448 | Ga0157375_10021880 | |||
| 1449 | Ga0157375_10057166 | |||
| 1450 | Ga0157375_10066427 | |||
| 1451 | Ga0157375_10106500 | |||
| 1452 | Ga0157375_10252728 | |||
| 1453 | Ga0157375_10274903 | |||
| 1454 | Ga0157375_10363143 | |||
| 1455 | Ga0157375_10396524 | |||
| 1456 | Ga0157375_10758144 | |||
| 1457 | Ga0157375_11006411 | |||
| 1458 | Ga0157375_11138633 | |||
| 1459 | Ga0157375_11370937 | |||
| 1460 | Ga0163163_10000939 | |||
| 1461 | Ga0163163_10011258 | |||
| 1462 | Ga0163163_10033586 | |||
| 1463 | Ga0163163_10038038 | |||
| 1464 | Ga0163163_10049213 | |||
| 1465 | Ga0163163_10052171 | |||
| 1466 | Ga0163163_10081373 | |||
| 1467 | Ga0163163_10176582 | |||
| 1468 | Ga0163163_10320310 | |||
| 1469 | Ga0163163_11499709 | |||
| 1470 | Ga0157380_10000747 | |||
| 1471 | Ga0157380_10004399 | |||
| 1472 | Ga0157380_10020826 | |||
| 1473 | Ga0157380_11652493 | |||
| 1474 | Ga0157377_10006322 | |||
| 1475 | Ga0157377_10068537 | |||
| 1476 | Ga0157377_10130884 | |||
| 1477 | Ga0157377_10204645 | |||
| 1478 | Ga0157377_10644502 | |||
| 1479 | Ga0157379_10000069 | |||
| 1480 | Ga0157379_10033202 | |||
| 1481 | Ga0157379_10059158 | |||
| 1482 | Ga0157379_10131702 | |||
| 1483 | Ga0157379_10346451 | |||
| 1484 | Ga0157379_11910660 | |||
| 1485 | Ga0157376_10055728 | |||
| 1486 | Ga0157376_10083130 | |||
| 1487 | Ga0157376_10095614 | |||
| 1488 | Ga0157376_10270348 | |||
| 1489 | Ga0157376_10300089 | |||
| 1490 | Ga0157376_10323717 | |||
| 1491 | Ga0157376_10402006 | |||
| 1492 | Ga0157376_10418717 | |||
| 1493 | Ga0157376_10540085 | |||
| 1494 | Ga0157376_11120896 | |||
| 1495 | Ga0163161_10015899 | |||
| 1496 | Ga0163161_10061887 | |||
| 1497 | Ga0213876_10124532 | |||
| 1498 | Ga0213876_10149847 | |||
| 1499 | Ga0213876_10367694 | |||
| 1500 | Ga0213875_10003847 | |||
| 1501 | Ga0213875_10019944 | |||
| 1502 | Ga0213875_10030113 | |||
| 1503 | Ga0213875_10075187 | |||
| 1504 | Ga0207697_10000680 | |||
| 1505 | Ga0207697_10020509 | |||
| 1506 | Ga0207656_10017509 | |||
| 1507 | Ga0207682_10002289 | |||
| 1508 | Ga0207682_10007390 | |||
| 1509 | Ga0207682_10072993 | |||
| 1510 | Ga0207642_10035791 | |||
| 1511 | Ga0207642_10639791 | |||
| 1512 | Ga0207710_10010415 | |||
| 1513 | Ga0207710_10243436 | |||
| 1514 | Ga0207688_10000268 | |||
| 1515 | Ga0207688_10226004 | |||
| 1516 | Ga0207680_10004745 | |||
| 1517 | Ga0207680_10042787 | |||
| 1518 | Ga0207680_10707935 | |||
| 1519 | Ga0207699_10215083 | |||
| 1520 | Ga0207699_10352261 | |||
| 1521 | Ga0207645_10002877 | |||
| 1522 | Ga0207645_10012264 | |||
| 1523 | Ga0207645_10065050 | |||
| 1524 | Ga0207645_10211746 | |||
| 1525 | Ga0207643_10000708 | |||
| 1526 | Ga0207643_10011490 | |||
| 1527 | Ga0207643_10022495 | |||
| 1528 | Ga0207643_10055257 | |||
| 1529 | Ga0207643_10086373 | |||
| 1530 | Ga0207705_10238597 | |||
| 1531 | Ga0207654_10002411 | |||
| 1532 | Ga0207654_10004960 | |||
| 1533 | Ga0207654_10192375 | |||
| 1534 | Ga0207654_10423316 | |||
| 1535 | Ga0207707_10000635 | |||
| 1536 | Ga0207707_10395146 | |||
| 1537 | Ga0207707_10604367 | |||
| 1538 | Ga0207695_10002273 | |||
| 1539 | Ga0207695_10005994 | |||
| 1540 | Ga0207695_10201629 | |||
| 1541 | Ga0207695_10262397 | |||
| 1542 | Ga0207695_10302820 | |||
| 1543 | Ga0207695_11043779 | |||
| 1544 | Ga0207695_11155704 | |||
| 1545 | Ga0207671_10004044 | |||
| 1546 | Ga0207671_10027866 | |||
| 1547 | Ga0207663_10316061 | |||
| 1548 | Ga0207660_10018851 | |||
| 1549 | Ga0207662_10303829 | |||
| 1550 | Ga0207662_10318844 | |||
| 1551 | Ga0207657_10094716 | |||
| 1552 | Ga0207649_10127973 | |||
| 1553 | Ga0207649_10178096 | |||
| 1554 | Ga0207649_10572987 | |||
| 1555 | Ga0207649_10587052 | |||
| 1556 | Ga0207652_10004226 | |||
| 1557 | Ga0207652_11040624 | |||
| 1558 | Ga0207681_10024487 | |||
| 1559 | Ga0207681_10092192 | |||
| 1560 | Ga0207681_10358030 | |||
| 1561 | Ga0207681_10669220 | |||
| 1562 | Ga0207694_10006135 | |||
| 1563 | Ga0207694_10006183 | |||
| 1564 | Ga0207694_10021682 | |||
| 1565 | Ga0207694_10049781 | |||
| 1566 | Ga0207694_10064694 | |||
| 1567 | Ga0207694_10789128 | |||
| 1568 | Ga0207650_10000669 | |||
| 1569 | Ga0207650_10014493 | |||
| 1570 | Ga0207650_10021187 | |||
| 1571 | Ga0207650_10026622 | |||
| 1572 | Ga0207659_10009983 | |||
| 1573 | Ga0207659_10021620 | |||
| 1574 | Ga0207659_10145347 | |||
| 1575 | Ga0207659_10165422 | |||
| 1576 | Ga0207659_10172113 | |||
| 1577 | Ga0207687_10001267 | |||
| 1578 | Ga0207687_10001373 | |||
| 1579 | Ga0207687_10006349 | |||
| 1580 | Ga0207687_10010444 | |||
| 1581 | Ga0207687_10024622 | |||
| 1582 | Ga0207687_10036743 | |||
| 1583 | Ga0207687_10641245 | |||
| 1584 | Ga0207687_10680019 | |||
| 1585 | Ga0207687_10699494 | |||
| 1586 | Ga0207700_10025932 | |||
| 1587 | Ga0207700_10041492 | |||
| 1588 | Ga0207700_10056548 | |||
| 1589 | Ga0207700_10118778 | |||
| 1590 | Ga0207700_10123579 | |||
| 1591 | Ga0207700_10763668 | |||
| 1592 | Ga0207664_10112471 | |||
| 1593 | Ga0207664_10492852 | |||
| 1594 | Ga0207644_10010085 | |||
| 1595 | Ga0207644_10018210 | |||
| 1596 | Ga0207644_10613032 | |||
| 1597 | Ga0207690_10046273 | |||
| 1598 | Ga0207690_10161180 | |||
| 1599 | Ga0207690_10387051 | |||
| 1600 | Ga0207706_10026543 | |||
| 1601 | Ga0207706_10028531 | |||
| 1602 | Ga0207706_10171176 | |||
| 1603 | Ga0207706_10253596 | |||
| 1604 | Ga0207686_10005592 | |||
| 1605 | Ga0207686_10026596 | |||
| 1606 | Ga0207686_10040325 | |||
| 1607 | Ga0207686_10075747 | |||
| 1608 | Ga0207686_10140532 | |||
| 1609 | Ga0207686_10212577 | |||
| 1610 | Ga0207686_10243997 | |||
| 1611 | Ga0207686_10498818 | |||
| 1612 | Ga0207686_10528170 | |||
| 1613 | Ga0207686_10769060 | |||
| 1614 | Ga0207709_10008144 | |||
| 1615 | Ga0207709_10219872 | |||
| 1616 | Ga0207670_10040975 | |||
| 1617 | Ga0207670_10091049 | |||
| 1618 | Ga0207670_10112716 | |||
| 1619 | Ga0207670_10255574 | |||
| 1620 | Ga0207670_10261196 | |||
| 1621 | Ga0207670_10326963 | |||
| 1622 | Ga0207670_10335117 | |||
| 1623 | Ga0207670_11063657 | |||
| 1624 | Ga0207669_10028286 | |||
| 1625 | Ga0207669_10032274 | |||
| 1626 | Ga0207669_10475972 | |||
| 1627 | Ga0207669_10533619 | |||
| 1628 | Ga0207704_10006007 | |||
| 1629 | Ga0207704_10022147 | |||
| 1630 | Ga0207704_10034022 | |||
| 1631 | Ga0207704_10038267 | |||
| 1632 | Ga0207704_10126208 | |||
| 1633 | Ga0207704_10180555 | |||
| 1634 | Ga0207704_10631354 | |||
| 1635 | Ga0207704_10644244 | |||
| 1636 | Ga0207691_10000562 | |||
| 1637 | Ga0207691_10001885 | |||
| 1638 | Ga0207691_10080977 | |||
| 1639 | Ga0207691_10091658 | |||
| 1640 | Ga0207691_10113159 | |||
| 1641 | Ga0207691_10126468 | |||
| 1642 | Ga0207711_10001792 | |||
| 1643 | Ga0207711_10003178 | |||
| 1644 | Ga0207711_10008497 | |||
| 1645 | Ga0207711_10016304 | |||
| 1646 | Ga0207711_10029831 | |||
| 1647 | Ga0207711_10084682 | |||
| 1648 | Ga0207711_10201454 | |||
| 1649 | Ga0207711_10236279 | |||
| 1650 | Ga0207711_10299510 | |||
| 1651 | Ga0207711_10300216 | |||
| 1652 | Ga0207711_10652017 | |||
| 1653 | Ga0207711_10849519 | |||
| 1654 | Ga0207711_11648641 | |||
| 1655 | Ga0207689_10003413 | |||
| 1656 | Ga0207689_10010340 | |||
| 1657 | Ga0207689_10038343 | |||
| 1658 | Ga0207689_10093831 | |||
| 1659 | Ga0207689_10201546 | |||
| 1660 | Ga0207689_10297012 | |||
| 1661 | Ga0207661_10005767 | |||
| 1662 | Ga0207661_10061986 | |||
| 1663 | Ga0207661_10062203 | |||
| 1664 | Ga0207661_10205014 | |||
| 1665 | Ga0207661_10221553 | |||
| 1666 | Ga0207661_11033166 | |||
| 1667 | Ga0207679_10001709 | |||
| 1668 | Ga0207679_10007555 | |||
| 1669 | Ga0207679_10015089 | |||
| 1670 | Ga0207679_10032416 | |||
| 1671 | Ga0207679_10113247 | |||
| 1672 | Ga0207679_10115142 | |||
| 1673 | Ga0207679_10219413 | |||
| 1674 | Ga0207679_11417834 | |||
| 1675 | Ga0207667_10002906 | |||
| 1676 | Ga0207667_10008651 | |||
| 1677 | Ga0207667_10017758 | |||
| 1678 | Ga0207667_10215396 | |||
| 1679 | Ga0207667_10321695 | |||
| 1680 | Ga0207651_10025209 | |||
| 1681 | Ga0207651_10057208 | |||
| 1682 | Ga0207651_10082478 | |||
| 1683 | Ga0207651_10221699 | |||
| 1684 | Ga0207651_10401136 | |||
| 1685 | Ga0207651_10518741 | |||
| 1686 | Ga0207712_10031838 | |||
| 1687 | Ga0207712_10168242 | |||
| 1688 | Ga0207668_10028073 | |||
| 1689 | Ga0207668_10761071 | |||
| 1690 | Ga0207668_10770374 | |||
| 1691 | Ga0207658_10006244 | |||
| 1692 | Ga0207658_10012202 | |||
| 1693 | Ga0207658_10543745 | |||
| 1694 | Ga0207658_11149168 | |||
| 1695 | Ga0207658_11306128 | |||
| 1696 | Ga0207677_10012860 | |||
| 1697 | Ga0207677_10122534 | |||
| 1698 | Ga0207677_11591547 | |||
| 1699 | Ga0207703_10009873 | |||
| 1700 | Ga0207703_10053354 | |||
| 1701 | Ga0207703_10092763 | |||
| 1702 | Ga0207703_10149084 | |||
| 1703 | Ga0207703_10173058 | |||
| 1704 | Ga0207703_10192558 | |||
| 1705 | Ga0207703_10197336 | |||
| 1706 | Ga0207703_10278377 | |||
| 1707 | Ga0207703_10369674 | |||
| 1708 | Ga0207703_10461619 | |||
| 1709 | Ga0207703_10581362 | |||
| 1710 | Ga0207703_11058671 | |||
| 1711 | Ga0207703_11395150 | |||
| 1712 | Ga0207703_11476789 | |||
| 1713 | Ga0207639_10012687 | |||
| 1714 | Ga0207639_10023802 | |||
| 1715 | Ga0207639_10226952 | |||
| 1716 | Ga0207678_10053034 | |||
| 1717 | Ga0207708_10021776 | |||
| 1718 | Ga0207708_10083182 | |||
| 1719 | Ga0207702_10008257 | |||
| 1720 | Ga0207702_10009009 | |||
| 1721 | Ga0207702_10068042 | |||
| 1722 | Ga0207702_10342219 | |||
| 1723 | Ga0207702_10349206 | |||
| 1724 | Ga0207641_10001413 | |||
| 1725 | Ga0207641_10075407 | |||
| 1726 | Ga0207641_10079521 | |||
| 1727 | Ga0207641_10080625 | |||
| 1728 | Ga0207648_10004726 | |||
| 1729 | Ga0207648_10040801 | |||
| 1730 | Ga0207648_10059754 | |||
| 1731 | Ga0207648_10171259 | |||
| 1732 | Ga0207648_10769211 | |||
| 1733 | Ga0207648_10924021 | |||
| 1734 | Ga0207676_10038566 | |||
| 1735 | Ga0207676_10052268 | |||
| 1736 | Ga0207676_10059984 | |||
| 1737 | Ga0207676_10282973 | |||
| 1738 | Ga0207676_11111832 | |||
| 1739 | Ga0207674_10000657 | |||
| 1740 | Ga0207674_10014434 | |||
| 1741 | Ga0207674_10021150 | |||
| 1742 | Ga0207674_10413005 | |||
| 1743 | Ga0207674_10485023 | |||
| 1744 | Ga0207674_10622117 | |||
| 1745 | Ga0207675_100013958 | |||
| 1746 | Ga0207675_100093440 | |||
| 1747 | Ga0207675_100227230 | |||
| 1748 | Ga0207675_100324177 | |||
| 1749 | Ga0207675_100387380 | |||
| 1750 | Ga0207683_10042732 | |||
| 1751 | Ga0207683_10067607 | |||
| 1752 | Ga0207683_10245443 | |||
| 1753 | Ga0207683_10357595 | |||
| 1754 | Ga0207683_10426451 | |||
| 1755 | Ga0207683_10523042 | |||
| 1756 | Ga0207683_10788529 | |||
| 1757 | Ga0207683_11125553 | |||
| 1758 | Ga0207698_10048812 | |||
| 1759 | Ga0207698_10218529 | |||
| 1760 | Ga0207698_10904257 | |||
| 1761 | Ga0207698_10993898 | |||
| 1762 | Ga0207698_11560071 | |||
| 1763 | Ga0207428_10064965 | |||
| 1764 | Ga0268266_10019693 | |||
| 1765 | Ga0268265_10108753 | |||
| 1766 | Ga0268265_10118832 | |||
| 1767 | Ga0268265_10338703 | |||
| 1768 | Ga0268265_10914844 | |||
| 1769 | Ga0268265_11079732 | |||
| 1770 | Ga0268264_10011988 | |||
| 1771 | Ga0268264_10131783 | |||
| 1772 | Ga0268264_10229241 | |||
| 1773 | Ga0268264_10329445 | |||
| 1774 | Ga0268264_10409493 | |||
| 1775 | Ga0268264_10457519 | |||
| 1776 | Ga0268264_11009834 | |||
| 1777 | Ga0265338_10103399 | |||
| 1778 | Ga0265316_10873973 | |||
| 1779 | Ga0265313_10001183 | |||
| 1780 | Ga0265314_10000503 | |||
| 1781 | Ga0265314_10171977 | |||
| 1782 | Ga0373928_0024123 | |||
| 1783 | Ga0373934_0005371 | |||
| 1784 | Ga0373934_0007079 | |||
| 1785 | Ga0373932_0127083 | |||
| 1786 | Ga0373936_0141820 | |||
| 1787 | Ga0373953_0009327 | |||
| 1788 | Ga0373953_0022397 | |||
| 1789 | Ga0373953_0079172 | |||
| 1790 | Ga0373953_0352498 | |||
| 1791 | Ga0373954_0001361 | |||
| 1792 | Ga0373954_0004614 | |||
| 1793 | Ga0373954_0059276 | |||
| 1794 | Ga0373956_0356171 | |||
| 1795 | Ga0373957_0019616 | |||
| 1796 | Ga0373957_0090701 | |||
| 1797 | Ga0373943_0040004 | |||
| 1798 | Ga0373943_0235114 | |||
| 1799 | Ga0373943_0375344 | |||
| 1800 | Ga0373955_0017079 | |||
| 1801 | Ga0373955_0199873 | |||
| 1802 | Ga0373955_0353018 | |||
| 1803 | Ga0373955_0432788 | |||
| 1804 | Ga0373962_0085847 | |||
| 1805 | Ga0373924_0129949 | |||
| 1806 | Ga0373931_0358531 | |||
| 1807 | Ga0373931_0386001 | |||
| 1808 | Ga0373931_0701082 | |||
| 1809 | Ga0373935_0298901 | |||
| 1810 | Ga0373927_0329918 | |||
| 1811 | Ga0373933_0065585 | |||
| 1812 | Ga0373933_0089691 | |||
| 1813 | Ga0373933_0097681 | |||
| 1814 | Ga0373933_0109497 | |||
| 1815 | Ga0373933_0275211 | |||
| 1816 | Ga0373947_0707656 | |||
| 1817 | Ga0373937_0006723 | |||
| 1818 | Ga0373937_0019146 | |||
| 1819 | Ga0373937_0033755 | |||
| 1820 | Ga0373937_0045199 | |||
| 1821 | Ga0373937_0166293 | |||
| 1822 | Ga0373937_0187248 | |||
| 1823 | Ga0373937_0358356 | |||
| 1824 | Ga0373937_0389919 | |||
| 1825 | Ga0373937_0820900 | |||
| 1826 | Ga0373937_1015101 | |||
| 1827 | Ga0373925_0113445 | |||
| 1828 | Ga0373925_0116741 | |||
| 1829 | Ga0373925_0251595 | |||
| 1830 | Ga0436364_0352191 | |||
| 1831 | Ga0436364_0460607 | |||
| 1832 | Ga0436364_0488163 | |||
| 1833 | Ga0436365_0093359 | |||
| 1834 | Ga0436365_0424101 | |||
| 1835 | Ga0436365_1249443 | |||
| 1836 | Ga0436363_0897675 | |||
| 1837 | Ga0450905_083775 | |||
| 1838 | Ga0439435_0194322 | |||
| 1839 | Ga0453684_1802526 | |||
| 1840 | Ga0451576_0145652 | |||
| 1841 | Ga0451576_0740932 | |||
| 1842 | Ga0495592_0011351 | |||
| 1843 | Ga0495592_0030371 | |||
| 1844 | Ga0495629_0346023 | |||
| 1845 | Ga0495629_0379356 | |||
| 1846 | Ga0495629_0448070 | |||
| 1847 | Ga0495629_0818158 | |||
| 1848 | Ga0495651_0148029 | |||
| 1849 | Ga0495651_0699123 | |||
| 1850 | Ga0495653_0351977 | |||
| 1851 | Ga0495580_0053881 | |||
| 1852 | Ga0495580_0138395 | |||
| 1853 | Ga0495580_0150749 | |||
| 1854 | Ga0495580_0156132 | |||
| 1855 | Ga0495580_0622016 | |||
| 1856 | Ga0495582_0011640 | |||
| 1857 | Ga0495582_0172643 | |||
| 1858 | Ga0495582_0223324 | |||
| 1859 | Ga0495582_0482769 | |||
| 1860 | Ga0495639_0170245 | |||
| 1861 | Ga0495639_0324760 | |||
| 1862 | Ga0495662_0595821 | |||
| 1863 | Ga0495664_0222530 | |||
| 1864 | Ga0495664_0332404 | |||
| 1865 | Ga0495608_0007616 | |||
| 1866 | Ga0495608_0043390 | |||
| 1867 | Ga0495608_0273985 | |||
| 1868 | Ga0495628_0292179 | |||
| 1869 | Ga0495628_0363134 | |||
| 1870 | Ga0495628_0429694 | |||
| 1871 | Ga0495628_0429922 | |||
| 1872 | Ga0495628_0718746 | |||
| 1873 | Ga0495630_0006444 | |||
| 1874 | Ga0495630_0378823 | |||
| 1875 | Ga0495630_0498178 | |||
| 1876 | Ga0495630_0525246 | |||
| 1877 | Ga0495666_0327428 | |||
| 1878 | Ga0495652_0017431 | |||
| 1879 | Ga0495652_0161497 | |||
| 1880 | Ga0495652_0375162 | |||
| 1881 | Ga0495652_0546356 | |||
| 1882 | Ga0495652_0812104 | |||
| 1883 | Ga0495665_0147732 | |||
| 1884 | Ga0495586_0065180 | |||
| 1885 | Ga0495586_0102994 | |||
| 1886 | Ga0495586_0241936 | |||
| 1887 | Ga0495586_0249521 | |||
| 1888 | Ga0495586_0587118 | |||
| 1889 | Ga0495586_0877200 | |||
| 1890 | Ga0495587_0000875 | |||
| 1891 | Ga0495587_0064199 | |||
| 1892 | Ga0495587_0142396 | |||
| 1893 | Ga0495598_0073910 | |||
| 1894 | Ga0495598_0245302 | |||
| 1895 | Ga0495621_0242628 | |||
| 1896 | Ga0495645_0015913 | |||
| 1897 | Ga0495645_0139178 | |||
| 1898 | Ga0495645_0195744 | |||
| 1899 | Ga0495645_0267162 | |||
| 1900 | Ga0495645_0274995 | |||
| 1901 | Ga0495633_0231877 | |||
| 1902 | Ga0495667_0011414 | |||
| 1903 | Ga0495667_0016323 | |||
| 1904 | Ga0495667_0125960 | |||
| 1905 | Ga0495667_0176013 | |||
| 1906 | Ga0495667_0261254 | |||
| 1907 | Ga0495667_0785849 | |||
| 1908 | Ga0495656_0155051 | |||
| 1909 | Ga0495634_0089145 | |||
| 1910 | Ga0495634_0110076 | |||
| 1911 | Ga0495635_0262410 | |||
| 1912 | Ga0495635_0323357 | |||
| 1913 | Ga0495635_0923272 | |||
| 1914 | Ga0495657_0004492 | |||
| 1915 | Ga0495599_0048516 | |||
| 1916 | Ga0495599_0051044 | |||
| 1917 | Ga0495599_0438572 | |||
| 1918 | Ga0495623_0350561 | |||
| 1919 | Ga0495647_0227506 | |||
| 1920 | Ga0495658_0034244 | |||
| 1921 | Ga0495613_0000412 | |||
| 1922 | Ga0495613_0041160 | |||
| 1923 | Ga0495613_0054144 | |||
| 1924 | Ga0495613_0276593 | |||
| 1925 | Ga0495600_0221257 | |||
| 1926 | Ga0495600_0600206 | |||
| 1927 | Ga0495581_0248439 | |||
| 1928 | Ga0495636_0010186 | |||
| 1929 | Ga0495636_0038950 | |||
| 1930 | Ga0495674_0069412 | |||
| 1931 | Ga0495674_0078633 | |||
| 1932 | Ga0495674_0081647 | |||
| 1933 | Ga0495674_0162467 | |||
| 1934 | Ga0495674_0201016 | |||
| 1935 | Ga0495674_0618281 | |||
| 1936 | Ga0495675_0037964 | |||
| 1937 | Ga0495675_0223337 | |||
| 1938 | Ga0495675_0338997 | |||
| 1939 | Ga0495675_0369096 | |||
| 1940 | Ga0495684_0001712 | |||
| 1941 | Ga0495684_0013588 | |||
| 1942 | Ga0495684_0066688 | |||
| 1943 | Ga0495684_0074027 | |||
| 1944 | Ga0495684_0078116 | |||
| 1945 | Ga0495684_0185651 | |||
| 1946 | Ga0495684_0432249 | |||
| 1947 | Ga0495684_0527259 | |||
| 1948 | Ga0495684_0765974 | |||
| 1949 | Ga0495593_0273060 | |||
| 1950 | Ga0495602_0004849 | |||
| 1951 | Ga0495602_0032555 | |||
| 1952 | Ga0495602_0101082 | |||
| 1953 | Ga0496104_0142370 | |||
| 1954 | Ga0496104_0162981 | |||
| 1955 | Ga0496104_0204919 | |||
| 1956 | Ga0496105_0348097 | |||
| 1957 | Ga0496105_0818044 | |||
| 1958 | Ga0496106_0419215 | |||
| 1959 | Ga0496108_0709793 | |||
| 1960 | Ga0496108_1385210 | |||
| 1961 | Ga0496109_0690381 | |||
| 1962 | Ga0496110_0156887 | |||
| 1963 | Ga0496110_0439066 | |||
| 1964 | Ga0496112_1090693 | |||
| 1965 | Ga0496114_0099313 | |||
| 1966 | Ga0496114_1074345 | |||
| 1967 | Ga0496115_0084893 | |||
| 1968 | nmdc:mga05p37_55458_c1 | |||
| 1969 | nmdc:mga05p37_621352_c1 | |||
| 1970 | nmdc:mga09592_2369_c2 | |||
| 1971 | nmdc:mga09592_76774_c1 | |||
| 1972 | nmdc:mga0qj67_5287_c1 | |||
| 1973 | nmdc:mga06r32_4210_c1 | |||
| 1974 | nmdc:mga08y16_1053182_c1 | |||
| 1975 | nmdc:mga08y16_348872_c1 | |||
| 1976 | nmdc:mga08y16_479287_c1 | |||
| 1977 | nmdc:mga08y16_605972_c1 | |||
| 1978 | nmdc:mga08y16_643950_c1 | |||
| 1979 | nmdc:mga08y16_86868_c1 | |||
| 1980 | nmdc:mga0n895_192923_c1 | |||
| 1981 | nmdc:mga0n895_49344_c1 | |||
| 1982 | nmdc:mga0n895_550186_c1 | |||
| 1983 | nmdc:mga0n895_63470_c1 | |||
| 1984 | nmdc:mga0rr50_1028016_c1 | |||
| 1985 | nmdc:mga0rr50_878879_c1 | |||
| 1986 | nmdc:mga0a205_194793_c1 | |||
| 1987 | nmdc:mga0a205_26550_c1 | |||
| 1988 | Ga0495601_0002322 | |||
| 1989 | Ga0495601_0081500 | |||
| 1990 | Ga0495612_0275019 | |||
| 1991 | Ga0495595_0288142 | |||
| 1992 | Ga0495619_0000326 | |||
| 1993 | Ga0495619_0229903 | |||
| 1994 | Ga0495619_0945256 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fa5-assembly1.cif.gz_B | crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli | 0.8336 | 24 | 149 |
| 2p7p-assembly2.cif.gz_D | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion | 0.8326 | 25 | 152 |
| 2p7q-assembly4.cif.gz_D-2 | crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid | 0.8253 | 25 | 147 |
| 2p7k-assembly1.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) | 0.8219 | 24 | 152 |
| 2p7l-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 | 0.8219 | 25 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8324 | 99 | 150 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8299 | 95 | 154 | 3.30.720.110 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8222 | 24 | 152 | 3.10.180.10 |
| af_P15179_25_134_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8124 | 118 | 148 | 2.40.50.140 |
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8086 | 28 | 149 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3WTK2-F1-model_v4 | deleted | 0.9284 | 15 | 154 |
|
| AF-A0A1G0KCF0-F1-model_v4 | VOC domain-containing protein | 0.918 | 12 | 153 |
|
| AF-A0A7C8H242-F1-model_v4 | deleted | 0.8913 | 99 | 156 |
|
| AF-A0A7Y0BN36-F1-model_v4 | Glyoxalase/bleomycin resistance/dioxygenase family protein | 0.891 | 30 | 150 |
GO:0051213
|
| AF-A0A1Q7F0Z4-F1-model_v4 | VOC domain-containing protein | 0.8855 | 24 | 153 |
|