F487481

General Info

Members Datasets Scaffolds Average Seq Length
984 309 984 179

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0309025|Ga0451576_0309025_573_1199
Length 208
Sequence MATPSMPQSPADTPNASLDFAVAASRSGASRTKMLRWSLPLAIFVVVLGFLFVGLFRDPREVPSPLIGKPAPAFSLAQLHQPERTLATADMRGQVWLLNVWASWCVSCRVEHPLLVDLAKANIVPVIGLAYKDKPSDGLAWLAANGDPYKLSIVDLDGRVGIDFGVYGVPETFVIDKAGIIRYKQIGPLTADALKQTILPLVHELQKS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.57
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011967 3300001991 Bacteria 1571
2 JGI24743J22301_10099337 3300001991 Bacteria 626
3 Ga0065712_10151734 3300005290 Bacteria 1365
4 Ga0065715_10187171 3300005293 Bacteria 1438
5 Ga0065715_10326888 3300005293 Bacteria 990
6 Ga0070658_10092931 3300005327 Bacteria 2488
7 Ga0070658_10414064 3300005327 Bacteria 1158
8 Ga0070658_11080494 3300005327 Bacteria 698
9 Ga0070676_10000068 3300005328 Bacteria 34674
10 Ga0070676_10006880 3300005328 Bacteria 6089
11 Ga0070676_10022743 3300005328 Bacteria 3517
12 Ga0070676_10035719 3300005328 Bacteria 2860
13 Ga0070676_10086142 3300005328 Bacteria 1916
14 Ga0070676_10103743 3300005328 Bacteria 1761
15 Ga0070676_10246745 3300005328 Bacteria 1190
16 Ga0070683_100012992 3300005329 Bacteria 7248
17 Ga0070683_100103084 3300005329 Bacteria 2688
18 Ga0070690_100024623 3300005330 Bacteria 3702
19 Ga0070690_100085249 3300005330 Bacteria 2072
20 Ga0070670_100000715 3300005331 Bacteria 25793
21 Ga0070670_100003749 3300005331 Bacteria 12653
22 Ga0070670_100033776 3300005331 Bacteria 4405
23 Ga0070670_100103612 3300005331 Bacteria 2451
24 Ga0070670_100152545 3300005331 Bacteria 2000
25 Ga0070670_100178905 3300005331 Bacteria 1841
26 Ga0070670_100218977 3300005331 Bacteria 1656
27 Ga0070670_100436779 3300005331 Bacteria 1159
28 Ga0070670_101281117 3300005331 Bacteria 671
29 Ga0070677_10000388 3300005333 Bacteria 15432
30 Ga0070677_10171071 3300005333 Bacteria 1027
31 Ga0068869_100000926 3300005334 Bacteria 16926
32 Ga0068869_100006606 3300005334 Bacteria 7361
33 Ga0068869_100028520 3300005334 Bacteria 3901
34 Ga0068869_100145204 3300005334 Bacteria 1835
35 Ga0068869_100756798 3300005334 Bacteria 832
36 Ga0070666_10003246 3300005335 Bacteria 9877
37 Ga0070666_10007042 3300005335 Bacteria 6931
38 Ga0070666_10008121 3300005335 Bacteria 6500
39 Ga0070666_10083410 3300005335 Bacteria 2186
40 Ga0070666_10194203 3300005335 Bacteria 1427
41 Ga0070666_10320368 3300005335 Bacteria 1106
42 Ga0070680_100027477 3300005336 Bacteria 4556
43 Ga0070680_100322877 3300005336 Bacteria 1310
44 Ga0070682_100021911 3300005337 Bacteria 3777
45 Ga0070682_100158228 3300005337 Bacteria 1562
46 Ga0070682_100589750 3300005337 Bacteria 876
47 Ga0070682_100656375 3300005337 Bacteria 836
48 Ga0068868_100002572 3300005338 Bacteria 12589
49 Ga0068868_100079357 3300005338 Bacteria 2629
50 Ga0068868_100198409 3300005338 Bacteria 1672
51 Ga0068868_100693990 3300005338 Bacteria 910
52 Ga0068868_101078430 3300005338 Bacteria 738
53 Ga0070660_100000932 3300005339 Bacteria 19511
54 Ga0070660_100000940 3300005339 Bacteria 19449
55 Ga0070660_100007488 3300005339 Bacteria 7609
56 Ga0070660_100486734 3300005339 Bacteria 1025
57 Ga0070689_100012276 3300005340 Bacteria 6165
58 Ga0070689_100015305 3300005340 Bacteria 5590
59 Ga0070689_100259775 3300005340 Bacteria 1435
60 Ga0070689_100368870 3300005340 Bacteria 1208
61 Ga0070691_10061770 3300005341 Bacteria 1803
62 Ga0070691_10137834 3300005341 Bacteria 1241
63 Ga0070691_10223564 3300005341 Bacteria 999
64 Ga0070687_100021747 3300005343 Bacteria 3021
65 Ga0070687_100703179 3300005343 Bacteria 706
66 Ga0070661_100002505 3300005344 Bacteria 12584
67 Ga0070661_100014641 3300005344 Bacteria 5529
68 Ga0070661_100015498 3300005344 Bacteria 5379
69 Ga0070661_100051278 3300005344 Bacteria 3020
70 Ga0070661_100059703 3300005344 Bacteria 2797
71 Ga0070661_100083645 3300005344 Bacteria 2357
72 Ga0070661_100119280 3300005344 Bacteria 1975
73 Ga0070661_100176031 3300005344 Bacteria 1626
74 Ga0070661_100940507 3300005344 Bacteria 715
75 Ga0070692_10016880 3300005345 Bacteria 3479
76 Ga0070692_10019473 3300005345 Bacteria 3275
77 Ga0070668_100000779 3300005347 Bacteria 21987
78 Ga0070668_100015675 3300005347 Bacteria 5668
79 Ga0070668_100038163 3300005347 Bacteria 3670
80 Ga0070668_100066591 3300005347 Bacteria 2796
81 Ga0070668_100075157 3300005347 Bacteria 2637
82 Ga0070668_100326096 3300005347 Bacteria 1294
83 Ga0070669_100000668 3300005353 Bacteria 25208
84 Ga0070669_100075780 3300005353 Bacteria 2496
85 Ga0070669_100159309 3300005353 Bacteria 1753
86 Ga0070669_100181960 3300005353 Bacteria 1645
87 Ga0070669_100258639 3300005353 Bacteria 1388
88 Ga0070669_100425203 3300005353 Bacteria 1091
89 Ga0070675_100006613 3300005354 Bacteria 8910
90 Ga0070675_100007266 3300005354 Bacteria 8544
91 Ga0070675_100017405 3300005354 Bacteria 5711
92 Ga0070675_100275795 3300005354 Bacteria 1477
93 Ga0070671_100008688 3300005355 Bacteria 8152
94 Ga0070671_100010442 3300005355 Bacteria 7450
95 Ga0070671_100015993 3300005355 Bacteria 6061
96 Ga0070671_100019898 3300005355 Bacteria 5469
97 Ga0070671_100021917 3300005355 Bacteria 5219
98 Ga0070671_100059730 3300005355 Bacteria 3173
99 Ga0070671_100145096 3300005355 Bacteria 2003
100 Ga0070671_100303335 3300005355 Bacteria 1360
101 Ga0070674_100060097 3300005356 Bacteria 2648
102 Ga0070674_100073559 3300005356 Bacteria 2423
103 Ga0070674_100087028 3300005356 Bacteria 2245
104 Ga0070674_100143575 3300005356 Bacteria 1794
105 Ga0070674_100165920 3300005356 Bacteria 1679
106 Ga0070674_100370020 3300005356 Bacteria 1163
107 Ga0070673_100002041 3300005364 Bacteria 12191
108 Ga0070673_100005216 3300005364 Bacteria 8297
109 Ga0070673_100009308 3300005364 Bacteria 6591
110 Ga0070673_100045466 3300005364 Bacteria 3405
111 Ga0070673_100063676 3300005364 Bacteria 2935
112 Ga0070673_100168630 3300005364 Bacteria 1867
113 Ga0070673_101726739 3300005364 Bacteria 592
114 Ga0070688_100008334 3300005365 Bacteria 5625
115 Ga0070688_100065847 3300005365 Bacteria 2304
116 Ga0070688_100097897 3300005365 Bacteria 1929
117 Ga0070659_100004339 3300005366 Bacteria 10128
118 Ga0070659_100016845 3300005366 Bacteria 5491
119 Ga0070659_100055767 3300005366 Bacteria 3115
120 Ga0070659_100066836 3300005366 Bacteria 2850
121 Ga0070659_100093999 3300005366 Bacteria 2407
122 Ga0070659_100105503 3300005366 Bacteria 2271
123 Ga0070659_100836738 3300005366 Bacteria 802
124 Ga0070659_100896040 3300005366 Bacteria 775
125 Ga0070667_100001232 3300005367 Bacteria 23249
126 Ga0070667_100006774 3300005367 Bacteria 9514
127 Ga0070667_100017793 3300005367 Bacteria 5891
128 Ga0070667_100018925 3300005367 Bacteria 5710
129 Ga0070667_100065015 3300005367 Bacteria 3097
130 Ga0070667_100223895 3300005367 Bacteria 1675
131 Ga0070667_100707091 3300005367 Bacteria 933
132 Ga0070709_10026307 3300005434 Bacteria 3447
133 Ga0070709_10222483 3300005434 Bacteria 1347
134 Ga0070714_100015237 3300005435 Bacteria 6184
135 Ga0070714_100051617 3300005435 Bacteria 3507
136 Ga0070714_100074888 3300005435 Bacteria 2936
137 Ga0070714_100225801 3300005435 Bacteria 1723
138 Ga0070714_100689497 3300005435 Bacteria 985
139 Ga0070714_100836881 3300005435 Bacteria 892
140 Ga0070713_100009864 3300005436 Bacteria 6868
141 Ga0070713_100339207 3300005436 Bacteria 1392
142 Ga0070710_10013007 3300005437 Bacteria 4151
143 Ga0070701_10198336 3300005438 Bacteria 1185
144 Ga0070701_10450311 3300005438 Bacteria 826
145 Ga0070711_100000893 3300005439 Bacteria 15682
146 Ga0070711_100008242 3300005439 Bacteria 6375
147 Ga0070711_100610761 3300005439 Bacteria 911
148 Ga0070700_100024694 3300005441 Bacteria 3532
149 Ga0070708_100039252 3300005445 Bacteria 4141
150 Ga0070708_100132128 3300005445 Bacteria 2311
151 Ga0070708_100960367 3300005445 Bacteria 802
152 Ga0070663_100120258 3300005455 Bacteria 1983
153 Ga0070663_100159856 3300005455 Bacteria 1733
154 Ga0070663_100254210 3300005455 Bacteria 1392
155 Ga0070663_100373992 3300005455 Bacteria 1159
156 Ga0070663_100499535 3300005455 Bacteria 1010
157 Ga0070663_100615248 3300005455 Bacteria 915
158 Ga0070678_100000107 3300005456 Bacteria 32267
159 Ga0070678_100001539 3300005456 Bacteria 12334
160 Ga0070678_100005219 3300005456 Bacteria 7474
161 Ga0070678_100009357 3300005456 Bacteria 5930
162 Ga0070678_100298741 3300005456 Bacteria 1368
163 Ga0070662_100001459 3300005457 Bacteria 14573
164 Ga0070662_100004307 3300005457 Bacteria 8989
165 Ga0070662_100010358 3300005457 Bacteria 6114
166 Ga0070662_100027223 3300005457 Bacteria 3966
167 Ga0070681_10023269 3300005458 Bacteria 6230
168 Ga0070681_10345751 3300005458 Bacteria 1397
169 Ga0068867_100012431 3300005459 Bacteria 6023
170 Ga0068867_100018079 3300005459 Bacteria 5010
171 Ga0068867_100022440 3300005459 Bacteria 4514
172 Ga0068867_100034757 3300005459 Bacteria 3655
173 Ga0068867_100059084 3300005459 Bacteria 2842
174 Ga0068867_100228837 3300005459 Bacteria 1502
175 Ga0070685_10000221 3300005466 Bacteria 37567
176 Ga0070685_10012098 3300005466 Bacteria 4526
177 Ga0070706_100168852 3300005467 Bacteria 2043
178 Ga0070706_100221626 3300005467 Bacteria 1765
179 Ga0070706_100377675 3300005467 Bacteria 1320
180 Ga0070707_100231214 3300005468 Bacteria 1800
181 Ga0070707_100275861 3300005468 Bacteria 1634
182 Ga0070698_100265589 3300005471 Bacteria 1648
183 Ga0070699_100063919 3300005518 Bacteria 3191
184 Ga0070679_100084886 3300005530 Bacteria 3153
185 Ga0070679_100157620 3300005530 Bacteria 2245
186 Ga0070679_100212974 3300005530 Bacteria 1895
187 Ga0070679_100362935 3300005530 Bacteria 1396
188 Ga0070679_100374790 3300005530 Bacteria 1370
189 Ga0070679_100390337 3300005530 Bacteria 1338
190 Ga0070679_100471605 3300005530 Bacteria 1199
191 Ga0070684_100060574 3300005535 Bacteria 3311
192 Ga0070684_100078312 3300005535 Bacteria 2920
193 Ga0070684_100149456 3300005535 Bacteria 2115
194 Ga0070697_100002608 3300005536 Bacteria 13872
195 Ga0070697_100145522 3300005536 Bacteria 1994
196 Ga0068853_100007107 3300005539 Bacteria 8959
197 Ga0068853_100016729 3300005539 Bacteria 6040
198 Ga0068853_100021638 3300005539 Bacteria 5364
199 Ga0068853_100123757 3300005539 Bacteria 2309
200 Ga0068853_100237163 3300005539 Bacteria 1670
201 Ga0068853_100696449 3300005539 Bacteria 969
202 Ga0070672_100000287 3300005543 Bacteria 28567
203 Ga0070672_100014874 3300005543 Bacteria 5525
204 Ga0070672_100034011 3300005543 Bacteria 3865
205 Ga0070672_100034324 3300005543 Bacteria 3850
206 Ga0070672_100039318 3300005543 Bacteria 3622
207 Ga0070672_100084569 3300005543 Bacteria 2548
208 Ga0070672_100229339 3300005543 Bacteria 1560
209 Ga0070672_101023419 3300005543 Bacteria 732
210 Ga0070686_100004007 3300005544 Bacteria 8098
211 Ga0070686_100460519 3300005544 Bacteria 979
212 Ga0070695_100089044 3300005545 Bacteria 2056
213 Ga0070695_100838974 3300005545 Bacteria 739
214 Ga0070696_100174908 3300005546 Bacteria 1589
215 Ga0070696_100408373 3300005546 Bacteria 1064
216 Ga0070696_100442582 3300005546 Bacteria 1024
217 Ga0070693_100009100 3300005547 Bacteria 4929
218 Ga0070693_100018449 3300005547 Bacteria 3645
219 Ga0070693_100046276 3300005547 Bacteria 2470
220 Ga0070665_100005852 3300005548 Bacteria 12613
221 Ga0070665_100023957 3300005548 Bacteria 6147
222 Ga0070665_100027393 3300005548 Bacteria 5741
223 Ga0070665_100090615 3300005548 Bacteria 3063
224 Ga0070665_100223190 3300005548 Bacteria 1885
225 Ga0070665_100345746 3300005548 Bacteria 1492
226 Ga0070704_100127167 3300005549 Bacteria 1968
227 Ga0070704_100360052 3300005549 Bacteria 1230
228 Ga0068855_100004813 3300005563 Bacteria 16483
229 Ga0068855_100021114 3300005563 Bacteria 7808
230 Ga0068855_100054928 3300005563 Bacteria 4679
231 Ga0068855_100071153 3300005563 Bacteria 4045
232 Ga0068855_100209465 3300005563 Bacteria 2191
233 Ga0068855_100236360 3300005563 Bacteria 2044
234 Ga0068855_100592144 3300005563 Bacteria 1197
235 Ga0068855_100922448 3300005563 Bacteria 921
236 Ga0068855_101642162 3300005563 Bacteria 657
237 Ga0070664_100003781 3300005564 Bacteria 12209
238 Ga0070664_100005952 3300005564 Bacteria 9854
239 Ga0070664_100014836 3300005564 Bacteria 6359
240 Ga0070664_100025762 3300005564 Bacteria 4876
241 Ga0070664_100062291 3300005564 Bacteria 3180
242 Ga0070664_100065064 3300005564 Bacteria 3110
243 Ga0070664_100191243 3300005564 Bacteria 1823
244 Ga0070664_100305936 3300005564 Bacteria 1437
245 Ga0070664_100869586 3300005564 Bacteria 844
246 Ga0068857_100006994 3300005577 Bacteria 9707
247 Ga0068857_100087027 3300005577 Bacteria 2795
248 Ga0068857_100983352 3300005577 Bacteria 812
249 Ga0068854_100003585 3300005578 Bacteria 9708
250 Ga0068854_100039367 3300005578 Bacteria 3330
251 Ga0068854_100041321 3300005578 Bacteria 3258
252 Ga0068856_100003384 3300005614 Bacteria 16150
253 Ga0068856_100017101 3300005614 Bacteria 7030
254 Ga0068856_100035684 3300005614 Bacteria 4874
255 Ga0068856_100049046 3300005614 Bacteria 4161
256 Ga0068856_100073484 3300005614 Bacteria 3386
257 Ga0070702_100088814 3300005615 Bacteria 1869
258 Ga0070702_100514234 3300005615 Bacteria 882
259 Ga0068852_100001607 3300005616 Bacteria 15383
260 Ga0068852_100007039 3300005616 Bacteria 8191
261 Ga0068852_100007656 3300005616 Bacteria 7898
262 Ga0068852_100039794 3300005616 Bacteria 3961
263 Ga0068852_100049718 3300005616 Bacteria 3588
264 Ga0068852_100147063 3300005616 Bacteria 2187
265 Ga0068852_100194924 3300005616 Bacteria 1914
266 Ga0068852_100268517 3300005616 Bacteria 1641
267 Ga0068852_101294605 3300005616 Bacteria 750
268 Ga0068859_100003177 3300005617 Bacteria 16715
269 Ga0068859_100020837 3300005617 Bacteria 6580
270 Ga0068859_100056234 3300005617 Bacteria 3959
271 Ga0068859_100206562 3300005617 Bacteria 2049
272 Ga0068859_100228030 3300005617 Bacteria 1951
273 Ga0068859_100710813 3300005617 Bacteria 1095
274 Ga0068859_101024317 3300005617 Bacteria 907
275 Ga0068864_100001285 3300005618 Bacteria 20888
276 Ga0068864_100002616 3300005618 Bacteria 14866
277 Ga0068864_100008284 3300005618 Bacteria 8574
278 Ga0068864_100054096 3300005618 Bacteria 3464
279 Ga0068864_100107381 3300005618 Bacteria 2483
280 Ga0068864_100495626 3300005618 Bacteria 1174
281 Ga0068866_10000652 3300005718 Bacteria 15743
282 Ga0068866_10035833 3300005718 Bacteria 2426
283 Ga0068861_100003709 3300005719 Bacteria 10193
284 Ga0068861_100005006 3300005719 Bacteria 8930
285 Ga0068861_100075027 3300005719 Bacteria 2631
286 Ga0068861_100126387 3300005719 Bacteria 2069
287 Ga0068861_100153025 3300005719 Bacteria 1894
288 Ga0068861_100322956 3300005719 Bacteria 1345
289 Ga0068861_100765574 3300005719 Bacteria 903
290 Ga0068851_10002374 3300005834 Bacteria 8270
291 Ga0068851_10007294 3300005834 Bacteria 5071
292 Ga0068851_10012519 3300005834 Bacteria 4000
293 Ga0068851_10101164 3300005834 Bacteria 1529
294 Ga0068851_10119698 3300005834 Bacteria 1414
295 Ga0068851_10520052 3300005834 Bacteria 716
296 Ga0068870_10009006 3300005840 Bacteria 4516
297 Ga0068870_10192004 3300005840 Bacteria 1233
298 Ga0068870_10209989 3300005840 Bacteria 1185
299 Ga0068863_100002985 3300005841 Bacteria 16732
300 Ga0068863_100021433 3300005841 Bacteria 6168
301 Ga0068863_100029135 3300005841 Bacteria 5271
302 Ga0068863_100033720 3300005841 Bacteria 4878
303 Ga0068863_100074693 3300005841 Bacteria 3207
304 Ga0068863_100100410 3300005841 Bacteria 2750
305 Ga0068863_100230039 3300005841 Bacteria 1788
306 Ga0068863_100789797 3300005841 Bacteria 947
307 Ga0068863_101362936 3300005841 Bacteria 717
308 Ga0068858_100000603 3300005842 Bacteria 37588
309 Ga0068858_100021506 3300005842 Bacteria 6027
310 Ga0068858_100021707 3300005842 Bacteria 5999
311 Ga0068858_100209689 3300005842 Bacteria 1844
312 Ga0068860_100005493 3300005843 Bacteria 12840
313 Ga0068860_100005815 3300005843 Bacteria 12419
314 Ga0068860_100066041 3300005843 Bacteria 3436
315 Ga0068860_100150580 3300005843 Bacteria 2240
316 Ga0068860_100166829 3300005843 Bacteria 2126
317 Ga0068860_100234028 3300005843 Bacteria 1786
318 Ga0068860_100362200 3300005843 Bacteria 1429
319 Ga0068860_100466610 3300005843 Bacteria 1257
320 Ga0068860_100557381 3300005843 Bacteria 1149
321 Ga0068862_100029825 3300005844 Bacteria 4596
322 Ga0068862_100058971 3300005844 Bacteria 3294
323 Ga0068862_101405373 3300005844 Bacteria 701
324 Ga0070715_10012346 3300006163 Bacteria 3107
325 Ga0070716_100001339 3300006173 Bacteria 10909
326 Ga0070716_100543585 3300006173 Bacteria 865
327 Ga0070712_100005043 3300006175 Bacteria 8177
328 Ga0070712_100027301 3300006175 Bacteria 3811
329 Ga0070712_100691315 3300006175 Bacteria 869
330 Ga0097621_100001308 3300006237 Bacteria 17135
331 Ga0097621_100020593 3300006237 Bacteria 5083
332 Ga0097621_100266181 3300006237 Unclassified 1505
333 Ga0097621_100304330 3300006237 Bacteria 1409
334 Ga0097621_101056642 3300006237 Bacteria 761
335 Ga0068871_100001077 3300006358 Bacteria 18307
336 Ga0068871_100022355 3300006358 Bacteria 4874
337 Ga0068871_100109754 3300006358 Bacteria 2320
338 Ga0068871_100204799 3300006358 Bacteria 1705
339 Ga0068871_100230476 3300006358 Bacteria 1607
340 Ga0075428_100028198 3300006844 Bacteria 6210
341 Ga0075430_100652244 3300006846 Bacteria 868
342 Ga0075433_10056206 3300006852 Bacteria 3437
343 Ga0075434_100035035 3300006871 Bacteria 4962
344 Ga0075434_100146274 3300006871 Bacteria 2384
345 Ga0075434_100204116 3300006871 Bacteria 1997
346 Ga0068865_100015998 3300006881 Bacteria 4791
347 Ga0068865_100045238 3300006881 Bacteria 3017
348 Ga0068865_100053326 3300006881 Bacteria 2805
349 Ga0068865_100145066 3300006881 Bacteria 1794
350 Ga0068865_100248865 3300006881 Bacteria 1402
351 Ga0075436_100090334 3300006914 Bacteria 2129
352 Ga0075436_100221437 3300006914 Bacteria 1343
353 Ga0097620_100003176 3300006931 Bacteria 16715
354 Ga0097620_100020837 3300006931 Bacteria 6580
355 Ga0097620_100056234 3300006931 Bacteria 3959
356 Ga0097620_100206554 3300006931 Bacteria 2049
357 Ga0097620_100228024 3300006931 Bacteria 1951
358 Ga0097620_100710841 3300006931 Bacteria 1095
359 Ga0097620_101024316 3300006931 Bacteria 907
360 Ga0075435_100011479 3300007076 Bacteria 6520
361 Ga0099794_10237603 3300007265 Unclassified 938
362 Ga0105251_10276745 3300009011 Bacteria 759
363 Ga0105240_10002428 3300009093 Bacteria 29958
364 Ga0105240_10018683 3300009093 Bacteria 9288
365 Ga0105240_10036989 3300009093 Bacteria 6274
366 Ga0105240_10047724 3300009093 Bacteria 5418
367 Ga0111539_10257698 3300009094 Bacteria 2031
368 Ga0105245_10005497 3300009098 Bacteria 11132
369 Ga0105245_10014037 3300009098 Bacteria 6975
370 Ga0105245_10020376 3300009098 Bacteria 5816
371 Ga0105245_10209674 3300009098 Bacteria 1875
372 Ga0105245_10418636 3300009098 Bacteria 1342
373 Ga0105247_10180034 3300009101 Bacteria 1410
374 Ga0114129_10294637 3300009147 Bacteria 2164
375 Ga0105243_10091093 3300009148 Bacteria 2510
376 Ga0105241_10014237 3300009174 Bacteria 5827
377 Ga0105241_10022261 3300009174 Bacteria 4692
378 Ga0105241_10111769 3300009174 Bacteria 2188
379 Ga0105242_10002918 3300009176 Bacteria 13363
380 Ga0105248_10002074 3300009177 Bacteria 22178
381 Ga0105248_10018068 3300009177 Bacteria 7784
382 Ga0105248_10026830 3300009177 Bacteria 6408
383 Ga0105248_10141310 3300009177 Bacteria 2716
384 Ga0105248_10431634 3300009177 Bacteria 1484
385 Ga0105248_10995729 3300009177 Bacteria 947
386 Ga0105248_11263997 3300009177 Bacteria 835
387 Ga0105248_12572893 3300009177 Bacteria 580
388 Ga0105237_10080261 3300009545 Bacteria 3253
389 Ga0105237_10354688 3300009545 Bacteria 1471
390 Ga0105238_10001044 3300009551 Bacteria 28027
391 Ga0105238_10027188 3300009551 Bacteria 5829
392 Ga0105238_10067698 3300009551 Bacteria 3572
393 Ga0105249_10226118 3300009553 Bacteria 1844
394 Ga0105249_10266929 3300009553 Bacteria 1703
395 Ga0105249_10757998 3300009553 Bacteria 1033
396 Ga0105239_10033050 3300010375 Bacteria 5682
397 Ga0105239_10371690 3300010375 Bacteria 1616
398 Ga0105239_10691721 3300010375 Bacteria 1166
399 Ga0105239_10789428 3300010375 Bacteria 1088
400 Ga0105239_11598816 3300010375 Bacteria 754
401 Ga0105239_12005190 3300010375 Bacteria 672
402 Ga0105246_10119344 3300011119 Bacteria 1951
403 Ga0105246_10194636 3300011119 Bacteria 1572
404 Ga0157329_1000632 3300012491 Bacteria 1478
405 Ga0157373_10001146 3300013100 Bacteria 20311
406 Ga0157373_10001663 3300013100 Bacteria 16979
407 Ga0157373_10040985 3300013100 Bacteria 3313
408 Ga0157373_10572589 3300013100 Bacteria 820
409 Ga0157371_10001270 3300013102 Bacteria 26598
410 Ga0157371_10307675 3300013102 Bacteria 1148
411 Ga0157370_10028427 3300013104 Bacteria 5499
412 Ga0157370_10031257 3300013104 Bacteria 5210
413 Ga0157370_10034216 3300013104 Bacteria 4950
414 Ga0157370_10113007 3300013104 Bacteria 2538
415 Ga0157370_10580363 3300013104 Bacteria 1027
416 Ga0157370_10770293 3300013104 Bacteria 876
417 Ga0157369_10014238 3300013105 Bacteria 8986
418 Ga0157369_10112017 3300013105 Bacteria 2900
419 Ga0157369_10825111 3300013105 Bacteria 952
420 Ga0157374_10000565 3300013296 Bacteria 32833
421 Ga0157374_10001312 3300013296 Bacteria 21166
422 Ga0157374_10003097 3300013296 Bacteria 13957
423 Ga0157374_11147403 3300013296 Bacteria 798
424 Ga0157378_10005399 3300013297 Bacteria 11207
425 Ga0157378_10031024 3300013297 Bacteria 4720
426 Ga0157378_10171201 3300013297 Bacteria 2037
427 Ga0157378_10285543 3300013297 Bacteria 1592
428 Ga0157378_10486939 3300013297 Bacteria 1230
429 Ga0163162_10005459 3300013306 Bacteria 12283
430 Ga0163162_10022644 3300013306 Bacteria 6194
431 Ga0163162_10057652 3300013306 Bacteria 3912
432 Ga0163162_10073420 3300013306 Bacteria 3477
433 Ga0163162_10087446 3300013306 Bacteria 3195
434 Ga0163162_10104564 3300013306 Bacteria 2926
435 Ga0163162_11047736 3300013306 Bacteria 923
436 Ga0157372_10002798 3300013307 Bacteria 18848
437 Ga0157372_10004393 3300013307 Bacteria 15042
438 Ga0157372_10064232 3300013307 Bacteria 4119
439 Ga0157372_10082910 3300013307 Bacteria 3631
440 Ga0157372_10125410 3300013307 Bacteria 2952
441 Ga0157372_10257457 3300013307 Bacteria 2026
442 Ga0157372_11037427 3300013307 Bacteria 949
443 Ga0157372_11791555 3300013307 Bacteria 706
444 Ga0157375_10002469 3300013308 Bacteria 16013
445 Ga0157375_10004526 3300013308 Bacteria 12081
446 Ga0157375_10038200 3300013308 Bacteria 4608
447 Ga0157375_10052859 3300013308 Bacteria 3995
448 Ga0157375_10117630 3300013308 Bacteria 2764
449 Ga0157375_10150785 3300013308 Bacteria 2460
450 Ga0157375_10684861 3300013308 Bacteria 1180
451 Ga0157375_10713973 3300013308 Bacteria 1156
452 Ga0157375_10995462 3300013308 Bacteria 978
453 Ga0163163_10000689 3300014325 Bacteria 28712
454 Ga0163163_10010956 3300014325 Bacteria 8191
455 Ga0163163_10015342 3300014325 Bacteria 7081
456 Ga0163163_10054422 3300014325 Bacteria 3953
457 Ga0163163_10134510 3300014325 Bacteria 2513
458 Ga0163163_10751405 3300014325 Bacteria 1039
459 Ga0157380_10064658 3300014326 Bacteria 2938
460 Ga0157380_10139268 3300014326 Bacteria 2082
461 Ga0157377_10016528 3300014745 Bacteria 3797
462 Ga0157377_10343305 3300014745 Bacteria 999
463 Ga0157379_10000858 3300014968 Bacteria 24649
464 Ga0157379_10004449 3300014968 Bacteria 12018
465 Ga0157376_10007657 3300014969 Bacteria 7734
466 Ga0157376_10007747 3300014969 Bacteria 7696
467 Ga0157376_10012373 3300014969 Bacteria 6332
468 Ga0157376_10477196 3300014969 Bacteria 1221
469 Ga0157376_11076075 3300014969 Bacteria 829
470 Ga0157376_11313371 3300014969 Unclassified 753
471 Ga0163161_10010199 3300017792 Bacteria 6504
472 Ga0163161_10021494 3300017792 Bacteria 4534
473 Ga0163161_10167424 3300017792 Bacteria 1679
474 Ga0163161_10195601 3300017792 Bacteria 1556
475 Ga0163161_10723215 3300017792 Bacteria 831
476 Ga0163161_10841969 3300017792 Bacteria 773
477 Ga0206354_10723169 3300020081 Bacteria 1965
478 Ga0206354_11192541 3300020081 Bacteria 2529
479 Ga0213876_10184874 3300021384 Bacteria 1108
480 Ga0207697_10000414 3300025315 Bacteria 24140
481 Ga0207697_10008388 3300025315 Bacteria 4523
482 Ga0207697_10019659 3300025315 Bacteria 2767
483 Ga0207656_10016976 3300025321 Bacteria 2844
484 Ga0207656_10061127 3300025321 Bacteria 1653
485 Ga0207682_10000882 3300025893 Bacteria 13919
486 Ga0207682_10001053 3300025893 Bacteria 12703
487 Ga0207692_10005926 3300025898 Bacteria 4930
488 Ga0207692_10269429 3300025898 Bacteria 1026
489 Ga0207642_10000852 3300025899 Bacteria 9489
490 Ga0207710_10091805 3300025900 Bacteria 1422
491 Ga0207688_10001416 3300025901 Bacteria 12500
492 Ga0207680_10000458 3300025903 Bacteria 19273
493 Ga0207680_10018773 3300025903 Bacteria 3685
494 Ga0207680_10020828 3300025903 Bacteria 3540
495 Ga0207680_10042029 3300025903 Bacteria 2671
496 Ga0207680_10043021 3300025903 Bacteria 2646
497 Ga0207680_10056995 3300025903 Bacteria 2362
498 Ga0207680_10067693 3300025903 Bacteria 2201
499 Ga0207647_10095485 3300025904 Bacteria 1770
500 Ga0207685_10104526 3300025905 Bacteria 1217
501 Ga0207699_10001757 3300025906 Bacteria 10233
502 Ga0207645_10000308 3300025907 Bacteria 41052
503 Ga0207645_10000661 3300025907 Bacteria 28611
504 Ga0207645_10001318 3300025907 Bacteria 20383
505 Ga0207645_10068667 3300025907 Bacteria 2267
506 Ga0207645_10070649 3300025907 Bacteria 2233
507 Ga0207645_10279160 3300025907 Bacteria 1109
508 Ga0207645_10462481 3300025907 Bacteria 857
509 Ga0207643_10000515 3300025908 Bacteria 24751
510 Ga0207643_10006397 3300025908 Bacteria 6308
511 Ga0207643_10039127 3300025908 Bacteria 2667
512 Ga0207643_10101961 3300025908 Bacteria 1683
513 Ga0207643_10229113 3300025908 Bacteria 1139
514 Ga0207705_10591113 3300025909 Bacteria 863
515 Ga0207684_10685030 3300025910 Bacteria 872
516 Ga0207654_10003842 3300025911 Bacteria 7571
517 Ga0207654_10589145 3300025911 Bacteria 793
518 Ga0207707_10075114 3300025912 Bacteria 2948
519 Ga0207707_10106830 3300025912 Bacteria 2447
520 Ga0207707_10256342 3300025912 Bacteria 1519
521 Ga0207707_10270430 3300025912 Bacteria 1473
522 Ga0207695_10060223 3300025913 Bacteria 3931
523 Ga0207671_10142546 3300025914 Bacteria 1847
524 Ga0207671_10220291 3300025914 Bacteria 1486
525 Ga0207693_10001163 3300025915 Bacteria 23479
526 Ga0207693_10020414 3300025915 Bacteria 5270
527 Ga0207693_10032301 3300025915 Bacteria 4131
528 Ga0207663_10003837 3300025916 Bacteria 7420
529 Ga0207663_10027057 3300025916 Bacteria 3337
530 Ga0207660_10028314 3300025917 Bacteria 3831
531 Ga0207660_10078716 3300025917 Bacteria 2417
532 Ga0207660_10228576 3300025917 Bacteria 1462
533 Ga0207660_10276195 3300025917 Bacteria 1332
534 Ga0207660_10358902 3300025917 Bacteria 1169
535 Ga0207662_10007274 3300025918 Bacteria 6019
536 Ga0207662_10158243 3300025918 Bacteria 1445
537 Ga0207657_10000280 3300025919 Bacteria 54274
538 Ga0207657_10005254 3300025919 Bacteria 13564
539 Ga0207657_10005934 3300025919 Bacteria 12711
540 Ga0207657_10010916 3300025919 Bacteria 9040
541 Ga0207657_10019674 3300025919 Bacteria 6402
542 Ga0207657_10022078 3300025919 Bacteria 5973
543 Ga0207657_10031129 3300025919 Bacteria 4837
544 Ga0207657_10144962 3300025919 Bacteria 1938
545 Ga0207649_10010264 3300025920 Bacteria 5142
546 Ga0207649_10025326 3300025920 Bacteria 3457
547 Ga0207649_10095263 3300025920 Bacteria 1958
548 Ga0207649_10123864 3300025920 Bacteria 1746
549 Ga0207649_10254089 3300025920 Bacteria 1267
550 Ga0207649_10285277 3300025920 Bacteria 1202
551 Ga0207649_10490270 3300025920 Bacteria 933
552 Ga0207649_10594754 3300025920 Bacteria 850
553 Ga0207652_10007921 3300025921 Bacteria 8529
554 Ga0207652_10031111 3300025921 Bacteria 4479
555 Ga0207652_10322812 3300025921 Bacteria 1394
556 Ga0207652_10353757 3300025921 Bacteria 1326
557 Ga0207652_10858534 3300025921 Bacteria 803
558 Ga0207646_10012728 3300025922 Bacteria 8071
559 Ga0207646_10069627 3300025922 Bacteria 3142
560 Ga0207681_10013968 3300025923 Bacteria 4976
561 Ga0207681_10042165 3300025923 Bacteria 3047
562 Ga0207681_10077700 3300025923 Bacteria 2334
563 Ga0207681_10080022 3300025923 Bacteria 2304
564 Ga0207681_10198461 3300025923 Bacteria 1539
565 Ga0207681_10199963 3300025923 Bacteria 1534
566 Ga0207694_10009651 3300025924 Bacteria 7276
567 Ga0207694_10058569 3300025924 Bacteria 2996
568 Ga0207694_10235054 3300025924 Bacteria 1497
569 Ga0207650_10007692 3300025925 Bacteria 7340
570 Ga0207650_10014573 3300025925 Bacteria 5461
571 Ga0207650_10023409 3300025925 Bacteria 4380
572 Ga0207650_10081552 3300025925 Bacteria 2454
573 Ga0207650_10100240 3300025925 Bacteria 2228
574 Ga0207650_10176364 3300025925 Bacteria 1701
575 Ga0207650_10177682 3300025925 Bacteria 1695
576 Ga0207650_10272078 3300025925 Bacteria 1377
577 Ga0207650_10303583 3300025925 Bacteria 1304
578 Ga0207650_10320427 3300025925 Bacteria 1269
579 Ga0207650_10657315 3300025925 Bacteria 884
580 Ga0207659_10001947 3300025926 Bacteria 12255
581 Ga0207659_10008878 3300025926 Bacteria 6265
582 Ga0207659_10058286 3300025926 Bacteria 2772
583 Ga0207659_10239508 3300025926 Bacteria 1467
584 Ga0207659_10648046 3300025926 Bacteria 902
585 Ga0207687_10000741 3300025927 Bacteria 22128
586 Ga0207687_10009974 3300025927 Bacteria 6216
587 Ga0207687_10446015 3300025927 Bacteria 1072
588 Ga0207687_10563528 3300025927 Bacteria 957
589 Ga0207700_10031325 3300025928 Bacteria 3776
590 Ga0207700_10036111 3300025928 Bacteria 3566
591 Ga0207664_10009725 3300025929 Bacteria 6760
592 Ga0207664_10080459 3300025929 Bacteria 2648
593 Ga0207664_10112269 3300025929 Bacteria 2269
594 Ga0207664_10150946 3300025929 Bacteria 1974
595 Ga0207664_10368711 3300025929 Bacteria 1273
596 Ga0207644_10002123 3300025931 Bacteria 12863
597 Ga0207644_10002335 3300025931 Bacteria 12260
598 Ga0207644_10004658 3300025931 Bacteria 8914
599 Ga0207644_10011896 3300025931 Bacteria 5768
600 Ga0207644_10056245 3300025931 Bacteria 2838
601 Ga0207644_10077256 3300025931 Bacteria 2451
602 Ga0207690_10014956 3300025932 Bacteria 4699
603 Ga0207690_10051257 3300025932 Bacteria 2759
604 Ga0207690_10241125 3300025932 Bacteria 1392
605 Ga0207690_11194368 3300025932 Bacteria 635
606 Ga0207690_11298065 3300025932 Bacteria 608
607 Ga0207706_10002095 3300025933 Bacteria 19518
608 Ga0207706_10003433 3300025933 Bacteria 15131
609 Ga0207706_10044681 3300025933 Bacteria 3926
610 Ga0207706_10046409 3300025933 Bacteria 3846
611 Ga0207706_10049727 3300025933 Bacteria 3704
612 Ga0207706_10132342 3300025933 Bacteria 2194
613 Ga0207706_10243707 3300025933 Bacteria 1571
614 Ga0207706_10323910 3300025933 Bacteria 1341
615 Ga0207706_10332122 3300025933 Bacteria 1322
616 Ga0207706_10453825 3300025933 Bacteria 1108
617 Ga0207686_10000521 3300025934 Bacteria 24900
618 Ga0207709_10446596 3300025935 Bacteria 999
619 Ga0207670_10023785 3300025936 Bacteria 3819
620 Ga0207670_10267540 3300025936 Bacteria 1327
621 Ga0207670_10339691 3300025936 Bacteria 1186
622 Ga0207670_10654939 3300025936 Bacteria 866
623 Ga0207669_10062451 3300025937 Bacteria 2294
624 Ga0207669_10122910 3300025937 Bacteria 1766
625 Ga0207669_10218692 3300025937 Bacteria 1396
626 Ga0207669_10272264 3300025937 Bacteria 1272
627 Ga0207669_10432810 3300025937 Bacteria 1038
628 Ga0207704_10116095 3300025938 Bacteria 1821
629 Ga0207704_10267081 3300025938 Bacteria 1293
630 Ga0207704_10285633 3300025938 Bacteria 1256
631 Ga0207704_10492556 3300025938 Bacteria 986
632 Ga0207665_10004353 3300025939 Bacteria 9406
633 Ga0207691_10000016 3300025940 Bacteria 141024
634 Ga0207691_10000249 3300025940 Bacteria 53276
635 Ga0207691_10010436 3300025940 Bacteria 8910
636 Ga0207691_10023071 3300025940 Bacteria 5861
637 Ga0207691_10031686 3300025940 Bacteria 4933
638 Ga0207691_10043297 3300025940 Bacteria 4149
639 Ga0207691_10054464 3300025940 Bacteria 3648
640 Ga0207691_10088467 3300025940 Bacteria 2778
641 Ga0207711_10000448 3300025941 Bacteria 43007
642 Ga0207711_10015792 3300025941 Bacteria 6264
643 Ga0207711_10028790 3300025941 Bacteria 4678
644 Ga0207711_10129172 3300025941 Bacteria 2264
645 Ga0207711_10184264 3300025941 Bacteria 1900
646 Ga0207711_10262548 3300025941 Bacteria 1587
647 Ga0207711_11032127 3300025941 Bacteria 762
648 Ga0207689_10002125 3300025942 Bacteria 18643
649 Ga0207689_10006079 3300025942 Bacteria 10675
650 Ga0207689_10118222 3300025942 Bacteria 2180
651 Ga0207689_10130410 3300025942 Bacteria 2069
652 Ga0207661_10079457 3300025944 Bacteria 2703
653 Ga0207661_10162532 3300025944 Bacteria 1938
654 Ga0207661_10277832 3300025944 Bacteria 1496
655 Ga0207679_10023735 3300025945 Bacteria 4197
656 Ga0207679_10102883 3300025945 Bacteria 2237
657 Ga0207679_10246549 3300025945 Bacteria 1516
658 Ga0207679_10488415 3300025945 Bacteria 1097
659 Ga0207679_10589948 3300025945 Bacteria 1000
660 Ga0207679_10780569 3300025945 Bacteria 870
661 Ga0207667_10005138 3300025949 Bacteria 15985
662 Ga0207667_10007488 3300025949 Bacteria 13107
663 Ga0207667_10065531 3300025949 Bacteria 3788
664 Ga0207667_10074508 3300025949 Bacteria 3526
665 Ga0207667_10395391 3300025949 Bacteria 1407
666 Ga0207667_10457694 3300025949 Bacteria 1296
667 Ga0207667_10465475 3300025949 Bacteria 1284
668 Ga0207667_10541642 3300025949 Bacteria 1178
669 Ga0207667_10638834 3300025949 Bacteria 1071
670 Ga0207651_10001976 3300025960 Bacteria 9642
671 Ga0207651_10002125 3300025960 Bacteria 9356
672 Ga0207651_10006459 3300025960 Bacteria 6140
673 Ga0207651_10031705 3300025960 Bacteria 3383
674 Ga0207651_10046413 3300025960 Bacteria 2921
675 Ga0207651_10130259 3300025960 Bacteria 1924
676 Ga0207651_10278674 3300025960 Bacteria 1381
677 Ga0207712_10459007 3300025961 Bacteria 1082
678 Ga0207668_10002554 3300025972 Bacteria 10635
679 Ga0207668_10020730 3300025972 Bacteria 4183
680 Ga0207668_10021360 3300025972 Bacteria 4128
681 Ga0207668_10292192 3300025972 Bacteria 1341
682 Ga0207668_10394978 3300025972 Bacteria 1168
683 Ga0207668_10424551 3300025972 Bacteria 1129
684 Ga0207668_10642539 3300025972 Bacteria 928
685 Ga0207668_10983613 3300025972 Bacteria 753
686 Ga0207640_10018886 3300025981 Bacteria 4060
687 Ga0207640_10026417 3300025981 Bacteria 3525
688 Ga0207640_10031013 3300025981 Bacteria 3299
689 Ga0207640_10079950 3300025981 Bacteria 2230
690 Ga0207640_10107359 3300025981 Bacteria 1971
691 Ga0207640_10264209 3300025981 Bacteria 1343
692 Ga0207640_10931322 3300025981 Bacteria 761
693 Ga0207658_10001272 3300025986 Bacteria 19944
694 Ga0207658_10006610 3300025986 Bacteria 7902
695 Ga0207658_10018261 3300025986 Bacteria 4839
696 Ga0207658_10031594 3300025986 Bacteria 3761
697 Ga0207658_10043012 3300025986 Bacteria 3281
698 Ga0207658_10086331 3300025986 Bacteria 2420
699 Ga0207658_10240136 3300025986 Bacteria 1534
700 Ga0207658_10272447 3300025986 Bacteria 1447
701 Ga0207677_10000253 3300026023 Bacteria 41332
702 Ga0207677_10007009 3300026023 Bacteria 6201
703 Ga0207677_10008530 3300026023 Bacteria 5732
704 Ga0207677_10029996 3300026023 Bacteria 3465
705 Ga0207677_10117961 3300026023 Bacteria 1990
706 Ga0207677_11268081 3300026023 Bacteria 676
707 Ga0207703_10000517 3300026035 Bacteria 39928
708 Ga0207703_10002267 3300026035 Bacteria 16814
709 Ga0207703_10011900 3300026035 Bacteria 6776
710 Ga0207703_10601799 3300026035 Bacteria 1040
711 Ga0207703_11220166 3300026035 Bacteria 723
712 Ga0207639_10068248 3300026041 Bacteria 2770
713 Ga0207639_10330041 3300026041 Bacteria 1357
714 Ga0207639_10835911 3300026041 Bacteria 859
715 Ga0207678_10013575 3300026067 Bacteria 7152
716 Ga0207678_10092965 3300026067 Bacteria 2577
717 Ga0207678_10125132 3300026067 Bacteria 2193
718 Ga0207678_10199353 3300026067 Bacteria 1711
719 Ga0207678_10202123 3300026067 Bacteria 1699
720 Ga0207678_10274939 3300026067 Bacteria 1445
721 Ga0207678_10282617 3300026067 Bacteria 1424
722 Ga0207678_10634197 3300026067 Bacteria 938
723 Ga0207708_10035511 3300026075 Bacteria 3793
724 Ga0207708_10044106 3300026075 Bacteria 3398
725 Ga0207702_10009250 3300026078 Bacteria 8280
726 Ga0207702_10009791 3300026078 Bacteria 8039
727 Ga0207702_10020077 3300026078 Bacteria 5536
728 Ga0207702_10053604 3300026078 Bacteria 3415
729 Ga0207702_10287372 3300026078 Bacteria 1557
730 Ga0207702_10377091 3300026078 Bacteria 1363
731 Ga0207641_10000374 3300026088 Bacteria 53088
732 Ga0207641_10000610 3300026088 Bacteria 39160
733 Ga0207641_10015912 3300026088 Bacteria 6160
734 Ga0207641_10065192 3300026088 Bacteria 3115
735 Ga0207641_10109938 3300026088 Bacteria 2442
736 Ga0207641_10143071 3300026088 Bacteria 2160
737 Ga0207641_10288356 3300026088 Bacteria 1547
738 Ga0207641_10404453 3300026088 Bacteria 1311
739 Ga0207641_10548303 3300026088 Bacteria 1127
740 Ga0207641_10690017 3300026088 Bacteria 1005
741 Ga0207648_10000523 3300026089 Bacteria 42961
742 Ga0207648_10002934 3300026089 Bacteria 18047
743 Ga0207648_10006980 3300026089 Bacteria 11171
744 Ga0207648_10029738 3300026089 Bacteria 4844
745 Ga0207648_10038007 3300026089 Bacteria 4237
746 Ga0207648_10147528 3300026089 Bacteria 2075
747 Ga0207648_10262650 3300026089 Bacteria 1541
748 Ga0207676_10000167 3300026095 Bacteria 57507
749 Ga0207676_10017764 3300026095 Bacteria 5161
750 Ga0207676_10031925 3300026095 Bacteria 3963
751 Ga0207676_10065863 3300026095 Bacteria 2886
752 Ga0207676_10142805 3300026095 Bacteria 2052
753 Ga0207674_10000118 3300026116 Bacteria 92408
754 Ga0207674_10001292 3300026116 Bacteria 32705
755 Ga0207674_10004098 3300026116 Bacteria 17651
756 Ga0207674_10005648 3300026116 Bacteria 14829
757 Ga0207674_10157640 3300026116 Bacteria 2225
758 Ga0207675_100000635 3300026118 Bacteria 34445
759 Ga0207675_100002219 3300026118 Bacteria 19296
760 Ga0207675_100083843 3300026118 Bacteria 2990
761 Ga0207675_100086258 3300026118 Bacteria 2948
762 Ga0207675_100222891 3300026118 Bacteria 1817
763 Ga0207675_100429926 3300026118 Bacteria 1305
764 Ga0207675_100784130 3300026118 Bacteria 966
765 Ga0207683_10000476 3300026121 Bacteria 37318
766 Ga0207683_10000672 3300026121 Bacteria 31425
767 Ga0207683_10000965 3300026121 Bacteria 26325
768 Ga0207683_10002112 3300026121 Bacteria 17478
769 Ga0207683_10007275 3300026121 Bacteria 9486
770 Ga0207683_10025522 3300026121 Bacteria 5099
771 Ga0207683_10325511 3300026121 Bacteria 1408
772 Ga0207683_10511714 3300026121 Bacteria 1109
773 Ga0207698_10005967 3300026142 Bacteria 7569
774 Ga0207698_10046956 3300026142 Bacteria 3266
775 Ga0207698_10131243 3300026142 Bacteria 2141
776 Ga0207698_10131938 3300026142 Bacteria 2136
777 Ga0207698_10152720 3300026142 Bacteria 2007
778 Ga0207698_10166207 3300026142 Bacteria 1936
779 Ga0207698_10209756 3300026142 Bacteria 1752
780 Ga0207698_10541797 3300026142 Bacteria 1139
781 Ga0207698_10948722 3300026142 Bacteria 869
782 Ga0209982_1042253 3300027552 Bacteria 728
783 Ga0209970_1035631 3300027614 Bacteria 875
784 Ga0210002_1017004 3300027617 Bacteria 1155
785 Ga0209983_1035371 3300027665 Bacteria 1071
786 Ga0209971_1028050 3300027682 Bacteria 1347
787 Ga0209998_10002560 3300027717 Bacteria 4131
788 Ga0209974_10004113 3300027876 Bacteria 5198
789 Ga0209974_10015442 3300027876 Bacteria 2536
790 Ga0207428_10130264 3300027907 Bacteria 1925
791 Ga0268266_10005004 3300028379 Bacteria 12519
792 Ga0268266_10005562 3300028379 Bacteria 11729
793 Ga0268266_10128475 3300028379 Bacteria 2264
794 Ga0268266_10201074 3300028379 Bacteria 1823
795 Ga0268266_10277511 3300028379 Bacteria 1557
796 Ga0268265_10312345 3300028380 Bacteria 1420
797 Ga0268265_10325203 3300028380 Bacteria 1394
798 Ga0268265_10428092 3300028380 Bacteria 1230
799 Ga0268265_10895298 3300028380 Bacteria 871
800 Ga0268264_10001027 3300028381 Bacteria 28045
801 Ga0268264_10002850 3300028381 Bacteria 15079
802 Ga0268264_10007025 3300028381 Bacteria 9444
803 Ga0268264_10019003 3300028381 Bacteria 5618
804 Ga0268264_10033881 3300028381 Bacteria 4198
805 Ga0268264_10102882 3300028381 Bacteria 2486
806 Ga0268264_10349600 3300028381 Bacteria 1407
807 Ga0268264_10424774 3300028381 Bacteria 1283
808 Ga0268264_10565830 3300028381 Bacteria 1117
809 Ga0307408_100007603 3300031548 Bacteria 7167
810 Ga0307405_10668172 3300031731 Bacteria 856
811 Ga0307413_10003503 3300031824 Bacteria 6617
812 Ga0307413_10011768 3300031824 Bacteria 4320
813 Ga0307410_10002137 3300031852 Bacteria 9390
814 Ga0307410_10009379 3300031852 Bacteria 5486
815 Ga0307406_10009643 3300031901 Bacteria 5426
816 Ga0307406_10009681 3300031901 Bacteria 5417
817 Ga0307407_10003844 3300031903 Bacteria 6256
818 Ga0307407_10005873 3300031903 Bacteria 5383
819 Ga0307412_10067247 3300031911 Bacteria 2432
820 Ga0307409_100000504 3300031995 Bacteria 16863
821 Ga0307409_100004202 3300031995 Bacteria 8026
822 Ga0307416_100385982 3300032002 Bacteria 1432
823 Ga0307416_101673955 3300032002 Unclassified 741
824 Ga0307414_10819809 3300032004 Bacteria 849
825 Ga0307411_10004100 3300032005 Bacteria 6910
826 Ga0307415_100002092 3300032126 Bacteria 9872
827 Ga0307415_100644037 3300032126 Bacteria 949
828 Ga0316583_10000595 3300032133 Bacteria 10985
829 Ga0316583_10074828 3300032133 Bacteria 1184
830 Ga0373926_0055058 3300035083 Bacteria 1441
831 Ga0373926_0061626 3300035083 Bacteria 1368
832 Ga0373934_0004862 3300035086 Bacteria 4970
833 Ga0373944_0098711 3300035089 Bacteria 984
834 Ga0373923_0001149 3300035111 Bacteria 7344
835 Ga0373936_0047524 3300035113 Bacteria 1731
836 Ga0373941_0260880 3300035115 Bacteria 680
837 Ga0373945_0032663 3300035116 Bacteria 1845
838 Ga0373945_0059662 3300035116 Bacteria 1421
839 Ga0373953_0005084 3300035117 Bacteria 4244
840 Ga0373954_0000524 3300035118 Bacteria 14404
841 Ga0373954_0101671 3300035118 Bacteria 1387
842 Ga0373956_0084905 3300035119 Bacteria 1455
843 Ga0373957_0012776 3300035120 Bacteria 2833
844 Ga0373957_0174728 3300035120 Bacteria 889
845 Ga0373943_0014005 3300035170 Bacteria 3626
846 Ga0373955_0065739 3300035172 Unclassified 2014
847 Ga0373924_0063792 3300035410 Bacteria 1545
848 Ga0373931_0071372 3300035691 Bacteria 1897
849 Ga0373935_0011090 3300035692 Bacteria 5415
850 Ga0373935_0074473 3300035692 Bacteria 2195
851 Ga0373927_0010847 3300035695 Bacteria 6070
852 Ga0373927_0020370 3300035695 Bacteria 4350
853 Ga0373927_0060319 3300035695 Bacteria 2454
854 Ga0373927_0183814 3300035695 Bacteria 1371
855 Ga0373927_0186810 3300035695 Bacteria 1359
856 Ga0373933_0011110 3300035724 Bacteria 4950
857 Ga0373933_0210114 3300035724 Unclassified 1247
858 Ga0373947_0011737 3300035725 Bacteria 5020
859 Ga0373947_0013335 3300035725 Bacteria 4709
860 Ga0373937_0002150 3300036401 Bacteria 16502
861 Ga0373937_0015112 3300036401 Bacteria 6820
862 Ga0373937_0094946 3300036401 Bacteria 2765
863 Ga0373937_1298888 3300036401 Bacteria 676
864 Ga0373925_0018839 3300037068 Bacteria 5018
865 Ga0373925_0064487 3300037068 Bacteria 2757
866 Ga0373925_0269358 3300037068 Bacteria 1370
867 Ga0373925_0286095 3300037068 Bacteria 1328
868 Ga0395900_1145339 3300037418 Bacteria 694
869 Ga0395898_0548833 3300037466 Bacteria 1098
870 Ga0395905_1495877 3300037471 Bacteria 579
871 Ga0395901_0563452 3300038443 Bacteria 1153
872 Ga0436365_0042302 3300039437 Bacteria 2846
873 Ga0451793_0118162 3300041452 Bacteria 687
874 Ga0451845_0443829 3300041501 Bacteria 744
875 Ga0451577_0046785 3300042876 Bacteria 3870
876 Ga0466972_0000519 3300044658 Bacteria 19047
877 Ga0466965_0104298 3300044683 Bacteria 1452
878 Ga0466961_0057086 3300044693 Bacteria 2486
879 Ga0453684_0518400 3300044712 Bacteria 1317
880 Ga0466971_0297144 3300044719 Bacteria 775
881 Ga0451576_0309025 3300045051 Bacteria 1654
882 Ga0451576_0735579 3300045051 Bacteria 1036
883 Ga0466958_0064880 3300045836 Bacteria 2228
884 Ga0466967_0204818 3300045976 Bacteria 1870
885 Ga0466967_1035178 3300045976 Bacteria 818
886 Ga0495629_0113062 3300046459 Bacteria 1892
887 Ga0495580_0046517 3300046472 Bacteria 3078
888 Ga0495580_0071403 3300046472 Bacteria 2425
889 Ga0495580_0146534 3300046472 Bacteria 1636
890 Ga0495582_0006109 3300046473 Bacteria 6703
891 Ga0495662_0008769 3300046476 Bacteria 4974
892 Ga0495662_0196924 3300046476 Bacteria 993
893 Ga0495664_0021456 3300046477 Bacteria 3731
894 Ga0495594_0022970 3300046499 Bacteria 3340
895 Ga0495608_0126558 3300046511 Unclassified 1636
896 Ga0495618_0172528 3300046514 Bacteria 1376
897 Ga0495628_0170594 3300046516 Bacteria 1650
898 Ga0495665_0104985 3300046531 Bacteria 1482
899 Ga0495621_0001573 3300046539 Bacteria 5945
900 Ga0495667_0008647 3300046559 Bacteria 6914
901 Ga0495667_0321257 3300046559 Bacteria 979
902 Ga0495635_0147009 3300046663 Bacteria 1604
903 Ga0495659_0019322 3300046664 Bacteria 2280
904 Ga0495657_0000805 3300046675 Bacteria 27819
905 Ga0495623_0196988 3300046679 Bacteria 1160
906 Ga0495647_0001796 3300046681 Bacteria 6630
907 Ga0495613_0008532 3300046689 Bacteria 7605
908 Ga0495613_0072198 3300046689 Bacteria 2516
909 Ga0495600_0221406 3300046809 Bacteria 1210
910 Ga0495581_0070175 3300047315 Bacteria 2026
911 Ga0495604_0187948 3300047317 Bacteria 1441
912 Ga0495674_0024725 3300047319 Bacteria 5514
913 Ga0495680_0119784 3300047322 Bacteria 1944
914 Ga0495684_0010210 3300047471 Bacteria 7264
915 Ga0495684_0430179 3300047471 Bacteria 921
916 Ga0496100_0265577 3300048903 Bacteria 1274
917 Ga0496100_0306145 3300048903 Bacteria 1190
918 Ga0496101_0012612 3300048904 Bacteria 5644
919 Ga0496101_0197531 3300048904 Bacteria 1554
920 Ga0496101_0377397 3300048904 Bacteria 1115
921 Ga0496101_0384185 3300048904 Bacteria 1105
922 Ga0496102_0004620 3300048905 Bacteria 11651
923 Ga0496102_0052668 3300048905 Bacteria 3709
924 Ga0496102_0555021 3300048905 Bacteria 1071
925 Ga0496102_0686043 3300048905 Bacteria 947
926 Ga0496103_0019475 3300048906 Bacteria 4076
927 Ga0496103_0039856 3300048906 Bacteria 2887
928 Ga0496103_0211033 3300048906 Bacteria 1249
929 Ga0496104_0002793 3300048907 Bacteria 15045
930 Ga0496104_0021708 3300048907 Bacteria 5897
931 Ga0496105_0022747 3300048908 Bacteria 5078
932 Ga0496105_0055654 3300048908 Bacteria 3266
933 Ga0496105_0384780 3300048908 Bacteria 1116
934 Ga0496106_0011048 3300048909 Bacteria 6675
935 Ga0496106_0038445 3300048909 Bacteria 3581
936 Ga0496106_0040940 3300048909 Bacteria 3471
937 Ga0496106_0169315 3300048909 Bacteria 1731
938 Ga0496107_0045692 3300048910 Bacteria 3151
939 Ga0496107_0083807 3300048910 Bacteria 2325
940 Ga0496107_0126064 3300048910 Bacteria 1888
941 Ga0496108_0031541 3300048911 Bacteria 4397
942 Ga0496108_0134527 3300048911 Bacteria 2126
943 Ga0496108_0205922 3300048911 Bacteria 1707
944 Ga0496109_0006393 3300048912 Bacteria 9920
945 Ga0496109_0046869 3300048912 Bacteria 3927
946 Ga0496109_0134673 3300048912 Bacteria 2308
947 Ga0496109_0711188 3300048912 Bacteria 942
948 Ga0496109_1627422 3300048912 Bacteria 580
949 Ga0496110_0007678 3300048913 Bacteria 8630
950 Ga0496110_0209853 3300048913 Bacteria 1770
951 Ga0496111_0499194 3300048914 Bacteria 896
952 Ga0496112_0001041 3300048915 Bacteria 20441
953 Ga0496112_0650621 3300048915 Bacteria 984
954 Ga0496112_1027392 3300048915 Bacteria 744
955 Ga0496113_0280626 3300048916 Bacteria 1332
956 Ga0496114_0050417 3300048917 Bacteria 3464
957 Ga0496114_0082369 3300048917 Bacteria 2720
958 Ga0496114_0191517 3300048917 Bacteria 1789
959 Ga0496115_0054993 3300048918 Bacteria 3197
960 Ga0501036_0282528 3300049572 Bacteria 1389
961 Ga0501037_0005424 3300049573 Bacteria 9286
962 Ga0501038_0001493 3300049574 Bacteria 21546
963 Ga0501038_0301801 3300049574 Bacteria 1257
964 Ga0501039_0738135 3300049575 Bacteria 769
965 Ga0501067_0181537 3300049583 Bacteria 1172
966 Ga0501070_0008712 3300049586 Bacteria 8578
967 Ga0501074_0015107 3300049590 Bacteria 5615
968 Ga0501080_0017703 3300049742 Bacteria 6593
969 nmdc:mga05p37_76448_c1 3300050507 Bacteria 4122
970 nmdc:mga0qj67_635875_c1 3300050509 Bacteria 852
971 nmdc:mga08y16_73941_c1 3300050511 Bacteria 3551
972 nmdc:mga0n895_226561_c1 3300050512 Bacteria 1897
973 nmdc:mga0n895_38129_c1 3300050512 Bacteria 4654
974 nmdc:mga0n895_402025_c1 3300050512 Bacteria 1385
975 nmdc:mga0n895_590624_c1 3300050512 Bacteria 1114
976 nmdc:mga0rr50_10098_c1 3300050513 Bacteria 5973
977 nmdc:mga08x19_114952_c1 3300050514 Bacteria 1798
978 nmdc:mga0a205_120325_c1 3300050515 Bacteria 2525
979 Ga0495601_0356142 3300053077 Bacteria 951
980 Ga0495612_0030881 3300053078 Bacteria 2159
981 Ga0495595_0034147 3300053084 Bacteria 2300
982 Ga0495595_0279289 3300053084 Bacteria 838
983 Ga0495619_0038259 3300053085 Bacteria 3129
984 Ga0495619_0065195 3300053085 Bacteria 2429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100429926 Ga0207675_1004299262 164
2 3300025912 Ga0207707_10270430 Ga0207707_102704302 165
3 3300005344 Ga0070661_100940507 Ga0070661_1009405071 173
4 3300032002 Ga0307416_101673955 Ga0307416_1016739551 173
5 3300005336 Ga0070680_100322877 Ga0070680_1003228772 174
6 3300005341 Ga0070691_10137834 Ga0070691_101378342 174
7 3300005344 Ga0070661_100176031 Ga0070661_1001760313 174
8 3300005366 Ga0070659_100004339 Ga0070659_10000433910 174
9 3300005434 Ga0070709_10222483 Ga0070709_102224832 174
10 3300005435 Ga0070714_100015237 Ga0070714_1000152373 174
11 3300005530 Ga0070679_100471605 Ga0070679_1004716052 174
12 3300005549 Ga0070704_100360052 Ga0070704_1003600521 174
13 3300005564 Ga0070664_100005952 Ga0070664_1000059528 174
14 3300005578 Ga0068854_100003585 Ga0068854_1000035853 174
15 3300006237 Ga0097621_100266181 Ga0097621_1002661812 174
16 3300006358 Ga0068871_100022355 Ga0068871_1000223553 174
17 3300009093 Ga0105240_10036989 Ga0105240_100369898 174
18 3300009174 Ga0105241_10014237 Ga0105241_100142377 174
19 3300009551 Ga0105238_10027188 Ga0105238_100271883 174
20 3300010375 Ga0105239_10691721 Ga0105239_106917212 174
21 3300013100 Ga0157373_10001663 Ga0157373_100016639 174
22 3300013104 Ga0157370_10580363 Ga0157370_105803631 174
23 3300013296 Ga0157374_11147403 Ga0157374_111474032 174
24 3300014325 Ga0163163_10010956 Ga0163163_100109566 174
25 3300014969 Ga0157376_11313371 Ga0157376_113133711 174
26 3300020081 Ga0206354_11192541 Ga0206354_111925412 174
27 3300025917 Ga0207660_10276195 Ga0207660_102761952 174
28 3300025919 Ga0207657_10005934 Ga0207657_1000593411 174
29 3300025920 Ga0207649_10254089 Ga0207649_102540892 174
30 3300025921 Ga0207652_10007921 Ga0207652_100079212 174
31 3300025924 Ga0207694_10235054 Ga0207694_102350543 174
32 3300025929 Ga0207664_10080459 Ga0207664_100804592 174
33 3300025944 Ga0207661_10277832 Ga0207661_102778322 174
34 3300026116 Ga0207674_10001292 Ga0207674_1000129210 174
35 3300026142 Ga0207698_10948722 Ga0207698_109487222 174
36 3300035172 Ga0373955_0065739 Ga0373955_0065739_654_1187 174
37 3300035692 Ga0373935_0074473 Ga0373935_0074473_1605_2129 174
38 3300035695 Ga0373927_0010847 Ga0373927_0010847_3429_3953 174
39 3300035724 Ga0373933_0210114 Ga0373933_0210114_405_938 174
40 3300036401 Ga0373937_0002150 Ga0373937_0002150_6390_6923 174
41 3300036401 Ga0373937_1298888 Ga0373937_1298888_127_651 174
42 3300037068 Ga0373925_0064487 Ga0373925_0064487_1175_1699 174
43 3300037418 Ga0395900_1145339 Ga0395900_1145339_84_608 174
44 3300037466 Ga0395898_0548833 Ga0395898_0548833_44_568 174
45 3300038443 Ga0395901_0563452 Ga0395901_0563452_231_755 174
46 3300046476 Ga0495662_0196924 Ga0495662_0196924_188_730 174
47 3300046511 Ga0495608_0126558 Ga0495608_0126558_432_965 174
48 3300046514 Ga0495618_0172528 Ga0495618_0172528_584_1126 174
49 3300046559 Ga0495667_0008647 Ga0495667_0008647_4310_4843 174
50 3300046675 Ga0495657_0000805 Ga0495657_0000805_1986_2519 174
51 3300046689 Ga0495613_0072198 Ga0495613_0072198_1421_1963 174
52 3300047319 Ga0495674_0024725 Ga0495674_0024725_2387_2929 174
53 3300047471 Ga0495684_0430179 Ga0495684_0430179_355_897 174
54 3300048906 Ga0496103_0211033 Ga0496103_0211033_630_1154 174
55 3300049575 Ga0501039_0738135 Ga0501039_0738135_109_633 174
56 3300053085 Ga0495619_0038259 Ga0495619_0038259_672_1205 174
57 3300005339 Ga0070660_100007488 Ga0070660_1000074883 175
58 3300005344 Ga0070661_100059703 Ga0070661_1000597032 175
59 3300005366 Ga0070659_100896040 Ga0070659_1008960401 175
60 3300005445 Ga0070708_100132128 Ga0070708_1001321282 175
61 3300005539 Ga0068853_100237163 Ga0068853_1002371632 175
62 3300006175 Ga0070712_100691315 Ga0070712_1006913151 175
63 3300013104 Ga0157370_10028427 Ga0157370_100284272 175
64 3300013105 Ga0157369_10825111 Ga0157369_108251112 175
65 3300025917 Ga0207660_10358902 Ga0207660_103589022 175
66 3300025919 Ga0207657_10005254 Ga0207657_1000525415 175
67 3300025919 Ga0207657_10144962 Ga0207657_101449622 175
68 3300026118 Ga0207675_100083843 Ga0207675_1000838432 175
69 3300032133 Ga0316583_10000595 Ga0316583_100005957 175
70 3300032133 Ga0316583_10074828 Ga0316583_100748282 175
71 3300037068 Ga0373925_0269358 Ga0373925_0269358_825_1352 175
72 3300049573 Ga0501037_0005424 Ga0501037_0005424_1414_1950 175
73 3300049574 Ga0501038_0001493 Ga0501038_0001493_11575_12111 175
74 3300049574 Ga0501038_0301801 Ga0501038_0301801_572_1108 175
75 3300049586 Ga0501070_0008712 Ga0501070_0008712_2805_3338 175
76 3300049590 Ga0501074_0015107 Ga0501074_0015107_4603_5139 175
77 3300049742 Ga0501080_0017703 Ga0501080_0017703_1777_2313 175
78 3300005329 Ga0070683_100103084 Ga0070683_1001030842 176
79 3300005331 Ga0070670_100033776 Ga0070670_1000337764 176
80 3300005334 Ga0068869_100145204 Ga0068869_1001452041 176
81 3300005335 Ga0070666_10003246 Ga0070666_1000324610 176
82 3300005336 Ga0070680_100027477 Ga0070680_1000274772 176
83 3300005337 Ga0070682_100021911 Ga0070682_1000219114 176
84 3300005337 Ga0070682_100158228 Ga0070682_1001582282 176
85 3300005338 Ga0068868_100002572 Ga0068868_1000025725 176
86 3300005338 Ga0068868_100198409 Ga0068868_1001984092 176
87 3300005339 Ga0070660_100000940 Ga0070660_1000009407 176
88 3300005339 Ga0070660_100486734 Ga0070660_1004867342 176
89 3300005341 Ga0070691_10061770 Ga0070691_100617702 176
90 3300005341 Ga0070691_10223564 Ga0070691_102235642 176
91 3300005343 Ga0070687_100021747 Ga0070687_1000217473 176
92 3300005344 Ga0070661_100002505 Ga0070661_1000025055 176
93 3300005345 Ga0070692_10016880 Ga0070692_100168804 176
94 3300005355 Ga0070671_100010442 Ga0070671_1000104425 176
95 3300005356 Ga0070674_100060097 Ga0070674_1000600972 176
96 3300005364 Ga0070673_100005216 Ga0070673_1000052166 176
97 3300005365 Ga0070688_100008334 Ga0070688_1000083345 176
98 3300005366 Ga0070659_100016845 Ga0070659_1000168455 176
99 3300005366 Ga0070659_100836738 Ga0070659_1008367381 176
100 3300005435 Ga0070714_100689497 Ga0070714_1006894972 176
101 3300005436 Ga0070713_100009864 Ga0070713_1000098646 176
102 3300005437 Ga0070710_10013007 Ga0070710_100130073 176
103 3300005438 Ga0070701_10198336 Ga0070701_101983362 176
104 3300005439 Ga0070711_100000893 Ga0070711_10000089313 176
105 3300005439 Ga0070711_100610761 Ga0070711_1006107612 176
106 3300005445 Ga0070708_100039252 Ga0070708_1000392523 176
107 3300005445 Ga0070708_100960367 Ga0070708_1009603672 176
108 3300005455 Ga0070663_100373992 Ga0070663_1003739922 176
109 3300005456 Ga0070678_100000107 Ga0070678_1000001074 176
110 3300005457 Ga0070662_100027223 Ga0070662_1000272232 176
111 3300005458 Ga0070681_10023269 Ga0070681_100232695 176
112 3300005459 Ga0068867_100022440 Ga0068867_1000224405 176
113 3300005466 Ga0070685_10000221 Ga0070685_100002218 176
114 3300005467 Ga0070706_100168852 Ga0070706_1001688522 176
115 3300005467 Ga0070706_100221626 Ga0070706_1002216262 176
116 3300005467 Ga0070706_100377675 Ga0070706_1003776752 176
117 3300005468 Ga0070707_100231214 Ga0070707_1002312142 176
118 3300005468 Ga0070707_100275861 Ga0070707_1002758612 176
119 3300005471 Ga0070698_100265589 Ga0070698_1002655893 176
120 3300005518 Ga0070699_100063919 Ga0070699_1000639194 176
121 3300005530 Ga0070679_100212974 Ga0070679_1002129742 176
122 3300005530 Ga0070679_100390337 Ga0070679_1003903371 176
123 3300005535 Ga0070684_100060574 Ga0070684_1000605742 176
124 3300005535 Ga0070684_100078312 Ga0070684_1000783123 176
125 3300005536 Ga0070697_100002608 Ga0070697_1000026084 176
126 3300005536 Ga0070697_100145522 Ga0070697_1001455222 176
127 3300005539 Ga0068853_100123757 Ga0068853_1001237572 176
128 3300005544 Ga0070686_100004007 Ga0070686_1000040072 176
129 3300005545 Ga0070695_100089044 Ga0070695_1000890442 176
130 3300005545 Ga0070695_100838974 Ga0070695_1008389742 176
131 3300005547 Ga0070693_100009100 Ga0070693_1000091001 176
132 3300005547 Ga0070693_100018449 Ga0070693_1000184495 176
133 3300005548 Ga0070665_100005852 Ga0070665_10000585212 176
134 3300005549 Ga0070704_100127167 Ga0070704_1001271672 176
135 3300005563 Ga0068855_100054928 Ga0068855_1000549281 176
136 3300005563 Ga0068855_100922448 Ga0068855_1009224482 176
137 3300005564 Ga0070664_100025762 Ga0070664_1000257625 176
138 3300005564 Ga0070664_100191243 Ga0070664_1001912432 176
139 3300005564 Ga0070664_100305936 Ga0070664_1003059362 176
140 3300005577 Ga0068857_100006994 Ga0068857_1000069949 176
141 3300005578 Ga0068854_100039367 Ga0068854_1000393672 176
142 3300005614 Ga0068856_100003384 Ga0068856_10000338412 176
143 3300005614 Ga0068856_100073484 Ga0068856_1000734844 176
144 3300005615 Ga0070702_100514234 Ga0070702_1005142342 176
145 3300005616 Ga0068852_100001607 Ga0068852_1000016076 176
146 3300005616 Ga0068852_100268517 Ga0068852_1002685172 176
147 3300005616 Ga0068852_101294605 Ga0068852_1012946052 176
148 3300005617 Ga0068859_100003177 Ga0068859_1000031778 176
149 3300005618 Ga0068864_100002616 Ga0068864_10000261613 176
150 3300005718 Ga0068866_10000652 Ga0068866_1000065212 176
151 3300005834 Ga0068851_10119698 Ga0068851_101196982 176
152 3300005834 Ga0068851_10520052 Ga0068851_105200522 176
153 3300005841 Ga0068863_100002985 Ga0068863_1000029859 176
154 3300005842 Ga0068858_100000603 Ga0068858_1000006038 176
155 3300006163 Ga0070715_10012346 Ga0070715_100123464 176
156 3300006173 Ga0070716_100001339 Ga0070716_10000133911 176
157 3300006173 Ga0070716_100543585 Ga0070716_1005435851 176
158 3300006175 Ga0070712_100005043 Ga0070712_1000050432 176
159 3300006175 Ga0070712_100027301 Ga0070712_1000273012 176
160 3300006237 Ga0097621_100020593 Ga0097621_1000205937 176
161 3300006237 Ga0097621_101056642 Ga0097621_1010566422 176
162 3300006358 Ga0068871_100230476 Ga0068871_1002304762 176
163 3300006852 Ga0075433_10056206 Ga0075433_100562064 176
164 3300006871 Ga0075434_100035035 Ga0075434_1000350357 176
165 3300006871 Ga0075434_100146274 Ga0075434_1001462743 176
166 3300006914 Ga0075436_100221437 Ga0075436_1002214372 176
167 3300006931 Ga0097620_100003176 Ga0097620_1000031768 176
168 3300007076 Ga0075435_100011479 Ga0075435_1000114796 176
169 3300009093 Ga0105240_10002428 Ga0105240_1000242836 176
170 3300009093 Ga0105240_10047724 Ga0105240_100477244 176
171 3300009098 Ga0105245_10005497 Ga0105245_1000549710 176
172 3300009098 Ga0105245_10014037 Ga0105245_100140375 176
173 3300009098 Ga0105245_10020376 Ga0105245_100203764 176
174 3300009147 Ga0114129_10294637 Ga0114129_102946372 176
175 3300009174 Ga0105241_10022261 Ga0105241_100222612 176
176 3300009174 Ga0105241_10111769 Ga0105241_101117692 176
177 3300009176 Ga0105242_10002918 Ga0105242_100029189 176
178 3300009177 Ga0105248_10026830 Ga0105248_100268305 176
179 3300009545 Ga0105237_10354688 Ga0105237_103546882 176
180 3300009551 Ga0105238_10001044 Ga0105238_1000104411 176
181 3300009551 Ga0105238_10067698 Ga0105238_100676984 176
182 3300009553 Ga0105249_10226118 Ga0105249_102261182 176
183 3300010375 Ga0105239_10033050 Ga0105239_100330504 176
184 3300010375 Ga0105239_10371690 Ga0105239_103716902 176
185 3300010375 Ga0105239_11598816 Ga0105239_115988162 176
186 3300011119 Ga0105246_10119344 Ga0105246_101193442 176
187 3300012491 Ga0157329_1000632 Ga0157329_10006322 176
188 3300013100 Ga0157373_10040985 Ga0157373_100409852 176
189 3300013100 Ga0157373_10572589 Ga0157373_105725892 176
190 3300013102 Ga0157371_10307675 Ga0157371_103076751 176
191 3300013105 Ga0157369_10014238 Ga0157369_100142389 176
192 3300013296 Ga0157374_10000565 Ga0157374_1000056534 176
193 3300013297 Ga0157378_10031024 Ga0157378_100310245 176
194 3300013297 Ga0157378_10171201 Ga0157378_101712011 176
195 3300013306 Ga0163162_10022644 Ga0163162_100226444 176
196 3300013306 Ga0163162_10087446 Ga0163162_100874462 176
197 3300013307 Ga0157372_10004393 Ga0157372_1000439312 176
198 3300013308 Ga0157375_10004526 Ga0157375_1000452610 176
199 3300014325 Ga0163163_10000689 Ga0163163_1000068912 176
200 3300014969 Ga0157376_10007657 Ga0157376_100076575 176
201 3300014969 Ga0157376_10007747 Ga0157376_100077475 176
202 3300017792 Ga0163161_10167424 Ga0163161_101674242 176
203 3300021384 Ga0213876_10184874 Ga0213876_101848742 176
204 3300025321 Ga0207656_10061127 Ga0207656_100611272 176
205 3300025898 Ga0207692_10005926 Ga0207692_100059265 176
206 3300025898 Ga0207692_10269429 Ga0207692_102694292 176
207 3300025899 Ga0207642_10000852 Ga0207642_100008526 176
208 3300025903 Ga0207680_10020828 Ga0207680_100208282 176
209 3300025903 Ga0207680_10043021 Ga0207680_100430213 176
210 3300025905 Ga0207685_10104526 Ga0207685_101045262 176
211 3300025907 Ga0207645_10068667 Ga0207645_100686674 176
212 3300025908 Ga0207643_10101961 Ga0207643_101019613 176
213 3300025910 Ga0207684_10685030 Ga0207684_106850302 176
214 3300025911 Ga0207654_10003842 Ga0207654_100038429 176
215 3300025912 Ga0207707_10106830 Ga0207707_101068305 176
216 3300025914 Ga0207671_10220291 Ga0207671_102202912 176
217 3300025915 Ga0207693_10001163 Ga0207693_100011635 176
218 3300025915 Ga0207693_10032301 Ga0207693_100323012 176
219 3300025916 Ga0207663_10027057 Ga0207663_100270574 176
220 3300025917 Ga0207660_10228576 Ga0207660_102285762 176
221 3300025919 Ga0207657_10000280 Ga0207657_1000028022 176
222 3300025919 Ga0207657_10019674 Ga0207657_100196746 176
223 3300025920 Ga0207649_10095263 Ga0207649_100952631 176
224 3300025920 Ga0207649_10490270 Ga0207649_104902702 176
225 3300025922 Ga0207646_10012728 Ga0207646_100127282 176
226 3300025922 Ga0207646_10069627 Ga0207646_100696273 176
227 3300025924 Ga0207694_10009651 Ga0207694_100096516 176
228 3300025924 Ga0207694_10058569 Ga0207694_100585692 176
229 3300025925 Ga0207650_10014573 Ga0207650_100145737 176
230 3300025927 Ga0207687_10000741 Ga0207687_100007415 176
231 3300025927 Ga0207687_10009974 Ga0207687_100099745 176
232 3300025927 Ga0207687_10563528 Ga0207687_105635281 176
233 3300025928 Ga0207700_10031325 Ga0207700_100313253 176
234 3300025929 Ga0207664_10009725 Ga0207664_100097256 176
235 3300025929 Ga0207664_10112269 Ga0207664_101122694 176
236 3300025931 Ga0207644_10002123 Ga0207644_1000212310 176
237 3300025931 Ga0207644_10056245 Ga0207644_100562452 176
238 3300025932 Ga0207690_10014956 Ga0207690_100149563 176
239 3300025933 Ga0207706_10049727 Ga0207706_100497273 176
240 3300025933 Ga0207706_10243707 Ga0207706_102437072 176
241 3300025934 Ga0207686_10000521 Ga0207686_1000052134 176
242 3300025937 Ga0207669_10122910 Ga0207669_101229101 176
243 3300025938 Ga0207704_10116095 Ga0207704_101160953 176
244 3300025939 Ga0207665_10004353 Ga0207665_100043539 176
245 3300025941 Ga0207711_10000448 Ga0207711_1000044815 176
246 3300025942 Ga0207689_10118222 Ga0207689_101182222 176
247 3300025944 Ga0207661_10079457 Ga0207661_100794574 176
248 3300025945 Ga0207679_10488415 Ga0207679_104884152 176
249 3300025949 Ga0207667_10005138 Ga0207667_1000513813 176
250 3300025949 Ga0207667_10457694 Ga0207667_104576942 176
251 3300025960 Ga0207651_10002125 Ga0207651_100021256 176
252 3300025981 Ga0207640_10018886 Ga0207640_100188862 176
253 3300025986 Ga0207658_10006610 Ga0207658_100066105 176
254 3300025986 Ga0207658_10272447 Ga0207658_102724472 176
255 3300026023 Ga0207677_10000253 Ga0207677_1000025312 176
256 3300026023 Ga0207677_10117961 Ga0207677_101179612 176
257 3300026023 Ga0207677_11268081 Ga0207677_112680811 176
258 3300026035 Ga0207703_10000517 Ga0207703_1000051734 176
259 3300026067 Ga0207678_10092965 Ga0207678_100929652 176
260 3300026067 Ga0207678_10125132 Ga0207678_101251322 176
261 3300026067 Ga0207678_10282617 Ga0207678_102826172 176
262 3300026078 Ga0207702_10009250 Ga0207702_100092507 176
263 3300026078 Ga0207702_10009791 Ga0207702_100097918 176
264 3300026078 Ga0207702_10053604 Ga0207702_100536042 176
265 3300026088 Ga0207641_10000610 Ga0207641_1000061010 176
266 3300026095 Ga0207676_10000167 Ga0207676_1000016747 176
267 3300026116 Ga0207674_10000118 Ga0207674_1000011871 176
268 3300026116 Ga0207674_10005648 Ga0207674_1000564829 176
269 3300026121 Ga0207683_10000965 Ga0207683_1000096512 176
270 3300026142 Ga0207698_10046956 Ga0207698_100469562 176
271 3300026142 Ga0207698_10131243 Ga0207698_101312434 176
272 3300026142 Ga0207698_10209756 Ga0207698_102097562 176
273 3300028379 Ga0268266_10005004 Ga0268266_100050048 176
274 3300028381 Ga0268264_10001027 Ga0268264_1000102724 176
275 3300028381 Ga0268264_10033881 Ga0268264_100338814 176
276 3300031824 Ga0307413_10003503 Ga0307413_100035031 176
277 3300031852 Ga0307410_10009379 Ga0307410_100093793 176
278 3300031901 Ga0307406_10009681 Ga0307406_100096812 176
279 3300031903 Ga0307407_10003844 Ga0307407_100038441 176
280 3300031995 Ga0307409_100004202 Ga0307409_1000042026 176
281 3300032004 Ga0307414_10819809 Ga0307414_108198091 176
282 3300032126 Ga0307415_100002092 Ga0307415_1000020928 176
283 3300035083 Ga0373926_0055058 Ga0373926_0055058_189_719 176
284 3300035083 Ga0373926_0061626 Ga0373926_0061626_700_1230 176
285 3300035086 Ga0373934_0004862 Ga0373934_0004862_1966_2496 176
286 3300035089 Ga0373944_0098711 Ga0373944_0098711_28_558 176
287 3300035111 Ga0373923_0001149 Ga0373923_0001149_143_673 176
288 3300035113 Ga0373936_0047524 Ga0373936_0047524_412_942 176
289 3300035116 Ga0373945_0032663 Ga0373945_0032663_900_1430 176
290 3300035116 Ga0373945_0059662 Ga0373945_0059662_228_758 176
291 3300035117 Ga0373953_0005084 Ga0373953_0005084_2257_2787 176
292 3300035118 Ga0373954_0000524 Ga0373954_0000524_380_910 176
293 3300035119 Ga0373956_0084905 Ga0373956_0084905_431_961 176
294 3300035120 Ga0373957_0012776 Ga0373957_0012776_1155_1685 176
295 3300035170 Ga0373943_0014005 Ga0373943_0014005_418_948 176
296 3300035410 Ga0373924_0063792 Ga0373924_0063792_549_1079 176
297 3300035692 Ga0373935_0011090 Ga0373935_0011090_2140_2670 176
298 3300035695 Ga0373927_0020370 Ga0373927_0020370_1350_1880 176
299 3300035695 Ga0373927_0060319 Ga0373927_0060319_1437_1970 176
300 3300035695 Ga0373927_0183814 Ga0373927_0183814_826_1356 176
301 3300035695 Ga0373927_0186810 Ga0373927_0186810_397_927 176
302 3300035724 Ga0373933_0011110 Ga0373933_0011110_1997_2527 176
303 3300035725 Ga0373947_0011737 Ga0373947_0011737_2713_3243 176
304 3300035725 Ga0373947_0013335 Ga0373947_0013335_980_1510 176
305 3300036401 Ga0373937_0015112 Ga0373937_0015112_1123_1653 176
306 3300037068 Ga0373925_0018839 Ga0373925_0018839_3756_4286 176
307 3300037068 Ga0373925_0286095 Ga0373925_0286095_633_1163 176
308 3300037471 Ga0395905_1495877 Ga0395905_1495877_30_560 176
309 3300039437 Ga0436365_0042302 Ga0436365_0042302_628_1158 176
310 3300042876 Ga0451577_0046785 Ga0451577_0046785_2450_2989 176
311 3300044693 Ga0466961_0057086 Ga0466961_0057086_1645_2175 176
312 3300044712 Ga0453684_0518400 Ga0453684_0518400_635_1174 176
313 3300046459 Ga0495629_0113062 Ga0495629_0113062_1257_1787 176
314 3300046472 Ga0495580_0046517 Ga0495580_0046517_2157_2687 176
315 3300046472 Ga0495580_0071403 Ga0495580_0071403_975_1505 176
316 3300046472 Ga0495580_0146534 Ga0495580_0146534_591_1121 176
317 3300046473 Ga0495582_0006109 Ga0495582_0006109_3909_4439 176
318 3300046476 Ga0495662_0008769 Ga0495662_0008769_876_1406 176
319 3300046477 Ga0495664_0021456 Ga0495664_0021456_2537_3067 176
320 3300046499 Ga0495594_0022970 Ga0495594_0022970_2049_2579 176
321 3300046516 Ga0495628_0170594 Ga0495628_0170594_613_1143 176
322 3300046531 Ga0495665_0104985 Ga0495665_0104985_778_1308 176
323 3300046539 Ga0495621_0001573 Ga0495621_0001573_1101_1631 176
324 3300046559 Ga0495667_0321257 Ga0495667_0321257_424_954 176
325 3300046663 Ga0495635_0147009 Ga0495635_0147009_823_1353 176
326 3300046664 Ga0495659_0019322 Ga0495659_0019322_555_1085 176
327 3300046679 Ga0495623_0196988 Ga0495623_0196988_423_953 176
328 3300046681 Ga0495647_0001796 Ga0495647_0001796_1151_1681 176
329 3300046689 Ga0495613_0008532 Ga0495613_0008532_975_1505 176
330 3300046809 Ga0495600_0221406 Ga0495600_0221406_403_933 176
331 3300047315 Ga0495581_0070175 Ga0495581_0070175_829_1359 176
332 3300047317 Ga0495604_0187948 Ga0495604_0187948_613_1143 176
333 3300047322 Ga0495680_0119784 Ga0495680_0119784_1343_1873 176
334 3300047471 Ga0495684_0010210 Ga0495684_0010210_3075_3605 176
335 3300048904 Ga0496101_0012612 Ga0496101_0012612_4188_4718 176
336 3300048905 Ga0496102_0052668 Ga0496102_0052668_2252_2797 176
337 3300048906 Ga0496103_0019475 Ga0496103_0019475_554_1099 176
338 3300048907 Ga0496104_0002793 Ga0496104_0002793_4195_4725 176
339 3300048908 Ga0496105_0022747 Ga0496105_0022747_558_1088 176
340 3300048909 Ga0496106_0169315 Ga0496106_0169315_20_565 176
341 3300048910 Ga0496107_0045692 Ga0496107_0045692_737_1267 176
342 3300048911 Ga0496108_0205922 Ga0496108_0205922_54_584 176
343 3300048912 Ga0496109_0006393 Ga0496109_0006393_588_1118 176
344 3300048915 Ga0496112_0001041 Ga0496112_0001041_14434_14964 176
345 3300048917 Ga0496114_0050417 Ga0496114_0050417_447_977 176
346 3300048918 Ga0496115_0054993 Ga0496115_0054993_2657_3187 176
347 3300050507 nmdc:mga05p37_76448_c1 nmdc:mga05p37_76448_c1_3538_4068 176
348 3300050512 nmdc:mga0n895_38129_c1 nmdc:mga0n895_38129_c1_1155_1685 176
349 3300050512 nmdc:mga0n895_590624_c1 nmdc:mga0n895_590624_c1_516_1046 176
350 3300050513 nmdc:mga0rr50_10098_c1 nmdc:mga0rr50_10098_c1_550_1080 176
351 3300050515 nmdc:mga0a205_120325_c1 nmdc:mga0a205_120325_c1_1482_2012 176
352 3300053077 Ga0495601_0356142 Ga0495601_0356142_127_657 176
353 3300053078 Ga0495612_0030881 Ga0495612_0030881_422_952 176
354 3300053084 Ga0495595_0279289 Ga0495595_0279289_172_702 176
355 3300053085 Ga0495619_0065195 Ga0495619_0065195_902_1432 176
356 3300001991 JGI24743J22301_10011967 JGI24743J22301_100119672 177
357 3300001991 JGI24743J22301_10099337 JGI24743J22301_100993371 177
358 3300005290 Ga0065712_10151734 Ga0065712_101517342 177
359 3300005293 Ga0065715_10187171 Ga0065715_101871713 177
360 3300005293 Ga0065715_10326888 Ga0065715_103268882 177
361 3300005327 Ga0070658_10092931 Ga0070658_100929313 177
362 3300005327 Ga0070658_10414064 Ga0070658_104140642 177
363 3300005327 Ga0070658_11080494 Ga0070658_110804941 177
364 3300005328 Ga0070676_10000068 Ga0070676_1000006837 177
365 3300005328 Ga0070676_10006880 Ga0070676_100068808 177
366 3300005328 Ga0070676_10022743 Ga0070676_100227433 177
367 3300005328 Ga0070676_10035719 Ga0070676_100357193 177
368 3300005328 Ga0070676_10086142 Ga0070676_100861424 177
369 3300005328 Ga0070676_10103743 Ga0070676_101037432 177
370 3300005328 Ga0070676_10246745 Ga0070676_102467452 177
371 3300005329 Ga0070683_100012992 Ga0070683_1000129927 177
372 3300005330 Ga0070690_100024623 Ga0070690_1000246233 177
373 3300005330 Ga0070690_100085249 Ga0070690_1000852492 177
374 3300005331 Ga0070670_100000715 Ga0070670_10000071512 177
375 3300005331 Ga0070670_100003749 Ga0070670_10000374913 177
376 3300005331 Ga0070670_100103612 Ga0070670_1001036122 177
377 3300005331 Ga0070670_100152545 Ga0070670_1001525453 177
378 3300005331 Ga0070670_100178905 Ga0070670_1001789053 177
379 3300005331 Ga0070670_100218977 Ga0070670_1002189773 177
380 3300005331 Ga0070670_100436779 Ga0070670_1004367792 177
381 3300005331 Ga0070670_101281117 Ga0070670_1012811171 177
382 3300005333 Ga0070677_10000388 Ga0070677_1000038810 177
383 3300005333 Ga0070677_10171071 Ga0070677_101710712 177
384 3300005334 Ga0068869_100000926 Ga0068869_10000092610 177
385 3300005334 Ga0068869_100006606 Ga0068869_1000066062 177
386 3300005334 Ga0068869_100028520 Ga0068869_1000285203 177
387 3300005334 Ga0068869_100756798 Ga0068869_1007567981 177
388 3300005335 Ga0070666_10007042 Ga0070666_100070424 177
389 3300005335 Ga0070666_10008121 Ga0070666_100081215 177
390 3300005335 Ga0070666_10083410 Ga0070666_100834102 177
391 3300005335 Ga0070666_10194203 Ga0070666_101942033 177
392 3300005335 Ga0070666_10320368 Ga0070666_103203682 177
393 3300005337 Ga0070682_100589750 Ga0070682_1005897501 177
394 3300005337 Ga0070682_100656375 Ga0070682_1006563752 177
395 3300005338 Ga0068868_100079357 Ga0068868_1000793572 177
396 3300005338 Ga0068868_100693990 Ga0068868_1006939902 177
397 3300005338 Ga0068868_101078430 Ga0068868_1010784302 177
398 3300005339 Ga0070660_100000932 Ga0070660_1000009329 177
399 3300005340 Ga0070689_100012276 Ga0070689_1000122766 177
400 3300005340 Ga0070689_100015305 Ga0070689_1000153053 177
401 3300005340 Ga0070689_100259775 Ga0070689_1002597752 177
402 3300005340 Ga0070689_100368870 Ga0070689_1003688702 177
403 3300005343 Ga0070687_100703179 Ga0070687_1007031791 177
404 3300005344 Ga0070661_100014641 Ga0070661_1000146414 177
405 3300005344 Ga0070661_100015498 Ga0070661_1000154986 177
406 3300005344 Ga0070661_100051278 Ga0070661_1000512783 177
407 3300005344 Ga0070661_100083645 Ga0070661_1000836453 177
408 3300005344 Ga0070661_100119280 Ga0070661_1001192802 177
409 3300005345 Ga0070692_10019473 Ga0070692_100194734 177
410 3300005347 Ga0070668_100000779 Ga0070668_10000077923 177
411 3300005347 Ga0070668_100015675 Ga0070668_1000156752 177
412 3300005347 Ga0070668_100038163 Ga0070668_1000381632 177
413 3300005347 Ga0070668_100066591 Ga0070668_1000665912 177
414 3300005347 Ga0070668_100075157 Ga0070668_1000751573 177
415 3300005347 Ga0070668_100326096 Ga0070668_1003260961 177
416 3300005353 Ga0070669_100000668 Ga0070669_10000066822 177
417 3300005353 Ga0070669_100075780 Ga0070669_1000757805 177
418 3300005353 Ga0070669_100159309 Ga0070669_1001593092 177
419 3300005353 Ga0070669_100181960 Ga0070669_1001819602 177
420 3300005353 Ga0070669_100258639 Ga0070669_1002586391 177
421 3300005353 Ga0070669_100425203 Ga0070669_1004252032 177
422 3300005354 Ga0070675_100006613 Ga0070675_1000066138 177
423 3300005354 Ga0070675_100007266 Ga0070675_1000072669 177
424 3300005354 Ga0070675_100017405 Ga0070675_1000174056 177
425 3300005354 Ga0070675_100275795 Ga0070675_1002757952 177
426 3300005355 Ga0070671_100008688 Ga0070671_1000086885 177
427 3300005355 Ga0070671_100015993 Ga0070671_1000159936 177
428 3300005355 Ga0070671_100019898 Ga0070671_1000198984 177
429 3300005355 Ga0070671_100021917 Ga0070671_1000219174 177
430 3300005355 Ga0070671_100059730 Ga0070671_1000597303 177
431 3300005355 Ga0070671_100145096 Ga0070671_1001450961 177
432 3300005355 Ga0070671_100303335 Ga0070671_1003033353 177
433 3300005356 Ga0070674_100073559 Ga0070674_1000735592 177
434 3300005356 Ga0070674_100087028 Ga0070674_1000870282 177
435 3300005356 Ga0070674_100143575 Ga0070674_1001435753 177
436 3300005356 Ga0070674_100165920 Ga0070674_1001659202 177
437 3300005356 Ga0070674_100370020 Ga0070674_1003700202 177
438 3300005364 Ga0070673_100002041 Ga0070673_10000204111 177
439 3300005364 Ga0070673_100009308 Ga0070673_1000093085 177
440 3300005364 Ga0070673_100045466 Ga0070673_1000454663 177
441 3300005364 Ga0070673_100063676 Ga0070673_1000636763 177
442 3300005364 Ga0070673_100168630 Ga0070673_1001686302 177
443 3300005364 Ga0070673_101726739 Ga0070673_1017267391 177
444 3300005365 Ga0070688_100065847 Ga0070688_1000658474 177
445 3300005365 Ga0070688_100097897 Ga0070688_1000978972 177
446 3300005366 Ga0070659_100055767 Ga0070659_1000557672 177
447 3300005366 Ga0070659_100066836 Ga0070659_1000668364 177
448 3300005366 Ga0070659_100093999 Ga0070659_1000939992 177
449 3300005366 Ga0070659_100105503 Ga0070659_1001055031 177
450 3300005367 Ga0070667_100001232 Ga0070667_1000012328 177
451 3300005367 Ga0070667_100006774 Ga0070667_1000067748 177
452 3300005367 Ga0070667_100017793 Ga0070667_1000177934 177
453 3300005367 Ga0070667_100018925 Ga0070667_1000189256 177
454 3300005367 Ga0070667_100065015 Ga0070667_1000650154 177
455 3300005367 Ga0070667_100223895 Ga0070667_1002238952 177
456 3300005367 Ga0070667_100707091 Ga0070667_1007070911 177
457 3300005434 Ga0070709_10026307 Ga0070709_100263073 177
458 3300005435 Ga0070714_100051617 Ga0070714_1000516172 177
459 3300005435 Ga0070714_100074888 Ga0070714_1000748883 177
460 3300005435 Ga0070714_100225801 Ga0070714_1002258013 177
461 3300005435 Ga0070714_100836881 Ga0070714_1008368812 177
462 3300005436 Ga0070713_100339207 Ga0070713_1003392071 177
463 3300005438 Ga0070701_10450311 Ga0070701_104503112 177
464 3300005439 Ga0070711_100008242 Ga0070711_1000082424 177
465 3300005441 Ga0070700_100024694 Ga0070700_1000246943 177
466 3300005455 Ga0070663_100120258 Ga0070663_1001202582 177
467 3300005455 Ga0070663_100159856 Ga0070663_1001598562 177
468 3300005455 Ga0070663_100254210 Ga0070663_1002542103 177
469 3300005455 Ga0070663_100499535 Ga0070663_1004995352 177
470 3300005455 Ga0070663_100615248 Ga0070663_1006152481 177
471 3300005456 Ga0070678_100001539 Ga0070678_10000153911 177
472 3300005456 Ga0070678_100005219 Ga0070678_1000052196 177
473 3300005456 Ga0070678_100009357 Ga0070678_1000093575 177
474 3300005456 Ga0070678_100298741 Ga0070678_1002987412 177
475 3300005457 Ga0070662_100001459 Ga0070662_1000014595 177
476 3300005457 Ga0070662_100004307 Ga0070662_1000043078 177
477 3300005457 Ga0070662_100010358 Ga0070662_1000103586 177
478 3300005458 Ga0070681_10345751 Ga0070681_103457512 177
479 3300005459 Ga0068867_100012431 Ga0068867_1000124314 177
480 3300005459 Ga0068867_100018079 Ga0068867_1000180795 177
481 3300005459 Ga0068867_100034757 Ga0068867_1000347572 177
482 3300005459 Ga0068867_100059084 Ga0068867_1000590843 177
483 3300005459 Ga0068867_100228837 Ga0068867_1002288372 177
484 3300005466 Ga0070685_10012098 Ga0070685_100120986 177
485 3300005530 Ga0070679_100084886 Ga0070679_1000848863 177
486 3300005530 Ga0070679_100157620 Ga0070679_1001576202 177
487 3300005530 Ga0070679_100362935 Ga0070679_1003629351 177
488 3300005530 Ga0070679_100374790 Ga0070679_1003747901 177
489 3300005535 Ga0070684_100149456 Ga0070684_1001494563 177
490 3300005539 Ga0068853_100007107 Ga0068853_1000071075 177
491 3300005539 Ga0068853_100016729 Ga0068853_1000167296 177
492 3300005539 Ga0068853_100021638 Ga0068853_1000216383 177
493 3300005539 Ga0068853_100696449 Ga0068853_1006964492 177
494 3300005543 Ga0070672_100000287 Ga0070672_10000028729 177
495 3300005543 Ga0070672_100014874 Ga0070672_1000148745 177
496 3300005543 Ga0070672_100034011 Ga0070672_1000340114 177
497 3300005543 Ga0070672_100034324 Ga0070672_1000343242 177
498 3300005543 Ga0070672_100039318 Ga0070672_1000393184 177
499 3300005543 Ga0070672_100084569 Ga0070672_1000845692 177
500 3300005543 Ga0070672_100229339 Ga0070672_1002293392 177
501 3300005543 Ga0070672_101023419 Ga0070672_1010234192 177
502 3300005544 Ga0070686_100460519 Ga0070686_1004605192 177
503 3300005546 Ga0070696_100174908 Ga0070696_1001749082 177
504 3300005546 Ga0070696_100408373 Ga0070696_1004083732 177
505 3300005546 Ga0070696_100442582 Ga0070696_1004425822 177
506 3300005547 Ga0070693_100046276 Ga0070693_1000462762 177
507 3300005548 Ga0070665_100023957 Ga0070665_1000239574 177
508 3300005548 Ga0070665_100027393 Ga0070665_1000273934 177
509 3300005548 Ga0070665_100090615 Ga0070665_1000906152 177
510 3300005548 Ga0070665_100223190 Ga0070665_1002231902 177
511 3300005548 Ga0070665_100345746 Ga0070665_1003457462 177
512 3300005563 Ga0068855_100004813 Ga0068855_10000481313 177
513 3300005563 Ga0068855_100021114 Ga0068855_1000211147 177
514 3300005563 Ga0068855_100071153 Ga0068855_1000711532 177
515 3300005563 Ga0068855_100209465 Ga0068855_1002094652 177
516 3300005563 Ga0068855_100236360 Ga0068855_1002363603 177
517 3300005563 Ga0068855_100592144 Ga0068855_1005921442 177
518 3300005563 Ga0068855_101642162 Ga0068855_1016421621 177
519 3300005564 Ga0070664_100003781 Ga0070664_1000037819 177
520 3300005564 Ga0070664_100014836 Ga0070664_1000148367 177
521 3300005564 Ga0070664_100062291 Ga0070664_1000622913 177
522 3300005564 Ga0070664_100065064 Ga0070664_1000650643 177
523 3300005564 Ga0070664_100869586 Ga0070664_1008695862 177
524 3300005577 Ga0068857_100087027 Ga0068857_1000870273 177
525 3300005577 Ga0068857_100983352 Ga0068857_1009833522 177
526 3300005578 Ga0068854_100041321 Ga0068854_1000413212 177
527 3300005614 Ga0068856_100017101 Ga0068856_1000171018 177
528 3300005614 Ga0068856_100035684 Ga0068856_1000356842 177
529 3300005614 Ga0068856_100049046 Ga0068856_1000490464 177
530 3300005615 Ga0070702_100088814 Ga0070702_1000888142 177
531 3300005616 Ga0068852_100007039 Ga0068852_1000070392 177
532 3300005616 Ga0068852_100007656 Ga0068852_1000076564 177
533 3300005616 Ga0068852_100039794 Ga0068852_1000397942 177
534 3300005616 Ga0068852_100049718 Ga0068852_1000497186 177
535 3300005616 Ga0068852_100147063 Ga0068852_1001470632 177
536 3300005616 Ga0068852_100194924 Ga0068852_1001949242 177
537 3300005617 Ga0068859_100020837 Ga0068859_1000208374 177
538 3300005617 Ga0068859_100056234 Ga0068859_1000562345 177
539 3300005617 Ga0068859_100206562 Ga0068859_1002065622 177
540 3300005617 Ga0068859_100228030 Ga0068859_1002280302 177
541 3300005617 Ga0068859_100710813 Ga0068859_1007108132 177
542 3300005617 Ga0068859_101024317 Ga0068859_1010243172 177
543 3300005618 Ga0068864_100001285 Ga0068864_10000128523 177
544 3300005618 Ga0068864_100008284 Ga0068864_1000082845 177
545 3300005618 Ga0068864_100054096 Ga0068864_1000540962 177
546 3300005618 Ga0068864_100107381 Ga0068864_1001073814 177
547 3300005618 Ga0068864_100495626 Ga0068864_1004956261 177
548 3300005718 Ga0068866_10035833 Ga0068866_100358334 177
549 3300005719 Ga0068861_100003709 Ga0068861_1000037093 177
550 3300005719 Ga0068861_100005006 Ga0068861_1000050065 177
551 3300005719 Ga0068861_100075027 Ga0068861_1000750272 177
552 3300005719 Ga0068861_100126387 Ga0068861_1001263872 177
553 3300005719 Ga0068861_100153025 Ga0068861_1001530252 177
554 3300005719 Ga0068861_100322956 Ga0068861_1003229562 177
555 3300005719 Ga0068861_100765574 Ga0068861_1007655742 177
556 3300005834 Ga0068851_10002374 Ga0068851_100023747 177
557 3300005834 Ga0068851_10007294 Ga0068851_100072943 177
558 3300005834 Ga0068851_10012519 Ga0068851_100125196 177
559 3300005834 Ga0068851_10101164 Ga0068851_101011642 177
560 3300005840 Ga0068870_10009006 Ga0068870_100090063 177
561 3300005840 Ga0068870_10192004 Ga0068870_101920042 177
562 3300005840 Ga0068870_10209989 Ga0068870_102099892 177
563 3300005841 Ga0068863_100021433 Ga0068863_1000214336 177
564 3300005841 Ga0068863_100029135 Ga0068863_1000291355 177
565 3300005841 Ga0068863_100033720 Ga0068863_1000337205 177
566 3300005841 Ga0068863_100074693 Ga0068863_1000746933 177
567 3300005841 Ga0068863_100100410 Ga0068863_1001004104 177
568 3300005841 Ga0068863_100230039 Ga0068863_1002300391 177
569 3300005841 Ga0068863_100789797 Ga0068863_1007897972 177
570 3300005841 Ga0068863_101362936 Ga0068863_1013629361 177
571 3300005842 Ga0068858_100021506 Ga0068858_1000215063 177
572 3300005842 Ga0068858_100021707 Ga0068858_1000217074 177
573 3300005842 Ga0068858_100209689 Ga0068858_1002096892 177
574 3300005843 Ga0068860_100005493 Ga0068860_10000549311 177
575 3300005843 Ga0068860_100005815 Ga0068860_1000058159 177
576 3300005843 Ga0068860_100066041 Ga0068860_1000660411 177
577 3300005843 Ga0068860_100150580 Ga0068860_1001505802 177
578 3300005843 Ga0068860_100166829 Ga0068860_1001668292 177
579 3300005843 Ga0068860_100234028 Ga0068860_1002340283 177
580 3300005843 Ga0068860_100362200 Ga0068860_1003622002 177
581 3300005843 Ga0068860_100466610 Ga0068860_1004666102 177
582 3300005843 Ga0068860_100557381 Ga0068860_1005573813 177
583 3300005844 Ga0068862_100029825 Ga0068862_1000298253 177
584 3300005844 Ga0068862_100058971 Ga0068862_1000589712 177
585 3300005844 Ga0068862_101405373 Ga0068862_1014053731 177
586 3300006237 Ga0097621_100001308 Ga0097621_10000130812 177
587 3300006237 Ga0097621_100304330 Ga0097621_1003043303 177
588 3300006358 Ga0068871_100001077 Ga0068871_10000107710 177
589 3300006358 Ga0068871_100109754 Ga0068871_1001097542 177
590 3300006358 Ga0068871_100204799 Ga0068871_1002047993 177
591 3300006844 Ga0075428_100028198 Ga0075428_1000281988 177
592 3300006846 Ga0075430_100652244 Ga0075430_1006522442 177
593 3300006871 Ga0075434_100204116 Ga0075434_1002041162 177
594 3300006881 Ga0068865_100015998 Ga0068865_1000159984 177
595 3300006881 Ga0068865_100045238 Ga0068865_1000452382 177
596 3300006881 Ga0068865_100053326 Ga0068865_1000533262 177
597 3300006881 Ga0068865_100145066 Ga0068865_1001450662 177
598 3300006881 Ga0068865_100248865 Ga0068865_1002488651 177
599 3300006914 Ga0075436_100090334 Ga0075436_1000903342 177
600 3300006931 Ga0097620_100020837 Ga0097620_1000208374 177
601 3300006931 Ga0097620_100056234 Ga0097620_1000562345 177
602 3300006931 Ga0097620_100206554 Ga0097620_1002065542 177
603 3300006931 Ga0097620_100228024 Ga0097620_1002280242 177
604 3300006931 Ga0097620_100710841 Ga0097620_1007108412 177
605 3300006931 Ga0097620_101024316 Ga0097620_1010243162 177
606 3300007265 Ga0099794_10237603 Ga0099794_102376032 177
607 3300009011 Ga0105251_10276745 Ga0105251_102767451 177
608 3300009093 Ga0105240_10018683 Ga0105240_100186834 177
609 3300009094 Ga0111539_10257698 Ga0111539_102576983 177
610 3300009098 Ga0105245_10209674 Ga0105245_102096744 177
611 3300009098 Ga0105245_10418636 Ga0105245_104186363 177
612 3300009101 Ga0105247_10180034 Ga0105247_101800343 177
613 3300009148 Ga0105243_10091093 Ga0105243_100910933 177
614 3300009177 Ga0105248_10002074 Ga0105248_100020749 177
615 3300009177 Ga0105248_10018068 Ga0105248_100180689 177
616 3300009177 Ga0105248_10141310 Ga0105248_101413103 177
617 3300009177 Ga0105248_10431634 Ga0105248_104316342 177
618 3300009177 Ga0105248_10995729 Ga0105248_109957291 177
619 3300009177 Ga0105248_11263997 Ga0105248_112639971 177
620 3300009177 Ga0105248_12572893 Ga0105248_125728931 177
621 3300009545 Ga0105237_10080261 Ga0105237_100802612 177
622 3300009553 Ga0105249_10266929 Ga0105249_102669292 177
623 3300009553 Ga0105249_10757998 Ga0105249_107579982 177
624 3300010375 Ga0105239_10789428 Ga0105239_107894282 177
625 3300010375 Ga0105239_12005190 Ga0105239_120051901 177
626 3300011119 Ga0105246_10194636 Ga0105246_101946362 177
627 3300013100 Ga0157373_10001146 Ga0157373_1000114618 177
628 3300013102 Ga0157371_10001270 Ga0157371_1000127013 177
629 3300013104 Ga0157370_10031257 Ga0157370_100312573 177
630 3300013104 Ga0157370_10034216 Ga0157370_100342164 177
631 3300013104 Ga0157370_10113007 Ga0157370_101130072 177
632 3300013104 Ga0157370_10770293 Ga0157370_107702931 177
633 3300013105 Ga0157369_10112017 Ga0157369_101120173 177
634 3300013296 Ga0157374_10001312 Ga0157374_100013129 177
635 3300013296 Ga0157374_10003097 Ga0157374_1000309714 177
636 3300013297 Ga0157378_10005399 Ga0157378_1000539912 177
637 3300013297 Ga0157378_10285543 Ga0157378_102855434 177
638 3300013297 Ga0157378_10486939 Ga0157378_104869392 177
639 3300013306 Ga0163162_10005459 Ga0163162_100054598 177
640 3300013306 Ga0163162_10057652 Ga0163162_100576521 177
641 3300013306 Ga0163162_10073420 Ga0163162_100734202 177
642 3300013306 Ga0163162_10104564 Ga0163162_101045643 177
643 3300013306 Ga0163162_11047736 Ga0163162_110477362 177
644 3300013307 Ga0157372_10002798 Ga0157372_100027988 177
645 3300013307 Ga0157372_10064232 Ga0157372_100642322 177
646 3300013307 Ga0157372_10082910 Ga0157372_100829104 177
647 3300013307 Ga0157372_10125410 Ga0157372_101254104 177
648 3300013307 Ga0157372_10257457 Ga0157372_102574572 177
649 3300013307 Ga0157372_11037427 Ga0157372_110374272 177
650 3300013307 Ga0157372_11791555 Ga0157372_117915552 177
651 3300013308 Ga0157375_10002469 Ga0157375_1000246910 177
652 3300013308 Ga0157375_10038200 Ga0157375_100382002 177
653 3300013308 Ga0157375_10052859 Ga0157375_100528596 177
654 3300013308 Ga0157375_10117630 Ga0157375_101176303 177
655 3300013308 Ga0157375_10150785 Ga0157375_101507852 177
656 3300013308 Ga0157375_10684861 Ga0157375_106848612 177
657 3300013308 Ga0157375_10713973 Ga0157375_107139732 177
658 3300013308 Ga0157375_10995462 Ga0157375_109954622 177
659 3300014325 Ga0163163_10015342 Ga0163163_100153421 177
660 3300014325 Ga0163163_10054422 Ga0163163_100544223 177
661 3300014325 Ga0163163_10134510 Ga0163163_101345103 177
662 3300014325 Ga0163163_10751405 Ga0163163_107514052 177
663 3300014326 Ga0157380_10064658 Ga0157380_100646584 177
664 3300014326 Ga0157380_10139268 Ga0157380_101392682 177
665 3300014745 Ga0157377_10016528 Ga0157377_100165283 177
666 3300014745 Ga0157377_10343305 Ga0157377_103433052 177
667 3300014968 Ga0157379_10000858 Ga0157379_100008589 177
668 3300014968 Ga0157379_10004449 Ga0157379_100044497 177
669 3300014969 Ga0157376_10012373 Ga0157376_100123735 177
670 3300014969 Ga0157376_10477196 Ga0157376_104771962 177
671 3300014969 Ga0157376_11076075 Ga0157376_110760752 177
672 3300017792 Ga0163161_10010199 Ga0163161_100101997 177
673 3300017792 Ga0163161_10021494 Ga0163161_100214945 177
674 3300017792 Ga0163161_10195601 Ga0163161_101956012 177
675 3300017792 Ga0163161_10723215 Ga0163161_107232152 177
676 3300017792 Ga0163161_10841969 Ga0163161_108419692 177
677 3300020081 Ga0206354_10723169 Ga0206354_107231692 177
678 3300025315 Ga0207697_10000414 Ga0207697_100004149 177
679 3300025315 Ga0207697_10008388 Ga0207697_100083884 177
680 3300025315 Ga0207697_10019659 Ga0207697_100196592 177
681 3300025321 Ga0207656_10016976 Ga0207656_100169765 177
682 3300025893 Ga0207682_10000882 Ga0207682_100008824 177
683 3300025893 Ga0207682_10001053 Ga0207682_1000105311 177
684 3300025900 Ga0207710_10091805 Ga0207710_100918052 177
685 3300025901 Ga0207688_10001416 Ga0207688_100014169 177
686 3300025903 Ga0207680_10000458 Ga0207680_1000045817 177
687 3300025903 Ga0207680_10018773 Ga0207680_100187733 177
688 3300025903 Ga0207680_10042029 Ga0207680_100420293 177
689 3300025903 Ga0207680_10056995 Ga0207680_100569954 177
690 3300025903 Ga0207680_10067693 Ga0207680_100676932 177
691 3300025904 Ga0207647_10095485 Ga0207647_100954852 177
692 3300025906 Ga0207699_10001757 Ga0207699_1000175712 177
693 3300025907 Ga0207645_10000308 Ga0207645_1000030818 177
694 3300025907 Ga0207645_10000661 Ga0207645_1000066138 177
695 3300025907 Ga0207645_10001318 Ga0207645_100013184 177
696 3300025907 Ga0207645_10070649 Ga0207645_100706493 177
697 3300025907 Ga0207645_10279160 Ga0207645_102791602 177
698 3300025907 Ga0207645_10462481 Ga0207645_104624812 177
699 3300025908 Ga0207643_10000515 Ga0207643_1000051512 177
700 3300025908 Ga0207643_10006397 Ga0207643_100063972 177
701 3300025908 Ga0207643_10039127 Ga0207643_100391271 177
702 3300025908 Ga0207643_10229113 Ga0207643_102291132 177
703 3300025909 Ga0207705_10591113 Ga0207705_105911131 177
704 3300025911 Ga0207654_10589145 Ga0207654_105891451 177
705 3300025912 Ga0207707_10075114 Ga0207707_100751142 177
706 3300025912 Ga0207707_10256342 Ga0207707_102563422 177
707 3300025913 Ga0207695_10060223 Ga0207695_100602233 177
708 3300025914 Ga0207671_10142546 Ga0207671_101425463 177
709 3300025915 Ga0207693_10020414 Ga0207693_100204147 177
710 3300025916 Ga0207663_10003837 Ga0207663_100038375 177
711 3300025917 Ga0207660_10028314 Ga0207660_100283142 177
712 3300025917 Ga0207660_10078716 Ga0207660_100787162 177
713 3300025918 Ga0207662_10007274 Ga0207662_100072746 177
714 3300025918 Ga0207662_10158243 Ga0207662_101582432 177
715 3300025919 Ga0207657_10010916 Ga0207657_100109168 177
716 3300025919 Ga0207657_10022078 Ga0207657_100220783 177
717 3300025919 Ga0207657_10031129 Ga0207657_100311294 177
718 3300025920 Ga0207649_10010264 Ga0207649_100102642 177
719 3300025920 Ga0207649_10025326 Ga0207649_100253263 177
720 3300025920 Ga0207649_10123864 Ga0207649_101238642 177
721 3300025920 Ga0207649_10285277 Ga0207649_102852772 177
722 3300025920 Ga0207649_10594754 Ga0207649_105947542 177
723 3300025921 Ga0207652_10031111 Ga0207652_100311114 177
724 3300025921 Ga0207652_10322812 Ga0207652_103228122 177
725 3300025921 Ga0207652_10353757 Ga0207652_103537572 177
726 3300025921 Ga0207652_10858534 Ga0207652_108585342 177
727 3300025923 Ga0207681_10013968 Ga0207681_100139685 177
728 3300025923 Ga0207681_10042165 Ga0207681_100421652 177
729 3300025923 Ga0207681_10077700 Ga0207681_100777002 177
730 3300025923 Ga0207681_10080022 Ga0207681_100800224 177
731 3300025923 Ga0207681_10198461 Ga0207681_101984612 177
732 3300025923 Ga0207681_10199963 Ga0207681_101999633 177
733 3300025925 Ga0207650_10007692 Ga0207650_100076927 177
734 3300025925 Ga0207650_10023409 Ga0207650_100234095 177
735 3300025925 Ga0207650_10081552 Ga0207650_100815522 177
736 3300025925 Ga0207650_10100240 Ga0207650_101002402 177
737 3300025925 Ga0207650_10176364 Ga0207650_101763643 177
738 3300025925 Ga0207650_10177682 Ga0207650_101776822 177
739 3300025925 Ga0207650_10272078 Ga0207650_102720783 177
740 3300025925 Ga0207650_10303583 Ga0207650_103035833 177
741 3300025925 Ga0207650_10320427 Ga0207650_103204273 177
742 3300025925 Ga0207650_10657315 Ga0207650_106573152 177
743 3300025926 Ga0207659_10001947 Ga0207659_100019479 177
744 3300025926 Ga0207659_10008878 Ga0207659_100088784 177
745 3300025926 Ga0207659_10058286 Ga0207659_100582862 177
746 3300025926 Ga0207659_10239508 Ga0207659_102395081 177
747 3300025926 Ga0207659_10648046 Ga0207659_106480462 177
748 3300025927 Ga0207687_10446015 Ga0207687_104460152 177
749 3300025928 Ga0207700_10036111 Ga0207700_100361115 177
750 3300025929 Ga0207664_10150946 Ga0207664_101509461 177
751 3300025929 Ga0207664_10368711 Ga0207664_103687112 177
752 3300025931 Ga0207644_10002335 Ga0207644_100023357 177
753 3300025931 Ga0207644_10004658 Ga0207644_100046586 177
754 3300025931 Ga0207644_10011896 Ga0207644_100118967 177
755 3300025931 Ga0207644_10077256 Ga0207644_100772564 177
756 3300025932 Ga0207690_10051257 Ga0207690_100512573 177
757 3300025932 Ga0207690_10241125 Ga0207690_102411252 177
758 3300025932 Ga0207690_11194368 Ga0207690_111943681 177
759 3300025932 Ga0207690_11298065 Ga0207690_112980651 177
760 3300025933 Ga0207706_10002095 Ga0207706_1000209517 177
761 3300025933 Ga0207706_10003433 Ga0207706_100034337 177
762 3300025933 Ga0207706_10044681 Ga0207706_100446815 177
763 3300025933 Ga0207706_10046409 Ga0207706_100464092 177
764 3300025933 Ga0207706_10132342 Ga0207706_101323422 177
765 3300025933 Ga0207706_10323910 Ga0207706_103239102 177
766 3300025933 Ga0207706_10332122 Ga0207706_103321222 177
767 3300025933 Ga0207706_10453825 Ga0207706_104538252 177
768 3300025935 Ga0207709_10446596 Ga0207709_104465962 177
769 3300025936 Ga0207670_10023785 Ga0207670_100237855 177
770 3300025936 Ga0207670_10267540 Ga0207670_102675402 177
771 3300025936 Ga0207670_10339691 Ga0207670_103396912 177
772 3300025936 Ga0207670_10654939 Ga0207670_106549392 177
773 3300025937 Ga0207669_10062451 Ga0207669_100624512 177
774 3300025937 Ga0207669_10218692 Ga0207669_102186922 177
775 3300025937 Ga0207669_10272264 Ga0207669_102722642 177
776 3300025937 Ga0207669_10432810 Ga0207669_104328102 177
777 3300025938 Ga0207704_10267081 Ga0207704_102670813 177
778 3300025938 Ga0207704_10285633 Ga0207704_102856331 177
779 3300025938 Ga0207704_10492556 Ga0207704_104925562 177
780 3300025940 Ga0207691_10000016 Ga0207691_100000169 177
781 3300025940 Ga0207691_10000249 Ga0207691_1000024921 177
782 3300025940 Ga0207691_10010436 Ga0207691_100104369 177
783 3300025940 Ga0207691_10023071 Ga0207691_100230713 177
784 3300025940 Ga0207691_10031686 Ga0207691_100316862 177
785 3300025940 Ga0207691_10043297 Ga0207691_100432974 177
786 3300025940 Ga0207691_10054464 Ga0207691_100544641 177
787 3300025940 Ga0207691_10088467 Ga0207691_100884672 177
788 3300025941 Ga0207711_10015792 Ga0207711_100157924 177
789 3300025941 Ga0207711_10028790 Ga0207711_100287905 177
790 3300025941 Ga0207711_10129172 Ga0207711_101291722 177
791 3300025941 Ga0207711_10184264 Ga0207711_101842643 177
792 3300025941 Ga0207711_10262548 Ga0207711_102625482 177
793 3300025941 Ga0207711_11032127 Ga0207711_110321271 177
794 3300025942 Ga0207689_10002125 Ga0207689_1000212516 177
795 3300025942 Ga0207689_10006079 Ga0207689_1000607912 177
796 3300025942 Ga0207689_10130410 Ga0207689_101304103 177
797 3300025944 Ga0207661_10162532 Ga0207661_101625321 177
798 3300025945 Ga0207679_10023735 Ga0207679_100237356 177
799 3300025945 Ga0207679_10102883 Ga0207679_101028832 177
800 3300025945 Ga0207679_10246549 Ga0207679_102465492 177
801 3300025945 Ga0207679_10589948 Ga0207679_105899481 177
802 3300025945 Ga0207679_10780569 Ga0207679_107805692 177
803 3300025949 Ga0207667_10007488 Ga0207667_100074885 177
804 3300025949 Ga0207667_10065531 Ga0207667_100655313 177
805 3300025949 Ga0207667_10074508 Ga0207667_100745082 177
806 3300025949 Ga0207667_10395391 Ga0207667_103953913 177
807 3300025949 Ga0207667_10465475 Ga0207667_104654752 177
808 3300025949 Ga0207667_10541642 Ga0207667_105416422 177
809 3300025949 Ga0207667_10638834 Ga0207667_106388342 177
810 3300025960 Ga0207651_10001976 Ga0207651_100019763 177
811 3300025960 Ga0207651_10006459 Ga0207651_100064594 177
812 3300025960 Ga0207651_10031705 Ga0207651_100317052 177
813 3300025960 Ga0207651_10046413 Ga0207651_100464134 177
814 3300025960 Ga0207651_10130259 Ga0207651_101302592 177
815 3300025960 Ga0207651_10278674 Ga0207651_102786742 177
816 3300025961 Ga0207712_10459007 Ga0207712_104590072 177
817 3300025972 Ga0207668_10002554 Ga0207668_100025546 177
818 3300025972 Ga0207668_10020730 Ga0207668_100207302 177
819 3300025972 Ga0207668_10021360 Ga0207668_100213605 177
820 3300025972 Ga0207668_10292192 Ga0207668_102921922 177
821 3300025972 Ga0207668_10394978 Ga0207668_103949782 177
822 3300025972 Ga0207668_10424551 Ga0207668_104245511 177
823 3300025972 Ga0207668_10642539 Ga0207668_106425392 177
824 3300025972 Ga0207668_10983613 Ga0207668_109836131 177
825 3300025981 Ga0207640_10026417 Ga0207640_100264174 177
826 3300025981 Ga0207640_10031013 Ga0207640_100310132 177
827 3300025981 Ga0207640_10079950 Ga0207640_100799503 177
828 3300025981 Ga0207640_10107359 Ga0207640_101073593 177
829 3300025981 Ga0207640_10264209 Ga0207640_102642092 177
830 3300025981 Ga0207640_10931322 Ga0207640_109313222 177
831 3300025986 Ga0207658_10001272 Ga0207658_100012727 177
832 3300025986 Ga0207658_10018261 Ga0207658_100182616 177
833 3300025986 Ga0207658_10031594 Ga0207658_100315942 177
834 3300025986 Ga0207658_10043012 Ga0207658_100430122 177
835 3300025986 Ga0207658_10086331 Ga0207658_100863314 177
836 3300025986 Ga0207658_10240136 Ga0207658_102401364 177
837 3300026023 Ga0207677_10007009 Ga0207677_100070096 177
838 3300026023 Ga0207677_10008530 Ga0207677_100085305 177
839 3300026023 Ga0207677_10029996 Ga0207677_100299964 177
840 3300026035 Ga0207703_10002267 Ga0207703_1000226714 177
841 3300026035 Ga0207703_10011900 Ga0207703_100119008 177
842 3300026035 Ga0207703_10601799 Ga0207703_106017992 177
843 3300026035 Ga0207703_11220166 Ga0207703_112201662 177
844 3300026041 Ga0207639_10068248 Ga0207639_100682482 177
845 3300026041 Ga0207639_10330041 Ga0207639_103300412 177
846 3300026041 Ga0207639_10835911 Ga0207639_108359112 177
847 3300026067 Ga0207678_10013575 Ga0207678_100135757 177
848 3300026067 Ga0207678_10199353 Ga0207678_101993531 177
849 3300026067 Ga0207678_10202123 Ga0207678_102021232 177
850 3300026067 Ga0207678_10274939 Ga0207678_102749392 177
851 3300026067 Ga0207678_10634197 Ga0207678_106341971 177
852 3300026075 Ga0207708_10035511 Ga0207708_100355113 177
853 3300026075 Ga0207708_10044106 Ga0207708_100441064 177
854 3300026078 Ga0207702_10020077 Ga0207702_100200777 177
855 3300026078 Ga0207702_10287372 Ga0207702_102873723 177
856 3300026078 Ga0207702_10377091 Ga0207702_103770912 177
857 3300026088 Ga0207641_10000374 Ga0207641_1000037454 177
858 3300026088 Ga0207641_10015912 Ga0207641_100159122 177
859 3300026088 Ga0207641_10065192 Ga0207641_100651922 177
860 3300026088 Ga0207641_10109938 Ga0207641_101099384 177
861 3300026088 Ga0207641_10143071 Ga0207641_101430712 177
862 3300026088 Ga0207641_10288356 Ga0207641_102883561 177
863 3300026088 Ga0207641_10404453 Ga0207641_104044532 177
864 3300026088 Ga0207641_10548303 Ga0207641_105483031 177
865 3300026088 Ga0207641_10690017 Ga0207641_106900172 177
866 3300026089 Ga0207648_10000523 Ga0207648_1000052324 177
867 3300026089 Ga0207648_10002934 Ga0207648_100029342 177
868 3300026089 Ga0207648_10006980 Ga0207648_1000698011 177
869 3300026089 Ga0207648_10029738 Ga0207648_100297382 177
870 3300026089 Ga0207648_10038007 Ga0207648_100380076 177
871 3300026089 Ga0207648_10147528 Ga0207648_101475281 177
872 3300026089 Ga0207648_10262650 Ga0207648_102626502 177
873 3300026095 Ga0207676_10017764 Ga0207676_100177642 177
874 3300026095 Ga0207676_10031925 Ga0207676_100319251 177
875 3300026095 Ga0207676_10065863 Ga0207676_100658634 177
876 3300026095 Ga0207676_10142805 Ga0207676_101428052 177
877 3300026116 Ga0207674_10004098 Ga0207674_100040988 177
878 3300026116 Ga0207674_10157640 Ga0207674_101576402 177
879 3300026118 Ga0207675_100000635 Ga0207675_10000063519 177
880 3300026118 Ga0207675_100002219 Ga0207675_1000022192 177
881 3300026118 Ga0207675_100086258 Ga0207675_1000862582 177
882 3300026118 Ga0207675_100222891 Ga0207675_1002228912 177
883 3300026118 Ga0207675_100784130 Ga0207675_1007841302 177
884 3300026121 Ga0207683_10000476 Ga0207683_1000047628 177
885 3300026121 Ga0207683_10000672 Ga0207683_1000067245 177
886 3300026121 Ga0207683_10002112 Ga0207683_1000211215 177
887 3300026121 Ga0207683_10007275 Ga0207683_100072755 177
888 3300026121 Ga0207683_10025522 Ga0207683_100255226 177
889 3300026121 Ga0207683_10325511 Ga0207683_103255112 177
890 3300026121 Ga0207683_10511714 Ga0207683_105117142 177
891 3300026142 Ga0207698_10005967 Ga0207698_100059678 177
892 3300026142 Ga0207698_10131938 Ga0207698_101319382 177
893 3300026142 Ga0207698_10152720 Ga0207698_101527202 177
894 3300026142 Ga0207698_10166207 Ga0207698_101662072 177
895 3300026142 Ga0207698_10541797 Ga0207698_105417972 177
896 3300027552 Ga0209982_1042253 Ga0209982_10422531 177
897 3300027614 Ga0209970_1035631 Ga0209970_10356312 177
898 3300027617 Ga0210002_1017004 Ga0210002_10170042 177
899 3300027665 Ga0209983_1035371 Ga0209983_10353712 177
900 3300027682 Ga0209971_1028050 Ga0209971_10280502 177
901 3300027717 Ga0209998_10002560 Ga0209998_100025603 177
902 3300027876 Ga0209974_10004113 Ga0209974_100041132 177
903 3300027876 Ga0209974_10015442 Ga0209974_100154424 177
904 3300027907 Ga0207428_10130264 Ga0207428_101302642 177
905 3300028379 Ga0268266_10005562 Ga0268266_100055628 177
906 3300028379 Ga0268266_10128475 Ga0268266_101284752 177
907 3300028379 Ga0268266_10201074 Ga0268266_102010743 177
908 3300028379 Ga0268266_10277511 Ga0268266_102775113 177
909 3300028380 Ga0268265_10312345 Ga0268265_103123453 177
910 3300028380 Ga0268265_10325203 Ga0268265_103252032 177
911 3300028380 Ga0268265_10428092 Ga0268265_104280922 177
912 3300028380 Ga0268265_10895298 Ga0268265_108952982 177
913 3300028381 Ga0268264_10002850 Ga0268264_100028507 177
914 3300028381 Ga0268264_10007025 Ga0268264_100070252 177
915 3300028381 Ga0268264_10019003 Ga0268264_100190034 177
916 3300028381 Ga0268264_10102882 Ga0268264_101028822 177
917 3300028381 Ga0268264_10349600 Ga0268264_103496003 177
918 3300028381 Ga0268264_10424774 Ga0268264_104247743 177
919 3300028381 Ga0268264_10565830 Ga0268264_105658302 177
920 3300031548 Ga0307408_100007603 Ga0307408_1000076035 177
921 3300031731 Ga0307405_10668172 Ga0307405_106681722 177
922 3300031824 Ga0307413_10011768 Ga0307413_100117682 177
923 3300031852 Ga0307410_10002137 Ga0307410_100021377 177
924 3300031901 Ga0307406_10009643 Ga0307406_100096435 177
925 3300031903 Ga0307407_10005873 Ga0307407_100058732 177
926 3300031911 Ga0307412_10067247 Ga0307412_100672474 177
927 3300031995 Ga0307409_100000504 Ga0307409_10000050415 177
928 3300032002 Ga0307416_100385982 Ga0307416_1003859823 177
929 3300032005 Ga0307411_10004100 Ga0307411_100041004 177
930 3300032126 Ga0307415_100644037 Ga0307415_1006440372 177
931 3300035115 Ga0373941_0260880 Ga0373941_0260880_77_622 177
932 3300035118 Ga0373954_0101671 Ga0373954_0101671_61_594 177
933 3300035120 Ga0373957_0174728 Ga0373957_0174728_243_776 177
934 3300035691 Ga0373931_0071372 Ga0373931_0071372_458_1033 177
935 3300036401 Ga0373937_0094946 Ga0373937_0094946_1057_1590 177
936 3300041452 Ga0451793_0118162 Ga0451793_0118162_37_591 177
937 3300041501 Ga0451845_0443829 Ga0451845_0443829_81_614 177
938 3300044658 Ga0466972_0000519 Ga0466972_0000519_10015_10548 177
939 3300044683 Ga0466965_0104298 Ga0466965_0104298_289_822 177
940 3300044719 Ga0466971_0297144 Ga0466971_0297144_77_610 177
941 3300045051 Ga0451576_0309025 Ga0451576_0309025_573_1199 177
942 3300045051 Ga0451576_0735579 Ga0451576_0735579_109_708 177
943 3300045836 Ga0466958_0064880 Ga0466958_0064880_1137_1718 177
944 3300045976 Ga0466967_0204818 Ga0466967_0204818_177_752 177
945 3300045976 Ga0466967_1035178 Ga0466967_1035178_61_642 177
946 3300048903 Ga0496100_0265577 Ga0496100_0265577_422_955 177
947 3300048903 Ga0496100_0306145 Ga0496100_0306145_154_687 177
948 3300048904 Ga0496101_0197531 Ga0496101_0197531_225_758 177
949 3300048904 Ga0496101_0377397 Ga0496101_0377397_350_883 177
950 3300048904 Ga0496101_0384185 Ga0496101_0384185_343_885 177
951 3300048905 Ga0496102_0004620 Ga0496102_0004620_8977_9552 177
952 3300048905 Ga0496102_0555021 Ga0496102_0555021_440_973 177
953 3300048905 Ga0496102_0686043 Ga0496102_0686043_353_895 177
954 3300048906 Ga0496103_0039856 Ga0496103_0039856_106_681 177
955 3300048907 Ga0496104_0021708 Ga0496104_0021708_1074_1607 177
956 3300048908 Ga0496105_0055654 Ga0496105_0055654_910_1443 177
957 3300048908 Ga0496105_0384780 Ga0496105_0384780_433_966 177
958 3300048909 Ga0496106_0011048 Ga0496106_0011048_3817_4350 177
959 3300048909 Ga0496106_0038445 Ga0496106_0038445_1602_2135 177
960 3300048909 Ga0496106_0040940 Ga0496106_0040940_2190_2765 177
961 3300048910 Ga0496107_0083807 Ga0496107_0083807_1143_1676 177
962 3300048910 Ga0496107_0126064 Ga0496107_0126064_38_571 177
963 3300048911 Ga0496108_0031541 Ga0496108_0031541_1490_2023 177
964 3300048911 Ga0496108_0134527 Ga0496108_0134527_14_556 177
965 3300048912 Ga0496109_0046869 Ga0496109_0046869_3195_3728 177
966 3300048912 Ga0496109_0134673 Ga0496109_0134673_1171_1713 177
967 3300048912 Ga0496109_0711188 Ga0496109_0711188_337_906 177
968 3300048912 Ga0496109_1627422 Ga0496109_1627422_36_569 177
969 3300048913 Ga0496110_0007678 Ga0496110_0007678_2655_3188 177
970 3300048913 Ga0496110_0209853 Ga0496110_0209853_875_1408 177
971 3300048914 Ga0496111_0499194 Ga0496111_0499194_98_673 177
972 3300048915 Ga0496112_0650621 Ga0496112_0650621_86_628 177
973 3300048915 Ga0496112_1027392 Ga0496112_1027392_135_668 177
974 3300048916 Ga0496113_0280626 Ga0496113_0280626_754_1287 177
975 3300048917 Ga0496114_0082369 Ga0496114_0082369_1028_1561 177
976 3300048917 Ga0496114_0191517 Ga0496114_0191517_748_1281 177
977 3300049572 Ga0501036_0282528 Ga0501036_0282528_430_963 177
978 3300049583 Ga0501067_0181537 Ga0501067_0181537_37_570 177
979 3300050509 nmdc:mga0qj67_635875_c1 nmdc:mga0qj67_635875_c1_159_692 177
980 3300050511 nmdc:mga08y16_73941_c1 nmdc:mga08y16_73941_c1_842_1375 177
981 3300050512 nmdc:mga0n895_226561_c1 nmdc:mga0n895_226561_c1_1058_1591 177
982 3300050512 nmdc:mga0n895_402025_c1 nmdc:mga0n895_402025_c1_78_686 177
983 3300050514 nmdc:mga08x19_114952_c1 nmdc:mga08x19_114952_c1_402_953 177
984 3300053084 Ga0495595_0034147 Ga0495595_0034147_1388_1921 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

66

198

0.93

PF00578

AhpC-TSA

AhpC/TSA family

67

184

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9355 31 176
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.9325 31 176
1z5y-assembly1.cif.gz_E crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg 0.9275 45 176
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9175 38 174
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.9155 27 174
ID Description Score Start End Superfamily
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9354 31 176 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9175 38 174 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9116 31 176 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8713 43 174 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8713 37 175 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0X5A7-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9925 36 177 GO:0015036
GO:0017004
GO:0030288
AF-A0A7W0X5A7-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9856 36 177 GO:0015036
GO:0017004
GO:0030288
AF-A0A536Z3B2-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9747 72 177 GO:0015036
GO:0017004
GO:0030288
AF-A0A1H7XPN3-F1-model_v4 Cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE 0.9717 23 177 GO:0015036
GO:0017004
GO:0030288
AF-A0A3M0YK98-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.969 58 177 GO:0005886
GO:0015036
GO:0017004
GO:0030288

Feature Viewer

pLDDT pTM Quality
92.97 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map