F487508

General Info

Members Datasets Scaffolds Average Seq Length
985 246 1970 164

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0741319|Ga0466963_0741319_14_505
Length 163
Sequence MSEGGERRIALAAVAGAHGVKGELRLKLFSESAESLSRHEKVFVGGVERRLLFVRDGGKTAVARIEGVSDRSAAEALRGTLIEVDRISLPPLEEGEYYHADLIGLPVVDRQAKPVGAVAAVENYGAGDLLEIDVKGKRSLIPFRDGIADLEDGRIVIDPEFLA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4.87
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0741319 3300044694 Bacteria 693
2 JGI24746J21847_1006150 3300001977 Bacteria 1864
3 JGI24740J21852_10011235 3300001979 Bacteria 3416
4 JGI24740J21852_10026679 3300001979 Bacteria 1932
5 JGI24739J22299_10029807 3300001989 Bacteria 1894
6 JGI24739J22299_10044564 3300001989 Bacteria 1460
7 JGI24737J22298_10004224 3300001990 Bacteria 5024
8 JGI24737J22298_10006934 3300001990 Bacteria 3843
9 JGI24737J22298_10016699 3300001990 Bacteria 2369
10 JGI24737J22298_10030371 3300001990 Bacteria 1691
11 JGI24743J22301_10041815 3300001991 Bacteria 921
12 JGI24735J21928_10030428 3300002067 Bacteria 1604
13 JGI24735J21928_10058028 3300002067 Bacteria 1113
14 JGI24735J21928_10098534 3300002067 Bacteria 839
15 JGI24738J21930_10016072 3300002075 Bacteria 1586
16 JGI24738J21930_10056670 3300002075 Bacteria 802
17 JGI24744J21845_10034295 3300002077 Bacteria 963
18 Ga0065715_10032120 3300005293 Bacteria 1262
19 Ga0065715_10390953 3300005293 Bacteria 894
20 Ga0070658_10000183 3300005327 Bacteria 54970
21 Ga0070658_10017240 3300005327 Bacteria 5779
22 Ga0070658_10093771 3300005327 Bacteria 2476
23 Ga0070658_10147687 3300005327 Bacteria 1967
24 Ga0070658_10191787 3300005327 Bacteria 1722
25 Ga0070658_10205828 3300005327 Bacteria 1661
26 Ga0070658_10333415 3300005327 Bacteria 1297
27 Ga0070658_10986925 3300005327 Bacteria 732
28 Ga0070676_10064191 3300005328 Bacteria 2189
29 Ga0070676_10209665 3300005328 Bacteria 1281
30 Ga0070676_10489140 3300005328 Bacteria 872
31 Ga0070683_100000846 3300005329 Bacteria 22677
32 Ga0070683_100113981 3300005329 Bacteria 2552
33 Ga0070683_100192439 3300005329 Bacteria 1937
34 Ga0070683_100728795 3300005329 Bacteria 950
35 Ga0070683_101194563 3300005329 Bacteria 731
36 Ga0070690_100010247 3300005330 Bacteria 5448
37 Ga0070690_100035762 3300005330 Bacteria 3118
38 Ga0070690_100267394 3300005330 Bacteria 1215
39 Ga0070690_100612331 3300005330 Bacteria 828
40 Ga0070670_100014882 3300005331 Bacteria 6673
41 Ga0070670_100033856 3300005331 Bacteria 4399
42 Ga0070670_100040208 3300005331 Bacteria 4021
43 Ga0070670_100040993 3300005331 Bacteria 3979
44 Ga0070670_100436808 3300005331 Bacteria 1159
45 Ga0070670_100719473 3300005331 Bacteria 898
46 Ga0070677_10343494 3300005333 Bacteria 771
47 Ga0068869_100023142 3300005334 Bacteria 4287
48 Ga0070666_10000784 3300005335 Bacteria 19242
49 Ga0070666_10057304 3300005335 Bacteria 2632
50 Ga0070666_10160333 3300005335 Bacteria 1572
51 Ga0070666_10529474 3300005335 Bacteria 856
52 Ga0070680_100028404 3300005336 Bacteria 4486
53 Ga0070680_100030637 3300005336 Bacteria 4322
54 Ga0070680_100052237 3300005336 Bacteria 3336
55 Ga0070680_100315243 3300005336 Bacteria 1327
56 Ga0070682_100016895 3300005337 Bacteria 4247
57 Ga0070682_100070707 3300005337 Bacteria 2232
58 Ga0070682_100201292 3300005337 Bacteria 1405
59 Ga0070682_100716462 3300005337 Bacteria 804
60 Ga0068868_100002185 3300005338 Bacteria 13483
61 Ga0068868_100063881 3300005338 Bacteria 2921
62 Ga0068868_100078083 3300005338 Bacteria 2650
63 Ga0068868_100079885 3300005338 Bacteria 2620
64 Ga0068868_100896951 3300005338 Bacteria 805
65 Ga0068868_101726963 3300005338 Bacteria 590
66 Ga0070660_100000355 3300005339 Bacteria 30584
67 Ga0070660_100000378 3300005339 Bacteria 29634
68 Ga0070660_100036606 3300005339 Bacteria 3717
69 Ga0070660_100041322 3300005339 Bacteria 3514
70 Ga0070660_100047555 3300005339 Bacteria 3293
71 Ga0070660_100070202 3300005339 Bacteria 2733
72 Ga0070660_100078845 3300005339 Bacteria 2583
73 Ga0070660_100095310 3300005339 Bacteria 2352
74 Ga0070660_100167479 3300005339 Bacteria 1773
75 Ga0070660_100192332 3300005339 Bacteria 1653
76 Ga0070660_100212114 3300005339 Bacteria 1572
77 Ga0070660_100260919 3300005339 Bacteria 1415
78 Ga0070660_100594736 3300005339 Bacteria 925
79 Ga0070660_100643788 3300005339 Bacteria 887
80 Ga0070691_10000225 3300005341 Bacteria 19202
81 Ga0070687_100049938 3300005343 Bacteria 2159
82 Ga0070661_100000485 3300005344 Bacteria 30409
83 Ga0070661_100048460 3300005344 Bacteria 3110
84 Ga0070661_100125190 3300005344 Bacteria 1927
85 Ga0070661_100136465 3300005344 Bacteria 1846
86 Ga0070661_100152156 3300005344 Bacteria 1749
87 Ga0070661_100208609 3300005344 Bacteria 1495
88 Ga0070661_100227862 3300005344 Bacteria 1431
89 Ga0070661_100248970 3300005344 Bacteria 1371
90 Ga0070661_100350112 3300005344 Bacteria 1159
91 Ga0070661_101149159 3300005344 Bacteria 648
92 Ga0070692_10076636 3300005345 Bacteria 1793
93 Ga0070668_100414372 3300005347 Bacteria 1152
94 Ga0070668_100697503 3300005347 Bacteria 895
95 Ga0070669_100248827 3300005353 Unclassified 1415
96 Ga0070669_100425538 3300005353 Bacteria 1090
97 Ga0070675_100085206 3300005354 Bacteria 2640
98 Ga0070671_100026952 3300005355 Bacteria 4727
99 Ga0070671_100081622 3300005355 Bacteria 2703
100 Ga0070671_100269109 3300005355 Bacteria 1448
101 Ga0070671_100281103 3300005355 Bacteria 1415
102 Ga0070671_100377625 3300005355 Bacteria 1211
103 Ga0070671_100417065 3300005355 Bacteria 1150
104 Ga0070674_100019841 3300005356 Bacteria 4280
105 Ga0070674_100060478 3300005356 Bacteria 2640
106 Ga0070674_100222660 3300005356 Bacteria 1468
107 Ga0070674_100335395 3300005356 Bacteria 1216
108 Ga0070673_100085606 3300005364 Bacteria 2566
109 Ga0070673_100103004 3300005364 Bacteria 2354
110 Ga0070673_100114919 3300005364 Bacteria 2237
111 Ga0070673_100187777 3300005364 Bacteria 1773
112 Ga0070673_100373653 3300005364 Bacteria 1270
113 Ga0070673_100597358 3300005364 Bacteria 1006
114 Ga0070688_100101713 3300005365 Bacteria 1896
115 Ga0070688_100242845 3300005365 Bacteria 1279
116 Ga0070659_100006821 3300005366 Bacteria 8267
117 Ga0070659_100020041 3300005366 Bacteria 5078
118 Ga0070659_100043087 3300005366 Bacteria 3530
119 Ga0070659_100065207 3300005366 Bacteria 2884
120 Ga0070659_100065946 3300005366 Bacteria 2868
121 Ga0070659_100067896 3300005366 Bacteria 2828
122 Ga0070659_100078653 3300005366 Bacteria 2631
123 Ga0070659_100137627 3300005366 Bacteria 1986
124 Ga0070659_100146713 3300005366 Bacteria 1923
125 Ga0070659_100238637 3300005366 Bacteria 1504
126 Ga0070659_100674958 3300005366 Bacteria 892
127 Ga0070659_101456595 3300005366 Bacteria 609
128 Ga0070667_100000764 3300005367 Bacteria 30578
129 Ga0070667_100010668 3300005367 Bacteria 7590
130 Ga0070667_100052231 3300005367 Bacteria 3448
131 Ga0070667_100136842 3300005367 Bacteria 2142
132 Ga0070667_100424149 3300005367 Bacteria 1213
133 Ga0070667_100430418 3300005367 Bacteria 1204
134 Ga0070709_10314994 3300005434 Bacteria 1147
135 Ga0070714_100069880 3300005435 Bacteria 3034
136 Ga0070714_100251868 3300005435 Bacteria 1633
137 Ga0070713_100029606 3300005436 Bacteria 4339
138 Ga0070713_100042551 3300005436 Bacteria 3708
139 Ga0070711_100907425 3300005439 Bacteria 752
140 Ga0070694_100050983 3300005444 Bacteria 2792
141 Ga0070663_100025419 3300005455 Bacteria 3998
142 Ga0070663_100083239 3300005455 Bacteria 2356
143 Ga0070663_100088639 3300005455 Bacteria 2288
144 Ga0070663_100199062 3300005455 Bacteria 1562
145 Ga0070663_100203623 3300005455 Bacteria 1546
146 Ga0070663_100222824 3300005455 Bacteria 1481
147 Ga0070663_100359521 3300005455 Bacteria 1181
148 Ga0070663_100544021 3300005455 Bacteria 970
149 Ga0070663_100548818 3300005455 Bacteria 966
150 Ga0070663_101050201 3300005455 Bacteria 710
151 Ga0070678_100031301 3300005456 Bacteria 3668
152 Ga0070678_100046089 3300005456 Bacteria 3123
153 Ga0070678_100355045 3300005456 Unclassified 1261
154 Ga0070662_100000793 3300005457 Bacteria 19387
155 Ga0070662_100007148 3300005457 Bacteria 7230
156 Ga0070662_100027905 3300005457 Bacteria 3924
157 Ga0070662_100041532 3300005457 Bacteria 3282
158 Ga0070662_100056693 3300005457 Bacteria 2845
159 Ga0070662_100066577 3300005457 Bacteria 2643
160 Ga0070662_100102818 3300005457 Bacteria 2165
161 Ga0070662_100136081 3300005457 Bacteria 1900
162 Ga0070662_100177386 3300005457 Bacteria 1678
163 Ga0070662_100464755 3300005457 Bacteria 1052
164 Ga0070662_100470963 3300005457 Bacteria 1045
165 Ga0070662_100584655 3300005457 Bacteria 938
166 Ga0070681_10107574 3300005458 Bacteria 2729
167 Ga0070681_10196894 3300005458 Bacteria 1934
168 Ga0070681_10299234 3300005458 Bacteria 1519
169 Ga0070681_10316024 3300005458 Bacteria 1471
170 Ga0070681_10343057 3300005458 Bacteria 1404
171 Ga0070681_10612875 3300005458 Bacteria 1003
172 Ga0070681_11526236 3300005458 Bacteria 593
173 Ga0068867_100048650 3300005459 Bacteria 3120
174 Ga0068867_100182370 3300005459 Bacteria 1670
175 Ga0068867_100310759 3300005459 Bacteria 1302
176 Ga0068867_100554502 3300005459 Bacteria 996
177 Ga0070685_10419116 3300005466 Bacteria 931
178 Ga0070679_100149654 3300005530 Bacteria 2311
179 Ga0070679_100232758 3300005530 Bacteria 1802
180 Ga0070679_100314203 3300005530 Bacteria 1516
181 Ga0070684_100040641 3300005535 Bacteria 4006
182 Ga0070684_100046901 3300005535 Bacteria 3744
183 Ga0070684_100052329 3300005535 Bacteria 3551
184 Ga0068853_100000848 3300005539 Bacteria 21352
185 Ga0068853_100075455 3300005539 Bacteria 2942
186 Ga0068853_100094409 3300005539 Bacteria 2635
187 Ga0068853_100156555 3300005539 Bacteria 2053
188 Ga0068853_100171611 3300005539 Bacteria 1962
189 Ga0068853_100204242 3300005539 Bacteria 1799
190 Ga0070672_100010512 3300005543 Bacteria 6422
191 Ga0070672_100018520 3300005543 Bacteria 5036
192 Ga0070672_100031146 3300005543 Bacteria 4013
193 Ga0070672_100047034 3300005543 Bacteria 3346
194 Ga0070672_100048296 3300005543 Bacteria 3307
195 Ga0070672_100324939 3300005543 Bacteria 1308
196 Ga0070672_100536978 3300005543 Bacteria 1014
197 Ga0070672_101331283 3300005543 Bacteria 641
198 Ga0070686_100074398 3300005544 Bacteria 2233
199 Ga0070695_100315322 3300005545 Bacteria 1160
200 Ga0070693_100005013 3300005547 Bacteria 6327
201 Ga0070693_100822640 3300005547 Bacteria 690
202 Ga0070693_101141470 3300005547 Unclassified 596
203 Ga0070665_100080334 3300005548 Bacteria 3266
204 Ga0070665_100118407 3300005548 Bacteria 2650
205 Ga0070665_100145808 3300005548 Bacteria 2370
206 Ga0070665_100712981 3300005548 Bacteria 1016
207 Ga0070704_100321075 3300005549 Bacteria 1297
208 Ga0068855_100000480 3300005563 Bacteria 49187
209 Ga0068855_100005847 3300005563 Bacteria 15017
210 Ga0068855_100107916 3300005563 Bacteria 3198
211 Ga0068855_100121553 3300005563 Bacteria 2988
212 Ga0068855_100477524 3300005563 Bacteria 1357
213 Ga0070664_100000066 3300005564 Bacteria 65204
214 Ga0070664_100003204 3300005564 Bacteria 13221
215 Ga0070664_100004403 3300005564 Bacteria 11311
216 Ga0070664_100040266 3300005564 Bacteria 3939
217 Ga0070664_100078115 3300005564 Bacteria 2847
218 Ga0070664_100081658 3300005564 Bacteria 2786
219 Ga0070664_100246151 3300005564 Bacteria 1606
220 Ga0070664_100483294 3300005564 Bacteria 1140
221 Ga0070664_101329320 3300005564 Bacteria 679
222 Ga0068857_100003003 3300005577 Bacteria 13924
223 Ga0068857_100045313 3300005577 Bacteria 3901
224 Ga0068857_100131085 3300005577 Bacteria 2261
225 Ga0068857_100261098 3300005577 Bacteria 1589
226 Ga0068854_100037539 3300005578 Bacteria 3402
227 Ga0068854_100044040 3300005578 Bacteria 3166
228 Ga0068854_100059073 3300005578 Bacteria 2770
229 Ga0068854_100092156 3300005578 Bacteria 2257
230 Ga0068854_100319465 3300005578 Bacteria 1261
231 Ga0068854_100456239 3300005578 Bacteria 1069
232 Ga0068854_100925440 3300005578 Bacteria 767
233 Ga0068854_101511915 3300005578 Bacteria 610
234 Ga0068856_100000213 3300005614 Bacteria 62582
235 Ga0068856_100048398 3300005614 Bacteria 4189
236 Ga0068856_100133298 3300005614 Bacteria 2489
237 Ga0068856_100163320 3300005614 Bacteria 2238
238 Ga0068856_100316287 3300005614 Bacteria 1578
239 Ga0068856_100423264 3300005614 Bacteria 1352
240 Ga0068856_100705740 3300005614 Bacteria 1029
241 Ga0068856_100708581 3300005614 Bacteria 1027
242 Ga0068856_101000140 3300005614 Bacteria 854
243 Ga0068856_101073520 3300005614 Bacteria 823
244 Ga0070702_100223419 3300005615 Bacteria 1261
245 Ga0068852_100034686 3300005616 Bacteria 4201
246 Ga0068852_100043695 3300005616 Bacteria 3801
247 Ga0068852_100044867 3300005616 Bacteria 3757
248 Ga0068852_100074303 3300005616 Bacteria 2993
249 Ga0068852_100130283 3300005616 Bacteria 2315
250 Ga0068852_100136827 3300005616 Bacteria 2262
251 Ga0068852_100152311 3300005616 Bacteria 2151
252 Ga0068852_100167502 3300005616 Bacteria 2057
253 Ga0068852_100233779 3300005616 Bacteria 1753
254 Ga0068852_100332103 3300005616 Bacteria 1479
255 Ga0068852_100347061 3300005616 Bacteria 1448
256 Ga0068859_100190866 3300005617 Bacteria 2133
257 Ga0068859_100245688 3300005617 Bacteria 1879
258 Ga0068859_100278037 3300005617 Bacteria 1767
259 Ga0068859_100321484 3300005617 Bacteria 1641
260 Ga0068859_100453828 3300005617 Bacteria 1378
261 Ga0068864_100006481 3300005618 Bacteria 9588
262 Ga0068864_100021963 3300005618 Bacteria 5349
263 Ga0068864_100056486 3300005618 Bacteria 3392
264 Ga0068864_100065492 3300005618 Bacteria 3152
265 Ga0068864_100099178 3300005618 Bacteria 2580
266 Ga0068864_100320708 3300005618 Bacteria 1455
267 Ga0068851_10017425 3300005834 Bacteria 3449
268 Ga0068851_10018074 3300005834 Bacteria 3395
269 Ga0068851_10067645 3300005834 Bacteria 1843
270 Ga0068851_10157728 3300005834 Bacteria 1244
271 Ga0068870_10558141 3300005840 Bacteria 772
272 Ga0068863_100008515 3300005841 Bacteria 10018
273 Ga0068863_100075804 3300005841 Bacteria 3182
274 Ga0068863_100114348 3300005841 Bacteria 2571
275 Ga0068863_100225041 3300005841 Bacteria 1808
276 Ga0068863_100459956 3300005841 Bacteria 1250
277 Ga0068863_100836134 3300005841 Bacteria 919
278 Ga0068858_100012234 3300005842 Bacteria 8092
279 Ga0068858_100076559 3300005842 Bacteria 3107
280 Ga0068858_101271946 3300005842 Bacteria 724
281 Ga0068860_100069472 3300005843 Bacteria 3348
282 Ga0068860_100101165 3300005843 Bacteria 2750
283 Ga0068860_100185883 3300005843 Bacteria 2009
284 Ga0068860_100315825 3300005843 Bacteria 1533
285 Ga0068860_100379535 3300005843 Bacteria 1395
286 Ga0068862_100131997 3300005844 Bacteria 2210
287 Ga0068862_100387678 3300005844 Bacteria 1304
288 Ga0068862_100562302 3300005844 Bacteria 1090
289 Ga0068862_100978710 3300005844 Bacteria 836
290 Ga0070717_10011949 3300006028 Bacteria 6609
291 Ga0075366_10028095 3300006195 Bacteria 3300
292 Ga0097621_100061713 3300006237 Bacteria 3075
293 Ga0097621_100093841 3300006237 Bacteria 2515
294 Ga0097621_100191923 3300006237 Bacteria 1769
295 Ga0097621_100313050 3300006237 Bacteria 1389
296 Ga0068871_100216244 3300006358 Bacteria 1659
297 Ga0068871_100262187 3300006358 Bacteria 1508
298 Ga0068871_100902557 3300006358 Bacteria 819
299 Ga0068871_101458144 3300006358 Bacteria 646
300 Ga0075428_100157986 3300006844 Bacteria 2461
301 Ga0075431_100795740 3300006847 Bacteria 919
302 Ga0075434_100369231 3300006871 Bacteria 1456
303 Ga0068865_100015764 3300006881 Bacteria 4822
304 Ga0068865_100050040 3300006881 Bacteria 2884
305 Ga0075436_100322403 3300006914 Bacteria 1110
306 Ga0097620_100190867 3300006931 Bacteria 2133
307 Ga0097620_100245692 3300006931 Bacteria 1879
308 Ga0097620_100278027 3300006931 Bacteria 1767
309 Ga0097620_100321478 3300006931 Bacteria 1641
310 Ga0097620_100453846 3300006931 Bacteria 1378
311 Ga0105240_10056853 3300009093 Bacteria 4893
312 Ga0105240_10471943 3300009093 Bacteria 1400
313 Ga0105245_10069022 3300009098 Bacteria 3204
314 Ga0105245_10092048 3300009098 Bacteria 2792
315 Ga0105245_10189820 3300009098 Bacteria 1968
316 Ga0114129_10648199 3300009147 Bacteria 1363
317 Ga0105243_10064626 3300009148 Bacteria 2937
318 Ga0105243_10140356 3300009148 Bacteria 2061
319 Ga0105241_10029441 3300009174 Bacteria 4097
320 Ga0105241_10196178 3300009174 Bacteria 1683
321 Ga0105241_10283169 3300009174 Bacteria 1416
322 Ga0105241_11487171 3300009174 Bacteria 651
323 Ga0105241_11980518 3300009174 Bacteria 573
324 Ga0105242_10061662 3300009176 Bacteria 3084
325 Ga0105248_10002046 3300009177 Bacteria 22341
326 Ga0105248_10002343 3300009177 Bacteria 21013
327 Ga0105248_10003721 3300009177 Bacteria 16908
328 Ga0105248_10007464 3300009177 Bacteria 11997
329 Ga0105248_10181879 3300009177 Bacteria 2369
330 Ga0105248_10610236 3300009177 Bacteria 1231
331 Ga0105238_10249263 3300009551 Bacteria 1754
332 Ga0105238_10359414 3300009551 Bacteria 1445
333 Ga0105238_10480953 3300009551 Bacteria 1241
334 Ga0105238_11215889 3300009551 Bacteria 778
335 Ga0105238_11219118 3300009551 Bacteria 777
336 Ga0105249_10041962 3300009553 Bacteria 4160
337 Ga0105239_10299020 3300010375 Bacteria 1812
338 Ga0105246_10121803 3300011119 Bacteria 1934
339 Ga0157373_10040504 3300013100 Bacteria 3333
340 Ga0157373_10072826 3300013100 Bacteria 2425
341 Ga0157373_10079169 3300013100 Bacteria 2318
342 Ga0157373_10094093 3300013100 Bacteria 2110
343 Ga0157373_10097590 3300013100 Bacteria 2068
344 Ga0157373_10197764 3300013100 Bacteria 1417
345 Ga0157373_10718484 3300013100 Bacteria 733
346 Ga0157371_10009971 3300013102 Bacteria 7434
347 Ga0157371_10026402 3300013102 Bacteria 4222
348 Ga0157371_10139246 3300013102 Bacteria 1729
349 Ga0157371_10146782 3300013102 Bacteria 1681
350 Ga0157371_10375995 3300013102 Bacteria 1037
351 Ga0157371_10886966 3300013102 Bacteria 676
352 Ga0157370_10074309 3300013104 Bacteria 3206
353 Ga0157370_10110312 3300013104 Bacteria 2572
354 Ga0157370_10116518 3300013104 Bacteria 2495
355 Ga0157370_10308620 3300013104 Unclassified 1460
356 Ga0157370_10365274 3300013104 Bacteria 1330
357 Ga0157370_10428868 3300013104 Bacteria 1216
358 Ga0157370_10453556 3300013104 Unclassified 1179
359 Ga0157369_10080893 3300013105 Bacteria 3477
360 Ga0157369_10081793 3300013105 Bacteria 3456
361 Ga0157369_10089869 3300013105 Bacteria 3279
362 Ga0157369_10189057 3300013105 Bacteria 2164
363 Ga0157369_10248696 3300013105 Bacteria 1856
364 Ga0157369_10403885 3300013105 Bacteria 1417
365 Ga0157369_10568522 3300013105 Bacteria 1171
366 Ga0157369_10636383 3300013105 Bacteria 1100
367 Ga0157369_11396679 3300013105 Bacteria 713
368 Ga0157369_11811656 3300013105 Unclassified 620
369 Ga0157374_10005153 3300013296 Bacteria 10957
370 Ga0157374_10115415 3300013296 Bacteria 2586
371 Ga0157374_10127291 3300013296 Bacteria 2462
372 Ga0157374_10365465 3300013296 Bacteria 1435
373 Ga0157374_10539145 3300013296 Unclassified 1174
374 Ga0157374_11038424 3300013296 Bacteria 839
375 Ga0157378_10109451 3300013297 Bacteria 2531
376 Ga0157378_10128281 3300013297 Bacteria 2345
377 Ga0157378_10376119 3300013297 Bacteria 1394
378 Ga0157378_10639062 3300013297 Bacteria 1079
379 Ga0157378_11881501 3300013297 Bacteria 647
380 Ga0163162_10020273 3300013306 Bacteria 6529
381 Ga0163162_10073340 3300013306 Bacteria 3479
382 Ga0163162_10649433 3300013306 Bacteria 1179
383 Ga0163162_11825781 3300013306 Bacteria 695
384 Ga0157372_10125781 3300013307 Bacteria 2947
385 Ga0157372_10194062 3300013307 Bacteria 2352
386 Ga0157372_10461322 3300013307 Bacteria 1481
387 Ga0157372_10658620 3300013307 Bacteria 1219
388 Ga0157372_11427829 3300013307 Bacteria 798
389 Ga0157375_10038481 3300013308 Bacteria 4592
390 Ga0157375_10269924 3300013308 Bacteria 1863
391 Ga0157375_10772579 3300013308 Bacteria 1111
392 Ga0163163_10011489 3300014325 Bacteria 8035
393 Ga0163163_10086702 3300014325 Bacteria 3140
394 Ga0163163_10151433 3300014325 Bacteria 2363
395 Ga0163163_10444049 3300014325 Bacteria 1357
396 Ga0157380_10448732 3300014326 Bacteria 1238
397 Ga0157377_10398034 3300014745 Unclassified 937
398 Ga0157379_10279957 3300014968 Bacteria 1518
399 Ga0157379_10302921 3300014968 Bacteria 1457
400 Ga0163161_10391160 3300017792 Bacteria 1113
401 Ga0207697_10006795 3300025315 Bacteria 5144
402 Ga0207697_10082949 3300025315 Bacteria 1352
403 Ga0207656_10032761 3300025321 Bacteria 2160
404 Ga0207656_10073015 3300025321 Bacteria 1529
405 Ga0207656_10245125 3300025321 Bacteria 876
406 Ga0207682_10212900 3300025893 Bacteria 892
407 Ga0207642_10031875 3300025899 Bacteria 2213
408 Ga0207642_10065952 3300025899 Bacteria 1703
409 Ga0207688_10006887 3300025901 Bacteria 6184
410 Ga0207688_10109533 3300025901 Bacteria 1602
411 Ga0207688_10180567 3300025901 Bacteria 1258
412 Ga0207688_10184919 3300025901 Bacteria 1244
413 Ga0207688_10207000 3300025901 Bacteria 1178
414 Ga0207680_10023059 3300025903 Bacteria 3393
415 Ga0207647_10009258 3300025904 Bacteria 7004
416 Ga0207647_10011621 3300025904 Bacteria 6165
417 Ga0207647_10015518 3300025904 Bacteria 5219
418 Ga0207647_10044801 3300025904 Bacteria 2763
419 Ga0207647_10055041 3300025904 Bacteria 2446
420 Ga0207647_10147403 3300025904 Bacteria 1377
421 Ga0207647_10386147 3300025904 Bacteria 790
422 Ga0207645_10043371 3300025907 Bacteria 2878
423 Ga0207645_10073574 3300025907 Bacteria 2187
424 Ga0207645_10237388 3300025907 Bacteria 1204
425 Ga0207645_10811796 3300025907 Bacteria 636
426 Ga0207643_10405267 3300025908 Unclassified 863
427 Ga0207705_10000131 3300025909 Bacteria 81639
428 Ga0207705_10000234 3300025909 Bacteria 55024
429 Ga0207705_10015561 3300025909 Bacteria 5459
430 Ga0207705_10023723 3300025909 Bacteria 4377
431 Ga0207705_10026945 3300025909 Bacteria 4096
432 Ga0207705_10045350 3300025909 Bacteria 3159
433 Ga0207705_10059962 3300025909 Bacteria 2747
434 Ga0207705_10061359 3300025909 Bacteria 2716
435 Ga0207705_10103576 3300025909 Bacteria 2096
436 Ga0207705_10276725 3300025909 Bacteria 1284
437 Ga0207705_10303561 3300025909 Bacteria 1225
438 Ga0207705_10402076 3300025909 Bacteria 1059
439 Ga0207654_10035844 3300025911 Bacteria 2767
440 Ga0207654_10261242 3300025911 Bacteria 1164
441 Ga0207654_10353093 3300025911 Bacteria 1013
442 Ga0207707_10301859 3300025912 Bacteria 1384
443 Ga0207707_10646193 3300025912 Bacteria 892
444 Ga0207707_10887695 3300025912 Bacteria 738
445 Ga0207707_11267966 3300025912 Bacteria 593
446 Ga0207695_10006878 3300025913 Bacteria 14637
447 Ga0207695_10049561 3300025913 Bacteria 4425
448 Ga0207695_10056772 3300025913 Bacteria 4072
449 Ga0207671_10471275 3300025914 Bacteria 1001
450 Ga0207660_10001465 3300025917 Bacteria 15872
451 Ga0207660_10056470 3300025917 Bacteria 2809
452 Ga0207660_10103168 3300025917 Bacteria 2133
453 Ga0207660_10721526 3300025917 Bacteria 813
454 Ga0207662_10028172 3300025918 Bacteria 3245
455 Ga0207657_10000598 3300025919 Bacteria 38277
456 Ga0207657_10005362 3300025919 Bacteria 13431
457 Ga0207657_10005629 3300025919 Bacteria 13076
458 Ga0207657_10064946 3300025919 Bacteria 3113
459 Ga0207657_10069994 3300025919 Bacteria 2975
460 Ga0207657_10071390 3300025919 Bacteria 2940
461 Ga0207657_10082054 3300025919 Bacteria 2707
462 Ga0207657_10082378 3300025919 Bacteria 2701
463 Ga0207657_10097568 3300025919 Bacteria 2443
464 Ga0207657_10164813 3300025919 Bacteria 1798
465 Ga0207657_10198943 3300025919 Bacteria 1613
466 Ga0207657_10247681 3300025919 Bacteria 1421
467 Ga0207657_10257473 3300025919 Bacteria 1389
468 Ga0207657_10339266 3300025919 Bacteria 1186
469 Ga0207657_10509109 3300025919 Bacteria 943
470 Ga0207657_10681160 3300025919 Bacteria 799
471 Ga0207657_10864009 3300025919 Bacteria 698
472 Ga0207649_10000159 3300025920 Bacteria 54703
473 Ga0207649_10019673 3300025920 Bacteria 3863
474 Ga0207649_10076841 3300025920 Bacteria 2150
475 Ga0207649_10181173 3300025920 Bacteria 1475
476 Ga0207649_10204763 3300025920 Bacteria 1396
477 Ga0207649_10257990 3300025920 Bacteria 1258
478 Ga0207649_10404341 3300025920 Bacteria 1022
479 Ga0207649_10688606 3300025920 Bacteria 792
480 Ga0207652_10135952 3300025921 Bacteria 2195
481 Ga0207652_10367045 3300025921 Bacteria 1299
482 Ga0207652_10983458 3300025921 Bacteria 742
483 Ga0207681_10039391 3300025923 Bacteria 3137
484 Ga0207681_10054289 3300025923 Bacteria 2724
485 Ga0207694_10093842 3300025924 Bacteria 2371
486 Ga0207694_10351106 3300025924 Bacteria 1221
487 Ga0207650_10024869 3300025925 Bacteria 4263
488 Ga0207650_10040433 3300025925 Bacteria 3412
489 Ga0207650_10056801 3300025925 Bacteria 2909
490 Ga0207650_10070513 3300025925 Bacteria 2627
491 Ga0207650_10125038 3300025925 Bacteria 2006
492 Ga0207650_10339068 3300025925 Bacteria 1234
493 Ga0207650_10625830 3300025925 Unclassified 906
494 Ga0207659_10009052 3300025926 Bacteria 6211
495 Ga0207687_10055424 3300025927 Bacteria 2778
496 Ga0207687_10188235 3300025927 Bacteria 1604
497 Ga0207687_10188609 3300025927 Bacteria 1603
498 Ga0207687_10349284 3300025927 Bacteria 1205
499 Ga0207687_10455488 3300025927 Bacteria 1062
500 Ga0207700_10182733 3300025928 Bacteria 1757
501 Ga0207664_10038971 3300025929 Bacteria 3687
502 Ga0207664_10053221 3300025929 Bacteria 3203
503 Ga0207664_10055692 3300025929 Bacteria 3138
504 Ga0207664_10479337 3300025929 Bacteria 1113
505 Ga0207644_10000452 3300025931 Bacteria 26514
506 Ga0207644_10004027 3300025931 Bacteria 9534
507 Ga0207644_10005865 3300025931 Bacteria 8005
508 Ga0207644_10024708 3300025931 Bacteria 4126
509 Ga0207644_10025397 3300025931 Bacteria 4075
510 Ga0207644_10039504 3300025931 Bacteria 3331
511 Ga0207644_10045406 3300025931 Bacteria 3125
512 Ga0207644_10047062 3300025931 Bacteria 3076
513 Ga0207644_10097840 3300025931 Bacteria 2198
514 Ga0207644_10214413 3300025931 Bacteria 1523
515 Ga0207644_10414989 3300025931 Bacteria 1102
516 Ga0207644_10457266 3300025931 Bacteria 1049
517 Ga0207690_10000120 3300025932 Bacteria 65338
518 Ga0207690_10006939 3300025932 Bacteria 6713
519 Ga0207690_10023006 3300025932 Bacteria 3884
520 Ga0207690_10045150 3300025932 Bacteria 2909
521 Ga0207690_10081619 3300025932 Bacteria 2260
522 Ga0207690_10090265 3300025932 Bacteria 2163
523 Ga0207690_10241164 3300025932 Bacteria 1392
524 Ga0207690_11277987 3300025932 Bacteria 613
525 Ga0207706_10000200 3300025933 Bacteria 65947
526 Ga0207706_10001063 3300025933 Bacteria 27913
527 Ga0207706_10048740 3300025933 Bacteria 3746
528 Ga0207706_10050300 3300025933 Bacteria 3683
529 Ga0207706_10054223 3300025933 Bacteria 3539
530 Ga0207706_10102482 3300025933 Bacteria 2518
531 Ga0207706_10124535 3300025933 Bacteria 2267
532 Ga0207706_10176698 3300025933 Bacteria 1876
533 Ga0207706_11275939 3300025933 Bacteria 608
534 Ga0207686_10234890 3300025934 Bacteria 1331
535 Ga0207709_10280446 3300025935 Bacteria 1230
536 Ga0207709_10338229 3300025935 Bacteria 1132
537 Ga0207669_10010727 3300025937 Bacteria 4425
538 Ga0207669_10139125 3300025937 Bacteria 1682
539 Ga0207669_10251875 3300025937 Unclassified 1315
540 Ga0207669_10274545 3300025937 Bacteria 1268
541 Ga0207669_10874728 3300025937 Bacteria 749
542 Ga0207704_10030237 3300025938 Bacteria 3034
543 Ga0207665_10289224 3300025939 Bacteria 1222
544 Ga0207691_10006215 3300025940 Bacteria 11534
545 Ga0207691_10012981 3300025940 Bacteria 7977
546 Ga0207691_10047792 3300025940 Bacteria 3925
547 Ga0207691_10071785 3300025940 Bacteria 3123
548 Ga0207691_10132253 3300025940 Bacteria 2203
549 Ga0207711_10000174 3300025941 Bacteria 69263
550 Ga0207711_10002763 3300025941 Bacteria 15458
551 Ga0207711_10032039 3300025941 Bacteria 4442
552 Ga0207711_10064265 3300025941 Bacteria 3169
553 Ga0207711_10207042 3300025941 Bacteria 1791
554 Ga0207711_10815643 3300025941 Bacteria 869
555 Ga0207689_10080450 3300025942 Bacteria 2678
556 Ga0207661_10010525 3300025944 Bacteria 6662
557 Ga0207661_10038968 3300025944 Bacteria 3728
558 Ga0207661_10461322 3300025944 Bacteria 1158
559 Ga0207661_10485125 3300025944 Bacteria 1128
560 Ga0207679_10000150 3300025945 Bacteria 57426
561 Ga0207679_10013707 3300025945 Bacteria 5316
562 Ga0207679_10019475 3300025945 Bacteria 4559
563 Ga0207679_10078327 3300025945 Bacteria 2517
564 Ga0207679_10101129 3300025945 Bacteria 2255
565 Ga0207679_10109935 3300025945 Bacteria 2173
566 Ga0207679_10289550 3300025945 Bacteria 1407
567 Ga0207679_10328638 3300025945 Bacteria 1326
568 Ga0207679_11277892 3300025945 Bacteria 674
569 Ga0207667_10000443 3300025949 Bacteria 55591
570 Ga0207667_10000586 3300025949 Bacteria 47384
571 Ga0207667_10015767 3300025949 Bacteria 8569
572 Ga0207667_10052536 3300025949 Bacteria 4291
573 Ga0207667_10117920 3300025949 Bacteria 2735
574 Ga0207667_10258298 3300025949 Bacteria 1782
575 Ga0207667_10329398 3300025949 Bacteria 1559
576 Ga0207667_10353502 3300025949 Bacteria 1498
577 Ga0207667_10414091 3300025949 Bacteria 1371
578 Ga0207651_10003579 3300025960 Bacteria 7640
579 Ga0207651_10014429 3300025960 Bacteria 4561
580 Ga0207651_10052912 3300025960 Bacteria 2771
581 Ga0207651_10125548 3300025960 Unclassified 1954
582 Ga0207651_10612191 3300025960 Bacteria 953
583 Ga0207651_10631972 3300025960 Bacteria 938
584 Ga0207712_10011567 3300025961 Bacteria 5626
585 Ga0207668_10109401 3300025972 Bacteria 2070
586 Ga0207668_10344523 3300025972 Bacteria 1244
587 Ga0207668_11473209 3300025972 Bacteria 614
588 Ga0207640_10011757 3300025981 Bacteria 4964
589 Ga0207640_10014935 3300025981 Bacteria 4482
590 Ga0207640_10022874 3300025981 Bacteria 3748
591 Ga0207640_10045920 3300025981 Bacteria 2808
592 Ga0207640_10046545 3300025981 Bacteria 2792
593 Ga0207640_10335510 3300025981 Unclassified 1209
594 Ga0207640_10474722 3300025981 Bacteria 1036
595 Ga0207640_10837658 3300025981 Bacteria 799
596 Ga0207658_10005682 3300025986 Bacteria 8529
597 Ga0207658_10039035 3300025986 Bacteria 3424
598 Ga0207658_10053640 3300025986 Bacteria 2980
599 Ga0207658_10109125 3300025986 Bacteria 2184
600 Ga0207677_10002793 3300026023 Bacteria 9219
601 Ga0207677_10005247 3300026023 Bacteria 7016
602 Ga0207677_10064749 3300026023 Bacteria 2547
603 Ga0207677_10082702 3300026023 Bacteria 2308
604 Ga0207677_10152628 3300026023 Bacteria 1784
605 Ga0207677_11178314 3300026023 Bacteria 701
606 Ga0207703_10001865 3300026035 Bacteria 18737
607 Ga0207703_10004057 3300026035 Bacteria 12096
608 Ga0207703_10010806 3300026035 Bacteria 7122
609 Ga0207703_10137628 3300026035 Bacteria 2116
610 Ga0207703_10294805 3300026035 Bacteria 1477
611 Ga0207703_10711247 3300026035 Bacteria 956
612 Ga0207703_10831258 3300026035 Bacteria 883
613 Ga0207639_10025536 3300026041 Bacteria 4284
614 Ga0207639_10037812 3300026041 Bacteria 3587
615 Ga0207639_10106495 3300026041 Bacteria 2276
616 Ga0207639_10253702 3300026041 Bacteria 1535
617 Ga0207639_10466457 3300026041 Bacteria 1149
618 Ga0207678_10041268 3300026067 Bacteria 4001
619 Ga0207678_10075493 3300026067 Bacteria 2887
620 Ga0207678_10088490 3300026067 Bacteria 2646
621 Ga0207678_10101506 3300026067 Bacteria 2456
622 Ga0207678_10109979 3300026067 Bacteria 2351
623 Ga0207678_10123779 3300026067 Bacteria 2207
624 Ga0207678_10139789 3300026067 Bacteria 2066
625 Ga0207678_10201834 3300026067 Bacteria 1700
626 Ga0207678_10291820 3300026067 Bacteria 1401
627 Ga0207678_10304091 3300026067 Bacteria 1371
628 Ga0207678_11064033 3300026067 Bacteria 716
629 Ga0207702_10005597 3300026078 Bacteria 10968
630 Ga0207702_10007741 3300026078 Bacteria 9122
631 Ga0207702_10098004 3300026078 Bacteria 2581
632 Ga0207702_10129262 3300026078 Bacteria 2271
633 Ga0207702_10332228 3300026078 Bacteria 1450
634 Ga0207702_10420206 3300026078 Bacteria 1293
635 Ga0207702_10578160 3300026078 Bacteria 1101
636 Ga0207702_10805045 3300026078 Bacteria 929
637 Ga0207641_10011660 3300026088 Bacteria 7217
638 Ga0207641_10071343 3300026088 Bacteria 2987
639 Ga0207641_10164001 3300026088 Bacteria 2022
640 Ga0207641_10168932 3300026088 Bacteria 1994
641 Ga0207648_10070674 3300026089 Bacteria 3043
642 Ga0207648_10258329 3300026089 Bacteria 1554
643 Ga0207648_10560423 3300026089 Bacteria 1050
644 Ga0207676_10016951 3300026095 Bacteria 5275
645 Ga0207676_10028319 3300026095 Bacteria 4183
646 Ga0207676_10078078 3300026095 Bacteria 2680
647 Ga0207676_10154119 3300026095 Bacteria 1982
648 Ga0207676_10157488 3300026095 Bacteria 1964
649 Ga0207676_10174455 3300026095 Bacteria 1876
650 Ga0207676_10304108 3300026095 Bacteria 1457
651 Ga0207674_10003404 3300026116 Bacteria 19500
652 Ga0207674_10003779 3300026116 Bacteria 18470
653 Ga0207674_10033590 3300026116 Bacteria 5370
654 Ga0207674_10204382 3300026116 Bacteria 1924
655 Ga0207674_10253438 3300026116 Bacteria 1707
656 Ga0207674_10369829 3300026116 Bacteria 1386
657 Ga0207674_10601994 3300026116 Bacteria 1062
658 Ga0207674_11438723 3300026116 Bacteria 658
659 Ga0207683_10017990 3300026121 Bacteria 6027
660 Ga0207683_10028785 3300026121 Bacteria 4806
661 Ga0207683_10048470 3300026121 Bacteria 3720
662 Ga0207683_10091275 3300026121 Bacteria 2713
663 Ga0207683_11089289 3300026121 Bacteria 741
664 Ga0207698_10011204 3300026142 Bacteria 5802
665 Ga0207698_10029797 3300026142 Bacteria 3914
666 Ga0207698_10048017 3300026142 Bacteria 3238
667 Ga0207698_10060884 3300026142 Bacteria 2938
668 Ga0207698_10070182 3300026142 Bacteria 2775
669 Ga0207698_10082763 3300026142 Bacteria 2595
670 Ga0207698_10095675 3300026142 Bacteria 2445
671 Ga0207698_10119038 3300026142 Bacteria 2231
672 Ga0207698_10142299 3300026142 Bacteria 2069
673 Ga0207698_10148697 3300026142 Bacteria 2029
674 Ga0207698_10337135 3300026142 Bacteria 1419
675 Ga0207698_10462287 3300026142 Bacteria 1227
676 Ga0207698_10841422 3300026142 Bacteria 922
677 Ga0268266_10006474 3300028379 Bacteria 10718
678 Ga0268266_10100331 3300028379 Bacteria 2550
679 Ga0268266_10167341 3300028379 Bacteria 1993
680 Ga0268266_10749480 3300028379 Bacteria 942
681 Ga0268265_10107312 3300028380 Bacteria 2270
682 Ga0268265_10285982 3300028380 Bacteria 1477
683 Ga0268264_10025388 3300028381 Bacteria 4841
684 Ga0268264_10414099 3300028381 Bacteria 1298
685 Ga0268264_10433818 3300028381 Bacteria 1269
686 Ga0307408_100068461 3300031548 Bacteria 2614
687 Ga0307408_100724353 3300031548 Bacteria 896
688 Ga0307405_10000956 3300031731 Bacteria 11553
689 Ga0307405_10297657 3300031731 Bacteria 1222
690 Ga0307413_10000474 3300031824 Bacteria 13100
691 Ga0307413_10347716 3300031824 Bacteria 1143
692 Ga0307413_10366164 3300031824 Bacteria 1118
693 Ga0307410_10007933 3300031852 Bacteria 5852
694 Ga0307410_10010904 3300031852 Bacteria 5173
695 Ga0307410_10017353 3300031852 Bacteria 4321
696 Ga0307410_10059322 3300031852 Bacteria 2612
697 Ga0307410_10144106 3300031852 Bacteria 1766
698 Ga0307410_10172925 3300031852 Bacteria 1629
699 Ga0307410_10251773 3300031852 Bacteria 1373
700 Ga0307410_10473372 3300031852 Bacteria 1026
701 Ga0307410_10509677 3300031852 Bacteria 991
702 Ga0307410_10969492 3300031852 Bacteria 732
703 Ga0307406_10001163 3300031901 Bacteria 14718
704 Ga0307406_10081956 3300031901 Bacteria 2147
705 Ga0307406_10112458 3300031901 Bacteria 1878
706 Ga0307406_10130572 3300031901 Bacteria 1763
707 Ga0307406_10726746 3300031901 Bacteria 831
708 Ga0307407_10175359 3300031903 Bacteria 1416
709 Ga0307412_10006564 3300031911 Bacteria 6586
710 Ga0307412_10071140 3300031911 Bacteria 2374
711 Ga0307412_10962922 3300031911 Bacteria 752
712 Ga0307409_100041049 3300031995 Bacteria 3452
713 Ga0307409_100050364 3300031995 Bacteria 3180
714 Ga0307409_100088615 3300031995 Bacteria 2527
715 Ga0307409_100095217 3300031995 Bacteria 2452
716 Ga0307409_100103481 3300031995 Bacteria 2368
717 Ga0307409_100670761 3300031995 Bacteria 1033
718 Ga0307416_100000539 3300032002 Bacteria 19259
719 Ga0307416_100070456 3300032002 Bacteria 2899
720 Ga0307416_100114599 3300032002 Bacteria 2385
721 Ga0307416_100219222 3300032002 Bacteria 1823
722 Ga0307414_10017946 3300032004 Bacteria 4340
723 Ga0307414_10045830 3300032004 Bacteria 2997
724 Ga0307414_10088018 3300032004 Bacteria 2297
725 Ga0307411_10005729 3300032005 Bacteria 6139
726 Ga0307411_10009303 3300032005 Bacteria 5157
727 Ga0307411_10039065 3300032005 Bacteria 2999
728 Ga0307411_10039505 3300032005 Bacteria 2985
729 Ga0307411_10057732 3300032005 Bacteria 2565
730 Ga0307411_10104136 3300032005 Bacteria 2014
731 Ga0307411_10154487 3300032005 Bacteria 1710
732 Ga0307411_10258676 3300032005 Bacteria 1373
733 Ga0307411_10341699 3300032005 Bacteria 1217
734 Ga0307411_10398628 3300032005 Bacteria 1137
735 Ga0307415_100002134 3300032126 Bacteria 9793
736 Ga0307415_100007459 3300032126 Bacteria 5986
737 Ga0307415_100043837 3300032126 Bacteria 2987
738 Ga0307415_100080067 3300032126 Bacteria 2329
739 Ga0307415_100228341 3300032126 Bacteria 1497
740 Ga0307415_100468868 3300032126 Bacteria 1093
741 Ga0373940_0237123 3300035088 Unclassified 611
742 Ga0373932_0210120 3300035112 Unclassified 695
743 Ga0373936_0078712 3300035113 Bacteria 1369
744 Ga0373941_0251153 3300035115 Bacteria 690
745 Ga0373945_0106964 3300035116 Bacteria 1100
746 Ga0373956_0026829 3300035119 Bacteria 2497
747 Ga0373960_0076568 3300035121 Bacteria 1045
748 Ga0373943_0008656 3300035170 Bacteria 4562
749 Ga0373946_0062035 3300035171 Bacteria 1593
750 Ga0373955_0008024 3300035172 Bacteria 4880
751 Ga0373931_0427995 3300035691 Bacteria 843
752 Ga0373935_0195196 3300035692 Bacteria 1396
753 Ga0373935_0440744 3300035692 Bacteria 940
754 Ga0373933_0338172 3300035724 Bacteria 977
755 Ga0373947_0018893 3300035725 Bacteria 3971
756 Ga0373947_0608797 3300035725 Bacteria 745
757 Ga0373937_0413815 3300036401 Bacteria 1279
758 Ga0373925_0010937 3300037068 Bacteria 6588
759 Ga0395899_0015650 3300037312 Bacteria 5784
760 Ga0395899_0040159 3300037312 Bacteria 3499
761 Ga0395899_0050365 3300037312 Bacteria 3092
762 Ga0395899_0063271 3300037312 Bacteria 2722
763 Ga0395899_0093951 3300037312 Bacteria 2170
764 Ga0395899_0172695 3300037312 Bacteria 1521
765 Ga0395899_0313954 3300037312 Bacteria 1057
766 Ga0395899_0449873 3300037312 Bacteria 843
767 Ga0395899_0728517 3300037312 Bacteria 619
768 Ga0395900_0005269 3300037418 Bacteria 13560
769 Ga0395900_0014913 3300037418 Bacteria 7918
770 Ga0395900_0028661 3300037418 Bacteria 5706
771 Ga0395900_0029933 3300037418 Bacteria 5587
772 Ga0395900_0057692 3300037418 Bacteria 3997
773 Ga0395900_0066870 3300037418 Bacteria 3693
774 Ga0395900_0077182 3300037418 Bacteria 3422
775 Ga0395900_0104264 3300037418 Bacteria 2913
776 Ga0395900_0105218 3300037418 Bacteria 2899
777 Ga0395900_0121266 3300037418 Bacteria 2682
778 Ga0395900_0132667 3300037418 Bacteria 2552
779 Ga0395900_0133745 3300037418 Bacteria 2540
780 Ga0395900_0142004 3300037418 Bacteria 2458
781 Ga0395900_0143320 3300037418 Bacteria 2445
782 Ga0395900_0164618 3300037418 Bacteria 2260
783 Ga0395900_0175554 3300037418 Bacteria 2179
784 Ga0395900_0216307 3300037418 Bacteria 1933
785 Ga0395900_0259697 3300037418 Bacteria 1735
786 Ga0395900_0287061 3300037418 Bacteria 1635
787 Ga0395900_0321282 3300037418 Bacteria 1528
788 Ga0395900_0388136 3300037418 Bacteria 1363
789 Ga0395900_0395460 3300037418 Bacteria 1347
790 Ga0395900_0413825 3300037418 Bacteria 1310
791 Ga0395900_0487484 3300037418 Bacteria 1184
792 Ga0395900_0544675 3300037418 Bacteria 1106
793 Ga0395900_0548816 3300037418 Bacteria 1100
794 Ga0395900_0626159 3300037418 Bacteria 1014
795 Ga0395900_0785973 3300037418 Bacteria 880
796 Ga0395900_1051905 3300037418 Unclassified 732
797 Ga0395900_1094108 3300037418 Bacteria 714
798 Ga0395900_1158033 3300037418 Bacteria 689
799 Ga0395900_1549571 3300037418 Bacteria 574
800 Ga0395898_0036161 3300037466 Bacteria 4905
801 Ga0395898_0044230 3300037466 Bacteria 4385
802 Ga0395898_0078659 3300037466 Bacteria 3182
803 Ga0395898_0087382 3300037466 Bacteria 3003
804 Ga0395898_0119733 3300037466 Bacteria 2522
805 Ga0395898_0125760 3300037466 Bacteria 2456
806 Ga0395898_0191786 3300037466 Bacteria 1952
807 Ga0395898_0200704 3300037466 Bacteria 1904
808 Ga0395898_0217058 3300037466 Bacteria 1824
809 Ga0395898_0232054 3300037466 Bacteria 1760
810 Ga0395898_0291620 3300037466 Bacteria 1556
811 Ga0395898_0292053 3300037466 Bacteria 1555
812 Ga0395898_0344989 3300037466 Bacteria 1420
813 Ga0395898_0946416 3300037466 Bacteria 798
814 Ga0395898_1139683 3300037466 Bacteria 712
815 Ga0395898_1291730 3300037466 Bacteria 659
816 Ga0395898_1936261 3300037466 Bacteria 509
817 Ga0395905_0001865 3300037471 Bacteria 24270
818 Ga0395905_0002330 3300037471 Bacteria 21202
819 Ga0395905_0003602 3300037471 Bacteria 16473
820 Ga0395905_0005719 3300037471 Bacteria 12641
821 Ga0395905_0015933 3300037471 Bacteria 7143
822 Ga0395905_0016334 3300037471 Bacteria 7053
823 Ga0395905_0028904 3300037471 Bacteria 5225
824 Ga0395905_0029941 3300037471 Bacteria 5131
825 Ga0395905_0053783 3300037471 Bacteria 3768
826 Ga0395905_0070657 3300037471 Bacteria 3272
827 Ga0395905_0102736 3300037471 Bacteria 2683
828 Ga0395905_0110969 3300037471 Bacteria 2575
829 Ga0395905_0113902 3300037471 Bacteria 2541
830 Ga0395905_0115333 3300037471 Bacteria 2524
831 Ga0395905_0116125 3300037471 Bacteria 2515
832 Ga0395905_0217998 3300037471 Bacteria 1786
833 Ga0395905_0238885 3300037471 Bacteria 1698
834 Ga0395905_0299113 3300037471 Bacteria 1496
835 Ga0395905_0391374 3300037471 Bacteria 1284
836 Ga0395905_0414644 3300037471 Bacteria 1242
837 Ga0395905_0547437 3300037471 Bacteria 1058
838 Ga0395905_0549286 3300037471 Bacteria 1056
839 Ga0395905_0563642 3300037471 Bacteria 1040
840 Ga0395905_0586107 3300037471 Bacteria 1017
841 Ga0395905_0621442 3300037471 Bacteria 982
842 Ga0395905_0764877 3300037471 Bacteria 868
843 Ga0395905_1066932 3300037471 Bacteria 711
844 Ga0395901_0020034 3300038443 Bacteria 6844
845 Ga0395901_0021453 3300038443 Bacteria 6617
846 Ga0395901_0029313 3300038443 Bacteria 5665
847 Ga0395901_0037792 3300038443 Bacteria 4993
848 Ga0395901_0039635 3300038443 Bacteria 4876
849 Ga0395901_0046211 3300038443 Bacteria 4521
850 Ga0395901_0064478 3300038443 Bacteria 3814
851 Ga0395901_0071399 3300038443 Bacteria 3618
852 Ga0395901_0184064 3300038443 Bacteria 2191
853 Ga0395901_0186375 3300038443 Bacteria 2176
854 Ga0395901_0247967 3300038443 Bacteria 1856
855 Ga0395901_0257520 3300038443 Bacteria 1817
856 Ga0395901_0284745 3300038443 Bacteria 1716
857 Ga0395901_0311731 3300038443 Bacteria 1629
858 Ga0395901_0331387 3300038443 Bacteria 1573
859 Ga0395901_0456735 3300038443 Bacteria 1306
860 Ga0395901_0543875 3300038443 Bacteria 1177
861 Ga0395901_0582282 3300038443 Bacteria 1130
862 Ga0395901_0630218 3300038443 Bacteria 1078
863 Ga0395901_0693535 3300038443 Bacteria 1017
864 Ga0395901_0789612 3300038443 Bacteria 939
865 Ga0395901_0796200 3300038443 Bacteria 934
866 Ga0395901_1371042 3300038443 Unclassified 666
867 Ga0395901_1573094 3300038443 Bacteria 611
868 Ga0395901_1876539 3300038443 Unclassified 547
869 Ga0436365_0088937 3300039437 Bacteria 9210
870 Ga0436365_1029407 3300039437 Bacteria 1402
871 Ga0436365_1832884 3300039437 Bacteria 2458
872 Ga0451800_1113294 3300041459 Bacteria 748
873 Ga0439455_0020338 3300042012 Bacteria 1573
874 Ga0439458_0000160 3300042157 Bacteria 14953
875 Ga0439458_0004332 3300042157 Bacteria 3266
876 Ga0466969_0013140 3300044656 Bacteria 4362
877 Ga0466972_0102913 3300044658 Bacteria 1351
878 Ga0466972_0252985 3300044658 Bacteria 823
879 Ga0466972_0333063 3300044658 Bacteria 710
880 Ga0466965_0301607 3300044683 Bacteria 869
881 Ga0466966_0028779 3300044684 Bacteria 3617
882 Ga0466966_0183644 3300044684 Bacteria 1269
883 Ga0466966_0255759 3300044684 Bacteria 1055
884 Ga0466961_0024899 3300044693 Bacteria 3850
885 Ga0466961_0085158 3300044693 Unclassified 1999
886 Ga0466961_0476852 3300044693 Bacteria 754
887 Ga0466963_0002633 3300044694 Bacteria 10082
888 Ga0466963_0041435 3300044694 Bacteria 3020
889 Ga0466963_0097161 3300044694 Bacteria 2012
890 Ga0466963_0106649 3300044694 Bacteria 1921
891 Ga0466963_0140412 3300044694 Bacteria 1673
892 Ga0466963_0152534 3300044694 Bacteria 1605
893 Ga0466964_0027024 3300044706 Bacteria 2250
894 Ga0466971_0111576 3300044719 Bacteria 1262
895 Ga0466971_0187975 3300044719 Bacteria 972
896 Ga0466971_0450464 3300044719 Bacteria 631
897 Ga0466968_0081759 3300044735 Bacteria 1420
898 Ga0466970_0029279 3300044765 Bacteria 2899
899 Ga0466970_0064981 3300044765 Bacteria 1957
900 Ga0466970_0247917 3300044765 Bacteria 997
901 Ga0466957_0023567 3300044842 Bacteria 3639
902 Ga0466957_0039021 3300044842 Bacteria 2864
903 Ga0466957_0121900 3300044842 Bacteria 1663
904 Ga0466957_0174214 3300044842 Bacteria 1402
905 Ga0466957_0200182 3300044842 Bacteria 1311
906 Ga0466957_0295178 3300044842 Bacteria 1088
907 Ga0466960_0213488 3300044901 Bacteria 1059
908 Ga0466960_0370892 3300044901 Bacteria 820
909 Ga0466959_0115954 3300045049 Bacteria 1908
910 Ga0466959_0317740 3300045049 Bacteria 1065
911 Ga0466958_0018154 3300045836 Bacteria 4077
912 Ga0466967_0001266 3300045976 Bacteria 14316
913 Ga0466967_0073411 3300045976 Bacteria 3069
914 Ga0466967_0096384 3300045976 Bacteria 2698
915 Ga0466967_0131569 3300045976 Bacteria 2323
916 Ga0466967_0273847 3300045976 Bacteria 1618
917 Ga0466967_0324621 3300045976 Bacteria 1485
918 Ga0466967_0401680 3300045976 Bacteria 1333
919 Ga0466967_0621867 3300045976 Bacteria 1067
920 Ga0466967_1181304 3300045976 Bacteria 762
921 Ga0495663_0018892 3300046525 Bacteria 1966
922 Ga0495663_0044189 3300046525 Bacteria 1363
923 Ga0495586_0320558 3300046535 Bacteria 889
924 Ga0495598_0015032 3300046537 Bacteria 1945
925 Ga0495621_0101460 3300046539 Unclassified 1095
926 Ga0495633_0060613 3300046558 Bacteria 1773
927 Ga0495659_0314034 3300046664 Unclassified 664
928 Ga0495623_0257572 3300046679 Bacteria 978
929 Ga0495670_0006082 3300046691 Bacteria 5919
930 Ga0495670_0662284 3300046691 Bacteria 569
931 Ga0495602_0069295 3300048088 Bacteria 3024
932 Ga0496100_0006009 3300048903 Bacteria 6587
933 Ga0496100_0017483 3300048903 Bacteria 4234
934 Ga0496100_0067124 3300048903 Bacteria 2381
935 Ga0496101_0017472 3300048904 Bacteria 4866
936 Ga0496101_0019566 3300048904 Bacteria 4624
937 Ga0496102_1323229 3300048905 Bacteria 640
938 Ga0496104_0161668 3300048907 Bacteria 2148
939 Ga0496105_0091554 3300048908 Bacteria 2511
940 Ga0496105_0238049 3300048908 Bacteria 1478
941 Ga0496106_0010676 3300048909 Bacteria 6787
942 Ga0496106_0775505 3300048909 Bacteria 761
943 Ga0496107_0001813 3300048910 Bacteria 13471
944 Ga0496107_0030022 3300048910 Bacteria 3872
945 Ga0496107_0033675 3300048910 Bacteria 3667
946 Ga0496107_0091783 3300048910 Bacteria 2220
947 Ga0496107_0093926 3300048910 Bacteria 2194
948 Ga0496107_0161907 3300048910 Bacteria 1658
949 Ga0496108_0006433 3300048911 Bacteria 9523
950 Ga0496108_0104313 3300048911 Bacteria 2419
951 Ga0496108_0131269 3300048911 Bacteria 2153
952 Ga0496108_0233049 3300048911 Bacteria 1601
953 Ga0496108_0860719 3300048911 Bacteria 780
954 Ga0496109_0073984 3300048912 Bacteria 3131
955 Ga0496109_0093460 3300048912 Bacteria 2783
956 Ga0496109_0163702 3300048912 Bacteria 2084
957 Ga0496109_0462204 3300048912 Bacteria 1198
958 Ga0496109_0690378 3300048912 Bacteria 958
959 Ga0496109_1437330 3300048912 Bacteria 625
960 Ga0496110_0215746 3300048913 Bacteria 1745
961 Ga0496110_1628764 3300048913 Bacteria 555
962 Ga0496111_0047020 3300048914 Bacteria 3107
963 Ga0496111_0226835 3300048914 Bacteria 1387
964 Ga0496111_0467162 3300048914 Bacteria 930
965 Ga0496112_0001713 3300048915 Bacteria 17129
966 Ga0496112_0012943 3300048915 Bacteria 7687
967 Ga0496112_0032815 3300048915 Bacteria 5041
968 Ga0496112_0061964 3300048915 Bacteria 3688
969 Ga0496112_0098731 3300048915 Bacteria 2889
970 Ga0496113_0008898 3300048916 Bacteria 6566
971 Ga0496113_0024348 3300048916 Bacteria 4301
972 Ga0496113_0090991 3300048916 Bacteria 2351
973 Ga0496113_0106340 3300048916 Bacteria 2179
974 Ga0496113_0234083 3300048916 Unclassified 1465
975 Ga0496114_0183369 3300048917 Bacteria 1828
976 Ga0496114_0261165 3300048917 Bacteria 1525
977 Ga0496115_0000335 3300048918 Bacteria 40051
978 Ga0496115_0080726 3300048918 Bacteria 2648
979 Ga0501069_0327146 3300049585 Bacteria 901
980 nmdc:mga0k408_163068_c1 3300050493 Bacteria 1328
981 nmdc:mga05p37_516456_c1 3300050507 Bacteria 1367
982 nmdc:mga0rr50_450210_c1 3300050513 Bacteria 1091
983 nmdc:mga08x19_278650_c1 3300050514 Bacteria 1158
984 nmdc:mga0a205_37407_c1 3300050515 Bacteria 4667
985 Ga0466962_0027707 3300061719 Bacteria 2717
986 Ga0466963_0741319
987 JGI24746J21847_1006150
988 JGI24740J21852_10011235
989 JGI24740J21852_10026679
990 JGI24739J22299_10029807
991 JGI24739J22299_10044564
992 JGI24737J22298_10004224
993 JGI24737J22298_10006934
994 JGI24737J22298_10016699
995 JGI24737J22298_10030371
996 JGI24743J22301_10041815
997 JGI24735J21928_10030428
998 JGI24735J21928_10058028
999 JGI24735J21928_10098534
1000 JGI24738J21930_10016072
1001 JGI24738J21930_10056670
1002 JGI24744J21845_10034295
1003 Ga0065715_10032120
1004 Ga0065715_10390953
1005 Ga0070658_10000183
1006 Ga0070658_10017240
1007 Ga0070658_10093771
1008 Ga0070658_10147687
1009 Ga0070658_10191787
1010 Ga0070658_10205828
1011 Ga0070658_10333415
1012 Ga0070658_10986925
1013 Ga0070676_10064191
1014 Ga0070676_10209665
1015 Ga0070676_10489140
1016 Ga0070683_100000846
1017 Ga0070683_100113981
1018 Ga0070683_100192439
1019 Ga0070683_100728795
1020 Ga0070683_101194563
1021 Ga0070690_100010247
1022 Ga0070690_100035762
1023 Ga0070690_100267394
1024 Ga0070690_100612331
1025 Ga0070670_100014882
1026 Ga0070670_100033856
1027 Ga0070670_100040208
1028 Ga0070670_100040993
1029 Ga0070670_100436808
1030 Ga0070670_100719473
1031 Ga0070677_10343494
1032 Ga0068869_100023142
1033 Ga0070666_10000784
1034 Ga0070666_10057304
1035 Ga0070666_10160333
1036 Ga0070666_10529474
1037 Ga0070680_100028404
1038 Ga0070680_100030637
1039 Ga0070680_100052237
1040 Ga0070680_100315243
1041 Ga0070682_100016895
1042 Ga0070682_100070707
1043 Ga0070682_100201292
1044 Ga0070682_100716462
1045 Ga0068868_100002185
1046 Ga0068868_100063881
1047 Ga0068868_100078083
1048 Ga0068868_100079885
1049 Ga0068868_100896951
1050 Ga0068868_101726963
1051 Ga0070660_100000355
1052 Ga0070660_100000378
1053 Ga0070660_100036606
1054 Ga0070660_100041322
1055 Ga0070660_100047555
1056 Ga0070660_100070202
1057 Ga0070660_100078845
1058 Ga0070660_100095310
1059 Ga0070660_100167479
1060 Ga0070660_100192332
1061 Ga0070660_100212114
1062 Ga0070660_100260919
1063 Ga0070660_100594736
1064 Ga0070660_100643788
1065 Ga0070691_10000225
1066 Ga0070687_100049938
1067 Ga0070661_100000485
1068 Ga0070661_100048460
1069 Ga0070661_100125190
1070 Ga0070661_100136465
1071 Ga0070661_100152156
1072 Ga0070661_100208609
1073 Ga0070661_100227862
1074 Ga0070661_100248970
1075 Ga0070661_100350112
1076 Ga0070661_101149159
1077 Ga0070692_10076636
1078 Ga0070668_100414372
1079 Ga0070668_100697503
1080 Ga0070669_100248827
1081 Ga0070669_100425538
1082 Ga0070675_100085206
1083 Ga0070671_100026952
1084 Ga0070671_100081622
1085 Ga0070671_100269109
1086 Ga0070671_100281103
1087 Ga0070671_100377625
1088 Ga0070671_100417065
1089 Ga0070674_100019841
1090 Ga0070674_100060478
1091 Ga0070674_100222660
1092 Ga0070674_100335395
1093 Ga0070673_100085606
1094 Ga0070673_100103004
1095 Ga0070673_100114919
1096 Ga0070673_100187777
1097 Ga0070673_100373653
1098 Ga0070673_100597358
1099 Ga0070688_100101713
1100 Ga0070688_100242845
1101 Ga0070659_100006821
1102 Ga0070659_100020041
1103 Ga0070659_100043087
1104 Ga0070659_100065207
1105 Ga0070659_100065946
1106 Ga0070659_100067896
1107 Ga0070659_100078653
1108 Ga0070659_100137627
1109 Ga0070659_100146713
1110 Ga0070659_100238637
1111 Ga0070659_100674958
1112 Ga0070659_101456595
1113 Ga0070667_100000764
1114 Ga0070667_100010668
1115 Ga0070667_100052231
1116 Ga0070667_100136842
1117 Ga0070667_100424149
1118 Ga0070667_100430418
1119 Ga0070709_10314994
1120 Ga0070714_100069880
1121 Ga0070714_100251868
1122 Ga0070713_100029606
1123 Ga0070713_100042551
1124 Ga0070711_100907425
1125 Ga0070694_100050983
1126 Ga0070663_100025419
1127 Ga0070663_100083239
1128 Ga0070663_100088639
1129 Ga0070663_100199062
1130 Ga0070663_100203623
1131 Ga0070663_100222824
1132 Ga0070663_100359521
1133 Ga0070663_100544021
1134 Ga0070663_100548818
1135 Ga0070663_101050201
1136 Ga0070678_100031301
1137 Ga0070678_100046089
1138 Ga0070678_100355045
1139 Ga0070662_100000793
1140 Ga0070662_100007148
1141 Ga0070662_100027905
1142 Ga0070662_100041532
1143 Ga0070662_100056693
1144 Ga0070662_100066577
1145 Ga0070662_100102818
1146 Ga0070662_100136081
1147 Ga0070662_100177386
1148 Ga0070662_100464755
1149 Ga0070662_100470963
1150 Ga0070662_100584655
1151 Ga0070681_10107574
1152 Ga0070681_10196894
1153 Ga0070681_10299234
1154 Ga0070681_10316024
1155 Ga0070681_10343057
1156 Ga0070681_10612875
1157 Ga0070681_11526236
1158 Ga0068867_100048650
1159 Ga0068867_100182370
1160 Ga0068867_100310759
1161 Ga0068867_100554502
1162 Ga0070685_10419116
1163 Ga0070679_100149654
1164 Ga0070679_100232758
1165 Ga0070679_100314203
1166 Ga0070684_100040641
1167 Ga0070684_100046901
1168 Ga0070684_100052329
1169 Ga0068853_100000848
1170 Ga0068853_100075455
1171 Ga0068853_100094409
1172 Ga0068853_100156555
1173 Ga0068853_100171611
1174 Ga0068853_100204242
1175 Ga0070672_100010512
1176 Ga0070672_100018520
1177 Ga0070672_100031146
1178 Ga0070672_100047034
1179 Ga0070672_100048296
1180 Ga0070672_100324939
1181 Ga0070672_100536978
1182 Ga0070672_101331283
1183 Ga0070686_100074398
1184 Ga0070695_100315322
1185 Ga0070693_100005013
1186 Ga0070693_100822640
1187 Ga0070693_101141470
1188 Ga0070665_100080334
1189 Ga0070665_100118407
1190 Ga0070665_100145808
1191 Ga0070665_100712981
1192 Ga0070704_100321075
1193 Ga0068855_100000480
1194 Ga0068855_100005847
1195 Ga0068855_100107916
1196 Ga0068855_100121553
1197 Ga0068855_100477524
1198 Ga0070664_100000066
1199 Ga0070664_100003204
1200 Ga0070664_100004403
1201 Ga0070664_100040266
1202 Ga0070664_100078115
1203 Ga0070664_100081658
1204 Ga0070664_100246151
1205 Ga0070664_100483294
1206 Ga0070664_101329320
1207 Ga0068857_100003003
1208 Ga0068857_100045313
1209 Ga0068857_100131085
1210 Ga0068857_100261098
1211 Ga0068854_100037539
1212 Ga0068854_100044040
1213 Ga0068854_100059073
1214 Ga0068854_100092156
1215 Ga0068854_100319465
1216 Ga0068854_100456239
1217 Ga0068854_100925440
1218 Ga0068854_101511915
1219 Ga0068856_100000213
1220 Ga0068856_100048398
1221 Ga0068856_100133298
1222 Ga0068856_100163320
1223 Ga0068856_100316287
1224 Ga0068856_100423264
1225 Ga0068856_100705740
1226 Ga0068856_100708581
1227 Ga0068856_101000140
1228 Ga0068856_101073520
1229 Ga0070702_100223419
1230 Ga0068852_100034686
1231 Ga0068852_100043695
1232 Ga0068852_100044867
1233 Ga0068852_100074303
1234 Ga0068852_100130283
1235 Ga0068852_100136827
1236 Ga0068852_100152311
1237 Ga0068852_100167502
1238 Ga0068852_100233779
1239 Ga0068852_100332103
1240 Ga0068852_100347061
1241 Ga0068859_100190866
1242 Ga0068859_100245688
1243 Ga0068859_100278037
1244 Ga0068859_100321484
1245 Ga0068859_100453828
1246 Ga0068864_100006481
1247 Ga0068864_100021963
1248 Ga0068864_100056486
1249 Ga0068864_100065492
1250 Ga0068864_100099178
1251 Ga0068864_100320708
1252 Ga0068851_10017425
1253 Ga0068851_10018074
1254 Ga0068851_10067645
1255 Ga0068851_10157728
1256 Ga0068870_10558141
1257 Ga0068863_100008515
1258 Ga0068863_100075804
1259 Ga0068863_100114348
1260 Ga0068863_100225041
1261 Ga0068863_100459956
1262 Ga0068863_100836134
1263 Ga0068858_100012234
1264 Ga0068858_100076559
1265 Ga0068858_101271946
1266 Ga0068860_100069472
1267 Ga0068860_100101165
1268 Ga0068860_100185883
1269 Ga0068860_100315825
1270 Ga0068860_100379535
1271 Ga0068862_100131997
1272 Ga0068862_100387678
1273 Ga0068862_100562302
1274 Ga0068862_100978710
1275 Ga0070717_10011949
1276 Ga0075366_10028095
1277 Ga0097621_100061713
1278 Ga0097621_100093841
1279 Ga0097621_100191923
1280 Ga0097621_100313050
1281 Ga0068871_100216244
1282 Ga0068871_100262187
1283 Ga0068871_100902557
1284 Ga0068871_101458144
1285 Ga0075428_100157986
1286 Ga0075431_100795740
1287 Ga0075434_100369231
1288 Ga0068865_100015764
1289 Ga0068865_100050040
1290 Ga0075436_100322403
1291 Ga0097620_100190867
1292 Ga0097620_100245692
1293 Ga0097620_100278027
1294 Ga0097620_100321478
1295 Ga0097620_100453846
1296 Ga0105240_10056853
1297 Ga0105240_10471943
1298 Ga0105245_10069022
1299 Ga0105245_10092048
1300 Ga0105245_10189820
1301 Ga0114129_10648199
1302 Ga0105243_10064626
1303 Ga0105243_10140356
1304 Ga0105241_10029441
1305 Ga0105241_10196178
1306 Ga0105241_10283169
1307 Ga0105241_11487171
1308 Ga0105241_11980518
1309 Ga0105242_10061662
1310 Ga0105248_10002046
1311 Ga0105248_10002343
1312 Ga0105248_10003721
1313 Ga0105248_10007464
1314 Ga0105248_10181879
1315 Ga0105248_10610236
1316 Ga0105238_10249263
1317 Ga0105238_10359414
1318 Ga0105238_10480953
1319 Ga0105238_11215889
1320 Ga0105238_11219118
1321 Ga0105249_10041962
1322 Ga0105239_10299020
1323 Ga0105246_10121803
1324 Ga0157373_10040504
1325 Ga0157373_10072826
1326 Ga0157373_10079169
1327 Ga0157373_10094093
1328 Ga0157373_10097590
1329 Ga0157373_10197764
1330 Ga0157373_10718484
1331 Ga0157371_10009971
1332 Ga0157371_10026402
1333 Ga0157371_10139246
1334 Ga0157371_10146782
1335 Ga0157371_10375995
1336 Ga0157371_10886966
1337 Ga0157370_10074309
1338 Ga0157370_10110312
1339 Ga0157370_10116518
1340 Ga0157370_10308620
1341 Ga0157370_10365274
1342 Ga0157370_10428868
1343 Ga0157370_10453556
1344 Ga0157369_10080893
1345 Ga0157369_10081793
1346 Ga0157369_10089869
1347 Ga0157369_10189057
1348 Ga0157369_10248696
1349 Ga0157369_10403885
1350 Ga0157369_10568522
1351 Ga0157369_10636383
1352 Ga0157369_11396679
1353 Ga0157369_11811656
1354 Ga0157374_10005153
1355 Ga0157374_10115415
1356 Ga0157374_10127291
1357 Ga0157374_10365465
1358 Ga0157374_10539145
1359 Ga0157374_11038424
1360 Ga0157378_10109451
1361 Ga0157378_10128281
1362 Ga0157378_10376119
1363 Ga0157378_10639062
1364 Ga0157378_11881501
1365 Ga0163162_10020273
1366 Ga0163162_10073340
1367 Ga0163162_10649433
1368 Ga0163162_11825781
1369 Ga0157372_10125781
1370 Ga0157372_10194062
1371 Ga0157372_10461322
1372 Ga0157372_10658620
1373 Ga0157372_11427829
1374 Ga0157375_10038481
1375 Ga0157375_10269924
1376 Ga0157375_10772579
1377 Ga0163163_10011489
1378 Ga0163163_10086702
1379 Ga0163163_10151433
1380 Ga0163163_10444049
1381 Ga0157380_10448732
1382 Ga0157377_10398034
1383 Ga0157379_10279957
1384 Ga0157379_10302921
1385 Ga0163161_10391160
1386 Ga0207697_10006795
1387 Ga0207697_10082949
1388 Ga0207656_10032761
1389 Ga0207656_10073015
1390 Ga0207656_10245125
1391 Ga0207682_10212900
1392 Ga0207642_10031875
1393 Ga0207642_10065952
1394 Ga0207688_10006887
1395 Ga0207688_10109533
1396 Ga0207688_10180567
1397 Ga0207688_10184919
1398 Ga0207688_10207000
1399 Ga0207680_10023059
1400 Ga0207647_10009258
1401 Ga0207647_10011621
1402 Ga0207647_10015518
1403 Ga0207647_10044801
1404 Ga0207647_10055041
1405 Ga0207647_10147403
1406 Ga0207647_10386147
1407 Ga0207645_10043371
1408 Ga0207645_10073574
1409 Ga0207645_10237388
1410 Ga0207645_10811796
1411 Ga0207643_10405267
1412 Ga0207705_10000131
1413 Ga0207705_10000234
1414 Ga0207705_10015561
1415 Ga0207705_10023723
1416 Ga0207705_10026945
1417 Ga0207705_10045350
1418 Ga0207705_10059962
1419 Ga0207705_10061359
1420 Ga0207705_10103576
1421 Ga0207705_10276725
1422 Ga0207705_10303561
1423 Ga0207705_10402076
1424 Ga0207654_10035844
1425 Ga0207654_10261242
1426 Ga0207654_10353093
1427 Ga0207707_10301859
1428 Ga0207707_10646193
1429 Ga0207707_10887695
1430 Ga0207707_11267966
1431 Ga0207695_10006878
1432 Ga0207695_10049561
1433 Ga0207695_10056772
1434 Ga0207671_10471275
1435 Ga0207660_10001465
1436 Ga0207660_10056470
1437 Ga0207660_10103168
1438 Ga0207660_10721526
1439 Ga0207662_10028172
1440 Ga0207657_10000598
1441 Ga0207657_10005362
1442 Ga0207657_10005629
1443 Ga0207657_10064946
1444 Ga0207657_10069994
1445 Ga0207657_10071390
1446 Ga0207657_10082054
1447 Ga0207657_10082378
1448 Ga0207657_10097568
1449 Ga0207657_10164813
1450 Ga0207657_10198943
1451 Ga0207657_10247681
1452 Ga0207657_10257473
1453 Ga0207657_10339266
1454 Ga0207657_10509109
1455 Ga0207657_10681160
1456 Ga0207657_10864009
1457 Ga0207649_10000159
1458 Ga0207649_10019673
1459 Ga0207649_10076841
1460 Ga0207649_10181173
1461 Ga0207649_10204763
1462 Ga0207649_10257990
1463 Ga0207649_10404341
1464 Ga0207649_10688606
1465 Ga0207652_10135952
1466 Ga0207652_10367045
1467 Ga0207652_10983458
1468 Ga0207681_10039391
1469 Ga0207681_10054289
1470 Ga0207694_10093842
1471 Ga0207694_10351106
1472 Ga0207650_10024869
1473 Ga0207650_10040433
1474 Ga0207650_10056801
1475 Ga0207650_10070513
1476 Ga0207650_10125038
1477 Ga0207650_10339068
1478 Ga0207650_10625830
1479 Ga0207659_10009052
1480 Ga0207687_10055424
1481 Ga0207687_10188235
1482 Ga0207687_10188609
1483 Ga0207687_10349284
1484 Ga0207687_10455488
1485 Ga0207700_10182733
1486 Ga0207664_10038971
1487 Ga0207664_10053221
1488 Ga0207664_10055692
1489 Ga0207664_10479337
1490 Ga0207644_10000452
1491 Ga0207644_10004027
1492 Ga0207644_10005865
1493 Ga0207644_10024708
1494 Ga0207644_10025397
1495 Ga0207644_10039504
1496 Ga0207644_10045406
1497 Ga0207644_10047062
1498 Ga0207644_10097840
1499 Ga0207644_10214413
1500 Ga0207644_10414989
1501 Ga0207644_10457266
1502 Ga0207690_10000120
1503 Ga0207690_10006939
1504 Ga0207690_10023006
1505 Ga0207690_10045150
1506 Ga0207690_10081619
1507 Ga0207690_10090265
1508 Ga0207690_10241164
1509 Ga0207690_11277987
1510 Ga0207706_10000200
1511 Ga0207706_10001063
1512 Ga0207706_10048740
1513 Ga0207706_10050300
1514 Ga0207706_10054223
1515 Ga0207706_10102482
1516 Ga0207706_10124535
1517 Ga0207706_10176698
1518 Ga0207706_11275939
1519 Ga0207686_10234890
1520 Ga0207709_10280446
1521 Ga0207709_10338229
1522 Ga0207669_10010727
1523 Ga0207669_10139125
1524 Ga0207669_10251875
1525 Ga0207669_10274545
1526 Ga0207669_10874728
1527 Ga0207704_10030237
1528 Ga0207665_10289224
1529 Ga0207691_10006215
1530 Ga0207691_10012981
1531 Ga0207691_10047792
1532 Ga0207691_10071785
1533 Ga0207691_10132253
1534 Ga0207711_10000174
1535 Ga0207711_10002763
1536 Ga0207711_10032039
1537 Ga0207711_10064265
1538 Ga0207711_10207042
1539 Ga0207711_10815643
1540 Ga0207689_10080450
1541 Ga0207661_10010525
1542 Ga0207661_10038968
1543 Ga0207661_10461322
1544 Ga0207661_10485125
1545 Ga0207679_10000150
1546 Ga0207679_10013707
1547 Ga0207679_10019475
1548 Ga0207679_10078327
1549 Ga0207679_10101129
1550 Ga0207679_10109935
1551 Ga0207679_10289550
1552 Ga0207679_10328638
1553 Ga0207679_11277892
1554 Ga0207667_10000443
1555 Ga0207667_10000586
1556 Ga0207667_10015767
1557 Ga0207667_10052536
1558 Ga0207667_10117920
1559 Ga0207667_10258298
1560 Ga0207667_10329398
1561 Ga0207667_10353502
1562 Ga0207667_10414091
1563 Ga0207651_10003579
1564 Ga0207651_10014429
1565 Ga0207651_10052912
1566 Ga0207651_10125548
1567 Ga0207651_10612191
1568 Ga0207651_10631972
1569 Ga0207712_10011567
1570 Ga0207668_10109401
1571 Ga0207668_10344523
1572 Ga0207668_11473209
1573 Ga0207640_10011757
1574 Ga0207640_10014935
1575 Ga0207640_10022874
1576 Ga0207640_10045920
1577 Ga0207640_10046545
1578 Ga0207640_10335510
1579 Ga0207640_10474722
1580 Ga0207640_10837658
1581 Ga0207658_10005682
1582 Ga0207658_10039035
1583 Ga0207658_10053640
1584 Ga0207658_10109125
1585 Ga0207677_10002793
1586 Ga0207677_10005247
1587 Ga0207677_10064749
1588 Ga0207677_10082702
1589 Ga0207677_10152628
1590 Ga0207677_11178314
1591 Ga0207703_10001865
1592 Ga0207703_10004057
1593 Ga0207703_10010806
1594 Ga0207703_10137628
1595 Ga0207703_10294805
1596 Ga0207703_10711247
1597 Ga0207703_10831258
1598 Ga0207639_10025536
1599 Ga0207639_10037812
1600 Ga0207639_10106495
1601 Ga0207639_10253702
1602 Ga0207639_10466457
1603 Ga0207678_10041268
1604 Ga0207678_10075493
1605 Ga0207678_10088490
1606 Ga0207678_10101506
1607 Ga0207678_10109979
1608 Ga0207678_10123779
1609 Ga0207678_10139789
1610 Ga0207678_10201834
1611 Ga0207678_10291820
1612 Ga0207678_10304091
1613 Ga0207678_11064033
1614 Ga0207702_10005597
1615 Ga0207702_10007741
1616 Ga0207702_10098004
1617 Ga0207702_10129262
1618 Ga0207702_10332228
1619 Ga0207702_10420206
1620 Ga0207702_10578160
1621 Ga0207702_10805045
1622 Ga0207641_10011660
1623 Ga0207641_10071343
1624 Ga0207641_10164001
1625 Ga0207641_10168932
1626 Ga0207648_10070674
1627 Ga0207648_10258329
1628 Ga0207648_10560423
1629 Ga0207676_10016951
1630 Ga0207676_10028319
1631 Ga0207676_10078078
1632 Ga0207676_10154119
1633 Ga0207676_10157488
1634 Ga0207676_10174455
1635 Ga0207676_10304108
1636 Ga0207674_10003404
1637 Ga0207674_10003779
1638 Ga0207674_10033590
1639 Ga0207674_10204382
1640 Ga0207674_10253438
1641 Ga0207674_10369829
1642 Ga0207674_10601994
1643 Ga0207674_11438723
1644 Ga0207683_10017990
1645 Ga0207683_10028785
1646 Ga0207683_10048470
1647 Ga0207683_10091275
1648 Ga0207683_11089289
1649 Ga0207698_10011204
1650 Ga0207698_10029797
1651 Ga0207698_10048017
1652 Ga0207698_10060884
1653 Ga0207698_10070182
1654 Ga0207698_10082763
1655 Ga0207698_10095675
1656 Ga0207698_10119038
1657 Ga0207698_10142299
1658 Ga0207698_10148697
1659 Ga0207698_10337135
1660 Ga0207698_10462287
1661 Ga0207698_10841422
1662 Ga0268266_10006474
1663 Ga0268266_10100331
1664 Ga0268266_10167341
1665 Ga0268266_10749480
1666 Ga0268265_10107312
1667 Ga0268265_10285982
1668 Ga0268264_10025388
1669 Ga0268264_10414099
1670 Ga0268264_10433818
1671 Ga0307408_100068461
1672 Ga0307408_100724353
1673 Ga0307405_10000956
1674 Ga0307405_10297657
1675 Ga0307413_10000474
1676 Ga0307413_10347716
1677 Ga0307413_10366164
1678 Ga0307410_10007933
1679 Ga0307410_10010904
1680 Ga0307410_10017353
1681 Ga0307410_10059322
1682 Ga0307410_10144106
1683 Ga0307410_10172925
1684 Ga0307410_10251773
1685 Ga0307410_10473372
1686 Ga0307410_10509677
1687 Ga0307410_10969492
1688 Ga0307406_10001163
1689 Ga0307406_10081956
1690 Ga0307406_10112458
1691 Ga0307406_10130572
1692 Ga0307406_10726746
1693 Ga0307407_10175359
1694 Ga0307412_10006564
1695 Ga0307412_10071140
1696 Ga0307412_10962922
1697 Ga0307409_100041049
1698 Ga0307409_100050364
1699 Ga0307409_100088615
1700 Ga0307409_100095217
1701 Ga0307409_100103481
1702 Ga0307409_100670761
1703 Ga0307416_100000539
1704 Ga0307416_100070456
1705 Ga0307416_100114599
1706 Ga0307416_100219222
1707 Ga0307414_10017946
1708 Ga0307414_10045830
1709 Ga0307414_10088018
1710 Ga0307411_10005729
1711 Ga0307411_10009303
1712 Ga0307411_10039065
1713 Ga0307411_10039505
1714 Ga0307411_10057732
1715 Ga0307411_10104136
1716 Ga0307411_10154487
1717 Ga0307411_10258676
1718 Ga0307411_10341699
1719 Ga0307411_10398628
1720 Ga0307415_100002134
1721 Ga0307415_100007459
1722 Ga0307415_100043837
1723 Ga0307415_100080067
1724 Ga0307415_100228341
1725 Ga0307415_100468868
1726 Ga0373940_0237123
1727 Ga0373932_0210120
1728 Ga0373936_0078712
1729 Ga0373941_0251153
1730 Ga0373945_0106964
1731 Ga0373956_0026829
1732 Ga0373960_0076568
1733 Ga0373943_0008656
1734 Ga0373946_0062035
1735 Ga0373955_0008024
1736 Ga0373931_0427995
1737 Ga0373935_0195196
1738 Ga0373935_0440744
1739 Ga0373933_0338172
1740 Ga0373947_0018893
1741 Ga0373947_0608797
1742 Ga0373937_0413815
1743 Ga0373925_0010937
1744 Ga0395899_0015650
1745 Ga0395899_0040159
1746 Ga0395899_0050365
1747 Ga0395899_0063271
1748 Ga0395899_0093951
1749 Ga0395899_0172695
1750 Ga0395899_0313954
1751 Ga0395899_0449873
1752 Ga0395899_0728517
1753 Ga0395900_0005269
1754 Ga0395900_0014913
1755 Ga0395900_0028661
1756 Ga0395900_0029933
1757 Ga0395900_0057692
1758 Ga0395900_0066870
1759 Ga0395900_0077182
1760 Ga0395900_0104264
1761 Ga0395900_0105218
1762 Ga0395900_0121266
1763 Ga0395900_0132667
1764 Ga0395900_0133745
1765 Ga0395900_0142004
1766 Ga0395900_0143320
1767 Ga0395900_0164618
1768 Ga0395900_0175554
1769 Ga0395900_0216307
1770 Ga0395900_0259697
1771 Ga0395900_0287061
1772 Ga0395900_0321282
1773 Ga0395900_0388136
1774 Ga0395900_0395460
1775 Ga0395900_0413825
1776 Ga0395900_0487484
1777 Ga0395900_0544675
1778 Ga0395900_0548816
1779 Ga0395900_0626159
1780 Ga0395900_0785973
1781 Ga0395900_1051905
1782 Ga0395900_1094108
1783 Ga0395900_1158033
1784 Ga0395900_1549571
1785 Ga0395898_0036161
1786 Ga0395898_0044230
1787 Ga0395898_0078659
1788 Ga0395898_0087382
1789 Ga0395898_0119733
1790 Ga0395898_0125760
1791 Ga0395898_0191786
1792 Ga0395898_0200704
1793 Ga0395898_0217058
1794 Ga0395898_0232054
1795 Ga0395898_0291620
1796 Ga0395898_0292053
1797 Ga0395898_0344989
1798 Ga0395898_0946416
1799 Ga0395898_1139683
1800 Ga0395898_1291730
1801 Ga0395898_1936261
1802 Ga0395905_0001865
1803 Ga0395905_0002330
1804 Ga0395905_0003602
1805 Ga0395905_0005719
1806 Ga0395905_0015933
1807 Ga0395905_0016334
1808 Ga0395905_0028904
1809 Ga0395905_0029941
1810 Ga0395905_0053783
1811 Ga0395905_0070657
1812 Ga0395905_0102736
1813 Ga0395905_0110969
1814 Ga0395905_0113902
1815 Ga0395905_0115333
1816 Ga0395905_0116125
1817 Ga0395905_0217998
1818 Ga0395905_0238885
1819 Ga0395905_0299113
1820 Ga0395905_0391374
1821 Ga0395905_0414644
1822 Ga0395905_0547437
1823 Ga0395905_0549286
1824 Ga0395905_0563642
1825 Ga0395905_0586107
1826 Ga0395905_0621442
1827 Ga0395905_0764877
1828 Ga0395905_1066932
1829 Ga0395901_0020034
1830 Ga0395901_0021453
1831 Ga0395901_0029313
1832 Ga0395901_0037792
1833 Ga0395901_0039635
1834 Ga0395901_0046211
1835 Ga0395901_0064478
1836 Ga0395901_0071399
1837 Ga0395901_0184064
1838 Ga0395901_0186375
1839 Ga0395901_0247967
1840 Ga0395901_0257520
1841 Ga0395901_0284745
1842 Ga0395901_0311731
1843 Ga0395901_0331387
1844 Ga0395901_0456735
1845 Ga0395901_0543875
1846 Ga0395901_0582282
1847 Ga0395901_0630218
1848 Ga0395901_0693535
1849 Ga0395901_0789612
1850 Ga0395901_0796200
1851 Ga0395901_1371042
1852 Ga0395901_1573094
1853 Ga0395901_1876539
1854 Ga0436365_0088937
1855 Ga0436365_1029407
1856 Ga0436365_1832884
1857 Ga0451800_1113294
1858 Ga0439455_0020338
1859 Ga0439458_0000160
1860 Ga0439458_0004332
1861 Ga0466969_0013140
1862 Ga0466972_0102913
1863 Ga0466972_0252985
1864 Ga0466972_0333063
1865 Ga0466965_0301607
1866 Ga0466966_0028779
1867 Ga0466966_0183644
1868 Ga0466966_0255759
1869 Ga0466961_0024899
1870 Ga0466961_0085158
1871 Ga0466961_0476852
1872 Ga0466963_0002633
1873 Ga0466963_0041435
1874 Ga0466963_0097161
1875 Ga0466963_0106649
1876 Ga0466963_0140412
1877 Ga0466963_0152534
1878 Ga0466964_0027024
1879 Ga0466971_0111576
1880 Ga0466971_0187975
1881 Ga0466971_0450464
1882 Ga0466968_0081759
1883 Ga0466970_0029279
1884 Ga0466970_0064981
1885 Ga0466970_0247917
1886 Ga0466957_0023567
1887 Ga0466957_0039021
1888 Ga0466957_0121900
1889 Ga0466957_0174214
1890 Ga0466957_0200182
1891 Ga0466957_0295178
1892 Ga0466960_0213488
1893 Ga0466960_0370892
1894 Ga0466959_0115954
1895 Ga0466959_0317740
1896 Ga0466958_0018154
1897 Ga0466967_0001266
1898 Ga0466967_0073411
1899 Ga0466967_0096384
1900 Ga0466967_0131569
1901 Ga0466967_0273847
1902 Ga0466967_0324621
1903 Ga0466967_0401680
1904 Ga0466967_0621867
1905 Ga0466967_1181304
1906 Ga0495663_0018892
1907 Ga0495663_0044189
1908 Ga0495586_0320558
1909 Ga0495598_0015032
1910 Ga0495621_0101460
1911 Ga0495633_0060613
1912 Ga0495659_0314034
1913 Ga0495623_0257572
1914 Ga0495670_0006082
1915 Ga0495670_0662284
1916 Ga0495602_0069295
1917 Ga0496100_0006009
1918 Ga0496100_0017483
1919 Ga0496100_0067124
1920 Ga0496101_0017472
1921 Ga0496101_0019566
1922 Ga0496102_1323229
1923 Ga0496104_0161668
1924 Ga0496105_0091554
1925 Ga0496105_0238049
1926 Ga0496106_0010676
1927 Ga0496106_0775505
1928 Ga0496107_0001813
1929 Ga0496107_0030022
1930 Ga0496107_0033675
1931 Ga0496107_0091783
1932 Ga0496107_0093926
1933 Ga0496107_0161907
1934 Ga0496108_0006433
1935 Ga0496108_0104313
1936 Ga0496108_0131269
1937 Ga0496108_0233049
1938 Ga0496108_0860719
1939 Ga0496109_0073984
1940 Ga0496109_0093460
1941 Ga0496109_0163702
1942 Ga0496109_0462204
1943 Ga0496109_0690378
1944 Ga0496109_1437330
1945 Ga0496110_0215746
1946 Ga0496110_1628764
1947 Ga0496111_0047020
1948 Ga0496111_0226835
1949 Ga0496111_0467162
1950 Ga0496112_0001713
1951 Ga0496112_0012943
1952 Ga0496112_0032815
1953 Ga0496112_0061964
1954 Ga0496112_0098731
1955 Ga0496113_0008898
1956 Ga0496113_0024348
1957 Ga0496113_0090991
1958 Ga0496113_0106340
1959 Ga0496113_0234083
1960 Ga0496114_0183369
1961 Ga0496114_0261165
1962 Ga0496115_0000335
1963 Ga0496115_0080726
1964 Ga0501069_0327146
1965 nmdc:mga0k408_163068_c1
1966 nmdc:mga05p37_516456_c1
1967 nmdc:mga0rr50_450210_c1
1968 nmdc:mga08x19_278650_c1
1969 nmdc:mga0a205_37407_c1
1970 Ga0466962_0027707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

94

161

0.96

PF01782

RimM

RimM N-terminal domain

10

87

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8321 10 162
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8172 10 96
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8007 10 96
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7903 10 162
1pm3-assembly1.cif.gz_A mth1859 0.7534 105 161
ID Description Score Start End Superfamily
3a1pC02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.907 96 161 2.30.30.240
af_A0A1D8PLS6_1_66_3.30.160.70 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain 0.9062 121 147 3.30.160.70
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8665 95 161 2.30.30.240
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8586 10 94 2.40.30.60
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8584 10 95 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A7G9L5P4-F1-model_v4 Ribosome maturation factor RimM 0.8808 9 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A838QB37-F1-model_v4 16S rRNA processing protein RimM 0.8727 28 166 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A7G9L5P4-F1-model_v4 Ribosome maturation factor RimM 0.8658 9 166 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3B1C6H7-F1-model_v4 16S rRNA processing protein RimM 0.865 10 162 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A351PVU6-F1-model_v4 Ribosome maturation factor RimM 0.8644 11 161 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map