F487481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 984 | 309 | 984 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0309025|Ga0451576_0309025_573_1199 |
| Length | 208 |
| Sequence | MATPSMPQSPADTPNASLDFAVAASRSGASRTKMLRWSLPLAIFVVVLGFLFVGLFRDPREVPSPLIGKPAPAFSLAQLHQPERTLATADMRGQVWLLNVWASWCVSCRVEHPLLVDLAKANIVPVIGLAYKDKPSDGLAWLAANGDPYKLSIVDLDGRVGIDFGVYGVPETFVIDKAGIIRYKQIGPLTADALKQTILPLVHELQKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.57 |
| Rhizosphere | 95.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10011967 | 3300001991 | Bacteria | 1571 |
| 2 | JGI24743J22301_10099337 | 3300001991 | Bacteria | 626 |
| 3 | Ga0065712_10151734 | 3300005290 | Bacteria | 1365 |
| 4 | Ga0065715_10187171 | 3300005293 | Bacteria | 1438 |
| 5 | Ga0065715_10326888 | 3300005293 | Bacteria | 990 |
| 6 | Ga0070658_10092931 | 3300005327 | Bacteria | 2488 |
| 7 | Ga0070658_10414064 | 3300005327 | Bacteria | 1158 |
| 8 | Ga0070658_11080494 | 3300005327 | Bacteria | 698 |
| 9 | Ga0070676_10000068 | 3300005328 | Bacteria | 34674 |
| 10 | Ga0070676_10006880 | 3300005328 | Bacteria | 6089 |
| 11 | Ga0070676_10022743 | 3300005328 | Bacteria | 3517 |
| 12 | Ga0070676_10035719 | 3300005328 | Bacteria | 2860 |
| 13 | Ga0070676_10086142 | 3300005328 | Bacteria | 1916 |
| 14 | Ga0070676_10103743 | 3300005328 | Bacteria | 1761 |
| 15 | Ga0070676_10246745 | 3300005328 | Bacteria | 1190 |
| 16 | Ga0070683_100012992 | 3300005329 | Bacteria | 7248 |
| 17 | Ga0070683_100103084 | 3300005329 | Bacteria | 2688 |
| 18 | Ga0070690_100024623 | 3300005330 | Bacteria | 3702 |
| 19 | Ga0070690_100085249 | 3300005330 | Bacteria | 2072 |
| 20 | Ga0070670_100000715 | 3300005331 | Bacteria | 25793 |
| 21 | Ga0070670_100003749 | 3300005331 | Bacteria | 12653 |
| 22 | Ga0070670_100033776 | 3300005331 | Bacteria | 4405 |
| 23 | Ga0070670_100103612 | 3300005331 | Bacteria | 2451 |
| 24 | Ga0070670_100152545 | 3300005331 | Bacteria | 2000 |
| 25 | Ga0070670_100178905 | 3300005331 | Bacteria | 1841 |
| 26 | Ga0070670_100218977 | 3300005331 | Bacteria | 1656 |
| 27 | Ga0070670_100436779 | 3300005331 | Bacteria | 1159 |
| 28 | Ga0070670_101281117 | 3300005331 | Bacteria | 671 |
| 29 | Ga0070677_10000388 | 3300005333 | Bacteria | 15432 |
| 30 | Ga0070677_10171071 | 3300005333 | Bacteria | 1027 |
| 31 | Ga0068869_100000926 | 3300005334 | Bacteria | 16926 |
| 32 | Ga0068869_100006606 | 3300005334 | Bacteria | 7361 |
| 33 | Ga0068869_100028520 | 3300005334 | Bacteria | 3901 |
| 34 | Ga0068869_100145204 | 3300005334 | Bacteria | 1835 |
| 35 | Ga0068869_100756798 | 3300005334 | Bacteria | 832 |
| 36 | Ga0070666_10003246 | 3300005335 | Bacteria | 9877 |
| 37 | Ga0070666_10007042 | 3300005335 | Bacteria | 6931 |
| 38 | Ga0070666_10008121 | 3300005335 | Bacteria | 6500 |
| 39 | Ga0070666_10083410 | 3300005335 | Bacteria | 2186 |
| 40 | Ga0070666_10194203 | 3300005335 | Bacteria | 1427 |
| 41 | Ga0070666_10320368 | 3300005335 | Bacteria | 1106 |
| 42 | Ga0070680_100027477 | 3300005336 | Bacteria | 4556 |
| 43 | Ga0070680_100322877 | 3300005336 | Bacteria | 1310 |
| 44 | Ga0070682_100021911 | 3300005337 | Bacteria | 3777 |
| 45 | Ga0070682_100158228 | 3300005337 | Bacteria | 1562 |
| 46 | Ga0070682_100589750 | 3300005337 | Bacteria | 876 |
| 47 | Ga0070682_100656375 | 3300005337 | Bacteria | 836 |
| 48 | Ga0068868_100002572 | 3300005338 | Bacteria | 12589 |
| 49 | Ga0068868_100079357 | 3300005338 | Bacteria | 2629 |
| 50 | Ga0068868_100198409 | 3300005338 | Bacteria | 1672 |
| 51 | Ga0068868_100693990 | 3300005338 | Bacteria | 910 |
| 52 | Ga0068868_101078430 | 3300005338 | Bacteria | 738 |
| 53 | Ga0070660_100000932 | 3300005339 | Bacteria | 19511 |
| 54 | Ga0070660_100000940 | 3300005339 | Bacteria | 19449 |
| 55 | Ga0070660_100007488 | 3300005339 | Bacteria | 7609 |
| 56 | Ga0070660_100486734 | 3300005339 | Bacteria | 1025 |
| 57 | Ga0070689_100012276 | 3300005340 | Bacteria | 6165 |
| 58 | Ga0070689_100015305 | 3300005340 | Bacteria | 5590 |
| 59 | Ga0070689_100259775 | 3300005340 | Bacteria | 1435 |
| 60 | Ga0070689_100368870 | 3300005340 | Bacteria | 1208 |
| 61 | Ga0070691_10061770 | 3300005341 | Bacteria | 1803 |
| 62 | Ga0070691_10137834 | 3300005341 | Bacteria | 1241 |
| 63 | Ga0070691_10223564 | 3300005341 | Bacteria | 999 |
| 64 | Ga0070687_100021747 | 3300005343 | Bacteria | 3021 |
| 65 | Ga0070687_100703179 | 3300005343 | Bacteria | 706 |
| 66 | Ga0070661_100002505 | 3300005344 | Bacteria | 12584 |
| 67 | Ga0070661_100014641 | 3300005344 | Bacteria | 5529 |
| 68 | Ga0070661_100015498 | 3300005344 | Bacteria | 5379 |
| 69 | Ga0070661_100051278 | 3300005344 | Bacteria | 3020 |
| 70 | Ga0070661_100059703 | 3300005344 | Bacteria | 2797 |
| 71 | Ga0070661_100083645 | 3300005344 | Bacteria | 2357 |
| 72 | Ga0070661_100119280 | 3300005344 | Bacteria | 1975 |
| 73 | Ga0070661_100176031 | 3300005344 | Bacteria | 1626 |
| 74 | Ga0070661_100940507 | 3300005344 | Bacteria | 715 |
| 75 | Ga0070692_10016880 | 3300005345 | Bacteria | 3479 |
| 76 | Ga0070692_10019473 | 3300005345 | Bacteria | 3275 |
| 77 | Ga0070668_100000779 | 3300005347 | Bacteria | 21987 |
| 78 | Ga0070668_100015675 | 3300005347 | Bacteria | 5668 |
| 79 | Ga0070668_100038163 | 3300005347 | Bacteria | 3670 |
| 80 | Ga0070668_100066591 | 3300005347 | Bacteria | 2796 |
| 81 | Ga0070668_100075157 | 3300005347 | Bacteria | 2637 |
| 82 | Ga0070668_100326096 | 3300005347 | Bacteria | 1294 |
| 83 | Ga0070669_100000668 | 3300005353 | Bacteria | 25208 |
| 84 | Ga0070669_100075780 | 3300005353 | Bacteria | 2496 |
| 85 | Ga0070669_100159309 | 3300005353 | Bacteria | 1753 |
| 86 | Ga0070669_100181960 | 3300005353 | Bacteria | 1645 |
| 87 | Ga0070669_100258639 | 3300005353 | Bacteria | 1388 |
| 88 | Ga0070669_100425203 | 3300005353 | Bacteria | 1091 |
| 89 | Ga0070675_100006613 | 3300005354 | Bacteria | 8910 |
| 90 | Ga0070675_100007266 | 3300005354 | Bacteria | 8544 |
| 91 | Ga0070675_100017405 | 3300005354 | Bacteria | 5711 |
| 92 | Ga0070675_100275795 | 3300005354 | Bacteria | 1477 |
| 93 | Ga0070671_100008688 | 3300005355 | Bacteria | 8152 |
| 94 | Ga0070671_100010442 | 3300005355 | Bacteria | 7450 |
| 95 | Ga0070671_100015993 | 3300005355 | Bacteria | 6061 |
| 96 | Ga0070671_100019898 | 3300005355 | Bacteria | 5469 |
| 97 | Ga0070671_100021917 | 3300005355 | Bacteria | 5219 |
| 98 | Ga0070671_100059730 | 3300005355 | Bacteria | 3173 |
| 99 | Ga0070671_100145096 | 3300005355 | Bacteria | 2003 |
| 100 | Ga0070671_100303335 | 3300005355 | Bacteria | 1360 |
| 101 | Ga0070674_100060097 | 3300005356 | Bacteria | 2648 |
| 102 | Ga0070674_100073559 | 3300005356 | Bacteria | 2423 |
| 103 | Ga0070674_100087028 | 3300005356 | Bacteria | 2245 |
| 104 | Ga0070674_100143575 | 3300005356 | Bacteria | 1794 |
| 105 | Ga0070674_100165920 | 3300005356 | Bacteria | 1679 |
| 106 | Ga0070674_100370020 | 3300005356 | Bacteria | 1163 |
| 107 | Ga0070673_100002041 | 3300005364 | Bacteria | 12191 |
| 108 | Ga0070673_100005216 | 3300005364 | Bacteria | 8297 |
| 109 | Ga0070673_100009308 | 3300005364 | Bacteria | 6591 |
| 110 | Ga0070673_100045466 | 3300005364 | Bacteria | 3405 |
| 111 | Ga0070673_100063676 | 3300005364 | Bacteria | 2935 |
| 112 | Ga0070673_100168630 | 3300005364 | Bacteria | 1867 |
| 113 | Ga0070673_101726739 | 3300005364 | Bacteria | 592 |
| 114 | Ga0070688_100008334 | 3300005365 | Bacteria | 5625 |
| 115 | Ga0070688_100065847 | 3300005365 | Bacteria | 2304 |
| 116 | Ga0070688_100097897 | 3300005365 | Bacteria | 1929 |
| 117 | Ga0070659_100004339 | 3300005366 | Bacteria | 10128 |
| 118 | Ga0070659_100016845 | 3300005366 | Bacteria | 5491 |
| 119 | Ga0070659_100055767 | 3300005366 | Bacteria | 3115 |
| 120 | Ga0070659_100066836 | 3300005366 | Bacteria | 2850 |
| 121 | Ga0070659_100093999 | 3300005366 | Bacteria | 2407 |
| 122 | Ga0070659_100105503 | 3300005366 | Bacteria | 2271 |
| 123 | Ga0070659_100836738 | 3300005366 | Bacteria | 802 |
| 124 | Ga0070659_100896040 | 3300005366 | Bacteria | 775 |
| 125 | Ga0070667_100001232 | 3300005367 | Bacteria | 23249 |
| 126 | Ga0070667_100006774 | 3300005367 | Bacteria | 9514 |
| 127 | Ga0070667_100017793 | 3300005367 | Bacteria | 5891 |
| 128 | Ga0070667_100018925 | 3300005367 | Bacteria | 5710 |
| 129 | Ga0070667_100065015 | 3300005367 | Bacteria | 3097 |
| 130 | Ga0070667_100223895 | 3300005367 | Bacteria | 1675 |
| 131 | Ga0070667_100707091 | 3300005367 | Bacteria | 933 |
| 132 | Ga0070709_10026307 | 3300005434 | Bacteria | 3447 |
| 133 | Ga0070709_10222483 | 3300005434 | Bacteria | 1347 |
| 134 | Ga0070714_100015237 | 3300005435 | Bacteria | 6184 |
| 135 | Ga0070714_100051617 | 3300005435 | Bacteria | 3507 |
| 136 | Ga0070714_100074888 | 3300005435 | Bacteria | 2936 |
| 137 | Ga0070714_100225801 | 3300005435 | Bacteria | 1723 |
| 138 | Ga0070714_100689497 | 3300005435 | Bacteria | 985 |
| 139 | Ga0070714_100836881 | 3300005435 | Bacteria | 892 |
| 140 | Ga0070713_100009864 | 3300005436 | Bacteria | 6868 |
| 141 | Ga0070713_100339207 | 3300005436 | Bacteria | 1392 |
| 142 | Ga0070710_10013007 | 3300005437 | Bacteria | 4151 |
| 143 | Ga0070701_10198336 | 3300005438 | Bacteria | 1185 |
| 144 | Ga0070701_10450311 | 3300005438 | Bacteria | 826 |
| 145 | Ga0070711_100000893 | 3300005439 | Bacteria | 15682 |
| 146 | Ga0070711_100008242 | 3300005439 | Bacteria | 6375 |
| 147 | Ga0070711_100610761 | 3300005439 | Bacteria | 911 |
| 148 | Ga0070700_100024694 | 3300005441 | Bacteria | 3532 |
| 149 | Ga0070708_100039252 | 3300005445 | Bacteria | 4141 |
| 150 | Ga0070708_100132128 | 3300005445 | Bacteria | 2311 |
| 151 | Ga0070708_100960367 | 3300005445 | Bacteria | 802 |
| 152 | Ga0070663_100120258 | 3300005455 | Bacteria | 1983 |
| 153 | Ga0070663_100159856 | 3300005455 | Bacteria | 1733 |
| 154 | Ga0070663_100254210 | 3300005455 | Bacteria | 1392 |
| 155 | Ga0070663_100373992 | 3300005455 | Bacteria | 1159 |
| 156 | Ga0070663_100499535 | 3300005455 | Bacteria | 1010 |
| 157 | Ga0070663_100615248 | 3300005455 | Bacteria | 915 |
| 158 | Ga0070678_100000107 | 3300005456 | Bacteria | 32267 |
| 159 | Ga0070678_100001539 | 3300005456 | Bacteria | 12334 |
| 160 | Ga0070678_100005219 | 3300005456 | Bacteria | 7474 |
| 161 | Ga0070678_100009357 | 3300005456 | Bacteria | 5930 |
| 162 | Ga0070678_100298741 | 3300005456 | Bacteria | 1368 |
| 163 | Ga0070662_100001459 | 3300005457 | Bacteria | 14573 |
| 164 | Ga0070662_100004307 | 3300005457 | Bacteria | 8989 |
| 165 | Ga0070662_100010358 | 3300005457 | Bacteria | 6114 |
| 166 | Ga0070662_100027223 | 3300005457 | Bacteria | 3966 |
| 167 | Ga0070681_10023269 | 3300005458 | Bacteria | 6230 |
| 168 | Ga0070681_10345751 | 3300005458 | Bacteria | 1397 |
| 169 | Ga0068867_100012431 | 3300005459 | Bacteria | 6023 |
| 170 | Ga0068867_100018079 | 3300005459 | Bacteria | 5010 |
| 171 | Ga0068867_100022440 | 3300005459 | Bacteria | 4514 |
| 172 | Ga0068867_100034757 | 3300005459 | Bacteria | 3655 |
| 173 | Ga0068867_100059084 | 3300005459 | Bacteria | 2842 |
| 174 | Ga0068867_100228837 | 3300005459 | Bacteria | 1502 |
| 175 | Ga0070685_10000221 | 3300005466 | Bacteria | 37567 |
| 176 | Ga0070685_10012098 | 3300005466 | Bacteria | 4526 |
| 177 | Ga0070706_100168852 | 3300005467 | Bacteria | 2043 |
| 178 | Ga0070706_100221626 | 3300005467 | Bacteria | 1765 |
| 179 | Ga0070706_100377675 | 3300005467 | Bacteria | 1320 |
| 180 | Ga0070707_100231214 | 3300005468 | Bacteria | 1800 |
| 181 | Ga0070707_100275861 | 3300005468 | Bacteria | 1634 |
| 182 | Ga0070698_100265589 | 3300005471 | Bacteria | 1648 |
| 183 | Ga0070699_100063919 | 3300005518 | Bacteria | 3191 |
| 184 | Ga0070679_100084886 | 3300005530 | Bacteria | 3153 |
| 185 | Ga0070679_100157620 | 3300005530 | Bacteria | 2245 |
| 186 | Ga0070679_100212974 | 3300005530 | Bacteria | 1895 |
| 187 | Ga0070679_100362935 | 3300005530 | Bacteria | 1396 |
| 188 | Ga0070679_100374790 | 3300005530 | Bacteria | 1370 |
| 189 | Ga0070679_100390337 | 3300005530 | Bacteria | 1338 |
| 190 | Ga0070679_100471605 | 3300005530 | Bacteria | 1199 |
| 191 | Ga0070684_100060574 | 3300005535 | Bacteria | 3311 |
| 192 | Ga0070684_100078312 | 3300005535 | Bacteria | 2920 |
| 193 | Ga0070684_100149456 | 3300005535 | Bacteria | 2115 |
| 194 | Ga0070697_100002608 | 3300005536 | Bacteria | 13872 |
| 195 | Ga0070697_100145522 | 3300005536 | Bacteria | 1994 |
| 196 | Ga0068853_100007107 | 3300005539 | Bacteria | 8959 |
| 197 | Ga0068853_100016729 | 3300005539 | Bacteria | 6040 |
| 198 | Ga0068853_100021638 | 3300005539 | Bacteria | 5364 |
| 199 | Ga0068853_100123757 | 3300005539 | Bacteria | 2309 |
| 200 | Ga0068853_100237163 | 3300005539 | Bacteria | 1670 |
| 201 | Ga0068853_100696449 | 3300005539 | Bacteria | 969 |
| 202 | Ga0070672_100000287 | 3300005543 | Bacteria | 28567 |
| 203 | Ga0070672_100014874 | 3300005543 | Bacteria | 5525 |
| 204 | Ga0070672_100034011 | 3300005543 | Bacteria | 3865 |
| 205 | Ga0070672_100034324 | 3300005543 | Bacteria | 3850 |
| 206 | Ga0070672_100039318 | 3300005543 | Bacteria | 3622 |
| 207 | Ga0070672_100084569 | 3300005543 | Bacteria | 2548 |
| 208 | Ga0070672_100229339 | 3300005543 | Bacteria | 1560 |
| 209 | Ga0070672_101023419 | 3300005543 | Bacteria | 732 |
| 210 | Ga0070686_100004007 | 3300005544 | Bacteria | 8098 |
| 211 | Ga0070686_100460519 | 3300005544 | Bacteria | 979 |
| 212 | Ga0070695_100089044 | 3300005545 | Bacteria | 2056 |
| 213 | Ga0070695_100838974 | 3300005545 | Bacteria | 739 |
| 214 | Ga0070696_100174908 | 3300005546 | Bacteria | 1589 |
| 215 | Ga0070696_100408373 | 3300005546 | Bacteria | 1064 |
| 216 | Ga0070696_100442582 | 3300005546 | Bacteria | 1024 |
| 217 | Ga0070693_100009100 | 3300005547 | Bacteria | 4929 |
| 218 | Ga0070693_100018449 | 3300005547 | Bacteria | 3645 |
| 219 | Ga0070693_100046276 | 3300005547 | Bacteria | 2470 |
| 220 | Ga0070665_100005852 | 3300005548 | Bacteria | 12613 |
| 221 | Ga0070665_100023957 | 3300005548 | Bacteria | 6147 |
| 222 | Ga0070665_100027393 | 3300005548 | Bacteria | 5741 |
| 223 | Ga0070665_100090615 | 3300005548 | Bacteria | 3063 |
| 224 | Ga0070665_100223190 | 3300005548 | Bacteria | 1885 |
| 225 | Ga0070665_100345746 | 3300005548 | Bacteria | 1492 |
| 226 | Ga0070704_100127167 | 3300005549 | Bacteria | 1968 |
| 227 | Ga0070704_100360052 | 3300005549 | Bacteria | 1230 |
| 228 | Ga0068855_100004813 | 3300005563 | Bacteria | 16483 |
| 229 | Ga0068855_100021114 | 3300005563 | Bacteria | 7808 |
| 230 | Ga0068855_100054928 | 3300005563 | Bacteria | 4679 |
| 231 | Ga0068855_100071153 | 3300005563 | Bacteria | 4045 |
| 232 | Ga0068855_100209465 | 3300005563 | Bacteria | 2191 |
| 233 | Ga0068855_100236360 | 3300005563 | Bacteria | 2044 |
| 234 | Ga0068855_100592144 | 3300005563 | Bacteria | 1197 |
| 235 | Ga0068855_100922448 | 3300005563 | Bacteria | 921 |
| 236 | Ga0068855_101642162 | 3300005563 | Bacteria | 657 |
| 237 | Ga0070664_100003781 | 3300005564 | Bacteria | 12209 |
| 238 | Ga0070664_100005952 | 3300005564 | Bacteria | 9854 |
| 239 | Ga0070664_100014836 | 3300005564 | Bacteria | 6359 |
| 240 | Ga0070664_100025762 | 3300005564 | Bacteria | 4876 |
| 241 | Ga0070664_100062291 | 3300005564 | Bacteria | 3180 |
| 242 | Ga0070664_100065064 | 3300005564 | Bacteria | 3110 |
| 243 | Ga0070664_100191243 | 3300005564 | Bacteria | 1823 |
| 244 | Ga0070664_100305936 | 3300005564 | Bacteria | 1437 |
| 245 | Ga0070664_100869586 | 3300005564 | Bacteria | 844 |
| 246 | Ga0068857_100006994 | 3300005577 | Bacteria | 9707 |
| 247 | Ga0068857_100087027 | 3300005577 | Bacteria | 2795 |
| 248 | Ga0068857_100983352 | 3300005577 | Bacteria | 812 |
| 249 | Ga0068854_100003585 | 3300005578 | Bacteria | 9708 |
| 250 | Ga0068854_100039367 | 3300005578 | Bacteria | 3330 |
| 251 | Ga0068854_100041321 | 3300005578 | Bacteria | 3258 |
| 252 | Ga0068856_100003384 | 3300005614 | Bacteria | 16150 |
| 253 | Ga0068856_100017101 | 3300005614 | Bacteria | 7030 |
| 254 | Ga0068856_100035684 | 3300005614 | Bacteria | 4874 |
| 255 | Ga0068856_100049046 | 3300005614 | Bacteria | 4161 |
| 256 | Ga0068856_100073484 | 3300005614 | Bacteria | 3386 |
| 257 | Ga0070702_100088814 | 3300005615 | Bacteria | 1869 |
| 258 | Ga0070702_100514234 | 3300005615 | Bacteria | 882 |
| 259 | Ga0068852_100001607 | 3300005616 | Bacteria | 15383 |
| 260 | Ga0068852_100007039 | 3300005616 | Bacteria | 8191 |
| 261 | Ga0068852_100007656 | 3300005616 | Bacteria | 7898 |
| 262 | Ga0068852_100039794 | 3300005616 | Bacteria | 3961 |
| 263 | Ga0068852_100049718 | 3300005616 | Bacteria | 3588 |
| 264 | Ga0068852_100147063 | 3300005616 | Bacteria | 2187 |
| 265 | Ga0068852_100194924 | 3300005616 | Bacteria | 1914 |
| 266 | Ga0068852_100268517 | 3300005616 | Bacteria | 1641 |
| 267 | Ga0068852_101294605 | 3300005616 | Bacteria | 750 |
| 268 | Ga0068859_100003177 | 3300005617 | Bacteria | 16715 |
| 269 | Ga0068859_100020837 | 3300005617 | Bacteria | 6580 |
| 270 | Ga0068859_100056234 | 3300005617 | Bacteria | 3959 |
| 271 | Ga0068859_100206562 | 3300005617 | Bacteria | 2049 |
| 272 | Ga0068859_100228030 | 3300005617 | Bacteria | 1951 |
| 273 | Ga0068859_100710813 | 3300005617 | Bacteria | 1095 |
| 274 | Ga0068859_101024317 | 3300005617 | Bacteria | 907 |
| 275 | Ga0068864_100001285 | 3300005618 | Bacteria | 20888 |
| 276 | Ga0068864_100002616 | 3300005618 | Bacteria | 14866 |
| 277 | Ga0068864_100008284 | 3300005618 | Bacteria | 8574 |
| 278 | Ga0068864_100054096 | 3300005618 | Bacteria | 3464 |
| 279 | Ga0068864_100107381 | 3300005618 | Bacteria | 2483 |
| 280 | Ga0068864_100495626 | 3300005618 | Bacteria | 1174 |
| 281 | Ga0068866_10000652 | 3300005718 | Bacteria | 15743 |
| 282 | Ga0068866_10035833 | 3300005718 | Bacteria | 2426 |
| 283 | Ga0068861_100003709 | 3300005719 | Bacteria | 10193 |
| 284 | Ga0068861_100005006 | 3300005719 | Bacteria | 8930 |
| 285 | Ga0068861_100075027 | 3300005719 | Bacteria | 2631 |
| 286 | Ga0068861_100126387 | 3300005719 | Bacteria | 2069 |
| 287 | Ga0068861_100153025 | 3300005719 | Bacteria | 1894 |
| 288 | Ga0068861_100322956 | 3300005719 | Bacteria | 1345 |
| 289 | Ga0068861_100765574 | 3300005719 | Bacteria | 903 |
| 290 | Ga0068851_10002374 | 3300005834 | Bacteria | 8270 |
| 291 | Ga0068851_10007294 | 3300005834 | Bacteria | 5071 |
| 292 | Ga0068851_10012519 | 3300005834 | Bacteria | 4000 |
| 293 | Ga0068851_10101164 | 3300005834 | Bacteria | 1529 |
| 294 | Ga0068851_10119698 | 3300005834 | Bacteria | 1414 |
| 295 | Ga0068851_10520052 | 3300005834 | Bacteria | 716 |
| 296 | Ga0068870_10009006 | 3300005840 | Bacteria | 4516 |
| 297 | Ga0068870_10192004 | 3300005840 | Bacteria | 1233 |
| 298 | Ga0068870_10209989 | 3300005840 | Bacteria | 1185 |
| 299 | Ga0068863_100002985 | 3300005841 | Bacteria | 16732 |
| 300 | Ga0068863_100021433 | 3300005841 | Bacteria | 6168 |
| 301 | Ga0068863_100029135 | 3300005841 | Bacteria | 5271 |
| 302 | Ga0068863_100033720 | 3300005841 | Bacteria | 4878 |
| 303 | Ga0068863_100074693 | 3300005841 | Bacteria | 3207 |
| 304 | Ga0068863_100100410 | 3300005841 | Bacteria | 2750 |
| 305 | Ga0068863_100230039 | 3300005841 | Bacteria | 1788 |
| 306 | Ga0068863_100789797 | 3300005841 | Bacteria | 947 |
| 307 | Ga0068863_101362936 | 3300005841 | Bacteria | 717 |
| 308 | Ga0068858_100000603 | 3300005842 | Bacteria | 37588 |
| 309 | Ga0068858_100021506 | 3300005842 | Bacteria | 6027 |
| 310 | Ga0068858_100021707 | 3300005842 | Bacteria | 5999 |
| 311 | Ga0068858_100209689 | 3300005842 | Bacteria | 1844 |
| 312 | Ga0068860_100005493 | 3300005843 | Bacteria | 12840 |
| 313 | Ga0068860_100005815 | 3300005843 | Bacteria | 12419 |
| 314 | Ga0068860_100066041 | 3300005843 | Bacteria | 3436 |
| 315 | Ga0068860_100150580 | 3300005843 | Bacteria | 2240 |
| 316 | Ga0068860_100166829 | 3300005843 | Bacteria | 2126 |
| 317 | Ga0068860_100234028 | 3300005843 | Bacteria | 1786 |
| 318 | Ga0068860_100362200 | 3300005843 | Bacteria | 1429 |
| 319 | Ga0068860_100466610 | 3300005843 | Bacteria | 1257 |
| 320 | Ga0068860_100557381 | 3300005843 | Bacteria | 1149 |
| 321 | Ga0068862_100029825 | 3300005844 | Bacteria | 4596 |
| 322 | Ga0068862_100058971 | 3300005844 | Bacteria | 3294 |
| 323 | Ga0068862_101405373 | 3300005844 | Bacteria | 701 |
| 324 | Ga0070715_10012346 | 3300006163 | Bacteria | 3107 |
| 325 | Ga0070716_100001339 | 3300006173 | Bacteria | 10909 |
| 326 | Ga0070716_100543585 | 3300006173 | Bacteria | 865 |
| 327 | Ga0070712_100005043 | 3300006175 | Bacteria | 8177 |
| 328 | Ga0070712_100027301 | 3300006175 | Bacteria | 3811 |
| 329 | Ga0070712_100691315 | 3300006175 | Bacteria | 869 |
| 330 | Ga0097621_100001308 | 3300006237 | Bacteria | 17135 |
| 331 | Ga0097621_100020593 | 3300006237 | Bacteria | 5083 |
| 332 | Ga0097621_100266181 | 3300006237 | Unclassified | 1505 |
| 333 | Ga0097621_100304330 | 3300006237 | Bacteria | 1409 |
| 334 | Ga0097621_101056642 | 3300006237 | Bacteria | 761 |
| 335 | Ga0068871_100001077 | 3300006358 | Bacteria | 18307 |
| 336 | Ga0068871_100022355 | 3300006358 | Bacteria | 4874 |
| 337 | Ga0068871_100109754 | 3300006358 | Bacteria | 2320 |
| 338 | Ga0068871_100204799 | 3300006358 | Bacteria | 1705 |
| 339 | Ga0068871_100230476 | 3300006358 | Bacteria | 1607 |
| 340 | Ga0075428_100028198 | 3300006844 | Bacteria | 6210 |
| 341 | Ga0075430_100652244 | 3300006846 | Bacteria | 868 |
| 342 | Ga0075433_10056206 | 3300006852 | Bacteria | 3437 |
| 343 | Ga0075434_100035035 | 3300006871 | Bacteria | 4962 |
| 344 | Ga0075434_100146274 | 3300006871 | Bacteria | 2384 |
| 345 | Ga0075434_100204116 | 3300006871 | Bacteria | 1997 |
| 346 | Ga0068865_100015998 | 3300006881 | Bacteria | 4791 |
| 347 | Ga0068865_100045238 | 3300006881 | Bacteria | 3017 |
| 348 | Ga0068865_100053326 | 3300006881 | Bacteria | 2805 |
| 349 | Ga0068865_100145066 | 3300006881 | Bacteria | 1794 |
| 350 | Ga0068865_100248865 | 3300006881 | Bacteria | 1402 |
| 351 | Ga0075436_100090334 | 3300006914 | Bacteria | 2129 |
| 352 | Ga0075436_100221437 | 3300006914 | Bacteria | 1343 |
| 353 | Ga0097620_100003176 | 3300006931 | Bacteria | 16715 |
| 354 | Ga0097620_100020837 | 3300006931 | Bacteria | 6580 |
| 355 | Ga0097620_100056234 | 3300006931 | Bacteria | 3959 |
| 356 | Ga0097620_100206554 | 3300006931 | Bacteria | 2049 |
| 357 | Ga0097620_100228024 | 3300006931 | Bacteria | 1951 |
| 358 | Ga0097620_100710841 | 3300006931 | Bacteria | 1095 |
| 359 | Ga0097620_101024316 | 3300006931 | Bacteria | 907 |
| 360 | Ga0075435_100011479 | 3300007076 | Bacteria | 6520 |
| 361 | Ga0099794_10237603 | 3300007265 | Unclassified | 938 |
| 362 | Ga0105251_10276745 | 3300009011 | Bacteria | 759 |
| 363 | Ga0105240_10002428 | 3300009093 | Bacteria | 29958 |
| 364 | Ga0105240_10018683 | 3300009093 | Bacteria | 9288 |
| 365 | Ga0105240_10036989 | 3300009093 | Bacteria | 6274 |
| 366 | Ga0105240_10047724 | 3300009093 | Bacteria | 5418 |
| 367 | Ga0111539_10257698 | 3300009094 | Bacteria | 2031 |
| 368 | Ga0105245_10005497 | 3300009098 | Bacteria | 11132 |
| 369 | Ga0105245_10014037 | 3300009098 | Bacteria | 6975 |
| 370 | Ga0105245_10020376 | 3300009098 | Bacteria | 5816 |
| 371 | Ga0105245_10209674 | 3300009098 | Bacteria | 1875 |
| 372 | Ga0105245_10418636 | 3300009098 | Bacteria | 1342 |
| 373 | Ga0105247_10180034 | 3300009101 | Bacteria | 1410 |
| 374 | Ga0114129_10294637 | 3300009147 | Bacteria | 2164 |
| 375 | Ga0105243_10091093 | 3300009148 | Bacteria | 2510 |
| 376 | Ga0105241_10014237 | 3300009174 | Bacteria | 5827 |
| 377 | Ga0105241_10022261 | 3300009174 | Bacteria | 4692 |
| 378 | Ga0105241_10111769 | 3300009174 | Bacteria | 2188 |
| 379 | Ga0105242_10002918 | 3300009176 | Bacteria | 13363 |
| 380 | Ga0105248_10002074 | 3300009177 | Bacteria | 22178 |
| 381 | Ga0105248_10018068 | 3300009177 | Bacteria | 7784 |
| 382 | Ga0105248_10026830 | 3300009177 | Bacteria | 6408 |
| 383 | Ga0105248_10141310 | 3300009177 | Bacteria | 2716 |
| 384 | Ga0105248_10431634 | 3300009177 | Bacteria | 1484 |
| 385 | Ga0105248_10995729 | 3300009177 | Bacteria | 947 |
| 386 | Ga0105248_11263997 | 3300009177 | Bacteria | 835 |
| 387 | Ga0105248_12572893 | 3300009177 | Bacteria | 580 |
| 388 | Ga0105237_10080261 | 3300009545 | Bacteria | 3253 |
| 389 | Ga0105237_10354688 | 3300009545 | Bacteria | 1471 |
| 390 | Ga0105238_10001044 | 3300009551 | Bacteria | 28027 |
| 391 | Ga0105238_10027188 | 3300009551 | Bacteria | 5829 |
| 392 | Ga0105238_10067698 | 3300009551 | Bacteria | 3572 |
| 393 | Ga0105249_10226118 | 3300009553 | Bacteria | 1844 |
| 394 | Ga0105249_10266929 | 3300009553 | Bacteria | 1703 |
| 395 | Ga0105249_10757998 | 3300009553 | Bacteria | 1033 |
| 396 | Ga0105239_10033050 | 3300010375 | Bacteria | 5682 |
| 397 | Ga0105239_10371690 | 3300010375 | Bacteria | 1616 |
| 398 | Ga0105239_10691721 | 3300010375 | Bacteria | 1166 |
| 399 | Ga0105239_10789428 | 3300010375 | Bacteria | 1088 |
| 400 | Ga0105239_11598816 | 3300010375 | Bacteria | 754 |
| 401 | Ga0105239_12005190 | 3300010375 | Bacteria | 672 |
| 402 | Ga0105246_10119344 | 3300011119 | Bacteria | 1951 |
| 403 | Ga0105246_10194636 | 3300011119 | Bacteria | 1572 |
| 404 | Ga0157329_1000632 | 3300012491 | Bacteria | 1478 |
| 405 | Ga0157373_10001146 | 3300013100 | Bacteria | 20311 |
| 406 | Ga0157373_10001663 | 3300013100 | Bacteria | 16979 |
| 407 | Ga0157373_10040985 | 3300013100 | Bacteria | 3313 |
| 408 | Ga0157373_10572589 | 3300013100 | Bacteria | 820 |
| 409 | Ga0157371_10001270 | 3300013102 | Bacteria | 26598 |
| 410 | Ga0157371_10307675 | 3300013102 | Bacteria | 1148 |
| 411 | Ga0157370_10028427 | 3300013104 | Bacteria | 5499 |
| 412 | Ga0157370_10031257 | 3300013104 | Bacteria | 5210 |
| 413 | Ga0157370_10034216 | 3300013104 | Bacteria | 4950 |
| 414 | Ga0157370_10113007 | 3300013104 | Bacteria | 2538 |
| 415 | Ga0157370_10580363 | 3300013104 | Bacteria | 1027 |
| 416 | Ga0157370_10770293 | 3300013104 | Bacteria | 876 |
| 417 | Ga0157369_10014238 | 3300013105 | Bacteria | 8986 |
| 418 | Ga0157369_10112017 | 3300013105 | Bacteria | 2900 |
| 419 | Ga0157369_10825111 | 3300013105 | Bacteria | 952 |
| 420 | Ga0157374_10000565 | 3300013296 | Bacteria | 32833 |
| 421 | Ga0157374_10001312 | 3300013296 | Bacteria | 21166 |
| 422 | Ga0157374_10003097 | 3300013296 | Bacteria | 13957 |
| 423 | Ga0157374_11147403 | 3300013296 | Bacteria | 798 |
| 424 | Ga0157378_10005399 | 3300013297 | Bacteria | 11207 |
| 425 | Ga0157378_10031024 | 3300013297 | Bacteria | 4720 |
| 426 | Ga0157378_10171201 | 3300013297 | Bacteria | 2037 |
| 427 | Ga0157378_10285543 | 3300013297 | Bacteria | 1592 |
| 428 | Ga0157378_10486939 | 3300013297 | Bacteria | 1230 |
| 429 | Ga0163162_10005459 | 3300013306 | Bacteria | 12283 |
| 430 | Ga0163162_10022644 | 3300013306 | Bacteria | 6194 |
| 431 | Ga0163162_10057652 | 3300013306 | Bacteria | 3912 |
| 432 | Ga0163162_10073420 | 3300013306 | Bacteria | 3477 |
| 433 | Ga0163162_10087446 | 3300013306 | Bacteria | 3195 |
| 434 | Ga0163162_10104564 | 3300013306 | Bacteria | 2926 |
| 435 | Ga0163162_11047736 | 3300013306 | Bacteria | 923 |
| 436 | Ga0157372_10002798 | 3300013307 | Bacteria | 18848 |
| 437 | Ga0157372_10004393 | 3300013307 | Bacteria | 15042 |
| 438 | Ga0157372_10064232 | 3300013307 | Bacteria | 4119 |
| 439 | Ga0157372_10082910 | 3300013307 | Bacteria | 3631 |
| 440 | Ga0157372_10125410 | 3300013307 | Bacteria | 2952 |
| 441 | Ga0157372_10257457 | 3300013307 | Bacteria | 2026 |
| 442 | Ga0157372_11037427 | 3300013307 | Bacteria | 949 |
| 443 | Ga0157372_11791555 | 3300013307 | Bacteria | 706 |
| 444 | Ga0157375_10002469 | 3300013308 | Bacteria | 16013 |
| 445 | Ga0157375_10004526 | 3300013308 | Bacteria | 12081 |
| 446 | Ga0157375_10038200 | 3300013308 | Bacteria | 4608 |
| 447 | Ga0157375_10052859 | 3300013308 | Bacteria | 3995 |
| 448 | Ga0157375_10117630 | 3300013308 | Bacteria | 2764 |
| 449 | Ga0157375_10150785 | 3300013308 | Bacteria | 2460 |
| 450 | Ga0157375_10684861 | 3300013308 | Bacteria | 1180 |
| 451 | Ga0157375_10713973 | 3300013308 | Bacteria | 1156 |
| 452 | Ga0157375_10995462 | 3300013308 | Bacteria | 978 |
| 453 | Ga0163163_10000689 | 3300014325 | Bacteria | 28712 |
| 454 | Ga0163163_10010956 | 3300014325 | Bacteria | 8191 |
| 455 | Ga0163163_10015342 | 3300014325 | Bacteria | 7081 |
| 456 | Ga0163163_10054422 | 3300014325 | Bacteria | 3953 |
| 457 | Ga0163163_10134510 | 3300014325 | Bacteria | 2513 |
| 458 | Ga0163163_10751405 | 3300014325 | Bacteria | 1039 |
| 459 | Ga0157380_10064658 | 3300014326 | Bacteria | 2938 |
| 460 | Ga0157380_10139268 | 3300014326 | Bacteria | 2082 |
| 461 | Ga0157377_10016528 | 3300014745 | Bacteria | 3797 |
| 462 | Ga0157377_10343305 | 3300014745 | Bacteria | 999 |
| 463 | Ga0157379_10000858 | 3300014968 | Bacteria | 24649 |
| 464 | Ga0157379_10004449 | 3300014968 | Bacteria | 12018 |
| 465 | Ga0157376_10007657 | 3300014969 | Bacteria | 7734 |
| 466 | Ga0157376_10007747 | 3300014969 | Bacteria | 7696 |
| 467 | Ga0157376_10012373 | 3300014969 | Bacteria | 6332 |
| 468 | Ga0157376_10477196 | 3300014969 | Bacteria | 1221 |
| 469 | Ga0157376_11076075 | 3300014969 | Bacteria | 829 |
| 470 | Ga0157376_11313371 | 3300014969 | Unclassified | 753 |
| 471 | Ga0163161_10010199 | 3300017792 | Bacteria | 6504 |
| 472 | Ga0163161_10021494 | 3300017792 | Bacteria | 4534 |
| 473 | Ga0163161_10167424 | 3300017792 | Bacteria | 1679 |
| 474 | Ga0163161_10195601 | 3300017792 | Bacteria | 1556 |
| 475 | Ga0163161_10723215 | 3300017792 | Bacteria | 831 |
| 476 | Ga0163161_10841969 | 3300017792 | Bacteria | 773 |
| 477 | Ga0206354_10723169 | 3300020081 | Bacteria | 1965 |
| 478 | Ga0206354_11192541 | 3300020081 | Bacteria | 2529 |
| 479 | Ga0213876_10184874 | 3300021384 | Bacteria | 1108 |
| 480 | Ga0207697_10000414 | 3300025315 | Bacteria | 24140 |
| 481 | Ga0207697_10008388 | 3300025315 | Bacteria | 4523 |
| 482 | Ga0207697_10019659 | 3300025315 | Bacteria | 2767 |
| 483 | Ga0207656_10016976 | 3300025321 | Bacteria | 2844 |
| 484 | Ga0207656_10061127 | 3300025321 | Bacteria | 1653 |
| 485 | Ga0207682_10000882 | 3300025893 | Bacteria | 13919 |
| 486 | Ga0207682_10001053 | 3300025893 | Bacteria | 12703 |
| 487 | Ga0207692_10005926 | 3300025898 | Bacteria | 4930 |
| 488 | Ga0207692_10269429 | 3300025898 | Bacteria | 1026 |
| 489 | Ga0207642_10000852 | 3300025899 | Bacteria | 9489 |
| 490 | Ga0207710_10091805 | 3300025900 | Bacteria | 1422 |
| 491 | Ga0207688_10001416 | 3300025901 | Bacteria | 12500 |
| 492 | Ga0207680_10000458 | 3300025903 | Bacteria | 19273 |
| 493 | Ga0207680_10018773 | 3300025903 | Bacteria | 3685 |
| 494 | Ga0207680_10020828 | 3300025903 | Bacteria | 3540 |
| 495 | Ga0207680_10042029 | 3300025903 | Bacteria | 2671 |
| 496 | Ga0207680_10043021 | 3300025903 | Bacteria | 2646 |
| 497 | Ga0207680_10056995 | 3300025903 | Bacteria | 2362 |
| 498 | Ga0207680_10067693 | 3300025903 | Bacteria | 2201 |
| 499 | Ga0207647_10095485 | 3300025904 | Bacteria | 1770 |
| 500 | Ga0207685_10104526 | 3300025905 | Bacteria | 1217 |
| 501 | Ga0207699_10001757 | 3300025906 | Bacteria | 10233 |
| 502 | Ga0207645_10000308 | 3300025907 | Bacteria | 41052 |
| 503 | Ga0207645_10000661 | 3300025907 | Bacteria | 28611 |
| 504 | Ga0207645_10001318 | 3300025907 | Bacteria | 20383 |
| 505 | Ga0207645_10068667 | 3300025907 | Bacteria | 2267 |
| 506 | Ga0207645_10070649 | 3300025907 | Bacteria | 2233 |
| 507 | Ga0207645_10279160 | 3300025907 | Bacteria | 1109 |
| 508 | Ga0207645_10462481 | 3300025907 | Bacteria | 857 |
| 509 | Ga0207643_10000515 | 3300025908 | Bacteria | 24751 |
| 510 | Ga0207643_10006397 | 3300025908 | Bacteria | 6308 |
| 511 | Ga0207643_10039127 | 3300025908 | Bacteria | 2667 |
| 512 | Ga0207643_10101961 | 3300025908 | Bacteria | 1683 |
| 513 | Ga0207643_10229113 | 3300025908 | Bacteria | 1139 |
| 514 | Ga0207705_10591113 | 3300025909 | Bacteria | 863 |
| 515 | Ga0207684_10685030 | 3300025910 | Bacteria | 872 |
| 516 | Ga0207654_10003842 | 3300025911 | Bacteria | 7571 |
| 517 | Ga0207654_10589145 | 3300025911 | Bacteria | 793 |
| 518 | Ga0207707_10075114 | 3300025912 | Bacteria | 2948 |
| 519 | Ga0207707_10106830 | 3300025912 | Bacteria | 2447 |
| 520 | Ga0207707_10256342 | 3300025912 | Bacteria | 1519 |
| 521 | Ga0207707_10270430 | 3300025912 | Bacteria | 1473 |
| 522 | Ga0207695_10060223 | 3300025913 | Bacteria | 3931 |
| 523 | Ga0207671_10142546 | 3300025914 | Bacteria | 1847 |
| 524 | Ga0207671_10220291 | 3300025914 | Bacteria | 1486 |
| 525 | Ga0207693_10001163 | 3300025915 | Bacteria | 23479 |
| 526 | Ga0207693_10020414 | 3300025915 | Bacteria | 5270 |
| 527 | Ga0207693_10032301 | 3300025915 | Bacteria | 4131 |
| 528 | Ga0207663_10003837 | 3300025916 | Bacteria | 7420 |
| 529 | Ga0207663_10027057 | 3300025916 | Bacteria | 3337 |
| 530 | Ga0207660_10028314 | 3300025917 | Bacteria | 3831 |
| 531 | Ga0207660_10078716 | 3300025917 | Bacteria | 2417 |
| 532 | Ga0207660_10228576 | 3300025917 | Bacteria | 1462 |
| 533 | Ga0207660_10276195 | 3300025917 | Bacteria | 1332 |
| 534 | Ga0207660_10358902 | 3300025917 | Bacteria | 1169 |
| 535 | Ga0207662_10007274 | 3300025918 | Bacteria | 6019 |
| 536 | Ga0207662_10158243 | 3300025918 | Bacteria | 1445 |
| 537 | Ga0207657_10000280 | 3300025919 | Bacteria | 54274 |
| 538 | Ga0207657_10005254 | 3300025919 | Bacteria | 13564 |
| 539 | Ga0207657_10005934 | 3300025919 | Bacteria | 12711 |
| 540 | Ga0207657_10010916 | 3300025919 | Bacteria | 9040 |
| 541 | Ga0207657_10019674 | 3300025919 | Bacteria | 6402 |
| 542 | Ga0207657_10022078 | 3300025919 | Bacteria | 5973 |
| 543 | Ga0207657_10031129 | 3300025919 | Bacteria | 4837 |
| 544 | Ga0207657_10144962 | 3300025919 | Bacteria | 1938 |
| 545 | Ga0207649_10010264 | 3300025920 | Bacteria | 5142 |
| 546 | Ga0207649_10025326 | 3300025920 | Bacteria | 3457 |
| 547 | Ga0207649_10095263 | 3300025920 | Bacteria | 1958 |
| 548 | Ga0207649_10123864 | 3300025920 | Bacteria | 1746 |
| 549 | Ga0207649_10254089 | 3300025920 | Bacteria | 1267 |
| 550 | Ga0207649_10285277 | 3300025920 | Bacteria | 1202 |
| 551 | Ga0207649_10490270 | 3300025920 | Bacteria | 933 |
| 552 | Ga0207649_10594754 | 3300025920 | Bacteria | 850 |
| 553 | Ga0207652_10007921 | 3300025921 | Bacteria | 8529 |
| 554 | Ga0207652_10031111 | 3300025921 | Bacteria | 4479 |
| 555 | Ga0207652_10322812 | 3300025921 | Bacteria | 1394 |
| 556 | Ga0207652_10353757 | 3300025921 | Bacteria | 1326 |
| 557 | Ga0207652_10858534 | 3300025921 | Bacteria | 803 |
| 558 | Ga0207646_10012728 | 3300025922 | Bacteria | 8071 |
| 559 | Ga0207646_10069627 | 3300025922 | Bacteria | 3142 |
| 560 | Ga0207681_10013968 | 3300025923 | Bacteria | 4976 |
| 561 | Ga0207681_10042165 | 3300025923 | Bacteria | 3047 |
| 562 | Ga0207681_10077700 | 3300025923 | Bacteria | 2334 |
| 563 | Ga0207681_10080022 | 3300025923 | Bacteria | 2304 |
| 564 | Ga0207681_10198461 | 3300025923 | Bacteria | 1539 |
| 565 | Ga0207681_10199963 | 3300025923 | Bacteria | 1534 |
| 566 | Ga0207694_10009651 | 3300025924 | Bacteria | 7276 |
| 567 | Ga0207694_10058569 | 3300025924 | Bacteria | 2996 |
| 568 | Ga0207694_10235054 | 3300025924 | Bacteria | 1497 |
| 569 | Ga0207650_10007692 | 3300025925 | Bacteria | 7340 |
| 570 | Ga0207650_10014573 | 3300025925 | Bacteria | 5461 |
| 571 | Ga0207650_10023409 | 3300025925 | Bacteria | 4380 |
| 572 | Ga0207650_10081552 | 3300025925 | Bacteria | 2454 |
| 573 | Ga0207650_10100240 | 3300025925 | Bacteria | 2228 |
| 574 | Ga0207650_10176364 | 3300025925 | Bacteria | 1701 |
| 575 | Ga0207650_10177682 | 3300025925 | Bacteria | 1695 |
| 576 | Ga0207650_10272078 | 3300025925 | Bacteria | 1377 |
| 577 | Ga0207650_10303583 | 3300025925 | Bacteria | 1304 |
| 578 | Ga0207650_10320427 | 3300025925 | Bacteria | 1269 |
| 579 | Ga0207650_10657315 | 3300025925 | Bacteria | 884 |
| 580 | Ga0207659_10001947 | 3300025926 | Bacteria | 12255 |
| 581 | Ga0207659_10008878 | 3300025926 | Bacteria | 6265 |
| 582 | Ga0207659_10058286 | 3300025926 | Bacteria | 2772 |
| 583 | Ga0207659_10239508 | 3300025926 | Bacteria | 1467 |
| 584 | Ga0207659_10648046 | 3300025926 | Bacteria | 902 |
| 585 | Ga0207687_10000741 | 3300025927 | Bacteria | 22128 |
| 586 | Ga0207687_10009974 | 3300025927 | Bacteria | 6216 |
| 587 | Ga0207687_10446015 | 3300025927 | Bacteria | 1072 |
| 588 | Ga0207687_10563528 | 3300025927 | Bacteria | 957 |
| 589 | Ga0207700_10031325 | 3300025928 | Bacteria | 3776 |
| 590 | Ga0207700_10036111 | 3300025928 | Bacteria | 3566 |
| 591 | Ga0207664_10009725 | 3300025929 | Bacteria | 6760 |
| 592 | Ga0207664_10080459 | 3300025929 | Bacteria | 2648 |
| 593 | Ga0207664_10112269 | 3300025929 | Bacteria | 2269 |
| 594 | Ga0207664_10150946 | 3300025929 | Bacteria | 1974 |
| 595 | Ga0207664_10368711 | 3300025929 | Bacteria | 1273 |
| 596 | Ga0207644_10002123 | 3300025931 | Bacteria | 12863 |
| 597 | Ga0207644_10002335 | 3300025931 | Bacteria | 12260 |
| 598 | Ga0207644_10004658 | 3300025931 | Bacteria | 8914 |
| 599 | Ga0207644_10011896 | 3300025931 | Bacteria | 5768 |
| 600 | Ga0207644_10056245 | 3300025931 | Bacteria | 2838 |
| 601 | Ga0207644_10077256 | 3300025931 | Bacteria | 2451 |
| 602 | Ga0207690_10014956 | 3300025932 | Bacteria | 4699 |
| 603 | Ga0207690_10051257 | 3300025932 | Bacteria | 2759 |
| 604 | Ga0207690_10241125 | 3300025932 | Bacteria | 1392 |
| 605 | Ga0207690_11194368 | 3300025932 | Bacteria | 635 |
| 606 | Ga0207690_11298065 | 3300025932 | Bacteria | 608 |
| 607 | Ga0207706_10002095 | 3300025933 | Bacteria | 19518 |
| 608 | Ga0207706_10003433 | 3300025933 | Bacteria | 15131 |
| 609 | Ga0207706_10044681 | 3300025933 | Bacteria | 3926 |
| 610 | Ga0207706_10046409 | 3300025933 | Bacteria | 3846 |
| 611 | Ga0207706_10049727 | 3300025933 | Bacteria | 3704 |
| 612 | Ga0207706_10132342 | 3300025933 | Bacteria | 2194 |
| 613 | Ga0207706_10243707 | 3300025933 | Bacteria | 1571 |
| 614 | Ga0207706_10323910 | 3300025933 | Bacteria | 1341 |
| 615 | Ga0207706_10332122 | 3300025933 | Bacteria | 1322 |
| 616 | Ga0207706_10453825 | 3300025933 | Bacteria | 1108 |
| 617 | Ga0207686_10000521 | 3300025934 | Bacteria | 24900 |
| 618 | Ga0207709_10446596 | 3300025935 | Bacteria | 999 |
| 619 | Ga0207670_10023785 | 3300025936 | Bacteria | 3819 |
| 620 | Ga0207670_10267540 | 3300025936 | Bacteria | 1327 |
| 621 | Ga0207670_10339691 | 3300025936 | Bacteria | 1186 |
| 622 | Ga0207670_10654939 | 3300025936 | Bacteria | 866 |
| 623 | Ga0207669_10062451 | 3300025937 | Bacteria | 2294 |
| 624 | Ga0207669_10122910 | 3300025937 | Bacteria | 1766 |
| 625 | Ga0207669_10218692 | 3300025937 | Bacteria | 1396 |
| 626 | Ga0207669_10272264 | 3300025937 | Bacteria | 1272 |
| 627 | Ga0207669_10432810 | 3300025937 | Bacteria | 1038 |
| 628 | Ga0207704_10116095 | 3300025938 | Bacteria | 1821 |
| 629 | Ga0207704_10267081 | 3300025938 | Bacteria | 1293 |
| 630 | Ga0207704_10285633 | 3300025938 | Bacteria | 1256 |
| 631 | Ga0207704_10492556 | 3300025938 | Bacteria | 986 |
| 632 | Ga0207665_10004353 | 3300025939 | Bacteria | 9406 |
| 633 | Ga0207691_10000016 | 3300025940 | Bacteria | 141024 |
| 634 | Ga0207691_10000249 | 3300025940 | Bacteria | 53276 |
| 635 | Ga0207691_10010436 | 3300025940 | Bacteria | 8910 |
| 636 | Ga0207691_10023071 | 3300025940 | Bacteria | 5861 |
| 637 | Ga0207691_10031686 | 3300025940 | Bacteria | 4933 |
| 638 | Ga0207691_10043297 | 3300025940 | Bacteria | 4149 |
| 639 | Ga0207691_10054464 | 3300025940 | Bacteria | 3648 |
| 640 | Ga0207691_10088467 | 3300025940 | Bacteria | 2778 |
| 641 | Ga0207711_10000448 | 3300025941 | Bacteria | 43007 |
| 642 | Ga0207711_10015792 | 3300025941 | Bacteria | 6264 |
| 643 | Ga0207711_10028790 | 3300025941 | Bacteria | 4678 |
| 644 | Ga0207711_10129172 | 3300025941 | Bacteria | 2264 |
| 645 | Ga0207711_10184264 | 3300025941 | Bacteria | 1900 |
| 646 | Ga0207711_10262548 | 3300025941 | Bacteria | 1587 |
| 647 | Ga0207711_11032127 | 3300025941 | Bacteria | 762 |
| 648 | Ga0207689_10002125 | 3300025942 | Bacteria | 18643 |
| 649 | Ga0207689_10006079 | 3300025942 | Bacteria | 10675 |
| 650 | Ga0207689_10118222 | 3300025942 | Bacteria | 2180 |
| 651 | Ga0207689_10130410 | 3300025942 | Bacteria | 2069 |
| 652 | Ga0207661_10079457 | 3300025944 | Bacteria | 2703 |
| 653 | Ga0207661_10162532 | 3300025944 | Bacteria | 1938 |
| 654 | Ga0207661_10277832 | 3300025944 | Bacteria | 1496 |
| 655 | Ga0207679_10023735 | 3300025945 | Bacteria | 4197 |
| 656 | Ga0207679_10102883 | 3300025945 | Bacteria | 2237 |
| 657 | Ga0207679_10246549 | 3300025945 | Bacteria | 1516 |
| 658 | Ga0207679_10488415 | 3300025945 | Bacteria | 1097 |
| 659 | Ga0207679_10589948 | 3300025945 | Bacteria | 1000 |
| 660 | Ga0207679_10780569 | 3300025945 | Bacteria | 870 |
| 661 | Ga0207667_10005138 | 3300025949 | Bacteria | 15985 |
| 662 | Ga0207667_10007488 | 3300025949 | Bacteria | 13107 |
| 663 | Ga0207667_10065531 | 3300025949 | Bacteria | 3788 |
| 664 | Ga0207667_10074508 | 3300025949 | Bacteria | 3526 |
| 665 | Ga0207667_10395391 | 3300025949 | Bacteria | 1407 |
| 666 | Ga0207667_10457694 | 3300025949 | Bacteria | 1296 |
| 667 | Ga0207667_10465475 | 3300025949 | Bacteria | 1284 |
| 668 | Ga0207667_10541642 | 3300025949 | Bacteria | 1178 |
| 669 | Ga0207667_10638834 | 3300025949 | Bacteria | 1071 |
| 670 | Ga0207651_10001976 | 3300025960 | Bacteria | 9642 |
| 671 | Ga0207651_10002125 | 3300025960 | Bacteria | 9356 |
| 672 | Ga0207651_10006459 | 3300025960 | Bacteria | 6140 |
| 673 | Ga0207651_10031705 | 3300025960 | Bacteria | 3383 |
| 674 | Ga0207651_10046413 | 3300025960 | Bacteria | 2921 |
| 675 | Ga0207651_10130259 | 3300025960 | Bacteria | 1924 |
| 676 | Ga0207651_10278674 | 3300025960 | Bacteria | 1381 |
| 677 | Ga0207712_10459007 | 3300025961 | Bacteria | 1082 |
| 678 | Ga0207668_10002554 | 3300025972 | Bacteria | 10635 |
| 679 | Ga0207668_10020730 | 3300025972 | Bacteria | 4183 |
| 680 | Ga0207668_10021360 | 3300025972 | Bacteria | 4128 |
| 681 | Ga0207668_10292192 | 3300025972 | Bacteria | 1341 |
| 682 | Ga0207668_10394978 | 3300025972 | Bacteria | 1168 |
| 683 | Ga0207668_10424551 | 3300025972 | Bacteria | 1129 |
| 684 | Ga0207668_10642539 | 3300025972 | Bacteria | 928 |
| 685 | Ga0207668_10983613 | 3300025972 | Bacteria | 753 |
| 686 | Ga0207640_10018886 | 3300025981 | Bacteria | 4060 |
| 687 | Ga0207640_10026417 | 3300025981 | Bacteria | 3525 |
| 688 | Ga0207640_10031013 | 3300025981 | Bacteria | 3299 |
| 689 | Ga0207640_10079950 | 3300025981 | Bacteria | 2230 |
| 690 | Ga0207640_10107359 | 3300025981 | Bacteria | 1971 |
| 691 | Ga0207640_10264209 | 3300025981 | Bacteria | 1343 |
| 692 | Ga0207640_10931322 | 3300025981 | Bacteria | 761 |
| 693 | Ga0207658_10001272 | 3300025986 | Bacteria | 19944 |
| 694 | Ga0207658_10006610 | 3300025986 | Bacteria | 7902 |
| 695 | Ga0207658_10018261 | 3300025986 | Bacteria | 4839 |
| 696 | Ga0207658_10031594 | 3300025986 | Bacteria | 3761 |
| 697 | Ga0207658_10043012 | 3300025986 | Bacteria | 3281 |
| 698 | Ga0207658_10086331 | 3300025986 | Bacteria | 2420 |
| 699 | Ga0207658_10240136 | 3300025986 | Bacteria | 1534 |
| 700 | Ga0207658_10272447 | 3300025986 | Bacteria | 1447 |
| 701 | Ga0207677_10000253 | 3300026023 | Bacteria | 41332 |
| 702 | Ga0207677_10007009 | 3300026023 | Bacteria | 6201 |
| 703 | Ga0207677_10008530 | 3300026023 | Bacteria | 5732 |
| 704 | Ga0207677_10029996 | 3300026023 | Bacteria | 3465 |
| 705 | Ga0207677_10117961 | 3300026023 | Bacteria | 1990 |
| 706 | Ga0207677_11268081 | 3300026023 | Bacteria | 676 |
| 707 | Ga0207703_10000517 | 3300026035 | Bacteria | 39928 |
| 708 | Ga0207703_10002267 | 3300026035 | Bacteria | 16814 |
| 709 | Ga0207703_10011900 | 3300026035 | Bacteria | 6776 |
| 710 | Ga0207703_10601799 | 3300026035 | Bacteria | 1040 |
| 711 | Ga0207703_11220166 | 3300026035 | Bacteria | 723 |
| 712 | Ga0207639_10068248 | 3300026041 | Bacteria | 2770 |
| 713 | Ga0207639_10330041 | 3300026041 | Bacteria | 1357 |
| 714 | Ga0207639_10835911 | 3300026041 | Bacteria | 859 |
| 715 | Ga0207678_10013575 | 3300026067 | Bacteria | 7152 |
| 716 | Ga0207678_10092965 | 3300026067 | Bacteria | 2577 |
| 717 | Ga0207678_10125132 | 3300026067 | Bacteria | 2193 |
| 718 | Ga0207678_10199353 | 3300026067 | Bacteria | 1711 |
| 719 | Ga0207678_10202123 | 3300026067 | Bacteria | 1699 |
| 720 | Ga0207678_10274939 | 3300026067 | Bacteria | 1445 |
| 721 | Ga0207678_10282617 | 3300026067 | Bacteria | 1424 |
| 722 | Ga0207678_10634197 | 3300026067 | Bacteria | 938 |
| 723 | Ga0207708_10035511 | 3300026075 | Bacteria | 3793 |
| 724 | Ga0207708_10044106 | 3300026075 | Bacteria | 3398 |
| 725 | Ga0207702_10009250 | 3300026078 | Bacteria | 8280 |
| 726 | Ga0207702_10009791 | 3300026078 | Bacteria | 8039 |
| 727 | Ga0207702_10020077 | 3300026078 | Bacteria | 5536 |
| 728 | Ga0207702_10053604 | 3300026078 | Bacteria | 3415 |
| 729 | Ga0207702_10287372 | 3300026078 | Bacteria | 1557 |
| 730 | Ga0207702_10377091 | 3300026078 | Bacteria | 1363 |
| 731 | Ga0207641_10000374 | 3300026088 | Bacteria | 53088 |
| 732 | Ga0207641_10000610 | 3300026088 | Bacteria | 39160 |
| 733 | Ga0207641_10015912 | 3300026088 | Bacteria | 6160 |
| 734 | Ga0207641_10065192 | 3300026088 | Bacteria | 3115 |
| 735 | Ga0207641_10109938 | 3300026088 | Bacteria | 2442 |
| 736 | Ga0207641_10143071 | 3300026088 | Bacteria | 2160 |
| 737 | Ga0207641_10288356 | 3300026088 | Bacteria | 1547 |
| 738 | Ga0207641_10404453 | 3300026088 | Bacteria | 1311 |
| 739 | Ga0207641_10548303 | 3300026088 | Bacteria | 1127 |
| 740 | Ga0207641_10690017 | 3300026088 | Bacteria | 1005 |
| 741 | Ga0207648_10000523 | 3300026089 | Bacteria | 42961 |
| 742 | Ga0207648_10002934 | 3300026089 | Bacteria | 18047 |
| 743 | Ga0207648_10006980 | 3300026089 | Bacteria | 11171 |
| 744 | Ga0207648_10029738 | 3300026089 | Bacteria | 4844 |
| 745 | Ga0207648_10038007 | 3300026089 | Bacteria | 4237 |
| 746 | Ga0207648_10147528 | 3300026089 | Bacteria | 2075 |
| 747 | Ga0207648_10262650 | 3300026089 | Bacteria | 1541 |
| 748 | Ga0207676_10000167 | 3300026095 | Bacteria | 57507 |
| 749 | Ga0207676_10017764 | 3300026095 | Bacteria | 5161 |
| 750 | Ga0207676_10031925 | 3300026095 | Bacteria | 3963 |
| 751 | Ga0207676_10065863 | 3300026095 | Bacteria | 2886 |
| 752 | Ga0207676_10142805 | 3300026095 | Bacteria | 2052 |
| 753 | Ga0207674_10000118 | 3300026116 | Bacteria | 92408 |
| 754 | Ga0207674_10001292 | 3300026116 | Bacteria | 32705 |
| 755 | Ga0207674_10004098 | 3300026116 | Bacteria | 17651 |
| 756 | Ga0207674_10005648 | 3300026116 | Bacteria | 14829 |
| 757 | Ga0207674_10157640 | 3300026116 | Bacteria | 2225 |
| 758 | Ga0207675_100000635 | 3300026118 | Bacteria | 34445 |
| 759 | Ga0207675_100002219 | 3300026118 | Bacteria | 19296 |
| 760 | Ga0207675_100083843 | 3300026118 | Bacteria | 2990 |
| 761 | Ga0207675_100086258 | 3300026118 | Bacteria | 2948 |
| 762 | Ga0207675_100222891 | 3300026118 | Bacteria | 1817 |
| 763 | Ga0207675_100429926 | 3300026118 | Bacteria | 1305 |
| 764 | Ga0207675_100784130 | 3300026118 | Bacteria | 966 |
| 765 | Ga0207683_10000476 | 3300026121 | Bacteria | 37318 |
| 766 | Ga0207683_10000672 | 3300026121 | Bacteria | 31425 |
| 767 | Ga0207683_10000965 | 3300026121 | Bacteria | 26325 |
| 768 | Ga0207683_10002112 | 3300026121 | Bacteria | 17478 |
| 769 | Ga0207683_10007275 | 3300026121 | Bacteria | 9486 |
| 770 | Ga0207683_10025522 | 3300026121 | Bacteria | 5099 |
| 771 | Ga0207683_10325511 | 3300026121 | Bacteria | 1408 |
| 772 | Ga0207683_10511714 | 3300026121 | Bacteria | 1109 |
| 773 | Ga0207698_10005967 | 3300026142 | Bacteria | 7569 |
| 774 | Ga0207698_10046956 | 3300026142 | Bacteria | 3266 |
| 775 | Ga0207698_10131243 | 3300026142 | Bacteria | 2141 |
| 776 | Ga0207698_10131938 | 3300026142 | Bacteria | 2136 |
| 777 | Ga0207698_10152720 | 3300026142 | Bacteria | 2007 |
| 778 | Ga0207698_10166207 | 3300026142 | Bacteria | 1936 |
| 779 | Ga0207698_10209756 | 3300026142 | Bacteria | 1752 |
| 780 | Ga0207698_10541797 | 3300026142 | Bacteria | 1139 |
| 781 | Ga0207698_10948722 | 3300026142 | Bacteria | 869 |
| 782 | Ga0209982_1042253 | 3300027552 | Bacteria | 728 |
| 783 | Ga0209970_1035631 | 3300027614 | Bacteria | 875 |
| 784 | Ga0210002_1017004 | 3300027617 | Bacteria | 1155 |
| 785 | Ga0209983_1035371 | 3300027665 | Bacteria | 1071 |
| 786 | Ga0209971_1028050 | 3300027682 | Bacteria | 1347 |
| 787 | Ga0209998_10002560 | 3300027717 | Bacteria | 4131 |
| 788 | Ga0209974_10004113 | 3300027876 | Bacteria | 5198 |
| 789 | Ga0209974_10015442 | 3300027876 | Bacteria | 2536 |
| 790 | Ga0207428_10130264 | 3300027907 | Bacteria | 1925 |
| 791 | Ga0268266_10005004 | 3300028379 | Bacteria | 12519 |
| 792 | Ga0268266_10005562 | 3300028379 | Bacteria | 11729 |
| 793 | Ga0268266_10128475 | 3300028379 | Bacteria | 2264 |
| 794 | Ga0268266_10201074 | 3300028379 | Bacteria | 1823 |
| 795 | Ga0268266_10277511 | 3300028379 | Bacteria | 1557 |
| 796 | Ga0268265_10312345 | 3300028380 | Bacteria | 1420 |
| 797 | Ga0268265_10325203 | 3300028380 | Bacteria | 1394 |
| 798 | Ga0268265_10428092 | 3300028380 | Bacteria | 1230 |
| 799 | Ga0268265_10895298 | 3300028380 | Bacteria | 871 |
| 800 | Ga0268264_10001027 | 3300028381 | Bacteria | 28045 |
| 801 | Ga0268264_10002850 | 3300028381 | Bacteria | 15079 |
| 802 | Ga0268264_10007025 | 3300028381 | Bacteria | 9444 |
| 803 | Ga0268264_10019003 | 3300028381 | Bacteria | 5618 |
| 804 | Ga0268264_10033881 | 3300028381 | Bacteria | 4198 |
| 805 | Ga0268264_10102882 | 3300028381 | Bacteria | 2486 |
| 806 | Ga0268264_10349600 | 3300028381 | Bacteria | 1407 |
| 807 | Ga0268264_10424774 | 3300028381 | Bacteria | 1283 |
| 808 | Ga0268264_10565830 | 3300028381 | Bacteria | 1117 |
| 809 | Ga0307408_100007603 | 3300031548 | Bacteria | 7167 |
| 810 | Ga0307405_10668172 | 3300031731 | Bacteria | 856 |
| 811 | Ga0307413_10003503 | 3300031824 | Bacteria | 6617 |
| 812 | Ga0307413_10011768 | 3300031824 | Bacteria | 4320 |
| 813 | Ga0307410_10002137 | 3300031852 | Bacteria | 9390 |
| 814 | Ga0307410_10009379 | 3300031852 | Bacteria | 5486 |
| 815 | Ga0307406_10009643 | 3300031901 | Bacteria | 5426 |
| 816 | Ga0307406_10009681 | 3300031901 | Bacteria | 5417 |
| 817 | Ga0307407_10003844 | 3300031903 | Bacteria | 6256 |
| 818 | Ga0307407_10005873 | 3300031903 | Bacteria | 5383 |
| 819 | Ga0307412_10067247 | 3300031911 | Bacteria | 2432 |
| 820 | Ga0307409_100000504 | 3300031995 | Bacteria | 16863 |
| 821 | Ga0307409_100004202 | 3300031995 | Bacteria | 8026 |
| 822 | Ga0307416_100385982 | 3300032002 | Bacteria | 1432 |
| 823 | Ga0307416_101673955 | 3300032002 | Unclassified | 741 |
| 824 | Ga0307414_10819809 | 3300032004 | Bacteria | 849 |
| 825 | Ga0307411_10004100 | 3300032005 | Bacteria | 6910 |
| 826 | Ga0307415_100002092 | 3300032126 | Bacteria | 9872 |
| 827 | Ga0307415_100644037 | 3300032126 | Bacteria | 949 |
| 828 | Ga0316583_10000595 | 3300032133 | Bacteria | 10985 |
| 829 | Ga0316583_10074828 | 3300032133 | Bacteria | 1184 |
| 830 | Ga0373926_0055058 | 3300035083 | Bacteria | 1441 |
| 831 | Ga0373926_0061626 | 3300035083 | Bacteria | 1368 |
| 832 | Ga0373934_0004862 | 3300035086 | Bacteria | 4970 |
| 833 | Ga0373944_0098711 | 3300035089 | Bacteria | 984 |
| 834 | Ga0373923_0001149 | 3300035111 | Bacteria | 7344 |
| 835 | Ga0373936_0047524 | 3300035113 | Bacteria | 1731 |
| 836 | Ga0373941_0260880 | 3300035115 | Bacteria | 680 |
| 837 | Ga0373945_0032663 | 3300035116 | Bacteria | 1845 |
| 838 | Ga0373945_0059662 | 3300035116 | Bacteria | 1421 |
| 839 | Ga0373953_0005084 | 3300035117 | Bacteria | 4244 |
| 840 | Ga0373954_0000524 | 3300035118 | Bacteria | 14404 |
| 841 | Ga0373954_0101671 | 3300035118 | Bacteria | 1387 |
| 842 | Ga0373956_0084905 | 3300035119 | Bacteria | 1455 |
| 843 | Ga0373957_0012776 | 3300035120 | Bacteria | 2833 |
| 844 | Ga0373957_0174728 | 3300035120 | Bacteria | 889 |
| 845 | Ga0373943_0014005 | 3300035170 | Bacteria | 3626 |
| 846 | Ga0373955_0065739 | 3300035172 | Unclassified | 2014 |
| 847 | Ga0373924_0063792 | 3300035410 | Bacteria | 1545 |
| 848 | Ga0373931_0071372 | 3300035691 | Bacteria | 1897 |
| 849 | Ga0373935_0011090 | 3300035692 | Bacteria | 5415 |
| 850 | Ga0373935_0074473 | 3300035692 | Bacteria | 2195 |
| 851 | Ga0373927_0010847 | 3300035695 | Bacteria | 6070 |
| 852 | Ga0373927_0020370 | 3300035695 | Bacteria | 4350 |
| 853 | Ga0373927_0060319 | 3300035695 | Bacteria | 2454 |
| 854 | Ga0373927_0183814 | 3300035695 | Bacteria | 1371 |
| 855 | Ga0373927_0186810 | 3300035695 | Bacteria | 1359 |
| 856 | Ga0373933_0011110 | 3300035724 | Bacteria | 4950 |
| 857 | Ga0373933_0210114 | 3300035724 | Unclassified | 1247 |
| 858 | Ga0373947_0011737 | 3300035725 | Bacteria | 5020 |
| 859 | Ga0373947_0013335 | 3300035725 | Bacteria | 4709 |
| 860 | Ga0373937_0002150 | 3300036401 | Bacteria | 16502 |
| 861 | Ga0373937_0015112 | 3300036401 | Bacteria | 6820 |
| 862 | Ga0373937_0094946 | 3300036401 | Bacteria | 2765 |
| 863 | Ga0373937_1298888 | 3300036401 | Bacteria | 676 |
| 864 | Ga0373925_0018839 | 3300037068 | Bacteria | 5018 |
| 865 | Ga0373925_0064487 | 3300037068 | Bacteria | 2757 |
| 866 | Ga0373925_0269358 | 3300037068 | Bacteria | 1370 |
| 867 | Ga0373925_0286095 | 3300037068 | Bacteria | 1328 |
| 868 | Ga0395900_1145339 | 3300037418 | Bacteria | 694 |
| 869 | Ga0395898_0548833 | 3300037466 | Bacteria | 1098 |
| 870 | Ga0395905_1495877 | 3300037471 | Bacteria | 579 |
| 871 | Ga0395901_0563452 | 3300038443 | Bacteria | 1153 |
| 872 | Ga0436365_0042302 | 3300039437 | Bacteria | 2846 |
| 873 | Ga0451793_0118162 | 3300041452 | Bacteria | 687 |
| 874 | Ga0451845_0443829 | 3300041501 | Bacteria | 744 |
| 875 | Ga0451577_0046785 | 3300042876 | Bacteria | 3870 |
| 876 | Ga0466972_0000519 | 3300044658 | Bacteria | 19047 |
| 877 | Ga0466965_0104298 | 3300044683 | Bacteria | 1452 |
| 878 | Ga0466961_0057086 | 3300044693 | Bacteria | 2486 |
| 879 | Ga0453684_0518400 | 3300044712 | Bacteria | 1317 |
| 880 | Ga0466971_0297144 | 3300044719 | Bacteria | 775 |
| 881 | Ga0451576_0309025 | 3300045051 | Bacteria | 1654 |
| 882 | Ga0451576_0735579 | 3300045051 | Bacteria | 1036 |
| 883 | Ga0466958_0064880 | 3300045836 | Bacteria | 2228 |
| 884 | Ga0466967_0204818 | 3300045976 | Bacteria | 1870 |
| 885 | Ga0466967_1035178 | 3300045976 | Bacteria | 818 |
| 886 | Ga0495629_0113062 | 3300046459 | Bacteria | 1892 |
| 887 | Ga0495580_0046517 | 3300046472 | Bacteria | 3078 |
| 888 | Ga0495580_0071403 | 3300046472 | Bacteria | 2425 |
| 889 | Ga0495580_0146534 | 3300046472 | Bacteria | 1636 |
| 890 | Ga0495582_0006109 | 3300046473 | Bacteria | 6703 |
| 891 | Ga0495662_0008769 | 3300046476 | Bacteria | 4974 |
| 892 | Ga0495662_0196924 | 3300046476 | Bacteria | 993 |
| 893 | Ga0495664_0021456 | 3300046477 | Bacteria | 3731 |
| 894 | Ga0495594_0022970 | 3300046499 | Bacteria | 3340 |
| 895 | Ga0495608_0126558 | 3300046511 | Unclassified | 1636 |
| 896 | Ga0495618_0172528 | 3300046514 | Bacteria | 1376 |
| 897 | Ga0495628_0170594 | 3300046516 | Bacteria | 1650 |
| 898 | Ga0495665_0104985 | 3300046531 | Bacteria | 1482 |
| 899 | Ga0495621_0001573 | 3300046539 | Bacteria | 5945 |
| 900 | Ga0495667_0008647 | 3300046559 | Bacteria | 6914 |
| 901 | Ga0495667_0321257 | 3300046559 | Bacteria | 979 |
| 902 | Ga0495635_0147009 | 3300046663 | Bacteria | 1604 |
| 903 | Ga0495659_0019322 | 3300046664 | Bacteria | 2280 |
| 904 | Ga0495657_0000805 | 3300046675 | Bacteria | 27819 |
| 905 | Ga0495623_0196988 | 3300046679 | Bacteria | 1160 |
| 906 | Ga0495647_0001796 | 3300046681 | Bacteria | 6630 |
| 907 | Ga0495613_0008532 | 3300046689 | Bacteria | 7605 |
| 908 | Ga0495613_0072198 | 3300046689 | Bacteria | 2516 |
| 909 | Ga0495600_0221406 | 3300046809 | Bacteria | 1210 |
| 910 | Ga0495581_0070175 | 3300047315 | Bacteria | 2026 |
| 911 | Ga0495604_0187948 | 3300047317 | Bacteria | 1441 |
| 912 | Ga0495674_0024725 | 3300047319 | Bacteria | 5514 |
| 913 | Ga0495680_0119784 | 3300047322 | Bacteria | 1944 |
| 914 | Ga0495684_0010210 | 3300047471 | Bacteria | 7264 |
| 915 | Ga0495684_0430179 | 3300047471 | Bacteria | 921 |
| 916 | Ga0496100_0265577 | 3300048903 | Bacteria | 1274 |
| 917 | Ga0496100_0306145 | 3300048903 | Bacteria | 1190 |
| 918 | Ga0496101_0012612 | 3300048904 | Bacteria | 5644 |
| 919 | Ga0496101_0197531 | 3300048904 | Bacteria | 1554 |
| 920 | Ga0496101_0377397 | 3300048904 | Bacteria | 1115 |
| 921 | Ga0496101_0384185 | 3300048904 | Bacteria | 1105 |
| 922 | Ga0496102_0004620 | 3300048905 | Bacteria | 11651 |
| 923 | Ga0496102_0052668 | 3300048905 | Bacteria | 3709 |
| 924 | Ga0496102_0555021 | 3300048905 | Bacteria | 1071 |
| 925 | Ga0496102_0686043 | 3300048905 | Bacteria | 947 |
| 926 | Ga0496103_0019475 | 3300048906 | Bacteria | 4076 |
| 927 | Ga0496103_0039856 | 3300048906 | Bacteria | 2887 |
| 928 | Ga0496103_0211033 | 3300048906 | Bacteria | 1249 |
| 929 | Ga0496104_0002793 | 3300048907 | Bacteria | 15045 |
| 930 | Ga0496104_0021708 | 3300048907 | Bacteria | 5897 |
| 931 | Ga0496105_0022747 | 3300048908 | Bacteria | 5078 |
| 932 | Ga0496105_0055654 | 3300048908 | Bacteria | 3266 |
| 933 | Ga0496105_0384780 | 3300048908 | Bacteria | 1116 |
| 934 | Ga0496106_0011048 | 3300048909 | Bacteria | 6675 |
| 935 | Ga0496106_0038445 | 3300048909 | Bacteria | 3581 |
| 936 | Ga0496106_0040940 | 3300048909 | Bacteria | 3471 |
| 937 | Ga0496106_0169315 | 3300048909 | Bacteria | 1731 |
| 938 | Ga0496107_0045692 | 3300048910 | Bacteria | 3151 |
| 939 | Ga0496107_0083807 | 3300048910 | Bacteria | 2325 |
| 940 | Ga0496107_0126064 | 3300048910 | Bacteria | 1888 |
| 941 | Ga0496108_0031541 | 3300048911 | Bacteria | 4397 |
| 942 | Ga0496108_0134527 | 3300048911 | Bacteria | 2126 |
| 943 | Ga0496108_0205922 | 3300048911 | Bacteria | 1707 |
| 944 | Ga0496109_0006393 | 3300048912 | Bacteria | 9920 |
| 945 | Ga0496109_0046869 | 3300048912 | Bacteria | 3927 |
| 946 | Ga0496109_0134673 | 3300048912 | Bacteria | 2308 |
| 947 | Ga0496109_0711188 | 3300048912 | Bacteria | 942 |
| 948 | Ga0496109_1627422 | 3300048912 | Bacteria | 580 |
| 949 | Ga0496110_0007678 | 3300048913 | Bacteria | 8630 |
| 950 | Ga0496110_0209853 | 3300048913 | Bacteria | 1770 |
| 951 | Ga0496111_0499194 | 3300048914 | Bacteria | 896 |
| 952 | Ga0496112_0001041 | 3300048915 | Bacteria | 20441 |
| 953 | Ga0496112_0650621 | 3300048915 | Bacteria | 984 |
| 954 | Ga0496112_1027392 | 3300048915 | Bacteria | 744 |
| 955 | Ga0496113_0280626 | 3300048916 | Bacteria | 1332 |
| 956 | Ga0496114_0050417 | 3300048917 | Bacteria | 3464 |
| 957 | Ga0496114_0082369 | 3300048917 | Bacteria | 2720 |
| 958 | Ga0496114_0191517 | 3300048917 | Bacteria | 1789 |
| 959 | Ga0496115_0054993 | 3300048918 | Bacteria | 3197 |
| 960 | Ga0501036_0282528 | 3300049572 | Bacteria | 1389 |
| 961 | Ga0501037_0005424 | 3300049573 | Bacteria | 9286 |
| 962 | Ga0501038_0001493 | 3300049574 | Bacteria | 21546 |
| 963 | Ga0501038_0301801 | 3300049574 | Bacteria | 1257 |
| 964 | Ga0501039_0738135 | 3300049575 | Bacteria | 769 |
| 965 | Ga0501067_0181537 | 3300049583 | Bacteria | 1172 |
| 966 | Ga0501070_0008712 | 3300049586 | Bacteria | 8578 |
| 967 | Ga0501074_0015107 | 3300049590 | Bacteria | 5615 |
| 968 | Ga0501080_0017703 | 3300049742 | Bacteria | 6593 |
| 969 | nmdc:mga05p37_76448_c1 | 3300050507 | Bacteria | 4122 |
| 970 | nmdc:mga0qj67_635875_c1 | 3300050509 | Bacteria | 852 |
| 971 | nmdc:mga08y16_73941_c1 | 3300050511 | Bacteria | 3551 |
| 972 | nmdc:mga0n895_226561_c1 | 3300050512 | Bacteria | 1897 |
| 973 | nmdc:mga0n895_38129_c1 | 3300050512 | Bacteria | 4654 |
| 974 | nmdc:mga0n895_402025_c1 | 3300050512 | Bacteria | 1385 |
| 975 | nmdc:mga0n895_590624_c1 | 3300050512 | Bacteria | 1114 |
| 976 | nmdc:mga0rr50_10098_c1 | 3300050513 | Bacteria | 5973 |
| 977 | nmdc:mga08x19_114952_c1 | 3300050514 | Bacteria | 1798 |
| 978 | nmdc:mga0a205_120325_c1 | 3300050515 | Bacteria | 2525 |
| 979 | Ga0495601_0356142 | 3300053077 | Bacteria | 951 |
| 980 | Ga0495612_0030881 | 3300053078 | Bacteria | 2159 |
| 981 | Ga0495595_0034147 | 3300053084 | Bacteria | 2300 |
| 982 | Ga0495595_0279289 | 3300053084 | Bacteria | 838 |
| 983 | Ga0495619_0038259 | 3300053085 | Bacteria | 3129 |
| 984 | Ga0495619_0065195 | 3300053085 | Bacteria | 2429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100429926 | Ga0207675_1004299262 | 164 |
| 2 | 3300025912 | Ga0207707_10270430 | Ga0207707_102704302 | 165 |
| 3 | 3300005344 | Ga0070661_100940507 | Ga0070661_1009405071 | 173 |
| 4 | 3300032002 | Ga0307416_101673955 | Ga0307416_1016739551 | 173 |
| 5 | 3300005336 | Ga0070680_100322877 | Ga0070680_1003228772 | 174 |
| 6 | 3300005341 | Ga0070691_10137834 | Ga0070691_101378342 | 174 |
| 7 | 3300005344 | Ga0070661_100176031 | Ga0070661_1001760313 | 174 |
| 8 | 3300005366 | Ga0070659_100004339 | Ga0070659_10000433910 | 174 |
| 9 | 3300005434 | Ga0070709_10222483 | Ga0070709_102224832 | 174 |
| 10 | 3300005435 | Ga0070714_100015237 | Ga0070714_1000152373 | 174 |
| 11 | 3300005530 | Ga0070679_100471605 | Ga0070679_1004716052 | 174 |
| 12 | 3300005549 | Ga0070704_100360052 | Ga0070704_1003600521 | 174 |
| 13 | 3300005564 | Ga0070664_100005952 | Ga0070664_1000059528 | 174 |
| 14 | 3300005578 | Ga0068854_100003585 | Ga0068854_1000035853 | 174 |
| 15 | 3300006237 | Ga0097621_100266181 | Ga0097621_1002661812 | 174 |
| 16 | 3300006358 | Ga0068871_100022355 | Ga0068871_1000223553 | 174 |
| 17 | 3300009093 | Ga0105240_10036989 | Ga0105240_100369898 | 174 |
| 18 | 3300009174 | Ga0105241_10014237 | Ga0105241_100142377 | 174 |
| 19 | 3300009551 | Ga0105238_10027188 | Ga0105238_100271883 | 174 |
| 20 | 3300010375 | Ga0105239_10691721 | Ga0105239_106917212 | 174 |
| 21 | 3300013100 | Ga0157373_10001663 | Ga0157373_100016639 | 174 |
| 22 | 3300013104 | Ga0157370_10580363 | Ga0157370_105803631 | 174 |
| 23 | 3300013296 | Ga0157374_11147403 | Ga0157374_111474032 | 174 |
| 24 | 3300014325 | Ga0163163_10010956 | Ga0163163_100109566 | 174 |
| 25 | 3300014969 | Ga0157376_11313371 | Ga0157376_113133711 | 174 |
| 26 | 3300020081 | Ga0206354_11192541 | Ga0206354_111925412 | 174 |
| 27 | 3300025917 | Ga0207660_10276195 | Ga0207660_102761952 | 174 |
| 28 | 3300025919 | Ga0207657_10005934 | Ga0207657_1000593411 | 174 |
| 29 | 3300025920 | Ga0207649_10254089 | Ga0207649_102540892 | 174 |
| 30 | 3300025921 | Ga0207652_10007921 | Ga0207652_100079212 | 174 |
| 31 | 3300025924 | Ga0207694_10235054 | Ga0207694_102350543 | 174 |
| 32 | 3300025929 | Ga0207664_10080459 | Ga0207664_100804592 | 174 |
| 33 | 3300025944 | Ga0207661_10277832 | Ga0207661_102778322 | 174 |
| 34 | 3300026116 | Ga0207674_10001292 | Ga0207674_1000129210 | 174 |
| 35 | 3300026142 | Ga0207698_10948722 | Ga0207698_109487222 | 174 |
| 36 | 3300035172 | Ga0373955_0065739 | Ga0373955_0065739_654_1187 | 174 |
| 37 | 3300035692 | Ga0373935_0074473 | Ga0373935_0074473_1605_2129 | 174 |
| 38 | 3300035695 | Ga0373927_0010847 | Ga0373927_0010847_3429_3953 | 174 |
| 39 | 3300035724 | Ga0373933_0210114 | Ga0373933_0210114_405_938 | 174 |
| 40 | 3300036401 | Ga0373937_0002150 | Ga0373937_0002150_6390_6923 | 174 |
| 41 | 3300036401 | Ga0373937_1298888 | Ga0373937_1298888_127_651 | 174 |
| 42 | 3300037068 | Ga0373925_0064487 | Ga0373925_0064487_1175_1699 | 174 |
| 43 | 3300037418 | Ga0395900_1145339 | Ga0395900_1145339_84_608 | 174 |
| 44 | 3300037466 | Ga0395898_0548833 | Ga0395898_0548833_44_568 | 174 |
| 45 | 3300038443 | Ga0395901_0563452 | Ga0395901_0563452_231_755 | 174 |
| 46 | 3300046476 | Ga0495662_0196924 | Ga0495662_0196924_188_730 | 174 |
| 47 | 3300046511 | Ga0495608_0126558 | Ga0495608_0126558_432_965 | 174 |
| 48 | 3300046514 | Ga0495618_0172528 | Ga0495618_0172528_584_1126 | 174 |
| 49 | 3300046559 | Ga0495667_0008647 | Ga0495667_0008647_4310_4843 | 174 |
| 50 | 3300046675 | Ga0495657_0000805 | Ga0495657_0000805_1986_2519 | 174 |
| 51 | 3300046689 | Ga0495613_0072198 | Ga0495613_0072198_1421_1963 | 174 |
| 52 | 3300047319 | Ga0495674_0024725 | Ga0495674_0024725_2387_2929 | 174 |
| 53 | 3300047471 | Ga0495684_0430179 | Ga0495684_0430179_355_897 | 174 |
| 54 | 3300048906 | Ga0496103_0211033 | Ga0496103_0211033_630_1154 | 174 |
| 55 | 3300049575 | Ga0501039_0738135 | Ga0501039_0738135_109_633 | 174 |
| 56 | 3300053085 | Ga0495619_0038259 | Ga0495619_0038259_672_1205 | 174 |
| 57 | 3300005339 | Ga0070660_100007488 | Ga0070660_1000074883 | 175 |
| 58 | 3300005344 | Ga0070661_100059703 | Ga0070661_1000597032 | 175 |
| 59 | 3300005366 | Ga0070659_100896040 | Ga0070659_1008960401 | 175 |
| 60 | 3300005445 | Ga0070708_100132128 | Ga0070708_1001321282 | 175 |
| 61 | 3300005539 | Ga0068853_100237163 | Ga0068853_1002371632 | 175 |
| 62 | 3300006175 | Ga0070712_100691315 | Ga0070712_1006913151 | 175 |
| 63 | 3300013104 | Ga0157370_10028427 | Ga0157370_100284272 | 175 |
| 64 | 3300013105 | Ga0157369_10825111 | Ga0157369_108251112 | 175 |
| 65 | 3300025917 | Ga0207660_10358902 | Ga0207660_103589022 | 175 |
| 66 | 3300025919 | Ga0207657_10005254 | Ga0207657_1000525415 | 175 |
| 67 | 3300025919 | Ga0207657_10144962 | Ga0207657_101449622 | 175 |
| 68 | 3300026118 | Ga0207675_100083843 | Ga0207675_1000838432 | 175 |
| 69 | 3300032133 | Ga0316583_10000595 | Ga0316583_100005957 | 175 |
| 70 | 3300032133 | Ga0316583_10074828 | Ga0316583_100748282 | 175 |
| 71 | 3300037068 | Ga0373925_0269358 | Ga0373925_0269358_825_1352 | 175 |
| 72 | 3300049573 | Ga0501037_0005424 | Ga0501037_0005424_1414_1950 | 175 |
| 73 | 3300049574 | Ga0501038_0001493 | Ga0501038_0001493_11575_12111 | 175 |
| 74 | 3300049574 | Ga0501038_0301801 | Ga0501038_0301801_572_1108 | 175 |
| 75 | 3300049586 | Ga0501070_0008712 | Ga0501070_0008712_2805_3338 | 175 |
| 76 | 3300049590 | Ga0501074_0015107 | Ga0501074_0015107_4603_5139 | 175 |
| 77 | 3300049742 | Ga0501080_0017703 | Ga0501080_0017703_1777_2313 | 175 |
| 78 | 3300005329 | Ga0070683_100103084 | Ga0070683_1001030842 | 176 |
| 79 | 3300005331 | Ga0070670_100033776 | Ga0070670_1000337764 | 176 |
| 80 | 3300005334 | Ga0068869_100145204 | Ga0068869_1001452041 | 176 |
| 81 | 3300005335 | Ga0070666_10003246 | Ga0070666_1000324610 | 176 |
| 82 | 3300005336 | Ga0070680_100027477 | Ga0070680_1000274772 | 176 |
| 83 | 3300005337 | Ga0070682_100021911 | Ga0070682_1000219114 | 176 |
| 84 | 3300005337 | Ga0070682_100158228 | Ga0070682_1001582282 | 176 |
| 85 | 3300005338 | Ga0068868_100002572 | Ga0068868_1000025725 | 176 |
| 86 | 3300005338 | Ga0068868_100198409 | Ga0068868_1001984092 | 176 |
| 87 | 3300005339 | Ga0070660_100000940 | Ga0070660_1000009407 | 176 |
| 88 | 3300005339 | Ga0070660_100486734 | Ga0070660_1004867342 | 176 |
| 89 | 3300005341 | Ga0070691_10061770 | Ga0070691_100617702 | 176 |
| 90 | 3300005341 | Ga0070691_10223564 | Ga0070691_102235642 | 176 |
| 91 | 3300005343 | Ga0070687_100021747 | Ga0070687_1000217473 | 176 |
| 92 | 3300005344 | Ga0070661_100002505 | Ga0070661_1000025055 | 176 |
| 93 | 3300005345 | Ga0070692_10016880 | Ga0070692_100168804 | 176 |
| 94 | 3300005355 | Ga0070671_100010442 | Ga0070671_1000104425 | 176 |
| 95 | 3300005356 | Ga0070674_100060097 | Ga0070674_1000600972 | 176 |
| 96 | 3300005364 | Ga0070673_100005216 | Ga0070673_1000052166 | 176 |
| 97 | 3300005365 | Ga0070688_100008334 | Ga0070688_1000083345 | 176 |
| 98 | 3300005366 | Ga0070659_100016845 | Ga0070659_1000168455 | 176 |
| 99 | 3300005366 | Ga0070659_100836738 | Ga0070659_1008367381 | 176 |
| 100 | 3300005435 | Ga0070714_100689497 | Ga0070714_1006894972 | 176 |
| 101 | 3300005436 | Ga0070713_100009864 | Ga0070713_1000098646 | 176 |
| 102 | 3300005437 | Ga0070710_10013007 | Ga0070710_100130073 | 176 |
| 103 | 3300005438 | Ga0070701_10198336 | Ga0070701_101983362 | 176 |
| 104 | 3300005439 | Ga0070711_100000893 | Ga0070711_10000089313 | 176 |
| 105 | 3300005439 | Ga0070711_100610761 | Ga0070711_1006107612 | 176 |
| 106 | 3300005445 | Ga0070708_100039252 | Ga0070708_1000392523 | 176 |
| 107 | 3300005445 | Ga0070708_100960367 | Ga0070708_1009603672 | 176 |
| 108 | 3300005455 | Ga0070663_100373992 | Ga0070663_1003739922 | 176 |
| 109 | 3300005456 | Ga0070678_100000107 | Ga0070678_1000001074 | 176 |
| 110 | 3300005457 | Ga0070662_100027223 | Ga0070662_1000272232 | 176 |
| 111 | 3300005458 | Ga0070681_10023269 | Ga0070681_100232695 | 176 |
| 112 | 3300005459 | Ga0068867_100022440 | Ga0068867_1000224405 | 176 |
| 113 | 3300005466 | Ga0070685_10000221 | Ga0070685_100002218 | 176 |
| 114 | 3300005467 | Ga0070706_100168852 | Ga0070706_1001688522 | 176 |
| 115 | 3300005467 | Ga0070706_100221626 | Ga0070706_1002216262 | 176 |
| 116 | 3300005467 | Ga0070706_100377675 | Ga0070706_1003776752 | 176 |
| 117 | 3300005468 | Ga0070707_100231214 | Ga0070707_1002312142 | 176 |
| 118 | 3300005468 | Ga0070707_100275861 | Ga0070707_1002758612 | 176 |
| 119 | 3300005471 | Ga0070698_100265589 | Ga0070698_1002655893 | 176 |
| 120 | 3300005518 | Ga0070699_100063919 | Ga0070699_1000639194 | 176 |
| 121 | 3300005530 | Ga0070679_100212974 | Ga0070679_1002129742 | 176 |
| 122 | 3300005530 | Ga0070679_100390337 | Ga0070679_1003903371 | 176 |
| 123 | 3300005535 | Ga0070684_100060574 | Ga0070684_1000605742 | 176 |
| 124 | 3300005535 | Ga0070684_100078312 | Ga0070684_1000783123 | 176 |
| 125 | 3300005536 | Ga0070697_100002608 | Ga0070697_1000026084 | 176 |
| 126 | 3300005536 | Ga0070697_100145522 | Ga0070697_1001455222 | 176 |
| 127 | 3300005539 | Ga0068853_100123757 | Ga0068853_1001237572 | 176 |
| 128 | 3300005544 | Ga0070686_100004007 | Ga0070686_1000040072 | 176 |
| 129 | 3300005545 | Ga0070695_100089044 | Ga0070695_1000890442 | 176 |
| 130 | 3300005545 | Ga0070695_100838974 | Ga0070695_1008389742 | 176 |
| 131 | 3300005547 | Ga0070693_100009100 | Ga0070693_1000091001 | 176 |
| 132 | 3300005547 | Ga0070693_100018449 | Ga0070693_1000184495 | 176 |
| 133 | 3300005548 | Ga0070665_100005852 | Ga0070665_10000585212 | 176 |
| 134 | 3300005549 | Ga0070704_100127167 | Ga0070704_1001271672 | 176 |
| 135 | 3300005563 | Ga0068855_100054928 | Ga0068855_1000549281 | 176 |
| 136 | 3300005563 | Ga0068855_100922448 | Ga0068855_1009224482 | 176 |
| 137 | 3300005564 | Ga0070664_100025762 | Ga0070664_1000257625 | 176 |
| 138 | 3300005564 | Ga0070664_100191243 | Ga0070664_1001912432 | 176 |
| 139 | 3300005564 | Ga0070664_100305936 | Ga0070664_1003059362 | 176 |
| 140 | 3300005577 | Ga0068857_100006994 | Ga0068857_1000069949 | 176 |
| 141 | 3300005578 | Ga0068854_100039367 | Ga0068854_1000393672 | 176 |
| 142 | 3300005614 | Ga0068856_100003384 | Ga0068856_10000338412 | 176 |
| 143 | 3300005614 | Ga0068856_100073484 | Ga0068856_1000734844 | 176 |
| 144 | 3300005615 | Ga0070702_100514234 | Ga0070702_1005142342 | 176 |
| 145 | 3300005616 | Ga0068852_100001607 | Ga0068852_1000016076 | 176 |
| 146 | 3300005616 | Ga0068852_100268517 | Ga0068852_1002685172 | 176 |
| 147 | 3300005616 | Ga0068852_101294605 | Ga0068852_1012946052 | 176 |
| 148 | 3300005617 | Ga0068859_100003177 | Ga0068859_1000031778 | 176 |
| 149 | 3300005618 | Ga0068864_100002616 | Ga0068864_10000261613 | 176 |
| 150 | 3300005718 | Ga0068866_10000652 | Ga0068866_1000065212 | 176 |
| 151 | 3300005834 | Ga0068851_10119698 | Ga0068851_101196982 | 176 |
| 152 | 3300005834 | Ga0068851_10520052 | Ga0068851_105200522 | 176 |
| 153 | 3300005841 | Ga0068863_100002985 | Ga0068863_1000029859 | 176 |
| 154 | 3300005842 | Ga0068858_100000603 | Ga0068858_1000006038 | 176 |
| 155 | 3300006163 | Ga0070715_10012346 | Ga0070715_100123464 | 176 |
| 156 | 3300006173 | Ga0070716_100001339 | Ga0070716_10000133911 | 176 |
| 157 | 3300006173 | Ga0070716_100543585 | Ga0070716_1005435851 | 176 |
| 158 | 3300006175 | Ga0070712_100005043 | Ga0070712_1000050432 | 176 |
| 159 | 3300006175 | Ga0070712_100027301 | Ga0070712_1000273012 | 176 |
| 160 | 3300006237 | Ga0097621_100020593 | Ga0097621_1000205937 | 176 |
| 161 | 3300006237 | Ga0097621_101056642 | Ga0097621_1010566422 | 176 |
| 162 | 3300006358 | Ga0068871_100230476 | Ga0068871_1002304762 | 176 |
| 163 | 3300006852 | Ga0075433_10056206 | Ga0075433_100562064 | 176 |
| 164 | 3300006871 | Ga0075434_100035035 | Ga0075434_1000350357 | 176 |
| 165 | 3300006871 | Ga0075434_100146274 | Ga0075434_1001462743 | 176 |
| 166 | 3300006914 | Ga0075436_100221437 | Ga0075436_1002214372 | 176 |
| 167 | 3300006931 | Ga0097620_100003176 | Ga0097620_1000031768 | 176 |
| 168 | 3300007076 | Ga0075435_100011479 | Ga0075435_1000114796 | 176 |
| 169 | 3300009093 | Ga0105240_10002428 | Ga0105240_1000242836 | 176 |
| 170 | 3300009093 | Ga0105240_10047724 | Ga0105240_100477244 | 176 |
| 171 | 3300009098 | Ga0105245_10005497 | Ga0105245_1000549710 | 176 |
| 172 | 3300009098 | Ga0105245_10014037 | Ga0105245_100140375 | 176 |
| 173 | 3300009098 | Ga0105245_10020376 | Ga0105245_100203764 | 176 |
| 174 | 3300009147 | Ga0114129_10294637 | Ga0114129_102946372 | 176 |
| 175 | 3300009174 | Ga0105241_10022261 | Ga0105241_100222612 | 176 |
| 176 | 3300009174 | Ga0105241_10111769 | Ga0105241_101117692 | 176 |
| 177 | 3300009176 | Ga0105242_10002918 | Ga0105242_100029189 | 176 |
| 178 | 3300009177 | Ga0105248_10026830 | Ga0105248_100268305 | 176 |
| 179 | 3300009545 | Ga0105237_10354688 | Ga0105237_103546882 | 176 |
| 180 | 3300009551 | Ga0105238_10001044 | Ga0105238_1000104411 | 176 |
| 181 | 3300009551 | Ga0105238_10067698 | Ga0105238_100676984 | 176 |
| 182 | 3300009553 | Ga0105249_10226118 | Ga0105249_102261182 | 176 |
| 183 | 3300010375 | Ga0105239_10033050 | Ga0105239_100330504 | 176 |
| 184 | 3300010375 | Ga0105239_10371690 | Ga0105239_103716902 | 176 |
| 185 | 3300010375 | Ga0105239_11598816 | Ga0105239_115988162 | 176 |
| 186 | 3300011119 | Ga0105246_10119344 | Ga0105246_101193442 | 176 |
| 187 | 3300012491 | Ga0157329_1000632 | Ga0157329_10006322 | 176 |
| 188 | 3300013100 | Ga0157373_10040985 | Ga0157373_100409852 | 176 |
| 189 | 3300013100 | Ga0157373_10572589 | Ga0157373_105725892 | 176 |
| 190 | 3300013102 | Ga0157371_10307675 | Ga0157371_103076751 | 176 |
| 191 | 3300013105 | Ga0157369_10014238 | Ga0157369_100142389 | 176 |
| 192 | 3300013296 | Ga0157374_10000565 | Ga0157374_1000056534 | 176 |
| 193 | 3300013297 | Ga0157378_10031024 | Ga0157378_100310245 | 176 |
| 194 | 3300013297 | Ga0157378_10171201 | Ga0157378_101712011 | 176 |
| 195 | 3300013306 | Ga0163162_10022644 | Ga0163162_100226444 | 176 |
| 196 | 3300013306 | Ga0163162_10087446 | Ga0163162_100874462 | 176 |
| 197 | 3300013307 | Ga0157372_10004393 | Ga0157372_1000439312 | 176 |
| 198 | 3300013308 | Ga0157375_10004526 | Ga0157375_1000452610 | 176 |
| 199 | 3300014325 | Ga0163163_10000689 | Ga0163163_1000068912 | 176 |
| 200 | 3300014969 | Ga0157376_10007657 | Ga0157376_100076575 | 176 |
| 201 | 3300014969 | Ga0157376_10007747 | Ga0157376_100077475 | 176 |
| 202 | 3300017792 | Ga0163161_10167424 | Ga0163161_101674242 | 176 |
| 203 | 3300021384 | Ga0213876_10184874 | Ga0213876_101848742 | 176 |
| 204 | 3300025321 | Ga0207656_10061127 | Ga0207656_100611272 | 176 |
| 205 | 3300025898 | Ga0207692_10005926 | Ga0207692_100059265 | 176 |
| 206 | 3300025898 | Ga0207692_10269429 | Ga0207692_102694292 | 176 |
| 207 | 3300025899 | Ga0207642_10000852 | Ga0207642_100008526 | 176 |
| 208 | 3300025903 | Ga0207680_10020828 | Ga0207680_100208282 | 176 |
| 209 | 3300025903 | Ga0207680_10043021 | Ga0207680_100430213 | 176 |
| 210 | 3300025905 | Ga0207685_10104526 | Ga0207685_101045262 | 176 |
| 211 | 3300025907 | Ga0207645_10068667 | Ga0207645_100686674 | 176 |
| 212 | 3300025908 | Ga0207643_10101961 | Ga0207643_101019613 | 176 |
| 213 | 3300025910 | Ga0207684_10685030 | Ga0207684_106850302 | 176 |
| 214 | 3300025911 | Ga0207654_10003842 | Ga0207654_100038429 | 176 |
| 215 | 3300025912 | Ga0207707_10106830 | Ga0207707_101068305 | 176 |
| 216 | 3300025914 | Ga0207671_10220291 | Ga0207671_102202912 | 176 |
| 217 | 3300025915 | Ga0207693_10001163 | Ga0207693_100011635 | 176 |
| 218 | 3300025915 | Ga0207693_10032301 | Ga0207693_100323012 | 176 |
| 219 | 3300025916 | Ga0207663_10027057 | Ga0207663_100270574 | 176 |
| 220 | 3300025917 | Ga0207660_10228576 | Ga0207660_102285762 | 176 |
| 221 | 3300025919 | Ga0207657_10000280 | Ga0207657_1000028022 | 176 |
| 222 | 3300025919 | Ga0207657_10019674 | Ga0207657_100196746 | 176 |
| 223 | 3300025920 | Ga0207649_10095263 | Ga0207649_100952631 | 176 |
| 224 | 3300025920 | Ga0207649_10490270 | Ga0207649_104902702 | 176 |
| 225 | 3300025922 | Ga0207646_10012728 | Ga0207646_100127282 | 176 |
| 226 | 3300025922 | Ga0207646_10069627 | Ga0207646_100696273 | 176 |
| 227 | 3300025924 | Ga0207694_10009651 | Ga0207694_100096516 | 176 |
| 228 | 3300025924 | Ga0207694_10058569 | Ga0207694_100585692 | 176 |
| 229 | 3300025925 | Ga0207650_10014573 | Ga0207650_100145737 | 176 |
| 230 | 3300025927 | Ga0207687_10000741 | Ga0207687_100007415 | 176 |
| 231 | 3300025927 | Ga0207687_10009974 | Ga0207687_100099745 | 176 |
| 232 | 3300025927 | Ga0207687_10563528 | Ga0207687_105635281 | 176 |
| 233 | 3300025928 | Ga0207700_10031325 | Ga0207700_100313253 | 176 |
| 234 | 3300025929 | Ga0207664_10009725 | Ga0207664_100097256 | 176 |
| 235 | 3300025929 | Ga0207664_10112269 | Ga0207664_101122694 | 176 |
| 236 | 3300025931 | Ga0207644_10002123 | Ga0207644_1000212310 | 176 |
| 237 | 3300025931 | Ga0207644_10056245 | Ga0207644_100562452 | 176 |
| 238 | 3300025932 | Ga0207690_10014956 | Ga0207690_100149563 | 176 |
| 239 | 3300025933 | Ga0207706_10049727 | Ga0207706_100497273 | 176 |
| 240 | 3300025933 | Ga0207706_10243707 | Ga0207706_102437072 | 176 |
| 241 | 3300025934 | Ga0207686_10000521 | Ga0207686_1000052134 | 176 |
| 242 | 3300025937 | Ga0207669_10122910 | Ga0207669_101229101 | 176 |
| 243 | 3300025938 | Ga0207704_10116095 | Ga0207704_101160953 | 176 |
| 244 | 3300025939 | Ga0207665_10004353 | Ga0207665_100043539 | 176 |
| 245 | 3300025941 | Ga0207711_10000448 | Ga0207711_1000044815 | 176 |
| 246 | 3300025942 | Ga0207689_10118222 | Ga0207689_101182222 | 176 |
| 247 | 3300025944 | Ga0207661_10079457 | Ga0207661_100794574 | 176 |
| 248 | 3300025945 | Ga0207679_10488415 | Ga0207679_104884152 | 176 |
| 249 | 3300025949 | Ga0207667_10005138 | Ga0207667_1000513813 | 176 |
| 250 | 3300025949 | Ga0207667_10457694 | Ga0207667_104576942 | 176 |
| 251 | 3300025960 | Ga0207651_10002125 | Ga0207651_100021256 | 176 |
| 252 | 3300025981 | Ga0207640_10018886 | Ga0207640_100188862 | 176 |
| 253 | 3300025986 | Ga0207658_10006610 | Ga0207658_100066105 | 176 |
| 254 | 3300025986 | Ga0207658_10272447 | Ga0207658_102724472 | 176 |
| 255 | 3300026023 | Ga0207677_10000253 | Ga0207677_1000025312 | 176 |
| 256 | 3300026023 | Ga0207677_10117961 | Ga0207677_101179612 | 176 |
| 257 | 3300026023 | Ga0207677_11268081 | Ga0207677_112680811 | 176 |
| 258 | 3300026035 | Ga0207703_10000517 | Ga0207703_1000051734 | 176 |
| 259 | 3300026067 | Ga0207678_10092965 | Ga0207678_100929652 | 176 |
| 260 | 3300026067 | Ga0207678_10125132 | Ga0207678_101251322 | 176 |
| 261 | 3300026067 | Ga0207678_10282617 | Ga0207678_102826172 | 176 |
| 262 | 3300026078 | Ga0207702_10009250 | Ga0207702_100092507 | 176 |
| 263 | 3300026078 | Ga0207702_10009791 | Ga0207702_100097918 | 176 |
| 264 | 3300026078 | Ga0207702_10053604 | Ga0207702_100536042 | 176 |
| 265 | 3300026088 | Ga0207641_10000610 | Ga0207641_1000061010 | 176 |
| 266 | 3300026095 | Ga0207676_10000167 | Ga0207676_1000016747 | 176 |
| 267 | 3300026116 | Ga0207674_10000118 | Ga0207674_1000011871 | 176 |
| 268 | 3300026116 | Ga0207674_10005648 | Ga0207674_1000564829 | 176 |
| 269 | 3300026121 | Ga0207683_10000965 | Ga0207683_1000096512 | 176 |
| 270 | 3300026142 | Ga0207698_10046956 | Ga0207698_100469562 | 176 |
| 271 | 3300026142 | Ga0207698_10131243 | Ga0207698_101312434 | 176 |
| 272 | 3300026142 | Ga0207698_10209756 | Ga0207698_102097562 | 176 |
| 273 | 3300028379 | Ga0268266_10005004 | Ga0268266_100050048 | 176 |
| 274 | 3300028381 | Ga0268264_10001027 | Ga0268264_1000102724 | 176 |
| 275 | 3300028381 | Ga0268264_10033881 | Ga0268264_100338814 | 176 |
| 276 | 3300031824 | Ga0307413_10003503 | Ga0307413_100035031 | 176 |
| 277 | 3300031852 | Ga0307410_10009379 | Ga0307410_100093793 | 176 |
| 278 | 3300031901 | Ga0307406_10009681 | Ga0307406_100096812 | 176 |
| 279 | 3300031903 | Ga0307407_10003844 | Ga0307407_100038441 | 176 |
| 280 | 3300031995 | Ga0307409_100004202 | Ga0307409_1000042026 | 176 |
| 281 | 3300032004 | Ga0307414_10819809 | Ga0307414_108198091 | 176 |
| 282 | 3300032126 | Ga0307415_100002092 | Ga0307415_1000020928 | 176 |
| 283 | 3300035083 | Ga0373926_0055058 | Ga0373926_0055058_189_719 | 176 |
| 284 | 3300035083 | Ga0373926_0061626 | Ga0373926_0061626_700_1230 | 176 |
| 285 | 3300035086 | Ga0373934_0004862 | Ga0373934_0004862_1966_2496 | 176 |
| 286 | 3300035089 | Ga0373944_0098711 | Ga0373944_0098711_28_558 | 176 |
| 287 | 3300035111 | Ga0373923_0001149 | Ga0373923_0001149_143_673 | 176 |
| 288 | 3300035113 | Ga0373936_0047524 | Ga0373936_0047524_412_942 | 176 |
| 289 | 3300035116 | Ga0373945_0032663 | Ga0373945_0032663_900_1430 | 176 |
| 290 | 3300035116 | Ga0373945_0059662 | Ga0373945_0059662_228_758 | 176 |
| 291 | 3300035117 | Ga0373953_0005084 | Ga0373953_0005084_2257_2787 | 176 |
| 292 | 3300035118 | Ga0373954_0000524 | Ga0373954_0000524_380_910 | 176 |
| 293 | 3300035119 | Ga0373956_0084905 | Ga0373956_0084905_431_961 | 176 |
| 294 | 3300035120 | Ga0373957_0012776 | Ga0373957_0012776_1155_1685 | 176 |
| 295 | 3300035170 | Ga0373943_0014005 | Ga0373943_0014005_418_948 | 176 |
| 296 | 3300035410 | Ga0373924_0063792 | Ga0373924_0063792_549_1079 | 176 |
| 297 | 3300035692 | Ga0373935_0011090 | Ga0373935_0011090_2140_2670 | 176 |
| 298 | 3300035695 | Ga0373927_0020370 | Ga0373927_0020370_1350_1880 | 176 |
| 299 | 3300035695 | Ga0373927_0060319 | Ga0373927_0060319_1437_1970 | 176 |
| 300 | 3300035695 | Ga0373927_0183814 | Ga0373927_0183814_826_1356 | 176 |
| 301 | 3300035695 | Ga0373927_0186810 | Ga0373927_0186810_397_927 | 176 |
| 302 | 3300035724 | Ga0373933_0011110 | Ga0373933_0011110_1997_2527 | 176 |
| 303 | 3300035725 | Ga0373947_0011737 | Ga0373947_0011737_2713_3243 | 176 |
| 304 | 3300035725 | Ga0373947_0013335 | Ga0373947_0013335_980_1510 | 176 |
| 305 | 3300036401 | Ga0373937_0015112 | Ga0373937_0015112_1123_1653 | 176 |
| 306 | 3300037068 | Ga0373925_0018839 | Ga0373925_0018839_3756_4286 | 176 |
| 307 | 3300037068 | Ga0373925_0286095 | Ga0373925_0286095_633_1163 | 176 |
| 308 | 3300037471 | Ga0395905_1495877 | Ga0395905_1495877_30_560 | 176 |
| 309 | 3300039437 | Ga0436365_0042302 | Ga0436365_0042302_628_1158 | 176 |
| 310 | 3300042876 | Ga0451577_0046785 | Ga0451577_0046785_2450_2989 | 176 |
| 311 | 3300044693 | Ga0466961_0057086 | Ga0466961_0057086_1645_2175 | 176 |
| 312 | 3300044712 | Ga0453684_0518400 | Ga0453684_0518400_635_1174 | 176 |
| 313 | 3300046459 | Ga0495629_0113062 | Ga0495629_0113062_1257_1787 | 176 |
| 314 | 3300046472 | Ga0495580_0046517 | Ga0495580_0046517_2157_2687 | 176 |
| 315 | 3300046472 | Ga0495580_0071403 | Ga0495580_0071403_975_1505 | 176 |
| 316 | 3300046472 | Ga0495580_0146534 | Ga0495580_0146534_591_1121 | 176 |
| 317 | 3300046473 | Ga0495582_0006109 | Ga0495582_0006109_3909_4439 | 176 |
| 318 | 3300046476 | Ga0495662_0008769 | Ga0495662_0008769_876_1406 | 176 |
| 319 | 3300046477 | Ga0495664_0021456 | Ga0495664_0021456_2537_3067 | 176 |
| 320 | 3300046499 | Ga0495594_0022970 | Ga0495594_0022970_2049_2579 | 176 |
| 321 | 3300046516 | Ga0495628_0170594 | Ga0495628_0170594_613_1143 | 176 |
| 322 | 3300046531 | Ga0495665_0104985 | Ga0495665_0104985_778_1308 | 176 |
| 323 | 3300046539 | Ga0495621_0001573 | Ga0495621_0001573_1101_1631 | 176 |
| 324 | 3300046559 | Ga0495667_0321257 | Ga0495667_0321257_424_954 | 176 |
| 325 | 3300046663 | Ga0495635_0147009 | Ga0495635_0147009_823_1353 | 176 |
| 326 | 3300046664 | Ga0495659_0019322 | Ga0495659_0019322_555_1085 | 176 |
| 327 | 3300046679 | Ga0495623_0196988 | Ga0495623_0196988_423_953 | 176 |
| 328 | 3300046681 | Ga0495647_0001796 | Ga0495647_0001796_1151_1681 | 176 |
| 329 | 3300046689 | Ga0495613_0008532 | Ga0495613_0008532_975_1505 | 176 |
| 330 | 3300046809 | Ga0495600_0221406 | Ga0495600_0221406_403_933 | 176 |
| 331 | 3300047315 | Ga0495581_0070175 | Ga0495581_0070175_829_1359 | 176 |
| 332 | 3300047317 | Ga0495604_0187948 | Ga0495604_0187948_613_1143 | 176 |
| 333 | 3300047322 | Ga0495680_0119784 | Ga0495680_0119784_1343_1873 | 176 |
| 334 | 3300047471 | Ga0495684_0010210 | Ga0495684_0010210_3075_3605 | 176 |
| 335 | 3300048904 | Ga0496101_0012612 | Ga0496101_0012612_4188_4718 | 176 |
| 336 | 3300048905 | Ga0496102_0052668 | Ga0496102_0052668_2252_2797 | 176 |
| 337 | 3300048906 | Ga0496103_0019475 | Ga0496103_0019475_554_1099 | 176 |
| 338 | 3300048907 | Ga0496104_0002793 | Ga0496104_0002793_4195_4725 | 176 |
| 339 | 3300048908 | Ga0496105_0022747 | Ga0496105_0022747_558_1088 | 176 |
| 340 | 3300048909 | Ga0496106_0169315 | Ga0496106_0169315_20_565 | 176 |
| 341 | 3300048910 | Ga0496107_0045692 | Ga0496107_0045692_737_1267 | 176 |
| 342 | 3300048911 | Ga0496108_0205922 | Ga0496108_0205922_54_584 | 176 |
| 343 | 3300048912 | Ga0496109_0006393 | Ga0496109_0006393_588_1118 | 176 |
| 344 | 3300048915 | Ga0496112_0001041 | Ga0496112_0001041_14434_14964 | 176 |
| 345 | 3300048917 | Ga0496114_0050417 | Ga0496114_0050417_447_977 | 176 |
| 346 | 3300048918 | Ga0496115_0054993 | Ga0496115_0054993_2657_3187 | 176 |
| 347 | 3300050507 | nmdc:mga05p37_76448_c1 | nmdc:mga05p37_76448_c1_3538_4068 | 176 |
| 348 | 3300050512 | nmdc:mga0n895_38129_c1 | nmdc:mga0n895_38129_c1_1155_1685 | 176 |
| 349 | 3300050512 | nmdc:mga0n895_590624_c1 | nmdc:mga0n895_590624_c1_516_1046 | 176 |
| 350 | 3300050513 | nmdc:mga0rr50_10098_c1 | nmdc:mga0rr50_10098_c1_550_1080 | 176 |
| 351 | 3300050515 | nmdc:mga0a205_120325_c1 | nmdc:mga0a205_120325_c1_1482_2012 | 176 |
| 352 | 3300053077 | Ga0495601_0356142 | Ga0495601_0356142_127_657 | 176 |
| 353 | 3300053078 | Ga0495612_0030881 | Ga0495612_0030881_422_952 | 176 |
| 354 | 3300053084 | Ga0495595_0279289 | Ga0495595_0279289_172_702 | 176 |
| 355 | 3300053085 | Ga0495619_0065195 | Ga0495619_0065195_902_1432 | 176 |
| 356 | 3300001991 | JGI24743J22301_10011967 | JGI24743J22301_100119672 | 177 |
| 357 | 3300001991 | JGI24743J22301_10099337 | JGI24743J22301_100993371 | 177 |
| 358 | 3300005290 | Ga0065712_10151734 | Ga0065712_101517342 | 177 |
| 359 | 3300005293 | Ga0065715_10187171 | Ga0065715_101871713 | 177 |
| 360 | 3300005293 | Ga0065715_10326888 | Ga0065715_103268882 | 177 |
| 361 | 3300005327 | Ga0070658_10092931 | Ga0070658_100929313 | 177 |
| 362 | 3300005327 | Ga0070658_10414064 | Ga0070658_104140642 | 177 |
| 363 | 3300005327 | Ga0070658_11080494 | Ga0070658_110804941 | 177 |
| 364 | 3300005328 | Ga0070676_10000068 | Ga0070676_1000006837 | 177 |
| 365 | 3300005328 | Ga0070676_10006880 | Ga0070676_100068808 | 177 |
| 366 | 3300005328 | Ga0070676_10022743 | Ga0070676_100227433 | 177 |
| 367 | 3300005328 | Ga0070676_10035719 | Ga0070676_100357193 | 177 |
| 368 | 3300005328 | Ga0070676_10086142 | Ga0070676_100861424 | 177 |
| 369 | 3300005328 | Ga0070676_10103743 | Ga0070676_101037432 | 177 |
| 370 | 3300005328 | Ga0070676_10246745 | Ga0070676_102467452 | 177 |
| 371 | 3300005329 | Ga0070683_100012992 | Ga0070683_1000129927 | 177 |
| 372 | 3300005330 | Ga0070690_100024623 | Ga0070690_1000246233 | 177 |
| 373 | 3300005330 | Ga0070690_100085249 | Ga0070690_1000852492 | 177 |
| 374 | 3300005331 | Ga0070670_100000715 | Ga0070670_10000071512 | 177 |
| 375 | 3300005331 | Ga0070670_100003749 | Ga0070670_10000374913 | 177 |
| 376 | 3300005331 | Ga0070670_100103612 | Ga0070670_1001036122 | 177 |
| 377 | 3300005331 | Ga0070670_100152545 | Ga0070670_1001525453 | 177 |
| 378 | 3300005331 | Ga0070670_100178905 | Ga0070670_1001789053 | 177 |
| 379 | 3300005331 | Ga0070670_100218977 | Ga0070670_1002189773 | 177 |
| 380 | 3300005331 | Ga0070670_100436779 | Ga0070670_1004367792 | 177 |
| 381 | 3300005331 | Ga0070670_101281117 | Ga0070670_1012811171 | 177 |
| 382 | 3300005333 | Ga0070677_10000388 | Ga0070677_1000038810 | 177 |
| 383 | 3300005333 | Ga0070677_10171071 | Ga0070677_101710712 | 177 |
| 384 | 3300005334 | Ga0068869_100000926 | Ga0068869_10000092610 | 177 |
| 385 | 3300005334 | Ga0068869_100006606 | Ga0068869_1000066062 | 177 |
| 386 | 3300005334 | Ga0068869_100028520 | Ga0068869_1000285203 | 177 |
| 387 | 3300005334 | Ga0068869_100756798 | Ga0068869_1007567981 | 177 |
| 388 | 3300005335 | Ga0070666_10007042 | Ga0070666_100070424 | 177 |
| 389 | 3300005335 | Ga0070666_10008121 | Ga0070666_100081215 | 177 |
| 390 | 3300005335 | Ga0070666_10083410 | Ga0070666_100834102 | 177 |
| 391 | 3300005335 | Ga0070666_10194203 | Ga0070666_101942033 | 177 |
| 392 | 3300005335 | Ga0070666_10320368 | Ga0070666_103203682 | 177 |
| 393 | 3300005337 | Ga0070682_100589750 | Ga0070682_1005897501 | 177 |
| 394 | 3300005337 | Ga0070682_100656375 | Ga0070682_1006563752 | 177 |
| 395 | 3300005338 | Ga0068868_100079357 | Ga0068868_1000793572 | 177 |
| 396 | 3300005338 | Ga0068868_100693990 | Ga0068868_1006939902 | 177 |
| 397 | 3300005338 | Ga0068868_101078430 | Ga0068868_1010784302 | 177 |
| 398 | 3300005339 | Ga0070660_100000932 | Ga0070660_1000009329 | 177 |
| 399 | 3300005340 | Ga0070689_100012276 | Ga0070689_1000122766 | 177 |
| 400 | 3300005340 | Ga0070689_100015305 | Ga0070689_1000153053 | 177 |
| 401 | 3300005340 | Ga0070689_100259775 | Ga0070689_1002597752 | 177 |
| 402 | 3300005340 | Ga0070689_100368870 | Ga0070689_1003688702 | 177 |
| 403 | 3300005343 | Ga0070687_100703179 | Ga0070687_1007031791 | 177 |
| 404 | 3300005344 | Ga0070661_100014641 | Ga0070661_1000146414 | 177 |
| 405 | 3300005344 | Ga0070661_100015498 | Ga0070661_1000154986 | 177 |
| 406 | 3300005344 | Ga0070661_100051278 | Ga0070661_1000512783 | 177 |
| 407 | 3300005344 | Ga0070661_100083645 | Ga0070661_1000836453 | 177 |
| 408 | 3300005344 | Ga0070661_100119280 | Ga0070661_1001192802 | 177 |
| 409 | 3300005345 | Ga0070692_10019473 | Ga0070692_100194734 | 177 |
| 410 | 3300005347 | Ga0070668_100000779 | Ga0070668_10000077923 | 177 |
| 411 | 3300005347 | Ga0070668_100015675 | Ga0070668_1000156752 | 177 |
| 412 | 3300005347 | Ga0070668_100038163 | Ga0070668_1000381632 | 177 |
| 413 | 3300005347 | Ga0070668_100066591 | Ga0070668_1000665912 | 177 |
| 414 | 3300005347 | Ga0070668_100075157 | Ga0070668_1000751573 | 177 |
| 415 | 3300005347 | Ga0070668_100326096 | Ga0070668_1003260961 | 177 |
| 416 | 3300005353 | Ga0070669_100000668 | Ga0070669_10000066822 | 177 |
| 417 | 3300005353 | Ga0070669_100075780 | Ga0070669_1000757805 | 177 |
| 418 | 3300005353 | Ga0070669_100159309 | Ga0070669_1001593092 | 177 |
| 419 | 3300005353 | Ga0070669_100181960 | Ga0070669_1001819602 | 177 |
| 420 | 3300005353 | Ga0070669_100258639 | Ga0070669_1002586391 | 177 |
| 421 | 3300005353 | Ga0070669_100425203 | Ga0070669_1004252032 | 177 |
| 422 | 3300005354 | Ga0070675_100006613 | Ga0070675_1000066138 | 177 |
| 423 | 3300005354 | Ga0070675_100007266 | Ga0070675_1000072669 | 177 |
| 424 | 3300005354 | Ga0070675_100017405 | Ga0070675_1000174056 | 177 |
| 425 | 3300005354 | Ga0070675_100275795 | Ga0070675_1002757952 | 177 |
| 426 | 3300005355 | Ga0070671_100008688 | Ga0070671_1000086885 | 177 |
| 427 | 3300005355 | Ga0070671_100015993 | Ga0070671_1000159936 | 177 |
| 428 | 3300005355 | Ga0070671_100019898 | Ga0070671_1000198984 | 177 |
| 429 | 3300005355 | Ga0070671_100021917 | Ga0070671_1000219174 | 177 |
| 430 | 3300005355 | Ga0070671_100059730 | Ga0070671_1000597303 | 177 |
| 431 | 3300005355 | Ga0070671_100145096 | Ga0070671_1001450961 | 177 |
| 432 | 3300005355 | Ga0070671_100303335 | Ga0070671_1003033353 | 177 |
| 433 | 3300005356 | Ga0070674_100073559 | Ga0070674_1000735592 | 177 |
| 434 | 3300005356 | Ga0070674_100087028 | Ga0070674_1000870282 | 177 |
| 435 | 3300005356 | Ga0070674_100143575 | Ga0070674_1001435753 | 177 |
| 436 | 3300005356 | Ga0070674_100165920 | Ga0070674_1001659202 | 177 |
| 437 | 3300005356 | Ga0070674_100370020 | Ga0070674_1003700202 | 177 |
| 438 | 3300005364 | Ga0070673_100002041 | Ga0070673_10000204111 | 177 |
| 439 | 3300005364 | Ga0070673_100009308 | Ga0070673_1000093085 | 177 |
| 440 | 3300005364 | Ga0070673_100045466 | Ga0070673_1000454663 | 177 |
| 441 | 3300005364 | Ga0070673_100063676 | Ga0070673_1000636763 | 177 |
| 442 | 3300005364 | Ga0070673_100168630 | Ga0070673_1001686302 | 177 |
| 443 | 3300005364 | Ga0070673_101726739 | Ga0070673_1017267391 | 177 |
| 444 | 3300005365 | Ga0070688_100065847 | Ga0070688_1000658474 | 177 |
| 445 | 3300005365 | Ga0070688_100097897 | Ga0070688_1000978972 | 177 |
| 446 | 3300005366 | Ga0070659_100055767 | Ga0070659_1000557672 | 177 |
| 447 | 3300005366 | Ga0070659_100066836 | Ga0070659_1000668364 | 177 |
| 448 | 3300005366 | Ga0070659_100093999 | Ga0070659_1000939992 | 177 |
| 449 | 3300005366 | Ga0070659_100105503 | Ga0070659_1001055031 | 177 |
| 450 | 3300005367 | Ga0070667_100001232 | Ga0070667_1000012328 | 177 |
| 451 | 3300005367 | Ga0070667_100006774 | Ga0070667_1000067748 | 177 |
| 452 | 3300005367 | Ga0070667_100017793 | Ga0070667_1000177934 | 177 |
| 453 | 3300005367 | Ga0070667_100018925 | Ga0070667_1000189256 | 177 |
| 454 | 3300005367 | Ga0070667_100065015 | Ga0070667_1000650154 | 177 |
| 455 | 3300005367 | Ga0070667_100223895 | Ga0070667_1002238952 | 177 |
| 456 | 3300005367 | Ga0070667_100707091 | Ga0070667_1007070911 | 177 |
| 457 | 3300005434 | Ga0070709_10026307 | Ga0070709_100263073 | 177 |
| 458 | 3300005435 | Ga0070714_100051617 | Ga0070714_1000516172 | 177 |
| 459 | 3300005435 | Ga0070714_100074888 | Ga0070714_1000748883 | 177 |
| 460 | 3300005435 | Ga0070714_100225801 | Ga0070714_1002258013 | 177 |
| 461 | 3300005435 | Ga0070714_100836881 | Ga0070714_1008368812 | 177 |
| 462 | 3300005436 | Ga0070713_100339207 | Ga0070713_1003392071 | 177 |
| 463 | 3300005438 | Ga0070701_10450311 | Ga0070701_104503112 | 177 |
| 464 | 3300005439 | Ga0070711_100008242 | Ga0070711_1000082424 | 177 |
| 465 | 3300005441 | Ga0070700_100024694 | Ga0070700_1000246943 | 177 |
| 466 | 3300005455 | Ga0070663_100120258 | Ga0070663_1001202582 | 177 |
| 467 | 3300005455 | Ga0070663_100159856 | Ga0070663_1001598562 | 177 |
| 468 | 3300005455 | Ga0070663_100254210 | Ga0070663_1002542103 | 177 |
| 469 | 3300005455 | Ga0070663_100499535 | Ga0070663_1004995352 | 177 |
| 470 | 3300005455 | Ga0070663_100615248 | Ga0070663_1006152481 | 177 |
| 471 | 3300005456 | Ga0070678_100001539 | Ga0070678_10000153911 | 177 |
| 472 | 3300005456 | Ga0070678_100005219 | Ga0070678_1000052196 | 177 |
| 473 | 3300005456 | Ga0070678_100009357 | Ga0070678_1000093575 | 177 |
| 474 | 3300005456 | Ga0070678_100298741 | Ga0070678_1002987412 | 177 |
| 475 | 3300005457 | Ga0070662_100001459 | Ga0070662_1000014595 | 177 |
| 476 | 3300005457 | Ga0070662_100004307 | Ga0070662_1000043078 | 177 |
| 477 | 3300005457 | Ga0070662_100010358 | Ga0070662_1000103586 | 177 |
| 478 | 3300005458 | Ga0070681_10345751 | Ga0070681_103457512 | 177 |
| 479 | 3300005459 | Ga0068867_100012431 | Ga0068867_1000124314 | 177 |
| 480 | 3300005459 | Ga0068867_100018079 | Ga0068867_1000180795 | 177 |
| 481 | 3300005459 | Ga0068867_100034757 | Ga0068867_1000347572 | 177 |
| 482 | 3300005459 | Ga0068867_100059084 | Ga0068867_1000590843 | 177 |
| 483 | 3300005459 | Ga0068867_100228837 | Ga0068867_1002288372 | 177 |
| 484 | 3300005466 | Ga0070685_10012098 | Ga0070685_100120986 | 177 |
| 485 | 3300005530 | Ga0070679_100084886 | Ga0070679_1000848863 | 177 |
| 486 | 3300005530 | Ga0070679_100157620 | Ga0070679_1001576202 | 177 |
| 487 | 3300005530 | Ga0070679_100362935 | Ga0070679_1003629351 | 177 |
| 488 | 3300005530 | Ga0070679_100374790 | Ga0070679_1003747901 | 177 |
| 489 | 3300005535 | Ga0070684_100149456 | Ga0070684_1001494563 | 177 |
| 490 | 3300005539 | Ga0068853_100007107 | Ga0068853_1000071075 | 177 |
| 491 | 3300005539 | Ga0068853_100016729 | Ga0068853_1000167296 | 177 |
| 492 | 3300005539 | Ga0068853_100021638 | Ga0068853_1000216383 | 177 |
| 493 | 3300005539 | Ga0068853_100696449 | Ga0068853_1006964492 | 177 |
| 494 | 3300005543 | Ga0070672_100000287 | Ga0070672_10000028729 | 177 |
| 495 | 3300005543 | Ga0070672_100014874 | Ga0070672_1000148745 | 177 |
| 496 | 3300005543 | Ga0070672_100034011 | Ga0070672_1000340114 | 177 |
| 497 | 3300005543 | Ga0070672_100034324 | Ga0070672_1000343242 | 177 |
| 498 | 3300005543 | Ga0070672_100039318 | Ga0070672_1000393184 | 177 |
| 499 | 3300005543 | Ga0070672_100084569 | Ga0070672_1000845692 | 177 |
| 500 | 3300005543 | Ga0070672_100229339 | Ga0070672_1002293392 | 177 |
| 501 | 3300005543 | Ga0070672_101023419 | Ga0070672_1010234192 | 177 |
| 502 | 3300005544 | Ga0070686_100460519 | Ga0070686_1004605192 | 177 |
| 503 | 3300005546 | Ga0070696_100174908 | Ga0070696_1001749082 | 177 |
| 504 | 3300005546 | Ga0070696_100408373 | Ga0070696_1004083732 | 177 |
| 505 | 3300005546 | Ga0070696_100442582 | Ga0070696_1004425822 | 177 |
| 506 | 3300005547 | Ga0070693_100046276 | Ga0070693_1000462762 | 177 |
| 507 | 3300005548 | Ga0070665_100023957 | Ga0070665_1000239574 | 177 |
| 508 | 3300005548 | Ga0070665_100027393 | Ga0070665_1000273934 | 177 |
| 509 | 3300005548 | Ga0070665_100090615 | Ga0070665_1000906152 | 177 |
| 510 | 3300005548 | Ga0070665_100223190 | Ga0070665_1002231902 | 177 |
| 511 | 3300005548 | Ga0070665_100345746 | Ga0070665_1003457462 | 177 |
| 512 | 3300005563 | Ga0068855_100004813 | Ga0068855_10000481313 | 177 |
| 513 | 3300005563 | Ga0068855_100021114 | Ga0068855_1000211147 | 177 |
| 514 | 3300005563 | Ga0068855_100071153 | Ga0068855_1000711532 | 177 |
| 515 | 3300005563 | Ga0068855_100209465 | Ga0068855_1002094652 | 177 |
| 516 | 3300005563 | Ga0068855_100236360 | Ga0068855_1002363603 | 177 |
| 517 | 3300005563 | Ga0068855_100592144 | Ga0068855_1005921442 | 177 |
| 518 | 3300005563 | Ga0068855_101642162 | Ga0068855_1016421621 | 177 |
| 519 | 3300005564 | Ga0070664_100003781 | Ga0070664_1000037819 | 177 |
| 520 | 3300005564 | Ga0070664_100014836 | Ga0070664_1000148367 | 177 |
| 521 | 3300005564 | Ga0070664_100062291 | Ga0070664_1000622913 | 177 |
| 522 | 3300005564 | Ga0070664_100065064 | Ga0070664_1000650643 | 177 |
| 523 | 3300005564 | Ga0070664_100869586 | Ga0070664_1008695862 | 177 |
| 524 | 3300005577 | Ga0068857_100087027 | Ga0068857_1000870273 | 177 |
| 525 | 3300005577 | Ga0068857_100983352 | Ga0068857_1009833522 | 177 |
| 526 | 3300005578 | Ga0068854_100041321 | Ga0068854_1000413212 | 177 |
| 527 | 3300005614 | Ga0068856_100017101 | Ga0068856_1000171018 | 177 |
| 528 | 3300005614 | Ga0068856_100035684 | Ga0068856_1000356842 | 177 |
| 529 | 3300005614 | Ga0068856_100049046 | Ga0068856_1000490464 | 177 |
| 530 | 3300005615 | Ga0070702_100088814 | Ga0070702_1000888142 | 177 |
| 531 | 3300005616 | Ga0068852_100007039 | Ga0068852_1000070392 | 177 |
| 532 | 3300005616 | Ga0068852_100007656 | Ga0068852_1000076564 | 177 |
| 533 | 3300005616 | Ga0068852_100039794 | Ga0068852_1000397942 | 177 |
| 534 | 3300005616 | Ga0068852_100049718 | Ga0068852_1000497186 | 177 |
| 535 | 3300005616 | Ga0068852_100147063 | Ga0068852_1001470632 | 177 |
| 536 | 3300005616 | Ga0068852_100194924 | Ga0068852_1001949242 | 177 |
| 537 | 3300005617 | Ga0068859_100020837 | Ga0068859_1000208374 | 177 |
| 538 | 3300005617 | Ga0068859_100056234 | Ga0068859_1000562345 | 177 |
| 539 | 3300005617 | Ga0068859_100206562 | Ga0068859_1002065622 | 177 |
| 540 | 3300005617 | Ga0068859_100228030 | Ga0068859_1002280302 | 177 |
| 541 | 3300005617 | Ga0068859_100710813 | Ga0068859_1007108132 | 177 |
| 542 | 3300005617 | Ga0068859_101024317 | Ga0068859_1010243172 | 177 |
| 543 | 3300005618 | Ga0068864_100001285 | Ga0068864_10000128523 | 177 |
| 544 | 3300005618 | Ga0068864_100008284 | Ga0068864_1000082845 | 177 |
| 545 | 3300005618 | Ga0068864_100054096 | Ga0068864_1000540962 | 177 |
| 546 | 3300005618 | Ga0068864_100107381 | Ga0068864_1001073814 | 177 |
| 547 | 3300005618 | Ga0068864_100495626 | Ga0068864_1004956261 | 177 |
| 548 | 3300005718 | Ga0068866_10035833 | Ga0068866_100358334 | 177 |
| 549 | 3300005719 | Ga0068861_100003709 | Ga0068861_1000037093 | 177 |
| 550 | 3300005719 | Ga0068861_100005006 | Ga0068861_1000050065 | 177 |
| 551 | 3300005719 | Ga0068861_100075027 | Ga0068861_1000750272 | 177 |
| 552 | 3300005719 | Ga0068861_100126387 | Ga0068861_1001263872 | 177 |
| 553 | 3300005719 | Ga0068861_100153025 | Ga0068861_1001530252 | 177 |
| 554 | 3300005719 | Ga0068861_100322956 | Ga0068861_1003229562 | 177 |
| 555 | 3300005719 | Ga0068861_100765574 | Ga0068861_1007655742 | 177 |
| 556 | 3300005834 | Ga0068851_10002374 | Ga0068851_100023747 | 177 |
| 557 | 3300005834 | Ga0068851_10007294 | Ga0068851_100072943 | 177 |
| 558 | 3300005834 | Ga0068851_10012519 | Ga0068851_100125196 | 177 |
| 559 | 3300005834 | Ga0068851_10101164 | Ga0068851_101011642 | 177 |
| 560 | 3300005840 | Ga0068870_10009006 | Ga0068870_100090063 | 177 |
| 561 | 3300005840 | Ga0068870_10192004 | Ga0068870_101920042 | 177 |
| 562 | 3300005840 | Ga0068870_10209989 | Ga0068870_102099892 | 177 |
| 563 | 3300005841 | Ga0068863_100021433 | Ga0068863_1000214336 | 177 |
| 564 | 3300005841 | Ga0068863_100029135 | Ga0068863_1000291355 | 177 |
| 565 | 3300005841 | Ga0068863_100033720 | Ga0068863_1000337205 | 177 |
| 566 | 3300005841 | Ga0068863_100074693 | Ga0068863_1000746933 | 177 |
| 567 | 3300005841 | Ga0068863_100100410 | Ga0068863_1001004104 | 177 |
| 568 | 3300005841 | Ga0068863_100230039 | Ga0068863_1002300391 | 177 |
| 569 | 3300005841 | Ga0068863_100789797 | Ga0068863_1007897972 | 177 |
| 570 | 3300005841 | Ga0068863_101362936 | Ga0068863_1013629361 | 177 |
| 571 | 3300005842 | Ga0068858_100021506 | Ga0068858_1000215063 | 177 |
| 572 | 3300005842 | Ga0068858_100021707 | Ga0068858_1000217074 | 177 |
| 573 | 3300005842 | Ga0068858_100209689 | Ga0068858_1002096892 | 177 |
| 574 | 3300005843 | Ga0068860_100005493 | Ga0068860_10000549311 | 177 |
| 575 | 3300005843 | Ga0068860_100005815 | Ga0068860_1000058159 | 177 |
| 576 | 3300005843 | Ga0068860_100066041 | Ga0068860_1000660411 | 177 |
| 577 | 3300005843 | Ga0068860_100150580 | Ga0068860_1001505802 | 177 |
| 578 | 3300005843 | Ga0068860_100166829 | Ga0068860_1001668292 | 177 |
| 579 | 3300005843 | Ga0068860_100234028 | Ga0068860_1002340283 | 177 |
| 580 | 3300005843 | Ga0068860_100362200 | Ga0068860_1003622002 | 177 |
| 581 | 3300005843 | Ga0068860_100466610 | Ga0068860_1004666102 | 177 |
| 582 | 3300005843 | Ga0068860_100557381 | Ga0068860_1005573813 | 177 |
| 583 | 3300005844 | Ga0068862_100029825 | Ga0068862_1000298253 | 177 |
| 584 | 3300005844 | Ga0068862_100058971 | Ga0068862_1000589712 | 177 |
| 585 | 3300005844 | Ga0068862_101405373 | Ga0068862_1014053731 | 177 |
| 586 | 3300006237 | Ga0097621_100001308 | Ga0097621_10000130812 | 177 |
| 587 | 3300006237 | Ga0097621_100304330 | Ga0097621_1003043303 | 177 |
| 588 | 3300006358 | Ga0068871_100001077 | Ga0068871_10000107710 | 177 |
| 589 | 3300006358 | Ga0068871_100109754 | Ga0068871_1001097542 | 177 |
| 590 | 3300006358 | Ga0068871_100204799 | Ga0068871_1002047993 | 177 |
| 591 | 3300006844 | Ga0075428_100028198 | Ga0075428_1000281988 | 177 |
| 592 | 3300006846 | Ga0075430_100652244 | Ga0075430_1006522442 | 177 |
| 593 | 3300006871 | Ga0075434_100204116 | Ga0075434_1002041162 | 177 |
| 594 | 3300006881 | Ga0068865_100015998 | Ga0068865_1000159984 | 177 |
| 595 | 3300006881 | Ga0068865_100045238 | Ga0068865_1000452382 | 177 |
| 596 | 3300006881 | Ga0068865_100053326 | Ga0068865_1000533262 | 177 |
| 597 | 3300006881 | Ga0068865_100145066 | Ga0068865_1001450662 | 177 |
| 598 | 3300006881 | Ga0068865_100248865 | Ga0068865_1002488651 | 177 |
| 599 | 3300006914 | Ga0075436_100090334 | Ga0075436_1000903342 | 177 |
| 600 | 3300006931 | Ga0097620_100020837 | Ga0097620_1000208374 | 177 |
| 601 | 3300006931 | Ga0097620_100056234 | Ga0097620_1000562345 | 177 |
| 602 | 3300006931 | Ga0097620_100206554 | Ga0097620_1002065542 | 177 |
| 603 | 3300006931 | Ga0097620_100228024 | Ga0097620_1002280242 | 177 |
| 604 | 3300006931 | Ga0097620_100710841 | Ga0097620_1007108412 | 177 |
| 605 | 3300006931 | Ga0097620_101024316 | Ga0097620_1010243162 | 177 |
| 606 | 3300007265 | Ga0099794_10237603 | Ga0099794_102376032 | 177 |
| 607 | 3300009011 | Ga0105251_10276745 | Ga0105251_102767451 | 177 |
| 608 | 3300009093 | Ga0105240_10018683 | Ga0105240_100186834 | 177 |
| 609 | 3300009094 | Ga0111539_10257698 | Ga0111539_102576983 | 177 |
| 610 | 3300009098 | Ga0105245_10209674 | Ga0105245_102096744 | 177 |
| 611 | 3300009098 | Ga0105245_10418636 | Ga0105245_104186363 | 177 |
| 612 | 3300009101 | Ga0105247_10180034 | Ga0105247_101800343 | 177 |
| 613 | 3300009148 | Ga0105243_10091093 | Ga0105243_100910933 | 177 |
| 614 | 3300009177 | Ga0105248_10002074 | Ga0105248_100020749 | 177 |
| 615 | 3300009177 | Ga0105248_10018068 | Ga0105248_100180689 | 177 |
| 616 | 3300009177 | Ga0105248_10141310 | Ga0105248_101413103 | 177 |
| 617 | 3300009177 | Ga0105248_10431634 | Ga0105248_104316342 | 177 |
| 618 | 3300009177 | Ga0105248_10995729 | Ga0105248_109957291 | 177 |
| 619 | 3300009177 | Ga0105248_11263997 | Ga0105248_112639971 | 177 |
| 620 | 3300009177 | Ga0105248_12572893 | Ga0105248_125728931 | 177 |
| 621 | 3300009545 | Ga0105237_10080261 | Ga0105237_100802612 | 177 |
| 622 | 3300009553 | Ga0105249_10266929 | Ga0105249_102669292 | 177 |
| 623 | 3300009553 | Ga0105249_10757998 | Ga0105249_107579982 | 177 |
| 624 | 3300010375 | Ga0105239_10789428 | Ga0105239_107894282 | 177 |
| 625 | 3300010375 | Ga0105239_12005190 | Ga0105239_120051901 | 177 |
| 626 | 3300011119 | Ga0105246_10194636 | Ga0105246_101946362 | 177 |
| 627 | 3300013100 | Ga0157373_10001146 | Ga0157373_1000114618 | 177 |
| 628 | 3300013102 | Ga0157371_10001270 | Ga0157371_1000127013 | 177 |
| 629 | 3300013104 | Ga0157370_10031257 | Ga0157370_100312573 | 177 |
| 630 | 3300013104 | Ga0157370_10034216 | Ga0157370_100342164 | 177 |
| 631 | 3300013104 | Ga0157370_10113007 | Ga0157370_101130072 | 177 |
| 632 | 3300013104 | Ga0157370_10770293 | Ga0157370_107702931 | 177 |
| 633 | 3300013105 | Ga0157369_10112017 | Ga0157369_101120173 | 177 |
| 634 | 3300013296 | Ga0157374_10001312 | Ga0157374_100013129 | 177 |
| 635 | 3300013296 | Ga0157374_10003097 | Ga0157374_1000309714 | 177 |
| 636 | 3300013297 | Ga0157378_10005399 | Ga0157378_1000539912 | 177 |
| 637 | 3300013297 | Ga0157378_10285543 | Ga0157378_102855434 | 177 |
| 638 | 3300013297 | Ga0157378_10486939 | Ga0157378_104869392 | 177 |
| 639 | 3300013306 | Ga0163162_10005459 | Ga0163162_100054598 | 177 |
| 640 | 3300013306 | Ga0163162_10057652 | Ga0163162_100576521 | 177 |
| 641 | 3300013306 | Ga0163162_10073420 | Ga0163162_100734202 | 177 |
| 642 | 3300013306 | Ga0163162_10104564 | Ga0163162_101045643 | 177 |
| 643 | 3300013306 | Ga0163162_11047736 | Ga0163162_110477362 | 177 |
| 644 | 3300013307 | Ga0157372_10002798 | Ga0157372_100027988 | 177 |
| 645 | 3300013307 | Ga0157372_10064232 | Ga0157372_100642322 | 177 |
| 646 | 3300013307 | Ga0157372_10082910 | Ga0157372_100829104 | 177 |
| 647 | 3300013307 | Ga0157372_10125410 | Ga0157372_101254104 | 177 |
| 648 | 3300013307 | Ga0157372_10257457 | Ga0157372_102574572 | 177 |
| 649 | 3300013307 | Ga0157372_11037427 | Ga0157372_110374272 | 177 |
| 650 | 3300013307 | Ga0157372_11791555 | Ga0157372_117915552 | 177 |
| 651 | 3300013308 | Ga0157375_10002469 | Ga0157375_1000246910 | 177 |
| 652 | 3300013308 | Ga0157375_10038200 | Ga0157375_100382002 | 177 |
| 653 | 3300013308 | Ga0157375_10052859 | Ga0157375_100528596 | 177 |
| 654 | 3300013308 | Ga0157375_10117630 | Ga0157375_101176303 | 177 |
| 655 | 3300013308 | Ga0157375_10150785 | Ga0157375_101507852 | 177 |
| 656 | 3300013308 | Ga0157375_10684861 | Ga0157375_106848612 | 177 |
| 657 | 3300013308 | Ga0157375_10713973 | Ga0157375_107139732 | 177 |
| 658 | 3300013308 | Ga0157375_10995462 | Ga0157375_109954622 | 177 |
| 659 | 3300014325 | Ga0163163_10015342 | Ga0163163_100153421 | 177 |
| 660 | 3300014325 | Ga0163163_10054422 | Ga0163163_100544223 | 177 |
| 661 | 3300014325 | Ga0163163_10134510 | Ga0163163_101345103 | 177 |
| 662 | 3300014325 | Ga0163163_10751405 | Ga0163163_107514052 | 177 |
| 663 | 3300014326 | Ga0157380_10064658 | Ga0157380_100646584 | 177 |
| 664 | 3300014326 | Ga0157380_10139268 | Ga0157380_101392682 | 177 |
| 665 | 3300014745 | Ga0157377_10016528 | Ga0157377_100165283 | 177 |
| 666 | 3300014745 | Ga0157377_10343305 | Ga0157377_103433052 | 177 |
| 667 | 3300014968 | Ga0157379_10000858 | Ga0157379_100008589 | 177 |
| 668 | 3300014968 | Ga0157379_10004449 | Ga0157379_100044497 | 177 |
| 669 | 3300014969 | Ga0157376_10012373 | Ga0157376_100123735 | 177 |
| 670 | 3300014969 | Ga0157376_10477196 | Ga0157376_104771962 | 177 |
| 671 | 3300014969 | Ga0157376_11076075 | Ga0157376_110760752 | 177 |
| 672 | 3300017792 | Ga0163161_10010199 | Ga0163161_100101997 | 177 |
| 673 | 3300017792 | Ga0163161_10021494 | Ga0163161_100214945 | 177 |
| 674 | 3300017792 | Ga0163161_10195601 | Ga0163161_101956012 | 177 |
| 675 | 3300017792 | Ga0163161_10723215 | Ga0163161_107232152 | 177 |
| 676 | 3300017792 | Ga0163161_10841969 | Ga0163161_108419692 | 177 |
| 677 | 3300020081 | Ga0206354_10723169 | Ga0206354_107231692 | 177 |
| 678 | 3300025315 | Ga0207697_10000414 | Ga0207697_100004149 | 177 |
| 679 | 3300025315 | Ga0207697_10008388 | Ga0207697_100083884 | 177 |
| 680 | 3300025315 | Ga0207697_10019659 | Ga0207697_100196592 | 177 |
| 681 | 3300025321 | Ga0207656_10016976 | Ga0207656_100169765 | 177 |
| 682 | 3300025893 | Ga0207682_10000882 | Ga0207682_100008824 | 177 |
| 683 | 3300025893 | Ga0207682_10001053 | Ga0207682_1000105311 | 177 |
| 684 | 3300025900 | Ga0207710_10091805 | Ga0207710_100918052 | 177 |
| 685 | 3300025901 | Ga0207688_10001416 | Ga0207688_100014169 | 177 |
| 686 | 3300025903 | Ga0207680_10000458 | Ga0207680_1000045817 | 177 |
| 687 | 3300025903 | Ga0207680_10018773 | Ga0207680_100187733 | 177 |
| 688 | 3300025903 | Ga0207680_10042029 | Ga0207680_100420293 | 177 |
| 689 | 3300025903 | Ga0207680_10056995 | Ga0207680_100569954 | 177 |
| 690 | 3300025903 | Ga0207680_10067693 | Ga0207680_100676932 | 177 |
| 691 | 3300025904 | Ga0207647_10095485 | Ga0207647_100954852 | 177 |
| 692 | 3300025906 | Ga0207699_10001757 | Ga0207699_1000175712 | 177 |
| 693 | 3300025907 | Ga0207645_10000308 | Ga0207645_1000030818 | 177 |
| 694 | 3300025907 | Ga0207645_10000661 | Ga0207645_1000066138 | 177 |
| 695 | 3300025907 | Ga0207645_10001318 | Ga0207645_100013184 | 177 |
| 696 | 3300025907 | Ga0207645_10070649 | Ga0207645_100706493 | 177 |
| 697 | 3300025907 | Ga0207645_10279160 | Ga0207645_102791602 | 177 |
| 698 | 3300025907 | Ga0207645_10462481 | Ga0207645_104624812 | 177 |
| 699 | 3300025908 | Ga0207643_10000515 | Ga0207643_1000051512 | 177 |
| 700 | 3300025908 | Ga0207643_10006397 | Ga0207643_100063972 | 177 |
| 701 | 3300025908 | Ga0207643_10039127 | Ga0207643_100391271 | 177 |
| 702 | 3300025908 | Ga0207643_10229113 | Ga0207643_102291132 | 177 |
| 703 | 3300025909 | Ga0207705_10591113 | Ga0207705_105911131 | 177 |
| 704 | 3300025911 | Ga0207654_10589145 | Ga0207654_105891451 | 177 |
| 705 | 3300025912 | Ga0207707_10075114 | Ga0207707_100751142 | 177 |
| 706 | 3300025912 | Ga0207707_10256342 | Ga0207707_102563422 | 177 |
| 707 | 3300025913 | Ga0207695_10060223 | Ga0207695_100602233 | 177 |
| 708 | 3300025914 | Ga0207671_10142546 | Ga0207671_101425463 | 177 |
| 709 | 3300025915 | Ga0207693_10020414 | Ga0207693_100204147 | 177 |
| 710 | 3300025916 | Ga0207663_10003837 | Ga0207663_100038375 | 177 |
| 711 | 3300025917 | Ga0207660_10028314 | Ga0207660_100283142 | 177 |
| 712 | 3300025917 | Ga0207660_10078716 | Ga0207660_100787162 | 177 |
| 713 | 3300025918 | Ga0207662_10007274 | Ga0207662_100072746 | 177 |
| 714 | 3300025918 | Ga0207662_10158243 | Ga0207662_101582432 | 177 |
| 715 | 3300025919 | Ga0207657_10010916 | Ga0207657_100109168 | 177 |
| 716 | 3300025919 | Ga0207657_10022078 | Ga0207657_100220783 | 177 |
| 717 | 3300025919 | Ga0207657_10031129 | Ga0207657_100311294 | 177 |
| 718 | 3300025920 | Ga0207649_10010264 | Ga0207649_100102642 | 177 |
| 719 | 3300025920 | Ga0207649_10025326 | Ga0207649_100253263 | 177 |
| 720 | 3300025920 | Ga0207649_10123864 | Ga0207649_101238642 | 177 |
| 721 | 3300025920 | Ga0207649_10285277 | Ga0207649_102852772 | 177 |
| 722 | 3300025920 | Ga0207649_10594754 | Ga0207649_105947542 | 177 |
| 723 | 3300025921 | Ga0207652_10031111 | Ga0207652_100311114 | 177 |
| 724 | 3300025921 | Ga0207652_10322812 | Ga0207652_103228122 | 177 |
| 725 | 3300025921 | Ga0207652_10353757 | Ga0207652_103537572 | 177 |
| 726 | 3300025921 | Ga0207652_10858534 | Ga0207652_108585342 | 177 |
| 727 | 3300025923 | Ga0207681_10013968 | Ga0207681_100139685 | 177 |
| 728 | 3300025923 | Ga0207681_10042165 | Ga0207681_100421652 | 177 |
| 729 | 3300025923 | Ga0207681_10077700 | Ga0207681_100777002 | 177 |
| 730 | 3300025923 | Ga0207681_10080022 | Ga0207681_100800224 | 177 |
| 731 | 3300025923 | Ga0207681_10198461 | Ga0207681_101984612 | 177 |
| 732 | 3300025923 | Ga0207681_10199963 | Ga0207681_101999633 | 177 |
| 733 | 3300025925 | Ga0207650_10007692 | Ga0207650_100076927 | 177 |
| 734 | 3300025925 | Ga0207650_10023409 | Ga0207650_100234095 | 177 |
| 735 | 3300025925 | Ga0207650_10081552 | Ga0207650_100815522 | 177 |
| 736 | 3300025925 | Ga0207650_10100240 | Ga0207650_101002402 | 177 |
| 737 | 3300025925 | Ga0207650_10176364 | Ga0207650_101763643 | 177 |
| 738 | 3300025925 | Ga0207650_10177682 | Ga0207650_101776822 | 177 |
| 739 | 3300025925 | Ga0207650_10272078 | Ga0207650_102720783 | 177 |
| 740 | 3300025925 | Ga0207650_10303583 | Ga0207650_103035833 | 177 |
| 741 | 3300025925 | Ga0207650_10320427 | Ga0207650_103204273 | 177 |
| 742 | 3300025925 | Ga0207650_10657315 | Ga0207650_106573152 | 177 |
| 743 | 3300025926 | Ga0207659_10001947 | Ga0207659_100019479 | 177 |
| 744 | 3300025926 | Ga0207659_10008878 | Ga0207659_100088784 | 177 |
| 745 | 3300025926 | Ga0207659_10058286 | Ga0207659_100582862 | 177 |
| 746 | 3300025926 | Ga0207659_10239508 | Ga0207659_102395081 | 177 |
| 747 | 3300025926 | Ga0207659_10648046 | Ga0207659_106480462 | 177 |
| 748 | 3300025927 | Ga0207687_10446015 | Ga0207687_104460152 | 177 |
| 749 | 3300025928 | Ga0207700_10036111 | Ga0207700_100361115 | 177 |
| 750 | 3300025929 | Ga0207664_10150946 | Ga0207664_101509461 | 177 |
| 751 | 3300025929 | Ga0207664_10368711 | Ga0207664_103687112 | 177 |
| 752 | 3300025931 | Ga0207644_10002335 | Ga0207644_100023357 | 177 |
| 753 | 3300025931 | Ga0207644_10004658 | Ga0207644_100046586 | 177 |
| 754 | 3300025931 | Ga0207644_10011896 | Ga0207644_100118967 | 177 |
| 755 | 3300025931 | Ga0207644_10077256 | Ga0207644_100772564 | 177 |
| 756 | 3300025932 | Ga0207690_10051257 | Ga0207690_100512573 | 177 |
| 757 | 3300025932 | Ga0207690_10241125 | Ga0207690_102411252 | 177 |
| 758 | 3300025932 | Ga0207690_11194368 | Ga0207690_111943681 | 177 |
| 759 | 3300025932 | Ga0207690_11298065 | Ga0207690_112980651 | 177 |
| 760 | 3300025933 | Ga0207706_10002095 | Ga0207706_1000209517 | 177 |
| 761 | 3300025933 | Ga0207706_10003433 | Ga0207706_100034337 | 177 |
| 762 | 3300025933 | Ga0207706_10044681 | Ga0207706_100446815 | 177 |
| 763 | 3300025933 | Ga0207706_10046409 | Ga0207706_100464092 | 177 |
| 764 | 3300025933 | Ga0207706_10132342 | Ga0207706_101323422 | 177 |
| 765 | 3300025933 | Ga0207706_10323910 | Ga0207706_103239102 | 177 |
| 766 | 3300025933 | Ga0207706_10332122 | Ga0207706_103321222 | 177 |
| 767 | 3300025933 | Ga0207706_10453825 | Ga0207706_104538252 | 177 |
| 768 | 3300025935 | Ga0207709_10446596 | Ga0207709_104465962 | 177 |
| 769 | 3300025936 | Ga0207670_10023785 | Ga0207670_100237855 | 177 |
| 770 | 3300025936 | Ga0207670_10267540 | Ga0207670_102675402 | 177 |
| 771 | 3300025936 | Ga0207670_10339691 | Ga0207670_103396912 | 177 |
| 772 | 3300025936 | Ga0207670_10654939 | Ga0207670_106549392 | 177 |
| 773 | 3300025937 | Ga0207669_10062451 | Ga0207669_100624512 | 177 |
| 774 | 3300025937 | Ga0207669_10218692 | Ga0207669_102186922 | 177 |
| 775 | 3300025937 | Ga0207669_10272264 | Ga0207669_102722642 | 177 |
| 776 | 3300025937 | Ga0207669_10432810 | Ga0207669_104328102 | 177 |
| 777 | 3300025938 | Ga0207704_10267081 | Ga0207704_102670813 | 177 |
| 778 | 3300025938 | Ga0207704_10285633 | Ga0207704_102856331 | 177 |
| 779 | 3300025938 | Ga0207704_10492556 | Ga0207704_104925562 | 177 |
| 780 | 3300025940 | Ga0207691_10000016 | Ga0207691_100000169 | 177 |
| 781 | 3300025940 | Ga0207691_10000249 | Ga0207691_1000024921 | 177 |
| 782 | 3300025940 | Ga0207691_10010436 | Ga0207691_100104369 | 177 |
| 783 | 3300025940 | Ga0207691_10023071 | Ga0207691_100230713 | 177 |
| 784 | 3300025940 | Ga0207691_10031686 | Ga0207691_100316862 | 177 |
| 785 | 3300025940 | Ga0207691_10043297 | Ga0207691_100432974 | 177 |
| 786 | 3300025940 | Ga0207691_10054464 | Ga0207691_100544641 | 177 |
| 787 | 3300025940 | Ga0207691_10088467 | Ga0207691_100884672 | 177 |
| 788 | 3300025941 | Ga0207711_10015792 | Ga0207711_100157924 | 177 |
| 789 | 3300025941 | Ga0207711_10028790 | Ga0207711_100287905 | 177 |
| 790 | 3300025941 | Ga0207711_10129172 | Ga0207711_101291722 | 177 |
| 791 | 3300025941 | Ga0207711_10184264 | Ga0207711_101842643 | 177 |
| 792 | 3300025941 | Ga0207711_10262548 | Ga0207711_102625482 | 177 |
| 793 | 3300025941 | Ga0207711_11032127 | Ga0207711_110321271 | 177 |
| 794 | 3300025942 | Ga0207689_10002125 | Ga0207689_1000212516 | 177 |
| 795 | 3300025942 | Ga0207689_10006079 | Ga0207689_1000607912 | 177 |
| 796 | 3300025942 | Ga0207689_10130410 | Ga0207689_101304103 | 177 |
| 797 | 3300025944 | Ga0207661_10162532 | Ga0207661_101625321 | 177 |
| 798 | 3300025945 | Ga0207679_10023735 | Ga0207679_100237356 | 177 |
| 799 | 3300025945 | Ga0207679_10102883 | Ga0207679_101028832 | 177 |
| 800 | 3300025945 | Ga0207679_10246549 | Ga0207679_102465492 | 177 |
| 801 | 3300025945 | Ga0207679_10589948 | Ga0207679_105899481 | 177 |
| 802 | 3300025945 | Ga0207679_10780569 | Ga0207679_107805692 | 177 |
| 803 | 3300025949 | Ga0207667_10007488 | Ga0207667_100074885 | 177 |
| 804 | 3300025949 | Ga0207667_10065531 | Ga0207667_100655313 | 177 |
| 805 | 3300025949 | Ga0207667_10074508 | Ga0207667_100745082 | 177 |
| 806 | 3300025949 | Ga0207667_10395391 | Ga0207667_103953913 | 177 |
| 807 | 3300025949 | Ga0207667_10465475 | Ga0207667_104654752 | 177 |
| 808 | 3300025949 | Ga0207667_10541642 | Ga0207667_105416422 | 177 |
| 809 | 3300025949 | Ga0207667_10638834 | Ga0207667_106388342 | 177 |
| 810 | 3300025960 | Ga0207651_10001976 | Ga0207651_100019763 | 177 |
| 811 | 3300025960 | Ga0207651_10006459 | Ga0207651_100064594 | 177 |
| 812 | 3300025960 | Ga0207651_10031705 | Ga0207651_100317052 | 177 |
| 813 | 3300025960 | Ga0207651_10046413 | Ga0207651_100464134 | 177 |
| 814 | 3300025960 | Ga0207651_10130259 | Ga0207651_101302592 | 177 |
| 815 | 3300025960 | Ga0207651_10278674 | Ga0207651_102786742 | 177 |
| 816 | 3300025961 | Ga0207712_10459007 | Ga0207712_104590072 | 177 |
| 817 | 3300025972 | Ga0207668_10002554 | Ga0207668_100025546 | 177 |
| 818 | 3300025972 | Ga0207668_10020730 | Ga0207668_100207302 | 177 |
| 819 | 3300025972 | Ga0207668_10021360 | Ga0207668_100213605 | 177 |
| 820 | 3300025972 | Ga0207668_10292192 | Ga0207668_102921922 | 177 |
| 821 | 3300025972 | Ga0207668_10394978 | Ga0207668_103949782 | 177 |
| 822 | 3300025972 | Ga0207668_10424551 | Ga0207668_104245511 | 177 |
| 823 | 3300025972 | Ga0207668_10642539 | Ga0207668_106425392 | 177 |
| 824 | 3300025972 | Ga0207668_10983613 | Ga0207668_109836131 | 177 |
| 825 | 3300025981 | Ga0207640_10026417 | Ga0207640_100264174 | 177 |
| 826 | 3300025981 | Ga0207640_10031013 | Ga0207640_100310132 | 177 |
| 827 | 3300025981 | Ga0207640_10079950 | Ga0207640_100799503 | 177 |
| 828 | 3300025981 | Ga0207640_10107359 | Ga0207640_101073593 | 177 |
| 829 | 3300025981 | Ga0207640_10264209 | Ga0207640_102642092 | 177 |
| 830 | 3300025981 | Ga0207640_10931322 | Ga0207640_109313222 | 177 |
| 831 | 3300025986 | Ga0207658_10001272 | Ga0207658_100012727 | 177 |
| 832 | 3300025986 | Ga0207658_10018261 | Ga0207658_100182616 | 177 |
| 833 | 3300025986 | Ga0207658_10031594 | Ga0207658_100315942 | 177 |
| 834 | 3300025986 | Ga0207658_10043012 | Ga0207658_100430122 | 177 |
| 835 | 3300025986 | Ga0207658_10086331 | Ga0207658_100863314 | 177 |
| 836 | 3300025986 | Ga0207658_10240136 | Ga0207658_102401364 | 177 |
| 837 | 3300026023 | Ga0207677_10007009 | Ga0207677_100070096 | 177 |
| 838 | 3300026023 | Ga0207677_10008530 | Ga0207677_100085305 | 177 |
| 839 | 3300026023 | Ga0207677_10029996 | Ga0207677_100299964 | 177 |
| 840 | 3300026035 | Ga0207703_10002267 | Ga0207703_1000226714 | 177 |
| 841 | 3300026035 | Ga0207703_10011900 | Ga0207703_100119008 | 177 |
| 842 | 3300026035 | Ga0207703_10601799 | Ga0207703_106017992 | 177 |
| 843 | 3300026035 | Ga0207703_11220166 | Ga0207703_112201662 | 177 |
| 844 | 3300026041 | Ga0207639_10068248 | Ga0207639_100682482 | 177 |
| 845 | 3300026041 | Ga0207639_10330041 | Ga0207639_103300412 | 177 |
| 846 | 3300026041 | Ga0207639_10835911 | Ga0207639_108359112 | 177 |
| 847 | 3300026067 | Ga0207678_10013575 | Ga0207678_100135757 | 177 |
| 848 | 3300026067 | Ga0207678_10199353 | Ga0207678_101993531 | 177 |
| 849 | 3300026067 | Ga0207678_10202123 | Ga0207678_102021232 | 177 |
| 850 | 3300026067 | Ga0207678_10274939 | Ga0207678_102749392 | 177 |
| 851 | 3300026067 | Ga0207678_10634197 | Ga0207678_106341971 | 177 |
| 852 | 3300026075 | Ga0207708_10035511 | Ga0207708_100355113 | 177 |
| 853 | 3300026075 | Ga0207708_10044106 | Ga0207708_100441064 | 177 |
| 854 | 3300026078 | Ga0207702_10020077 | Ga0207702_100200777 | 177 |
| 855 | 3300026078 | Ga0207702_10287372 | Ga0207702_102873723 | 177 |
| 856 | 3300026078 | Ga0207702_10377091 | Ga0207702_103770912 | 177 |
| 857 | 3300026088 | Ga0207641_10000374 | Ga0207641_1000037454 | 177 |
| 858 | 3300026088 | Ga0207641_10015912 | Ga0207641_100159122 | 177 |
| 859 | 3300026088 | Ga0207641_10065192 | Ga0207641_100651922 | 177 |
| 860 | 3300026088 | Ga0207641_10109938 | Ga0207641_101099384 | 177 |
| 861 | 3300026088 | Ga0207641_10143071 | Ga0207641_101430712 | 177 |
| 862 | 3300026088 | Ga0207641_10288356 | Ga0207641_102883561 | 177 |
| 863 | 3300026088 | Ga0207641_10404453 | Ga0207641_104044532 | 177 |
| 864 | 3300026088 | Ga0207641_10548303 | Ga0207641_105483031 | 177 |
| 865 | 3300026088 | Ga0207641_10690017 | Ga0207641_106900172 | 177 |
| 866 | 3300026089 | Ga0207648_10000523 | Ga0207648_1000052324 | 177 |
| 867 | 3300026089 | Ga0207648_10002934 | Ga0207648_100029342 | 177 |
| 868 | 3300026089 | Ga0207648_10006980 | Ga0207648_1000698011 | 177 |
| 869 | 3300026089 | Ga0207648_10029738 | Ga0207648_100297382 | 177 |
| 870 | 3300026089 | Ga0207648_10038007 | Ga0207648_100380076 | 177 |
| 871 | 3300026089 | Ga0207648_10147528 | Ga0207648_101475281 | 177 |
| 872 | 3300026089 | Ga0207648_10262650 | Ga0207648_102626502 | 177 |
| 873 | 3300026095 | Ga0207676_10017764 | Ga0207676_100177642 | 177 |
| 874 | 3300026095 | Ga0207676_10031925 | Ga0207676_100319251 | 177 |
| 875 | 3300026095 | Ga0207676_10065863 | Ga0207676_100658634 | 177 |
| 876 | 3300026095 | Ga0207676_10142805 | Ga0207676_101428052 | 177 |
| 877 | 3300026116 | Ga0207674_10004098 | Ga0207674_100040988 | 177 |
| 878 | 3300026116 | Ga0207674_10157640 | Ga0207674_101576402 | 177 |
| 879 | 3300026118 | Ga0207675_100000635 | Ga0207675_10000063519 | 177 |
| 880 | 3300026118 | Ga0207675_100002219 | Ga0207675_1000022192 | 177 |
| 881 | 3300026118 | Ga0207675_100086258 | Ga0207675_1000862582 | 177 |
| 882 | 3300026118 | Ga0207675_100222891 | Ga0207675_1002228912 | 177 |
| 883 | 3300026118 | Ga0207675_100784130 | Ga0207675_1007841302 | 177 |
| 884 | 3300026121 | Ga0207683_10000476 | Ga0207683_1000047628 | 177 |
| 885 | 3300026121 | Ga0207683_10000672 | Ga0207683_1000067245 | 177 |
| 886 | 3300026121 | Ga0207683_10002112 | Ga0207683_1000211215 | 177 |
| 887 | 3300026121 | Ga0207683_10007275 | Ga0207683_100072755 | 177 |
| 888 | 3300026121 | Ga0207683_10025522 | Ga0207683_100255226 | 177 |
| 889 | 3300026121 | Ga0207683_10325511 | Ga0207683_103255112 | 177 |
| 890 | 3300026121 | Ga0207683_10511714 | Ga0207683_105117142 | 177 |
| 891 | 3300026142 | Ga0207698_10005967 | Ga0207698_100059678 | 177 |
| 892 | 3300026142 | Ga0207698_10131938 | Ga0207698_101319382 | 177 |
| 893 | 3300026142 | Ga0207698_10152720 | Ga0207698_101527202 | 177 |
| 894 | 3300026142 | Ga0207698_10166207 | Ga0207698_101662072 | 177 |
| 895 | 3300026142 | Ga0207698_10541797 | Ga0207698_105417972 | 177 |
| 896 | 3300027552 | Ga0209982_1042253 | Ga0209982_10422531 | 177 |
| 897 | 3300027614 | Ga0209970_1035631 | Ga0209970_10356312 | 177 |
| 898 | 3300027617 | Ga0210002_1017004 | Ga0210002_10170042 | 177 |
| 899 | 3300027665 | Ga0209983_1035371 | Ga0209983_10353712 | 177 |
| 900 | 3300027682 | Ga0209971_1028050 | Ga0209971_10280502 | 177 |
| 901 | 3300027717 | Ga0209998_10002560 | Ga0209998_100025603 | 177 |
| 902 | 3300027876 | Ga0209974_10004113 | Ga0209974_100041132 | 177 |
| 903 | 3300027876 | Ga0209974_10015442 | Ga0209974_100154424 | 177 |
| 904 | 3300027907 | Ga0207428_10130264 | Ga0207428_101302642 | 177 |
| 905 | 3300028379 | Ga0268266_10005562 | Ga0268266_100055628 | 177 |
| 906 | 3300028379 | Ga0268266_10128475 | Ga0268266_101284752 | 177 |
| 907 | 3300028379 | Ga0268266_10201074 | Ga0268266_102010743 | 177 |
| 908 | 3300028379 | Ga0268266_10277511 | Ga0268266_102775113 | 177 |
| 909 | 3300028380 | Ga0268265_10312345 | Ga0268265_103123453 | 177 |
| 910 | 3300028380 | Ga0268265_10325203 | Ga0268265_103252032 | 177 |
| 911 | 3300028380 | Ga0268265_10428092 | Ga0268265_104280922 | 177 |
| 912 | 3300028380 | Ga0268265_10895298 | Ga0268265_108952982 | 177 |
| 913 | 3300028381 | Ga0268264_10002850 | Ga0268264_100028507 | 177 |
| 914 | 3300028381 | Ga0268264_10007025 | Ga0268264_100070252 | 177 |
| 915 | 3300028381 | Ga0268264_10019003 | Ga0268264_100190034 | 177 |
| 916 | 3300028381 | Ga0268264_10102882 | Ga0268264_101028822 | 177 |
| 917 | 3300028381 | Ga0268264_10349600 | Ga0268264_103496003 | 177 |
| 918 | 3300028381 | Ga0268264_10424774 | Ga0268264_104247743 | 177 |
| 919 | 3300028381 | Ga0268264_10565830 | Ga0268264_105658302 | 177 |
| 920 | 3300031548 | Ga0307408_100007603 | Ga0307408_1000076035 | 177 |
| 921 | 3300031731 | Ga0307405_10668172 | Ga0307405_106681722 | 177 |
| 922 | 3300031824 | Ga0307413_10011768 | Ga0307413_100117682 | 177 |
| 923 | 3300031852 | Ga0307410_10002137 | Ga0307410_100021377 | 177 |
| 924 | 3300031901 | Ga0307406_10009643 | Ga0307406_100096435 | 177 |
| 925 | 3300031903 | Ga0307407_10005873 | Ga0307407_100058732 | 177 |
| 926 | 3300031911 | Ga0307412_10067247 | Ga0307412_100672474 | 177 |
| 927 | 3300031995 | Ga0307409_100000504 | Ga0307409_10000050415 | 177 |
| 928 | 3300032002 | Ga0307416_100385982 | Ga0307416_1003859823 | 177 |
| 929 | 3300032005 | Ga0307411_10004100 | Ga0307411_100041004 | 177 |
| 930 | 3300032126 | Ga0307415_100644037 | Ga0307415_1006440372 | 177 |
| 931 | 3300035115 | Ga0373941_0260880 | Ga0373941_0260880_77_622 | 177 |
| 932 | 3300035118 | Ga0373954_0101671 | Ga0373954_0101671_61_594 | 177 |
| 933 | 3300035120 | Ga0373957_0174728 | Ga0373957_0174728_243_776 | 177 |
| 934 | 3300035691 | Ga0373931_0071372 | Ga0373931_0071372_458_1033 | 177 |
| 935 | 3300036401 | Ga0373937_0094946 | Ga0373937_0094946_1057_1590 | 177 |
| 936 | 3300041452 | Ga0451793_0118162 | Ga0451793_0118162_37_591 | 177 |
| 937 | 3300041501 | Ga0451845_0443829 | Ga0451845_0443829_81_614 | 177 |
| 938 | 3300044658 | Ga0466972_0000519 | Ga0466972_0000519_10015_10548 | 177 |
| 939 | 3300044683 | Ga0466965_0104298 | Ga0466965_0104298_289_822 | 177 |
| 940 | 3300044719 | Ga0466971_0297144 | Ga0466971_0297144_77_610 | 177 |
| 941 | 3300045051 | Ga0451576_0309025 | Ga0451576_0309025_573_1199 | 177 |
| 942 | 3300045051 | Ga0451576_0735579 | Ga0451576_0735579_109_708 | 177 |
| 943 | 3300045836 | Ga0466958_0064880 | Ga0466958_0064880_1137_1718 | 177 |
| 944 | 3300045976 | Ga0466967_0204818 | Ga0466967_0204818_177_752 | 177 |
| 945 | 3300045976 | Ga0466967_1035178 | Ga0466967_1035178_61_642 | 177 |
| 946 | 3300048903 | Ga0496100_0265577 | Ga0496100_0265577_422_955 | 177 |
| 947 | 3300048903 | Ga0496100_0306145 | Ga0496100_0306145_154_687 | 177 |
| 948 | 3300048904 | Ga0496101_0197531 | Ga0496101_0197531_225_758 | 177 |
| 949 | 3300048904 | Ga0496101_0377397 | Ga0496101_0377397_350_883 | 177 |
| 950 | 3300048904 | Ga0496101_0384185 | Ga0496101_0384185_343_885 | 177 |
| 951 | 3300048905 | Ga0496102_0004620 | Ga0496102_0004620_8977_9552 | 177 |
| 952 | 3300048905 | Ga0496102_0555021 | Ga0496102_0555021_440_973 | 177 |
| 953 | 3300048905 | Ga0496102_0686043 | Ga0496102_0686043_353_895 | 177 |
| 954 | 3300048906 | Ga0496103_0039856 | Ga0496103_0039856_106_681 | 177 |
| 955 | 3300048907 | Ga0496104_0021708 | Ga0496104_0021708_1074_1607 | 177 |
| 956 | 3300048908 | Ga0496105_0055654 | Ga0496105_0055654_910_1443 | 177 |
| 957 | 3300048908 | Ga0496105_0384780 | Ga0496105_0384780_433_966 | 177 |
| 958 | 3300048909 | Ga0496106_0011048 | Ga0496106_0011048_3817_4350 | 177 |
| 959 | 3300048909 | Ga0496106_0038445 | Ga0496106_0038445_1602_2135 | 177 |
| 960 | 3300048909 | Ga0496106_0040940 | Ga0496106_0040940_2190_2765 | 177 |
| 961 | 3300048910 | Ga0496107_0083807 | Ga0496107_0083807_1143_1676 | 177 |
| 962 | 3300048910 | Ga0496107_0126064 | Ga0496107_0126064_38_571 | 177 |
| 963 | 3300048911 | Ga0496108_0031541 | Ga0496108_0031541_1490_2023 | 177 |
| 964 | 3300048911 | Ga0496108_0134527 | Ga0496108_0134527_14_556 | 177 |
| 965 | 3300048912 | Ga0496109_0046869 | Ga0496109_0046869_3195_3728 | 177 |
| 966 | 3300048912 | Ga0496109_0134673 | Ga0496109_0134673_1171_1713 | 177 |
| 967 | 3300048912 | Ga0496109_0711188 | Ga0496109_0711188_337_906 | 177 |
| 968 | 3300048912 | Ga0496109_1627422 | Ga0496109_1627422_36_569 | 177 |
| 969 | 3300048913 | Ga0496110_0007678 | Ga0496110_0007678_2655_3188 | 177 |
| 970 | 3300048913 | Ga0496110_0209853 | Ga0496110_0209853_875_1408 | 177 |
| 971 | 3300048914 | Ga0496111_0499194 | Ga0496111_0499194_98_673 | 177 |
| 972 | 3300048915 | Ga0496112_0650621 | Ga0496112_0650621_86_628 | 177 |
| 973 | 3300048915 | Ga0496112_1027392 | Ga0496112_1027392_135_668 | 177 |
| 974 | 3300048916 | Ga0496113_0280626 | Ga0496113_0280626_754_1287 | 177 |
| 975 | 3300048917 | Ga0496114_0082369 | Ga0496114_0082369_1028_1561 | 177 |
| 976 | 3300048917 | Ga0496114_0191517 | Ga0496114_0191517_748_1281 | 177 |
| 977 | 3300049572 | Ga0501036_0282528 | Ga0501036_0282528_430_963 | 177 |
| 978 | 3300049583 | Ga0501067_0181537 | Ga0501067_0181537_37_570 | 177 |
| 979 | 3300050509 | nmdc:mga0qj67_635875_c1 | nmdc:mga0qj67_635875_c1_159_692 | 177 |
| 980 | 3300050511 | nmdc:mga08y16_73941_c1 | nmdc:mga08y16_73941_c1_842_1375 | 177 |
| 981 | 3300050512 | nmdc:mga0n895_226561_c1 | nmdc:mga0n895_226561_c1_1058_1591 | 177 |
| 982 | 3300050512 | nmdc:mga0n895_402025_c1 | nmdc:mga0n895_402025_c1_78_686 | 177 |
| 983 | 3300050514 | nmdc:mga08x19_114952_c1 | nmdc:mga08x19_114952_c1_402_953 | 177 |
| 984 | 3300053084 | Ga0495595_0034147 | Ga0495595_0034147_1388_1921 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9355 | 31 | 176 |
| 2g0f-assembly1.cif.gz_A | crystal structure of p144a mutant of e.coli ccmg protein | 0.9325 | 31 | 176 |
| 1z5y-assembly1.cif.gz_E | crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg | 0.9275 | 45 | 176 |
| 1kng-assembly1.cif.gz_A | crystal structure of ccmg reducing oxidoreductase at 1.14 a | 0.9175 | 38 | 174 |
| 3kh9-assembly1.cif.gz_A | crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa | 0.9155 | 27 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9354 | 31 | 176 | 3.40.30.10 |
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9175 | 38 | 174 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9116 | 31 | 176 | 3.40.30.10 |
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8713 | 43 | 174 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8713 | 37 | 175 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0X5A7-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9925 | 36 | 177 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A7W0X5A7-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9856 | 36 | 177 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A536Z3B2-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9747 | 72 | 177 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A1H7XPN3-F1-model_v4 | Cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE | 0.9717 | 23 | 177 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A3M0YK98-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.969 | 58 | 177 |
GO:0005886
GO:0015036 GO:0017004 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar