F487250

General Info

Members Datasets Scaffolds Average Seq Length
976 278 976 114

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10238573|Ga0065704_102385732
Length 127
Sequence MINSNLGFGVWDLGFPNLIAMATPSQASPSPWLQFVPFVLVLGIFYFIILLPMKKRQQKVQAFLGALKVNDKVITSGGIYGTITKVSDASVQLQVANNVRIDVSRAAIVGYQGQEPVGEALSQSKTE

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
105 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
205 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
234 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
262 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1010804 3300001977 Bacteria 1347
2 JGI24035J26624_1009785 3300002126 Unclassified 947
3 JGI24033J26618_1022121 3300002155 Archaea 821
4 JGI24034J26672_10083343 3300002239 Archaea 586
5 JGI24751J29686_10039974 3300002459 Archaea 971
6 JGI24751J29686_10063087 3300002459 Bacteria 763
7 Ga0058861_11795853 3300004800 Unclassified 820
8 Ga0065714_10085582 3300005288 Bacteria 2142
9 Ga0065714_10131696 3300005288 Unclassified 1244
10 Ga0065714_10139313 3300005288 Bacteria 1184
11 Ga0065704_10238573 3300005289 Bacteria 1022
12 Ga0065704_10263811 3300005289 Archaea 956
13 Ga0065704_10280339 3300005289 Unclassified 924
14 Ga0065712_10009945 3300005290 Bacteria 3847
15 Ga0065712_10026972 3300005290 Bacteria 1634
16 Ga0065712_10068029 3300005290 Bacteria 16684
17 Ga0065712_10074468 3300005290 Bacteria 4086
18 Ga0065712_10172488 3300005290 Bacteria 1236
19 Ga0065715_10004827 3300005293 Bacteria 3943
20 Ga0065715_10007485 3300005293 Bacteria 6998
21 Ga0065715_10071301 3300005293 Unclassified 634
22 Ga0065715_10156526 3300005293 Bacteria 1671
23 Ga0065715_10179119 3300005293 Bacteria 1489
24 Ga0065707_10008321 3300005295 Bacteria 2505
25 Ga0065707_10012615 3300005295 Bacteria 2600
26 Ga0065707_10036311 3300005295 Bacteria 1232
27 Ga0065707_10177573 3300005295 Bacteria 1440
28 Ga0065707_10294736 3300005295 Bacteria 1017
29 Ga0065707_10513075 3300005295 Unclassified 747
30 Ga0070658_10681076 3300005327 Unclassified 892
31 Ga0070676_10004892 3300005328 Bacteria 7098
32 Ga0070676_10028131 3300005328 Bacteria 3192
33 Ga0070676_10116384 3300005328 Bacteria 1672
34 Ga0070676_10209629 3300005328 Bacteria 1282
35 Ga0070683_100307950 3300005329 Bacteria 1507
36 Ga0070683_100339982 3300005329 Unclassified 1429
37 Ga0070683_101058910 3300005329 Unclassified 779
38 Ga0070690_100020399 3300005330 Bacteria 4037
39 Ga0070690_100195332 3300005330 Bacteria 1405
40 Ga0070690_100236311 3300005330 Bacteria 1287
41 Ga0070690_100538619 3300005330 Bacteria 878
42 Ga0070670_100002473 3300005331 Bacteria 15248
43 Ga0070670_100006795 3300005331 Bacteria 9685
44 Ga0070670_100308078 3300005331 Bacteria 1386
45 Ga0070670_100372748 3300005331 Bacteria 1257
46 Ga0070670_100721919 3300005331 Bacteria 897
47 Ga0070677_10355963 3300005333 Bacteria 760
48 Ga0070677_10902812 3300005333 Archaea 511
49 Ga0068869_100015575 3300005334 Bacteria 5105
50 Ga0068869_100134140 3300005334 Bacteria 1906
51 Ga0068869_100168473 3300005334 Bacteria 1710
52 Ga0068869_100351982 3300005334 Bacteria 1201
53 Ga0070666_10017347 3300005335 Bacteria 4615
54 Ga0070666_10045843 3300005335 Bacteria 2931
55 Ga0070666_10427074 3300005335 Bacteria 955
56 Ga0070666_10576985 3300005335 Bacteria 819
57 Ga0070680_100967993 3300005336 Unclassified 735
58 Ga0068868_100028174 3300005338 Bacteria 4292
59 Ga0068868_100590139 3300005338 Bacteria 983
60 Ga0068868_101184660 3300005338 Unclassified 706
61 Ga0070660_101366093 3300005339 Unclassified 602
62 Ga0070660_101829905 3300005339 Bacteria 517
63 Ga0070689_100013831 3300005340 Bacteria 5847
64 Ga0070689_100113078 3300005340 Bacteria 2162
65 Ga0070689_100219937 3300005340 Bacteria 1557
66 Ga0070689_100457581 3300005340 Bacteria 1087
67 Ga0070689_100462733 3300005340 Bacteria 1081
68 Ga0070689_100496396 3300005340 Bacteria 1045
69 Ga0070689_100622486 3300005340 Bacteria 937
70 Ga0070689_101957773 3300005340 Bacteria 536
71 Ga0070689_102055714 3300005340 Unclassified 523
72 Ga0070691_10276112 3300005341 Bacteria 910
73 Ga0070687_100012056 3300005343 Bacteria 3803
74 Ga0070687_100120732 3300005343 Bacteria 1499
75 Ga0070687_100149692 3300005343 Bacteria 1369
76 Ga0070687_100801030 3300005343 Bacteria 667
77 Ga0070661_100284445 3300005344 Bacteria 1283
78 Ga0070661_100311862 3300005344 Bacteria 1227
79 Ga0070661_100434878 3300005344 Bacteria 1042
80 Ga0070692_10314873 3300005345 Bacteria 960
81 Ga0070692_10571464 3300005345 Bacteria 744
82 Ga0070692_10844979 3300005345 Unclassified 629
83 Ga0070668_100054752 3300005347 Bacteria 3077
84 Ga0070668_100171496 3300005347 Bacteria 1767
85 Ga0070668_100415741 3300005347 Bacteria 1151
86 Ga0070668_100781962 3300005347 Bacteria 847
87 Ga0070668_101305000 3300005347 Bacteria 660
88 Ga0070669_100024441 3300005353 Bacteria 4331
89 Ga0070669_100046285 3300005353 Bacteria 3172
90 Ga0070669_100094522 3300005353 Bacteria 2246
91 Ga0070669_100216571 3300005353 Bacteria 1513
92 Ga0070669_100348850 3300005353 Bacteria 1201
93 Ga0070669_100572461 3300005353 Bacteria 944
94 Ga0070669_100655190 3300005353 Bacteria 884
95 Ga0070669_101010391 3300005353 Unclassified 714
96 Ga0070669_101745864 3300005353 Bacteria 543
97 Ga0070675_100010643 3300005354 Bacteria 7191
98 Ga0070675_100026955 3300005354 Bacteria 4614
99 Ga0070675_100031699 3300005354 Bacteria 4275
100 Ga0070675_100051450 3300005354 Bacteria 3385
101 Ga0070675_100051531 3300005354 Bacteria 3382
102 Ga0070675_100054369 3300005354 Bacteria 3294
103 Ga0070675_100192394 3300005354 Bacteria 1768
104 Ga0070675_100210327 3300005354 Bacteria 1691
105 Ga0070675_100267127 3300005354 Bacteria 1500
106 Ga0070675_100389407 3300005354 Bacteria 1242
107 Ga0070675_100747922 3300005354 Bacteria 892
108 Ga0070675_101161058 3300005354 Unclassified 711
109 Ga0070675_101232846 3300005354 Bacteria 689
110 Ga0070675_101523782 3300005354 Unclassified 617
111 Ga0070671_100182084 3300005355 Unclassified 1779
112 Ga0070671_100411174 3300005355 Bacteria 1158
113 Ga0070671_100690875 3300005355 Bacteria 885
114 Ga0070671_100724560 3300005355 Bacteria 863
115 Ga0070674_100013105 3300005356 Bacteria 5114
116 Ga0070674_100535233 3300005356 Bacteria 981
117 Ga0070674_100754336 3300005356 Bacteria 836
118 Ga0070674_101397833 3300005356 Archaea 627
119 Ga0070673_100002298 3300005364 Bacteria 11610
120 Ga0070673_100011536 3300005364 Bacteria 6035
121 Ga0070673_100041539 3300005364 Bacteria 3538
122 Ga0070673_100044468 3300005364 Bacteria 3439
123 Ga0070673_100058219 3300005364 Bacteria 3054
124 Ga0070673_100178201 3300005364 Bacteria 1818
125 Ga0070673_100227528 3300005364 Bacteria 1617
126 Ga0070673_100727245 3300005364 Bacteria 913
127 Ga0070673_101641790 3300005364 Unclassified 608
128 Ga0070688_100102547 3300005365 Bacteria 1889
129 Ga0070688_100132670 3300005365 Bacteria 1683
130 Ga0070688_100363799 3300005365 Bacteria 1062
131 Ga0070688_100687743 3300005365 Bacteria 791
132 Ga0070688_100723809 3300005365 Unclassified 772
133 Ga0070688_100749471 3300005365 Bacteria 760
134 Ga0070659_100097397 3300005366 Bacteria 2364
135 Ga0070659_101025996 3300005366 Unclassified 725
136 Ga0070659_101199739 3300005366 Bacteria 671
137 Ga0070659_101696806 3300005366 Unclassified 565
138 Ga0070667_100022929 3300005367 Bacteria 5175
139 Ga0070667_100231914 3300005367 Bacteria 1646
140 Ga0070667_101549870 3300005367 Unclassified 623
141 Ga0070667_101602042 3300005367 Unclassified 612
142 Ga0070714_100001653 3300005435 Bacteria 16226
143 Ga0070701_10084109 3300005438 Bacteria 1730
144 Ga0070705_101031282 3300005440 Unclassified 669
145 Ga0070705_101040559 3300005440 Bacteria 667
146 Ga0070705_101177031 3300005440 Bacteria 630
147 Ga0070700_100181401 3300005441 Bacteria 1465
148 Ga0070700_100541694 3300005441 Bacteria 903
149 Ga0070700_100782494 3300005441 Bacteria 767
150 Ga0070694_100274786 3300005444 Bacteria 1283
151 Ga0070694_100321052 3300005444 Bacteria 1192
152 Ga0070694_100740583 3300005444 Archaea 802
153 Ga0070694_101047917 3300005444 Bacteria 679
154 Ga0070694_101322810 3300005444 Unclassified 606
155 Ga0070663_100259133 3300005455 Bacteria 1379
156 Ga0070678_100014125 3300005456 Bacteria 5028
157 Ga0070678_100173722 3300005456 Bacteria 1757
158 Ga0070678_100195696 3300005456 Unclassified 1665
159 Ga0070678_100679285 3300005456 Bacteria 926
160 Ga0070678_100830645 3300005456 Bacteria 841
161 Ga0070678_102237291 3300005456 Unclassified 519
162 Ga0070678_102237483 3300005456 Unclassified 519
163 Ga0070662_100027802 3300005457 Bacteria 3931
164 Ga0070662_100049208 3300005457 Bacteria 3039
165 Ga0070662_100089007 3300005457 Bacteria 2315
166 Ga0070662_100175462 3300005457 Bacteria 1686
167 Ga0070662_100274708 3300005457 Bacteria 1362
168 Ga0070662_101042959 3300005457 Bacteria 701
169 Ga0070681_11071047 3300005458 Unclassified 727
170 Ga0070681_11600664 3300005458 Unclassified 577
171 Ga0068867_100075291 3300005459 Bacteria 2532
172 Ga0068867_100199926 3300005459 Unclassified 1599
173 Ga0068867_100235396 3300005459 Bacteria 1482
174 Ga0068867_100424721 3300005459 Bacteria 1127
175 Ga0070685_10044463 3300005466 Bacteria 2542
176 Ga0070685_10085366 3300005466 Bacteria 1901
177 Ga0070685_10140010 3300005466 Bacteria 1522
178 Ga0070685_10189349 3300005466 Unclassified 1330
179 Ga0070685_10492493 3300005466 Bacteria 866
180 Ga0070707_100649286 3300005468 Bacteria 1018
181 Ga0070698_101398033 3300005471 Bacteria 651
182 Ga0070698_101768074 3300005471 Unclassified 571
183 Ga0070699_100057206 3300005518 Bacteria 3378
184 Ga0070699_100310293 3300005518 Bacteria 1416
185 Ga0070679_100746102 3300005530 Bacteria 922
186 Ga0070679_101264771 3300005530 Unclassified 683
187 Ga0070684_100351027 3300005535 Bacteria 1357
188 Ga0070697_100042970 3300005536 Bacteria 3658
189 Ga0070697_100148337 3300005536 Bacteria 1976
190 Ga0070672_100070216 3300005543 Bacteria 2783
191 Ga0070672_100153693 3300005543 Bacteria 1905
192 Ga0070672_100239578 3300005543 Bacteria 1525
193 Ga0070672_100302331 3300005543 Bacteria 1356
194 Ga0070672_100327978 3300005543 Bacteria 1302
195 Ga0070672_100734927 3300005543 Archaea 865
196 Ga0070686_100023123 3300005544 Bacteria 3712
197 Ga0070686_100065493 3300005544 Bacteria 2361
198 Ga0070686_100452164 3300005544 Bacteria 988
199 Ga0070686_100920107 3300005544 Archaea 713
200 Ga0070695_100001180 3300005545 Bacteria 14364
201 Ga0070695_100134955 3300005545 Bacteria 1705
202 Ga0070693_101410087 3300005547 Unclassified 542
203 Ga0070665_100363420 3300005548 Bacteria 1453
204 Ga0070665_102249190 3300005548 Bacteria 549
205 Ga0070704_100003047 3300005549 Bacteria 9536
206 Ga0070704_100129380 3300005549 Bacteria 1954
207 Ga0070704_100131876 3300005549 Bacteria 1938
208 Ga0070704_100339769 3300005549 Bacteria 1264
209 Ga0070704_100689817 3300005549 Bacteria 905
210 Ga0070664_100000586 3300005564 Bacteria 27743
211 Ga0070664_100028549 3300005564 Bacteria 4642
212 Ga0070664_100045139 3300005564 Bacteria 3722
213 Ga0070664_100094627 3300005564 Bacteria 2591
214 Ga0070664_100113742 3300005564 Bacteria 2364
215 Ga0070664_100153819 3300005564 Bacteria 2031
216 Ga0070664_100193616 3300005564 Bacteria 1812
217 Ga0070664_100906184 3300005564 Bacteria 827
218 Ga0070664_101119940 3300005564 Bacteria 742
219 Ga0070664_101176678 3300005564 Bacteria 723
220 Ga0070664_101815782 3300005564 Unclassified 578
221 Ga0068857_100094387 3300005577 Bacteria 2679
222 Ga0068857_100634226 3300005577 Bacteria 1012
223 Ga0068857_100695118 3300005577 Bacteria 966
224 Ga0068857_102504351 3300005577 Unclassified 507
225 Ga0068857_102562388 3300005577 Archaea 501
226 Ga0068854_100446566 3300005578 Unclassified 1079
227 Ga0068854_100775348 3300005578 Bacteria 834
228 Ga0068854_101212023 3300005578 Bacteria 677
229 Ga0068854_101927090 3300005578 Bacteria 544
230 Ga0068854_102232259 3300005578 Unclassified 507
231 Ga0070702_100058054 3300005615 Bacteria 2240
232 Ga0070702_100602296 3300005615 Unclassified 824
233 Ga0070702_100873489 3300005615 Archaea 702
234 Ga0068852_100694770 3300005616 Bacteria 1027
235 Ga0068852_101082062 3300005616 Bacteria 822
236 Ga0068859_100016878 3300005617 Bacteria 7328
237 Ga0068859_100027171 3300005617 Bacteria 5742
238 Ga0068859_100031700 3300005617 Bacteria 5308
239 Ga0068859_100137409 3300005617 Bacteria 2518
240 Ga0068859_100137882 3300005617 Bacteria 2513
241 Ga0068859_100154339 3300005617 Bacteria 2372
242 Ga0068859_100269810 3300005617 Unclassified 1794
243 Ga0068859_100285022 3300005617 Bacteria 1745
244 Ga0068859_100554065 3300005617 Bacteria 1244
245 Ga0068859_100616260 3300005617 Bacteria 1178
246 Ga0068859_100722804 3300005617 Unclassified 1086
247 Ga0068864_100012301 3300005618 Bacteria 7073
248 Ga0068864_100013736 3300005618 Bacteria 6717
249 Ga0068864_100244407 3300005618 Bacteria 1664
250 Ga0068864_100526900 3300005618 Unclassified 1140
251 Ga0068864_100715766 3300005618 Bacteria 979
252 Ga0068864_100921277 3300005618 Bacteria 864
253 Ga0068864_100943079 3300005618 Unclassified 854
254 Ga0068864_101993177 3300005618 Unclassified 587
255 Ga0068866_10331526 3300005718 Archaea 961
256 Ga0068866_11030466 3300005718 Unclassified 586
257 Ga0068861_100064192 3300005719 Bacteria 2824
258 Ga0068861_100088426 3300005719 Bacteria 2440
259 Ga0068861_100113088 3300005719 Bacteria 2178
260 Ga0068851_10608267 3300005834 Bacteria 666
261 Ga0068870_10037950 3300005840 Bacteria 2485
262 Ga0068870_10146966 3300005840 Bacteria 1385
263 Ga0068870_10500800 3300005840 Bacteria 810
264 Ga0068870_10930615 3300005840 Bacteria 616
265 Ga0068863_100046319 3300005841 Bacteria 4127
266 Ga0068863_100079308 3300005841 Bacteria 3110
267 Ga0068863_100632378 3300005841 Archaea 1061
268 Ga0068863_101079771 3300005841 Unclassified 807
269 Ga0068858_100073462 3300005842 Bacteria 3174
270 Ga0068858_100090118 3300005842 Bacteria 2853
271 Ga0068858_100258874 3300005842 Bacteria 1654
272 Ga0068858_100408647 3300005842 Bacteria 1305
273 Ga0068858_101026418 3300005842 Bacteria 808
274 Ga0068860_100202145 3300005843 Bacteria 1925
275 Ga0068860_100309486 3300005843 Bacteria 1549
276 Ga0068860_101379386 3300005843 Bacteria 726
277 Ga0068862_100070124 3300005844 Bacteria 3026
278 Ga0068862_100084833 3300005844 Bacteria 2752
279 Ga0068862_100394176 3300005844 Bacteria 1294
280 Ga0068862_100443243 3300005844 Bacteria 1223
281 Ga0068862_100650127 3300005844 Bacteria 1017
282 Ga0068862_100806812 3300005844 Bacteria 917
283 Ga0068862_101295591 3300005844 Unclassified 730
284 Ga0068862_101846704 3300005844 Bacteria 614
285 Ga0081539_10029084 3300005985 Bacteria 3462
286 Ga0075432_10223521 3300006058 Unclassified 754
287 Ga0075432_10254257 3300006058 Unclassified 714
288 Ga0070716_100295681 3300006173 Bacteria 1124
289 Ga0070712_100334364 3300006175 Bacteria 1235
290 Ga0097621_100860532 3300006237 Bacteria 843
291 Ga0097621_100879077 3300006237 Bacteria 834
292 Ga0068871_100053491 3300006358 Bacteria 3273
293 Ga0068871_100335133 3300006358 Bacteria 1335
294 Ga0068871_100431941 3300006358 Bacteria 1178
295 Ga0068871_100462484 3300006358 Bacteria 1139
296 Ga0068871_101319808 3300006358 Bacteria 679
297 Ga0075428_100000284 3300006844 Bacteria 49693
298 Ga0075428_100001176 3300006844 Bacteria 28020
299 Ga0075428_100030746 3300006844 Bacteria 5937
300 Ga0075428_100055909 3300006844 Bacteria 4323
301 Ga0075428_100061209 3300006844 Bacteria 4122
302 Ga0075428_100062542 3300006844 Bacteria 4075
303 Ga0075428_100092312 3300006844 Bacteria 3301
304 Ga0075428_100109766 3300006844 Bacteria 3005
305 Ga0075428_100412681 3300006844 Bacteria 1447
306 Ga0075428_100574562 3300006844 Bacteria 1205
307 Ga0075430_100007284 3300006846 Bacteria 9338
308 Ga0075430_100016847 3300006846 Bacteria 6225
309 Ga0075430_100034006 3300006846 Bacteria 4325
310 Ga0075430_100045040 3300006846 Bacteria 3729
311 Ga0075430_100051294 3300006846 Bacteria 3478
312 Ga0075430_100052018 3300006846 Bacteria 3449
313 Ga0075430_100090817 3300006846 Bacteria 2554
314 Ga0075430_100265976 3300006846 Bacteria 1420
315 Ga0075430_100333305 3300006846 Bacteria 1254
316 Ga0075430_100440196 3300006846 Bacteria 1076
317 Ga0075430_100726594 3300006846 Bacteria 819
318 Ga0075431_100003965 3300006847 Bacteria 14420
319 Ga0075431_100007807 3300006847 Bacteria 10657
320 Ga0075431_100008897 3300006847 Bacteria 10058
321 Ga0075431_100009529 3300006847 Bacteria 9755
322 Ga0075431_100020930 3300006847 Bacteria 6683
323 Ga0075431_100062847 3300006847 Bacteria 3831
324 Ga0075431_100126095 3300006847 Bacteria 2641
325 Ga0075431_100536181 3300006847 Bacteria 1159
326 Ga0075431_100627278 3300006847 Unclassified 1057
327 Ga0075433_10006016 3300006852 Bacteria 9559
328 Ga0075433_10010139 3300006852 Bacteria 7554
329 Ga0075433_10051341 3300006852 Bacteria 3591
330 Ga0075433_10065223 3300006852 Bacteria 3194
331 Ga0075433_10098544 3300006852 Bacteria 2588
332 Ga0075433_10455126 3300006852 Bacteria 1128
333 Ga0075433_10562871 3300006852 Bacteria 1001
334 Ga0075433_11103709 3300006852 Bacteria 690
335 Ga0075434_100010577 3300006871 Bacteria 8657
336 Ga0075434_100016832 3300006871 Bacteria 7033
337 Ga0075434_100017717 3300006871 Bacteria 6866
338 Ga0075434_100040403 3300006871 Bacteria 4618
339 Ga0075434_100078955 3300006871 Bacteria 3288
340 Ga0075434_100144644 3300006871 Bacteria 2398
341 Ga0075434_100160283 3300006871 Bacteria 2269
342 Ga0075434_100291799 3300006871 Bacteria 1651
343 Ga0075434_100584670 3300006871 Bacteria 1136
344 Ga0075434_101301769 3300006871 Unclassified 738
345 Ga0075429_100004197 3300006880 Bacteria 12338
346 Ga0075429_100009769 3300006880 Bacteria 8318
347 Ga0075429_100025829 3300006880 Bacteria 5100
348 Ga0075429_100031404 3300006880 Bacteria 4616
349 Ga0075429_100055647 3300006880 Bacteria 3442
350 Ga0075429_100095838 3300006880 Bacteria 2588
351 Ga0075429_100183248 3300006880 Bacteria 1835
352 Ga0075429_100193064 3300006880 Unclassified 1784
353 Ga0075429_100315394 3300006880 Bacteria 1368
354 Ga0075429_100557032 3300006880 Unclassified 1005
355 Ga0075429_100777492 3300006880 Unclassified 839
356 Ga0075429_100779165 3300006880 Bacteria 838
357 Ga0075429_101514358 3300006880 Unclassified 583
358 Ga0068865_100105404 3300006881 Bacteria 2071
359 Ga0068865_100132505 3300006881 Bacteria 1869
360 Ga0068865_100203585 3300006881 Unclassified 1538
361 Ga0068865_100302455 3300006881 Bacteria 1281
362 Ga0068865_101039397 3300006881 Bacteria 719
363 Ga0068865_101566687 3300006881 Bacteria 592
364 Ga0075436_100247270 3300006914 Bacteria 1269
365 Ga0097620_100016878 3300006931 Bacteria 7328
366 Ga0097620_100027171 3300006931 Bacteria 5742
367 Ga0097620_100031701 3300006931 Bacteria 5308
368 Ga0097620_100137405 3300006931 Bacteria 2518
369 Ga0097620_100137872 3300006931 Bacteria 2513
370 Ga0097620_100154336 3300006931 Bacteria 2372
371 Ga0097620_100269821 3300006931 Unclassified 1794
372 Ga0097620_100285032 3300006931 Bacteria 1745
373 Ga0097620_100554102 3300006931 Bacteria 1244
374 Ga0097620_100616189 3300006931 Bacteria 1178
375 Ga0097620_100722727 3300006931 Unclassified 1086
376 Ga0075435_100021650 3300007076 Bacteria 4948
377 Ga0075435_100110594 3300007076 Bacteria 2285
378 Ga0075435_100308202 3300007076 Bacteria 1355
379 Ga0105250_10369461 3300009092 Unclassified 631
380 Ga0105240_10152291 3300009093 Bacteria 2753
381 Ga0105240_11096188 3300009093 Unclassified 847
382 Ga0111539_10000306 3300009094 Bacteria 59726
383 Ga0111539_10000755 3300009094 Bacteria 42078
384 Ga0111539_10008742 3300009094 Bacteria 12847
385 Ga0111539_10009063 3300009094 Bacteria 12594
386 Ga0111539_10020960 3300009094 Bacteria 8047
387 Ga0111539_10046513 3300009094 Bacteria 5189
388 Ga0111539_10065215 3300009094 Bacteria 4304
389 Ga0111539_10096271 3300009094 Bacteria 3477
390 Ga0111539_10108999 3300009094 Bacteria 3249
391 Ga0111539_10305421 3300009094 Bacteria 1852
392 Ga0111539_10346671 3300009094 Bacteria 1728
393 Ga0111539_10430974 3300009094 Bacteria 1535
394 Ga0111539_11778179 3300009094 Unclassified 715
395 Ga0111539_11986943 3300009094 Bacteria 674
396 Ga0111539_12096497 3300009094 Unclassified 656
397 Ga0111539_13075629 3300009094 Unclassified 539
398 Ga0105245_10549944 3300009098 Bacteria 1176
399 Ga0105245_11361450 3300009098 Bacteria 759
400 Ga0105245_12821488 3300009098 Bacteria 538
401 Ga0105245_12828056 3300009098 Unclassified 538
402 Ga0105247_10042623 3300009101 Bacteria 2780
403 Ga0105247_10498168 3300009101 Bacteria 887
404 Ga0114129_10011461 3300009147 Bacteria 12623
405 Ga0114129_10015037 3300009147 Bacteria 11018
406 Ga0114129_10020716 3300009147 Bacteria 9344
407 Ga0114129_10029973 3300009147 Bacteria 7704
408 Ga0114129_10041091 3300009147 Bacteria 6518
409 Ga0114129_10052707 3300009147 Bacteria 5710
410 Ga0114129_10071381 3300009147 Bacteria 4842
411 Ga0114129_10088461 3300009147 Bacteria 4293
412 Ga0114129_10097771 3300009147 Bacteria 4064
413 Ga0114129_10161305 3300009147 Bacteria 3062
414 Ga0114129_11025944 3300009147 Bacteria 1037
415 Ga0114129_13427606 3300009147 Unclassified 509
416 Ga0105243_10489768 3300009148 Bacteria 1162
417 Ga0105243_11098730 3300009148 Bacteria 803
418 Ga0105243_11179696 3300009148 Bacteria 778
419 Ga0105243_11459078 3300009148 Bacteria 707
420 Ga0105243_12091718 3300009148 Unclassified 602
421 Ga0105242_10485248 3300009176 Bacteria 1172
422 Ga0105242_10543991 3300009176 Bacteria 1112
423 Ga0105242_12058796 3300009176 Unclassified 614
424 Ga0105242_12261840 3300009176 Bacteria 590
425 Ga0105248_10286403 3300009177 Unclassified 1855
426 Ga0105248_10381767 3300009177 Bacteria 1586
427 Ga0105248_12497464 3300009177 Bacteria 589
428 Ga0105237_12785171 3300009545 Bacteria 500
429 Ga0105238_11290638 3300009551 Unclassified 756
430 Ga0105249_10009569 3300009553 Bacteria 8493
431 Ga0105249_10055766 3300009553 Bacteria 3617
432 Ga0105249_10492529 3300009553 Bacteria 1270
433 Ga0105249_10709139 3300009553 Bacteria 1067
434 Ga0105249_11002137 3300009553 Bacteria 904
435 Ga0105249_11012239 3300009553 Bacteria 900
436 Ga0105249_12125889 3300009553 Bacteria 634
437 Ga0105249_12528720 3300009553 Bacteria 586
438 Ga0105246_10012256 3300011119 Bacteria 5345
439 Ga0105246_10386002 3300011119 Bacteria 1159
440 Ga0105246_10482864 3300011119 Bacteria 1049
441 Ga0105246_11004191 3300011119 Bacteria 756
442 Ga0157346_1009653 3300012480 Unclassified 687
443 Ga0157323_1014743 3300012495 Unclassified 674
444 Ga0157371_10376531 3300013102 Bacteria 1036
445 Ga0157370_10680047 3300013104 Bacteria 940
446 Ga0157369_11790139 3300013105 Unclassified 624
447 Ga0157374_10058009 3300013296 Bacteria 3617
448 Ga0157374_10338931 3300013296 Unclassified 1492
449 Ga0157378_10445215 3300013297 Bacteria 1285
450 Ga0157378_11308270 3300013297 Bacteria 766
451 Ga0157378_11536325 3300013297 Unclassified 711
452 Ga0157378_12146722 3300013297 Bacteria 609
453 Ga0163162_10008524 3300013306 Bacteria 9993
454 Ga0163162_10594590 3300013306 Bacteria 1233
455 Ga0163162_10655876 3300013306 Unclassified 1173
456 Ga0157372_11157983 3300013307 Bacteria 894
457 Ga0157372_11377976 3300013307 Bacteria 813
458 Ga0157375_10053871 3300013308 Bacteria 3960
459 Ga0157375_10375202 3300013308 Bacteria 1589
460 Ga0157375_10889915 3300013308 Bacteria 1035
461 Ga0157375_10896538 3300013308 Unclassified 1031
462 Ga0157375_12052295 3300013308 Unclassified 680
463 Ga0157375_12916576 3300013308 Unclassified 571
464 Ga0163163_10022722 3300014325 Bacteria 5943
465 Ga0163163_10078874 3300014325 Bacteria 3290
466 Ga0163163_10172038 3300014325 Bacteria 2213
467 Ga0163163_10176303 3300014325 Bacteria 2184
468 Ga0163163_11314973 3300014325 Bacteria 785
469 Ga0163163_12870914 3300014325 Bacteria 538
470 Ga0157380_10029501 3300014326 Bacteria 4192
471 Ga0157380_10062932 3300014326 Bacteria 2974
472 Ga0157380_10079032 3300014326 Bacteria 2685
473 Ga0157380_10146465 3300014326 Bacteria 2036
474 Ga0157380_10547370 3300014326 Bacteria 1134
475 Ga0157380_11440734 3300014326 Unclassified 740
476 Ga0157380_12581491 3300014326 Unclassified 574
477 Ga0157380_13058894 3300014326 Unclassified 533
478 Ga0157380_13531499 3300014326 Bacteria 501
479 Ga0157377_10005968 3300014745 Bacteria 5769
480 Ga0157377_10066351 3300014745 Bacteria 2074
481 Ga0157377_10111326 3300014745 Bacteria 1646
482 Ga0157377_10839215 3300014745 Bacteria 681
483 Ga0157379_10003064 3300014968 Bacteria 14133
484 Ga0157379_10005539 3300014968 Bacteria 10848
485 Ga0157379_10074359 3300014968 Bacteria 3042
486 Ga0157379_10622765 3300014968 Bacteria 1009
487 Ga0157379_11933437 3300014968 Bacteria 582
488 Ga0157376_10066871 3300014969 Bacteria 3039
489 Ga0157376_10146519 3300014969 Bacteria 2124
490 Ga0157376_10452981 3300014969 Bacteria 1252
491 Ga0157376_11517805 3300014969 Archaea 703
492 Ga0163161_10028324 3300017792 Bacteria 3978
493 Ga0163161_10039607 3300017792 Bacteria 3384
494 Ga0163161_10329549 3300017792 Bacteria 1209
495 Ga0207672_1006080 3300025223 Archaea 694
496 Ga0207697_10002059 3300025315 Bacteria 10589
497 Ga0207697_10020303 3300025315 Bacteria 2720
498 Ga0207697_10100323 3300025315 Bacteria 1233
499 Ga0207697_10316673 3300025315 Unclassified 692
500 Ga0207697_10425285 3300025315 Unclassified 589
501 Ga0207696_1150937 3300025711 Unclassified 620
502 Ga0207682_10061815 3300025893 Unclassified 1569
503 Ga0207682_10353181 3300025893 Unclassified 693
504 Ga0207682_10513646 3300025893 Unclassified 567
505 Ga0207710_10165396 3300025900 Bacteria 1079
506 Ga0207688_10011929 3300025901 Bacteria 4730
507 Ga0207688_10117851 3300025901 Bacteria 1547
508 Ga0207688_10203312 3300025901 Archaea 1188
509 Ga0207688_10361160 3300025901 Unclassified 896
510 Ga0207680_10140575 3300025903 Bacteria 1600
511 Ga0207680_10272872 3300025903 Bacteria 1173
512 Ga0207680_10530980 3300025903 Bacteria 839
513 Ga0207680_10574123 3300025903 Bacteria 806
514 Ga0207645_10051615 3300025907 Bacteria 2628
515 Ga0207645_10071891 3300025907 Bacteria 2214
516 Ga0207645_10140632 3300025907 Bacteria 1573
517 Ga0207645_10208134 3300025907 Bacteria 1288
518 Ga0207645_10465105 3300025907 Bacteria 854
519 Ga0207643_10014099 3300025908 Bacteria 4339
520 Ga0207643_10029188 3300025908 Bacteria 3067
521 Ga0207643_10156941 3300025908 Bacteria 1367
522 Ga0207643_10316273 3300025908 Bacteria 974
523 Ga0207684_11442527 3300025910 Bacteria 562
524 Ga0207695_10110371 3300025913 Bacteria 2731
525 Ga0207695_10797727 3300025913 Unclassified 824
526 Ga0207693_10381053 3300025915 Bacteria 1103
527 Ga0207660_10463954 3300025917 Unclassified 1025
528 Ga0207660_10535784 3300025917 Bacteria 952
529 Ga0207662_10022979 3300025918 Bacteria 3579
530 Ga0207662_10068981 3300025918 Bacteria 2136
531 Ga0207662_10129759 3300025918 Unclassified 1588
532 Ga0207662_10161409 3300025918 Bacteria 1432
533 Ga0207657_10612677 3300025919 Bacteria 849
534 Ga0207649_10023474 3300025920 Bacteria 3573
535 Ga0207649_10123466 3300025920 Bacteria 1749
536 Ga0207649_10207488 3300025920 Bacteria 1388
537 Ga0207649_11285241 3300025920 Unclassified 579
538 Ga0207652_10426207 3300025921 Bacteria 1196
539 Ga0207646_10176874 3300025922 Bacteria 1927
540 Ga0207681_10038068 3300025923 Bacteria 3183
541 Ga0207681_10088080 3300025923 Bacteria 2210
542 Ga0207681_10098151 3300025923 Bacteria 2107
543 Ga0207681_10214078 3300025923 Bacteria 1487
544 Ga0207681_10234283 3300025923 Bacteria 1426
545 Ga0207681_10245883 3300025923 Bacteria 1395
546 Ga0207681_10849554 3300025923 Bacteria 763
547 Ga0207681_11337461 3300025923 Bacteria 601
548 Ga0207650_10008408 3300025925 Bacteria 7046
549 Ga0207650_10216970 3300025925 Bacteria 1538
550 Ga0207650_10341737 3300025925 Bacteria 1229
551 Ga0207650_10378069 3300025925 Bacteria 1169
552 Ga0207650_11314223 3300025925 Unclassified 615
553 Ga0207659_10004148 3300025926 Bacteria 8745
554 Ga0207659_10009478 3300025926 Bacteria 6087
555 Ga0207659_10016839 3300025926 Bacteria 4766
556 Ga0207659_10036189 3300025926 Bacteria 3417
557 Ga0207659_10036422 3300025926 Bacteria 3408
558 Ga0207659_10107144 3300025926 Bacteria 2117
559 Ga0207659_10144191 3300025926 Bacteria 1852
560 Ga0207659_10246304 3300025926 Bacteria 1448
561 Ga0207659_10248867 3300025926 Bacteria 1441
562 Ga0207659_10260097 3300025926 Bacteria 1411
563 Ga0207659_10501468 3300025926 Bacteria 1028
564 Ga0207659_10697319 3300025926 Bacteria 869
565 Ga0207659_11394337 3300025926 Bacteria 601
566 Ga0207664_10028758 3300025929 Bacteria 4227
567 Ga0207644_10073010 3300025931 Bacteria 2515
568 Ga0207644_10662566 3300025931 Bacteria 869
569 Ga0207644_10915089 3300025931 Bacteria 735
570 Ga0207644_11118781 3300025931 Bacteria 662
571 Ga0207690_10420306 3300025932 Unclassified 1069
572 Ga0207690_10505589 3300025932 Unclassified 978
573 Ga0207690_10836519 3300025932 Unclassified 762
574 Ga0207706_10027855 3300025933 Bacteria 5051
575 Ga0207706_10038926 3300025933 Bacteria 4217
576 Ga0207706_10107569 3300025933 Bacteria 2454
577 Ga0207706_10158425 3300025933 Bacteria 1991
578 Ga0207706_10351216 3300025933 Bacteria 1282
579 Ga0207706_11161877 3300025933 Unclassified 643
580 Ga0207686_10748549 3300025934 Unclassified 780
581 Ga0207686_10934872 3300025934 Unclassified 701
582 Ga0207709_10956887 3300025935 Bacteria 698
583 Ga0207670_10195723 3300025936 Bacteria 1532
584 Ga0207670_10254989 3300025936 Bacteria 1357
585 Ga0207670_10324941 3300025936 Bacteria 1211
586 Ga0207670_10398434 3300025936 Bacteria 1100
587 Ga0207670_10524131 3300025936 Bacteria 965
588 Ga0207670_11038803 3300025936 Unclassified 690
589 Ga0207669_10016067 3300025937 Bacteria 3792
590 Ga0207669_10068122 3300025937 Bacteria 2221
591 Ga0207669_10366017 3300025937 Unclassified 1119
592 Ga0207669_10492500 3300025937 Bacteria 979
593 Ga0207669_10765135 3300025937 Unclassified 799
594 Ga0207669_11042207 3300025937 Bacteria 689
595 Ga0207704_10543167 3300025938 Bacteria 943
596 Ga0207704_10842829 3300025938 Bacteria 768
597 Ga0207665_10175780 3300025939 Bacteria 1548
598 Ga0207691_10006894 3300025940 Bacteria 10958
599 Ga0207691_10023881 3300025940 Bacteria 5754
600 Ga0207691_10051607 3300025940 Bacteria 3759
601 Ga0207691_10051671 3300025940 Bacteria 3756
602 Ga0207691_10111507 3300025940 Bacteria 2432
603 Ga0207691_10125050 3300025940 Bacteria 2276
604 Ga0207691_10302750 3300025940 Unclassified 1373
605 Ga0207691_10525625 3300025940 Bacteria 1004
606 Ga0207691_10641627 3300025940 Bacteria 898
607 Ga0207691_10937716 3300025940 Bacteria 724
608 Ga0207711_10107229 3300025941 Bacteria 2480
609 Ga0207711_10116745 3300025941 Bacteria 2380
610 Ga0207689_10006638 3300025942 Bacteria 10203
611 Ga0207689_10066540 3300025942 Bacteria 2962
612 Ga0207689_10073683 3300025942 Bacteria 2805
613 Ga0207689_10164159 3300025942 Bacteria 1830
614 Ga0207689_10207102 3300025942 Bacteria 1620
615 Ga0207689_11272182 3300025942 Unclassified 618
616 Ga0207661_10043583 3300025944 Bacteria 3542
617 Ga0207679_10007694 3300025945 Bacteria 6844
618 Ga0207679_10072733 3300025945 Bacteria 2598
619 Ga0207679_10268894 3300025945 Bacteria 1457
620 Ga0207679_10282284 3300025945 Bacteria 1424
621 Ga0207679_10442857 3300025945 Bacteria 1151
622 Ga0207679_10471757 3300025945 Unclassified 1116
623 Ga0207679_10853464 3300025945 Unclassified 832
624 Ga0207679_11176945 3300025945 Bacteria 703
625 Ga0207651_10002212 3300025960 Bacteria 9201
626 Ga0207651_10074395 3300025960 Bacteria 2419
627 Ga0207651_10082130 3300025960 Bacteria 2325
628 Ga0207651_10183494 3300025960 Bacteria 1662
629 Ga0207651_10188674 3300025960 Bacteria 1642
630 Ga0207651_10270489 3300025960 Bacteria 1399
631 Ga0207651_10394009 3300025960 Bacteria 1176
632 Ga0207651_11213175 3300025960 Bacteria 677
633 Ga0207712_10023448 3300025961 Bacteria 4072
634 Ga0207712_11111695 3300025961 Bacteria 704
635 Ga0207712_12103689 3300025961 Archaea 505
636 Ga0207668_10160384 3300025972 Bacteria 1752
637 Ga0207668_10710017 3300025972 Bacteria 884
638 Ga0207640_10132555 3300025981 Bacteria 1804
639 Ga0207640_10148930 3300025981 Unclassified 1717
640 Ga0207640_10857698 3300025981 Bacteria 791
641 Ga0207640_11130389 3300025981 Bacteria 694
642 Ga0207658_10043526 3300025986 Bacteria 3264
643 Ga0207658_10148154 3300025986 Bacteria 1909
644 Ga0207658_10435606 3300025986 Bacteria 1158
645 Ga0207658_10532335 3300025986 Bacteria 1050
646 Ga0207658_11962727 3300025986 Unclassified 533
647 Ga0207677_10054266 3300026023 Bacteria 2734
648 Ga0207677_10128062 3300026023 Bacteria 1922
649 Ga0207677_10624927 3300026023 Unclassified 948
650 Ga0207677_11740030 3300026023 Unclassified 578
651 Ga0207703_10028221 3300026035 Bacteria 4422
652 Ga0207703_10290096 3300026035 Bacteria 1489
653 Ga0207703_10525303 3300026035 Bacteria 1114
654 Ga0207678_10082154 3300026067 Bacteria 2757
655 Ga0207678_10586738 3300026067 Bacteria 976
656 Ga0207678_11021847 3300026067 Unclassified 732
657 Ga0207708_10084950 3300026075 Bacteria 2434
658 Ga0207708_10363917 3300026075 Bacteria 1189
659 Ga0207708_10780312 3300026075 Unclassified 822
660 Ga0207641_10204287 3300026088 Bacteria 1824
661 Ga0207641_10653180 3300026088 Archaea 1033
662 Ga0207641_10675788 3300026088 Unclassified 1015
663 Ga0207641_11226263 3300026088 Bacteria 750
664 Ga0207648_10023072 3300026089 Bacteria 5581
665 Ga0207648_10031931 3300026089 Bacteria 4652
666 Ga0207648_10119107 3300026089 Bacteria 2320
667 Ga0207648_10138033 3300026089 Bacteria 2148
668 Ga0207648_10391102 3300026089 Bacteria 1259
669 Ga0207648_10568499 3300026089 Bacteria 1043
670 Ga0207648_11254370 3300026089 Unclassified 696
671 Ga0207676_10038193 3300026095 Bacteria 3662
672 Ga0207676_10153225 3300026095 Bacteria 1988
673 Ga0207676_10156361 3300026095 Bacteria 1970
674 Ga0207676_10201180 3300026095 Bacteria 1760
675 Ga0207676_10452835 3300026095 Bacteria 1210
676 Ga0207676_10536862 3300026095 Bacteria 1116
677 Ga0207674_10123356 3300026116 Bacteria 2557
678 Ga0207674_10138458 3300026116 Bacteria 2395
679 Ga0207674_10164806 3300026116 Bacteria 2170
680 Ga0207674_10208160 3300026116 Bacteria 1905
681 Ga0207674_11316252 3300026116 Unclassified 692
682 Ga0207675_100035858 3300026118 Bacteria 4626
683 Ga0207675_100057612 3300026118 Bacteria 3625
684 Ga0207675_100072977 3300026118 Bacteria 3210
685 Ga0207675_100080301 3300026118 Bacteria 3058
686 Ga0207675_100222288 3300026118 Bacteria 1820
687 Ga0207675_100555107 3300026118 Bacteria 1148
688 Ga0207675_102041456 3300026118 Bacteria 590
689 Ga0207683_10007767 3300026121 Bacteria 9177
690 Ga0207683_10147538 3300026121 Bacteria 2122
691 Ga0207683_10278216 3300026121 Bacteria 1529
692 Ga0207683_10679813 3300026121 Archaea 954
693 Ga0207683_10947911 3300026121 Bacteria 799
694 Ga0207683_11251034 3300026121 Unclassified 687
695 Ga0207683_11783227 3300026121 Bacteria 565
696 Ga0207698_10914614 3300026142 Bacteria 885
697 Ga0207698_11117337 3300026142 Bacteria 801
698 Ga0207698_11238304 3300026142 Bacteria 760
699 Ga0209999_1078874 3300027543 Unclassified 634
700 Ga0210002_1039797 3300027617 Bacteria 797
701 Ga0209974_10013867 3300027876 Bacteria 2685
702 Ga0209974_10063137 3300027876 Bacteria 1256
703 Ga0209974_10066431 3300027876 Bacteria 1225
704 Ga0207428_10000690 3300027907 Bacteria 39183
705 Ga0207428_10003602 3300027907 Bacteria 14959
706 Ga0207428_10006364 3300027907 Bacteria 10922
707 Ga0207428_10007135 3300027907 Bacteria 10222
708 Ga0207428_10047890 3300027907 Bacteria 3432
709 Ga0207428_10232302 3300027907 Bacteria 1380
710 Ga0207428_10286830 3300027907 Bacteria 1221
711 Ga0207428_10330353 3300027907 Bacteria 1124
712 Ga0207428_10333215 3300027907 Unclassified 1119
713 Ga0207428_10769437 3300027907 Unclassified 685
714 Ga0268266_10377133 3300028379 Bacteria 1337
715 Ga0268265_10283603 3300028380 Bacteria 1483
716 Ga0268265_10314010 3300028380 Bacteria 1416
717 Ga0268265_10461428 3300028380 Bacteria 1189
718 Ga0268265_11624661 3300028380 Unclassified 651
719 Ga0268265_12218439 3300028380 Unclassified 556
720 Ga0268265_12636490 3300028380 Bacteria 508
721 Ga0268264_10135603 3300028381 Bacteria 2188
722 Ga0268264_10173986 3300028381 Bacteria 1950
723 Ga0268264_10241736 3300028381 Bacteria 1673
724 Ga0268264_10262106 3300028381 Bacteria 1611
725 Ga0268264_10383459 3300028381 Bacteria 1346
726 Ga0268264_11214925 3300028381 Bacteria 763
727 Ga0268264_11552364 3300028381 Bacteria 673
728 Ga0307408_100005337 3300031548 Bacteria 8608
729 Ga0307408_100131640 3300031548 Bacteria 1952
730 Ga0307408_100856354 3300031548 Bacteria 829
731 Ga0307408_101727238 3300031548 Unclassified 597
732 Ga0307405_10004965 3300031731 Bacteria 6355
733 Ga0307405_10006136 3300031731 Bacteria 5884
734 Ga0307405_10110521 3300031731 Bacteria 1861
735 Ga0307405_10195963 3300031731 Bacteria 1463
736 Ga0307413_10041777 3300031824 Bacteria 2688
737 Ga0307413_10246706 3300031824 Bacteria 1322
738 Ga0307410_10001041 3300031852 Bacteria 12033
739 Ga0307410_10030463 3300031852 Bacteria 3449
740 Ga0307410_10172661 3300031852 Bacteria 1630
741 Ga0307410_10296611 3300031852 Bacteria 1274
742 Ga0307410_10326807 3300031852 Bacteria 1219
743 Ga0307406_10011560 3300031901 Bacteria 5016
744 Ga0307406_10023602 3300031901 Bacteria 3662
745 Ga0307406_10448903 3300031901 Bacteria 1034
746 Ga0307407_10002185 3300031903 Bacteria 7538
747 Ga0307407_10006683 3300031903 Bacteria 5156
748 Ga0307407_10008661 3300031903 Bacteria 4685
749 Ga0307407_10616850 3300031903 Bacteria 809
750 Ga0307407_10653161 3300031903 Unclassified 788
751 Ga0307412_10006626 3300031911 Bacteria 6562
752 Ga0307412_10019036 3300031911 Bacteria 4147
753 Ga0307412_10085240 3300031911 Bacteria 2195
754 Ga0307412_10285258 3300031911 Bacteria 1298
755 Ga0307409_100005560 3300031995 Bacteria 7279
756 Ga0307409_100027658 3300031995 Bacteria 4024
757 Ga0307409_100096351 3300031995 Bacteria 2440
758 Ga0307409_100227714 3300031995 Bacteria 1687
759 Ga0307409_102302079 3300031995 Unclassified 568
760 Ga0307409_102441834 3300031995 Bacteria 552
761 Ga0307416_100007599 3300032002 Bacteria 6912
762 Ga0307416_100012407 3300032002 Bacteria 5741
763 Ga0307416_100020499 3300032002 Bacteria 4720
764 Ga0307416_100278820 3300032002 Bacteria 1647
765 Ga0307416_100305556 3300032002 Bacteria 1584
766 Ga0307416_100834867 3300032002 Bacteria 1019
767 Ga0307416_101060604 3300032002 Bacteria 914
768 Ga0307416_101554435 3300032002 Bacteria 767
769 Ga0307414_10023679 3300032004 Bacteria 3900
770 Ga0307414_10050145 3300032004 Bacteria 2890
771 Ga0307414_10066944 3300032004 Bacteria 2570
772 Ga0307414_10158817 3300032004 Bacteria 1793
773 Ga0307411_10003369 3300032005 Bacteria 7402
774 Ga0307411_10018126 3300032005 Bacteria 4031
775 Ga0307411_10024943 3300032005 Bacteria 3573
776 Ga0307411_10048122 3300032005 Bacteria 2762
777 Ga0307411_10388768 3300032005 Bacteria 1150
778 Ga0307411_10567011 3300032005 Bacteria 971
779 Ga0307415_100012041 3300032126 Bacteria 4984
780 Ga0307415_100087789 3300032126 Bacteria 2242
781 Ga0307415_101113346 3300032126 Bacteria 740
782 Ga0307415_101417589 3300032126 Unclassified 662
783 Ga0373932_0184177 3300035112 Unclassified 734
784 Ga0373960_0350446 3300035121 Bacteria 560
785 Ga0373961_0096490 3300035241 Bacteria 952
786 Ga0373931_0360102 3300035691 Unclassified 913
787 Ga0439439_0030271 3300041406 Bacteria 1376
788 Ga0439453_0003587 3300041408 Bacteria 2243
789 Ga0451795_1213003 3300041456 Bacteria 726
790 Ga0439433_0040335 3300041999 Bacteria 1086
791 Ga0439433_0213453 3300041999 Unclassified 513
792 Ga0439443_036869 3300042003 Bacteria 824
793 Ga0439443_045458 3300042003 Unclassified 758
794 Ga0439450_027769 3300042008 Unclassified 1255
795 Ga0439456_068446 3300042013 Bacteria 785
796 Ga0439457_039011 3300042014 Bacteria 1057
797 Ga0450920_067381 3300042122 Bacteria 726
798 Ga0450920_083914 3300042122 Unclassified 654
799 Ga0450890_088259 3300042127 Unclassified 512
800 Ga0450894_006981 3300042131 Bacteria 1456
801 Ga0439446_0195039 3300042156 Unclassified 682
802 Ga0439434_0038168 3300042435 Bacteria 1472
803 Ga0439434_0330459 3300042435 Unclassified 530
804 Ga0439435_0049424 3300042436 Bacteria 1200
805 Ga0439435_0098848 3300042436 Unclassified 895
806 Ga0439444_0050498 3300042437 Bacteria 844
807 Ga0439464_0031568 3300042439 Bacteria 1487
808 Ga0439464_0078464 3300042439 Bacteria 984
809 Ga0439460_0129669 3300042461 Bacteria 830
810 Ga0450916_006011 3300042530 Bacteria 1418
811 Ga0439440_0120505 3300042993 Unclassified 730
812 Ga0453683_0758109 3300044673 Unclassified 638
813 Ga0466963_0473724 3300044694 Bacteria 884
814 Ga0466964_0865252 3300044706 Bacteria 515
815 Ga0451576_0519841 3300045051 Bacteria 1250
816 Ga0451576_0587816 3300045051 Bacteria 1170
817 Ga0466967_0230110 3300045976 Bacteria 1765
818 Ga0495584_0034244 3300046491 Unclassified 2570
819 Ga0495594_0065323 3300046499 Bacteria 2018
820 Ga0495598_0070578 3300046537 Bacteria 1099
821 Ga0495598_0113047 3300046537 Unclassified 912
822 Ga0495598_0138449 3300046537 Unclassified 840
823 Ga0495621_0420692 3300046539 Unclassified 569
824 Ga0495656_0006702 3300046615 Bacteria 4043
825 Ga0495636_0698195 3300047318 Unclassified 501
826 Ga0495677_0353738 3300047445 Unclassified 580
827 Ga0496103_0594593 3300048906 Bacteria 705
828 Ga0496108_0720673 3300048911 Bacteria 864
829 Ga0496108_0854356 3300048911 Unclassified 783
830 Ga0496108_1496146 3300048911 Bacteria 562
831 Ga0496109_0110924 3300048912 Bacteria 2551
832 Ga0496109_0129207 3300048912 Bacteria 2357
833 Ga0496109_0235737 3300048912 Bacteria 1722
834 Ga0496111_0470664 3300048914 Bacteria 926
835 Ga0496112_0176680 3300048915 Bacteria 2100
836 Ga0496113_0049179 3300048916 Bacteria 3139
837 Ga0496113_0508867 3300048916 Unclassified 967
838 Ga0496114_0127115 3300048917 Bacteria 2198
839 Ga0501291_071558 3300049514 Bacteria 673
840 Ga0501292_027441 3300049515 Bacteria 944
841 Ga0501299_066872 3300049522 Unclassified 772
842 Ga0501031_0451062 3300049568 Bacteria 831
843 Ga0501033_0556441 3300049570 Bacteria 790
844 Ga0501036_0051933 3300049572 Bacteria 3472
845 Ga0501036_0126418 3300049572 Bacteria 2159
846 Ga0501038_1218417 3300049574 Bacteria 546
847 Ga0501039_0016762 3300049575 Bacteria 5615
848 Ga0501039_0120454 3300049575 Bacteria 2056
849 Ga0501040_0357532 3300049576 Unclassified 1046
850 Ga0501041_0002498 3300049577 Bacteria 10468
851 Ga0501041_0002879 3300049577 Bacteria 9851
852 Ga0501041_0590124 3300049577 Bacteria 709
853 Ga0501042_0011677 3300049578 Bacteria 5934
854 Ga0501042_0025943 3300049578 Bacteria 4118
855 Ga0501042_0791502 3300049578 Bacteria 690
856 Ga0501046_0189929 3300049580 Bacteria 1533
857 Ga0501048_0617519 3300049582 Unclassified 778
858 Ga0501068_0663943 3300049584 Unclassified 681
859 Ga0501070_0818211 3300049586 Bacteria 731
860 Ga0501071_0177634 3300049587 Bacteria 1595
861 Ga0501071_0440219 3300049587 Bacteria 997
862 Ga0501071_0728274 3300049587 Bacteria 764
863 Ga0501074_0822061 3300049590 Unclassified 654
864 Ga0501075_0128948 3300049591 Bacteria 1926
865 Ga0501075_0365637 3300049591 Bacteria 1100
866 Ga0501076_0011199 3300049592 Bacteria 6676
867 Ga0501076_1513172 3300049592 Unclassified 551
868 Ga0501076_1659453 3300049592 Unclassified 524
869 Ga0501077_0057339 3300049593 Bacteria 2473
870 Ga0501077_0094148 3300049593 Bacteria 1899
871 Ga0501077_0407901 3300049593 Bacteria 869
872 Ga0501202_059244 3300049652 Unclassified 862
873 Ga0501257_056364 3300049686 Bacteria 987
874 Ga0501258_042547 3300049687 Unclassified 611
875 Ga0501221_198029 3300049704 Unclassified 557
876 Ga0501079_0053734 3300049741 Bacteria 3107
877 Ga0501079_0232707 3300049741 Bacteria 1439
878 Ga0501079_0978269 3300049741 Unclassified 666
879 Ga0501080_0273987 3300049742 Bacteria 1535
880 Ga0501081_0011798 3300049743 Bacteria 5724
881 Ga0501081_0034579 3300049743 Bacteria 3439
882 Ga0501083_0595102 3300049744 Bacteria 720
883 Ga0501265_059244 3300049762 Unclassified 621
884 Ga0501274_044320 3300049771 Unclassified 542
885 Ga0501035_0945422 3300049822 Unclassified 680
886 Ga0501045_0263942 3300049824 Bacteria 1282
887 Ga0501045_0862712 3300049824 Bacteria 666
888 nmdc:mga05p37_1149796_c1 3300050507 Bacteria 807
889 nmdc:mga05p37_1775854_c1 3300050507 Unclassified 597
890 nmdc:mga05p37_277213_c1 3300050507 Bacteria 2001
891 nmdc:mga05p37_62008_c1 3300050507 Bacteria 4602
892 nmdc:mga05p37_62595_c1 3300050507 Bacteria 4579
893 nmdc:mga05p37_6472_c1 3300050507 Bacteria 13815
894 nmdc:mga05p37_68721_c1 3300050507 Bacteria 4357
895 nmdc:mga05p37_717761_c1 3300050507 Bacteria 1108
896 nmdc:mga05p37_7428_c1 3300050507 Bacteria 12930
897 nmdc:mga05p37_78942_c1 3300050507 Bacteria 4053
898 nmdc:mga05p37_93689_c1 3300050507 Bacteria 3701
899 nmdc:mga05p37_954583_c1 3300050507 Unclassified 917
900 nmdc:mga09592_159989_c1 3300050508 Bacteria 1945
901 nmdc:mga09592_204154_c1 3300050508 Bacteria 1712
902 nmdc:mga09592_20748_c1 3300050508 Bacteria 5407
903 nmdc:mga09592_24473_c1 3300050508 Bacteria 4994
904 nmdc:mga09592_287129_c1 3300050508 Bacteria 1427
905 nmdc:mga09592_296869_c1 3300050508 Bacteria 1401
906 nmdc:mga09592_3707_c1 3300050508 Bacteria 12320
907 nmdc:mga09592_41340_c1 3300050508 Bacteria 3876
908 nmdc:mga09592_4664_c1 3300050508 Bacteria 11097
909 nmdc:mga09592_6060_c1 3300050508 Bacteria 9857
910 nmdc:mga09592_704253_c1 3300050508 Unclassified 859
911 nmdc:mga09592_761574_c1 3300050508 Bacteria 821
912 nmdc:mga09592_771136_c1 3300050508 Unclassified 815
913 nmdc:mga0qj67_1127171_c1 3300050509 Bacteria 612
914 nmdc:mga0qj67_14220_c1 3300050509 Bacteria 6015
915 nmdc:mga0qj67_144399_c1 3300050509 Bacteria 1930
916 nmdc:mga0qj67_161722_c1 3300050509 Bacteria 1817
917 nmdc:mga0qj67_2106_c1 3300050509 Bacteria 14178
918 nmdc:mga0qj67_2598_c1 3300050509 Bacteria 12929
919 nmdc:mga0qj67_260352_c1 3300050509 Bacteria 1407
920 nmdc:mga0qj67_288054_c1 3300050509 Bacteria 1331
921 nmdc:mga0qj67_41459_c1 3300050509 Bacteria 3621
922 nmdc:mga0qj67_57517_c1 3300050509 Bacteria 3082
923 nmdc:mga0qj67_808670_c1 3300050509 Unclassified 742
924 nmdc:mga0qj67_8509_c1 3300050509 Bacteria 7613
925 nmdc:mga0qj67_942996_c1 3300050509 Unclassified 679
926 nmdc:mga06r32_10914_c1 3300050510 Bacteria 8179
927 nmdc:mga06r32_13698_c1 3300050510 Bacteria 7355
928 nmdc:mga06r32_18593_c1 3300050510 Bacteria 6365
929 nmdc:mga06r32_192768_c1 3300050510 Bacteria 2025
930 nmdc:mga06r32_4912_c1 3300050510 Bacteria 12044
931 nmdc:mga06r32_576955_c1 3300050510 Unclassified 1097
932 nmdc:mga06r32_722755_c1 3300050510 Bacteria 960
933 nmdc:mga06r32_93975_c1 3300050510 Bacteria 2934
934 nmdc:mga08y16_105_c1 3300050511 Bacteria 70187
935 nmdc:mga08y16_18317_c1 3300050511 Bacteria 7378
936 nmdc:mga08y16_190078_c1 3300050511 Bacteria 2130
937 nmdc:mga08y16_1992_c1 3300050511 Bacteria 20862
938 nmdc:mga08y16_2433_c2 3300050511 Bacteria 16697
939 nmdc:mga08y16_298447_c1 3300050511 Bacteria 1661
940 nmdc:mga08y16_33645_c1 3300050511 Bacteria 5382
941 nmdc:mga08y16_360075_c1 3300050511 Bacteria 1493
942 nmdc:mga08y16_48497_c1 3300050511 Bacteria 4445
943 nmdc:mga08y16_727661_c1 3300050511 Unclassified 990
944 nmdc:mga0n895_10056_c1 3300050512 Bacteria 8325
945 nmdc:mga0n895_194937_c1 3300050512 Bacteria 2057
946 nmdc:mga0n895_222478_c1 3300050512 Bacteria 1916
947 nmdc:mga0n895_2345_c1 3300050512 Bacteria 14753
948 nmdc:mga0n895_318942_c1 3300050512 Bacteria 1575
949 nmdc:mga0n895_389882_c1 3300050512 Bacteria 1409
950 nmdc:mga0n895_65296_c1 3300050512 Bacteria 3602
951 nmdc:mga0n895_7550_c1 3300050512 Bacteria 9346
952 nmdc:mga0n895_77955_c1 3300050512 Bacteria 3297
953 nmdc:mga0n895_975192_c1 3300050512 Unclassified 830
954 nmdc:mga0rr50_1349105_c1 3300050513 Bacteria 604
955 nmdc:mga0rr50_272559_c1 3300050513 Bacteria 1411
956 nmdc:mga0rr50_477152_c1 3300050513 Bacteria 1059
957 nmdc:mga0rr50_50304_c1 3300050513 Bacteria 3088
958 nmdc:mga08x19_228297_c1 3300050514 Bacteria 1281
959 nmdc:mga08x19_47535_c1 3300050514 Bacteria 2747
960 nmdc:mga0a205_1093_c1 3300050515 Bacteria 22518
961 nmdc:mga0a205_11081_c1 3300050515 Bacteria 8296
962 nmdc:mga0a205_1517634_c1 3300050515 Bacteria 518
963 nmdc:mga0a205_20268_c1 3300050515 Bacteria 6272
964 nmdc:mga0a205_51408_c1 3300050515 Bacteria 3978
965 nmdc:mga0a205_547441_c1 3300050515 Bacteria 1012
966 nmdc:mga0a205_721735_c1 3300050515 Bacteria 846
967 nmdc:mga0a205_72556_c1 3300050515 Bacteria 3326
968 nmdc:mga0a205_8089_c1 3300050515 Bacteria 9558
969 Ga0501084_0023342 3300054114 Bacteria 5163
970 Ga0501084_0044676 3300054114 Bacteria 3709
971 Ga0590077_155665 3300059426 Unclassified 548
972 Ga0587106_109685 3300059605 Unclassified 573
973 Ga0501082_0075363 3300060353 Bacteria 2907
974 Ga0530510_0003783 3300061734 Bacteria 10422
975 Ga0530510_0279412 3300061734 Bacteria 1247
976 Ga0530510_0839787 3300061734 Unclassified 701

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_101554435 Ga0307416_1015544351 93
2 3300005290 Ga0065712_10074468 Ga0065712_100744683 95
3 3300005293 Ga0065715_10071301 Ga0065715_100713011 95
4 3300005340 Ga0070689_101957773 Ga0070689_1019577731 95
5 3300005355 Ga0070671_100724560 Ga0070671_1007245601 95
6 3300005364 Ga0070673_100178201 Ga0070673_1001782012 95
7 3300006852 Ga0075433_10455126 Ga0075433_104551262 95
8 3300006871 Ga0075434_100160283 Ga0075434_1001602832 95
9 3300025315 Ga0207697_10316673 Ga0207697_103166732 95
10 3300025918 Ga0207662_10129759 Ga0207662_101297592 95
11 3300025940 Ga0207691_10937716 Ga0207691_109377161 95
12 3300035241 Ga0373961_0096490 Ga0373961_0096490_278_616 95
13 3300048912 Ga0496109_0129207 Ga0496109_0129207_650_988 95
14 3300048914 Ga0496111_0470664 Ga0496111_0470664_424_762 95
15 3300050512 nmdc:mga0n895_222478_c1 nmdc:mga0n895_222478_c1_914_1252 95
16 3300050515 nmdc:mga0a205_547441_c1 nmdc:mga0a205_547441_c1_265_603 95
17 3300025931 Ga0207644_11118781 Ga0207644_111187812 96
18 3300005617 Ga0068859_100285022 Ga0068859_1002850222 97
19 3300005841 Ga0068863_101079771 Ga0068863_1010797711 97
20 3300005842 Ga0068858_100073462 Ga0068858_1000734622 97
21 3300005844 Ga0068862_100806812 Ga0068862_1008068121 97
22 3300006931 Ga0097620_100285032 Ga0097620_1002850322 97
23 3300013297 Ga0157378_11536325 Ga0157378_115363252 97
24 3300014325 Ga0163163_10078874 Ga0163163_100788743 97
25 3300014968 Ga0157379_10005539 Ga0157379_100055395 97
26 3300025986 Ga0207658_11962727 Ga0207658_119627271 97
27 3300026088 Ga0207641_11226263 Ga0207641_112262631 97
28 3300028380 Ga0268265_12636490 Ga0268265_126364901 97
29 3300048917 Ga0496114_0127115 Ga0496114_0127115_1663_2013 97
30 3300002459 JGI24751J29686_10063087 JGI24751J29686_100630871 99
31 3300005288 Ga0065714_10085582 Ga0065714_100855822 99
32 3300005293 Ga0065715_10156526 Ga0065715_101565262 99
33 3300005330 Ga0070690_100195332 Ga0070690_1001953322 99
34 3300005331 Ga0070670_100006795 Ga0070670_1000067956 99
35 3300005333 Ga0070677_10355963 Ga0070677_103559632 99
36 3300005340 Ga0070689_100013831 Ga0070689_1000138314 99
37 3300005343 Ga0070687_100149692 Ga0070687_1001496922 99
38 3300005347 Ga0070668_100171496 Ga0070668_1001714962 99
39 3300005353 Ga0070669_100094522 Ga0070669_1000945222 99
40 3300005354 Ga0070675_100031699 Ga0070675_1000316994 99
41 3300005364 Ga0070673_100058219 Ga0070673_1000582193 99
42 3300005440 Ga0070705_101177031 Ga0070705_1011770311 99
43 3300005456 Ga0070678_102237483 Ga0070678_1022374831 99
44 3300005457 Ga0070662_100089007 Ga0070662_1000890073 99
45 3300005466 Ga0070685_10140010 Ga0070685_101400102 99
46 3300005468 Ga0070707_100649286 Ga0070707_1006492862 99
47 3300005543 Ga0070672_100239578 Ga0070672_1002395782 99
48 3300005549 Ga0070704_100129380 Ga0070704_1001293802 99
49 3300005564 Ga0070664_100153819 Ga0070664_1001538192 99
50 3300005577 Ga0068857_100094387 Ga0068857_1000943872 99
51 3300005578 Ga0068854_101212023 Ga0068854_1012120232 99
52 3300005615 Ga0070702_100602296 Ga0070702_1006022962 99
53 3300005617 Ga0068859_100031700 Ga0068859_1000317002 99
54 3300005618 Ga0068864_100013736 Ga0068864_1000137362 99
55 3300005840 Ga0068870_10500800 Ga0068870_105008002 99
56 3300005841 Ga0068863_100079308 Ga0068863_1000793082 99
57 3300005842 Ga0068858_100090118 Ga0068858_1000901182 99
58 3300005843 Ga0068860_100309486 Ga0068860_1003094862 99
59 3300005844 Ga0068862_100084833 Ga0068862_1000848332 99
60 3300006880 Ga0075429_100315394 Ga0075429_1003153942 99
61 3300006881 Ga0068865_100132505 Ga0068865_1001325052 99
62 3300006931 Ga0097620_100031701 Ga0097620_1000317012 99
63 3300013308 Ga0157375_10896538 Ga0157375_108965382 99
64 3300014325 Ga0163163_10022722 Ga0163163_100227226 99
65 3300025315 Ga0207697_10100323 Ga0207697_101003232 99
66 3300025918 Ga0207662_10161409 Ga0207662_101614092 99
67 3300025923 Ga0207681_10088080 Ga0207681_100880802 99
68 3300025925 Ga0207650_10008408 Ga0207650_100084082 99
69 3300025926 Ga0207659_10016839 Ga0207659_100168394 99
70 3300025933 Ga0207706_10107569 Ga0207706_101075691 99
71 3300025940 Ga0207691_10051671 Ga0207691_100516713 99
72 3300025945 Ga0207679_10268894 Ga0207679_102688942 99
73 3300025960 Ga0207651_10270489 Ga0207651_102704891 99
74 3300025972 Ga0207668_10160384 Ga0207668_101603842 99
75 3300025981 Ga0207640_11130389 Ga0207640_111303892 99
76 3300026088 Ga0207641_10204287 Ga0207641_102042872 99
77 3300026089 Ga0207648_11254370 Ga0207648_112543702 99
78 3300026095 Ga0207676_10038193 Ga0207676_100381932 99
79 3300026116 Ga0207674_10138458 Ga0207674_101384583 99
80 3300026142 Ga0207698_11238304 Ga0207698_112383042 99
81 3300028381 Ga0268264_11552364 Ga0268264_115523642 99
82 3300042122 Ga0450920_083914 Ga0450920_083914_275_625 99
83 3300049591 Ga0501075_0365637 Ga0501075_0365637_405_752 99
84 3300050508 nmdc:mga09592_296869_c1 nmdc:mga09592_296869_c1_55_438 99
85 3300049824 Ga0501045_0862712 Ga0501045_0862712_18_368 100
86 3300050509 nmdc:mga0qj67_288054_c1 nmdc:mga0qj67_288054_c1_371_724 100
87 3300005354 Ga0070675_101232846 Ga0070675_1012328461 102
88 3300014326 Ga0157380_11440734 Ga0157380_114407342 103
89 3300031852 Ga0307410_10296611 Ga0307410_102966112 103
90 3300032002 Ga0307416_100278820 Ga0307416_1002788202 103
91 3300032005 Ga0307411_10018126 Ga0307411_100181262 103
92 3300049771 Ga0501274_044320 Ga0501274_044320_10_321 103
93 3300005444 Ga0070694_101322810 Ga0070694_1013228102 104
94 3300009148 Ga0105243_11098730 Ga0105243_110987302 104
95 3300014325 Ga0163163_11314973 Ga0163163_113149732 104
96 3300025926 Ga0207659_11394337 Ga0207659_113943372 104
97 3300026023 Ga0207677_10128062 Ga0207677_101280622 104
98 3300035691 Ga0373931_0360102 Ga0373931_0360102_432_761 104
99 3300042461 Ga0439460_0129669 Ga0439460_0129669_103_417 104
100 3300050511 nmdc:mga08y16_360075_c1 nmdc:mga08y16_360075_c1_386_709 104
101 3300050512 nmdc:mga0n895_975192_c1 nmdc:mga0n895_975192_c1_14_343 104
102 3300031548 Ga0307408_100005337 Ga0307408_1000053377 105
103 3300031548 Ga0307408_100856354 Ga0307408_1008563541 105
104 3300031731 Ga0307405_10004965 Ga0307405_100049656 105
105 3300031731 Ga0307405_10110521 Ga0307405_101105212 105
106 3300031824 Ga0307413_10041777 Ga0307413_100417772 105
107 3300031824 Ga0307413_10246706 Ga0307413_102467062 105
108 3300031852 Ga0307410_10001041 Ga0307410_100010413 105
109 3300031852 Ga0307410_10030463 Ga0307410_100304631 105
110 3300031852 Ga0307410_10172661 Ga0307410_101726612 105
111 3300031901 Ga0307406_10011560 Ga0307406_100115602 105
112 3300031901 Ga0307406_10023602 Ga0307406_100236024 105
113 3300031903 Ga0307407_10002185 Ga0307407_100021852 105
114 3300031903 Ga0307407_10006683 Ga0307407_100066833 105
115 3300031903 Ga0307407_10008661 Ga0307407_100086614 105
116 3300031911 Ga0307412_10006626 Ga0307412_100066263 105
117 3300031911 Ga0307412_10019036 Ga0307412_100190362 105
118 3300031995 Ga0307409_100005560 Ga0307409_1000055606 105
119 3300031995 Ga0307409_100096351 Ga0307409_1000963512 105
120 3300031995 Ga0307409_100227714 Ga0307409_1002277142 105
121 3300032002 Ga0307416_100007599 Ga0307416_1000075992 105
122 3300032002 Ga0307416_100020499 Ga0307416_1000204994 105
123 3300032004 Ga0307414_10023679 Ga0307414_100236792 105
124 3300032004 Ga0307414_10050145 Ga0307414_100501452 105
125 3300032004 Ga0307414_10066944 Ga0307414_100669443 105
126 3300032005 Ga0307411_10003369 Ga0307411_100033693 105
127 3300032005 Ga0307411_10048122 Ga0307411_100481223 105
128 3300032126 Ga0307415_100012041 Ga0307415_1000120415 105
129 3300041999 Ga0439433_0040335 Ga0439433_0040335_201_551 105
130 3300049522 Ga0501299_066872 Ga0501299_066872_287_619 105
131 3300049762 Ga0501265_059244 Ga0501265_059244_38_370 105
132 3300050514 nmdc:mga08x19_228297_c1 nmdc:mga08x19_228297_c1_942_1259 105
133 3300026067 Ga0207678_11021847 Ga0207678_110218472 106
134 3300059426 Ga0590077_155665 Ga0590077_155665_90_446 106
135 3300005345 Ga0070692_10571464 Ga0070692_105714642 107
136 3300005354 Ga0070675_100747922 Ga0070675_1007479222 107
137 3300005549 Ga0070704_100689817 Ga0070704_1006898172 107
138 3300005618 Ga0068864_101993177 Ga0068864_1019931772 107
139 3300006846 Ga0075430_100007284 Ga0075430_1000072843 107
140 3300006846 Ga0075430_100440196 Ga0075430_1004401962 107
141 3300006846 Ga0075430_100726594 Ga0075430_1007265942 107
142 3300006847 Ga0075431_100008897 Ga0075431_1000088974 107
143 3300006880 Ga0075429_100095838 Ga0075429_1000958382 107
144 3300009147 Ga0114129_10015037 Ga0114129_100150375 107
145 3300025936 Ga0207670_10254989 Ga0207670_102549892 107
146 3300027907 Ga0207428_10330353 Ga0207428_103303532 107
147 3300031548 Ga0307408_100131640 Ga0307408_1001316402 107
148 3300031852 Ga0307410_10326807 Ga0307410_103268071 107
149 3300031901 Ga0307406_10448903 Ga0307406_104489032 107
150 3300031911 Ga0307412_10085240 Ga0307412_100852403 107
151 3300032126 Ga0307415_100087789 Ga0307415_1000877892 107
152 3300041406 Ga0439439_0030271 Ga0439439_0030271_977_1300 107
153 3300041456 Ga0451795_1213003 Ga0451795_1213003_57_380 107
154 3300042013 Ga0439456_068446 Ga0439456_068446_280_618 107
155 3300042014 Ga0439457_039011 Ga0439457_039011_667_990 107
156 3300042131 Ga0450894_006981 Ga0450894_006981_674_997 107
157 3300049586 Ga0501070_0818211 Ga0501070_0818211_363_692 107
158 3300050507 nmdc:mga05p37_62008_c1 nmdc:mga05p37_62008_c1_118_456 107
159 3300050507 nmdc:mga05p37_78942_c1 nmdc:mga05p37_78942_c1_1107_1430 107
160 3300050508 nmdc:mga09592_41340_c1 nmdc:mga09592_41340_c1_2854_3192 107
161 3300050508 nmdc:mga09592_6060_c1 nmdc:mga09592_6060_c1_7040_7363 107
162 3300050509 nmdc:mga0qj67_2598_c1 nmdc:mga0qj67_2598_c1_7586_7924 107
163 3300050509 nmdc:mga0qj67_260352_c1 nmdc:mga0qj67_260352_c1_976_1299 107
164 3300050510 nmdc:mga06r32_10914_c1 nmdc:mga06r32_10914_c1_5269_5607 107
165 3300050510 nmdc:mga06r32_13698_c1 nmdc:mga06r32_13698_c1_2373_2696 107
166 3300050511 nmdc:mga08y16_190078_c1 nmdc:mga08y16_190078_c1_591_914 107
167 3300050512 nmdc:mga0n895_2345_c1 nmdc:mga0n895_2345_c1_3921_4256 107
168 3300050513 nmdc:mga0rr50_50304_c1 nmdc:mga0rr50_50304_c1_1501_1836 107
169 3300005295 Ga0065707_10177573 Ga0065707_101775732 108
170 3300005295 Ga0065707_10513075 Ga0065707_105130752 108
171 3300005330 Ga0070690_100236311 Ga0070690_1002363111 108
172 3300005331 Ga0070670_100308078 Ga0070670_1003080782 108
173 3300005335 Ga0070666_10427074 Ga0070666_104270742 108
174 3300005338 Ga0068868_101184660 Ga0068868_1011846602 108
175 3300005340 Ga0070689_100496396 Ga0070689_1004963962 108
176 3300005340 Ga0070689_100622486 Ga0070689_1006224862 108
177 3300005353 Ga0070669_100348850 Ga0070669_1003488502 108
178 3300005354 Ga0070675_100054369 Ga0070675_1000543692 108
179 3300005354 Ga0070675_101161058 Ga0070675_1011610582 108
180 3300005355 Ga0070671_100411174 Ga0070671_1004111742 108
181 3300005364 Ga0070673_100227528 Ga0070673_1002275282 108
182 3300005365 Ga0070688_100132670 Ga0070688_1001326702 108
183 3300005366 Ga0070659_101696806 Ga0070659_1016968061 108
184 3300005367 Ga0070667_100231914 Ga0070667_1002319142 108
185 3300005456 Ga0070678_100195696 Ga0070678_1001956962 108
186 3300005457 Ga0070662_100175462 Ga0070662_1001754622 108
187 3300005466 Ga0070685_10189349 Ga0070685_101893491 108
188 3300005466 Ga0070685_10492493 Ga0070685_104924932 108
189 3300005518 Ga0070699_100057206 Ga0070699_1000572062 108
190 3300005536 Ga0070697_100042970 Ga0070697_1000429703 108
191 3300005543 Ga0070672_100327978 Ga0070672_1003279782 108
192 3300005564 Ga0070664_100193616 Ga0070664_1001936162 108
193 3300005617 Ga0068859_100137409 Ga0068859_1001374092 108
194 3300005617 Ga0068859_100616260 Ga0068859_1006162602 108
195 3300005844 Ga0068862_100394176 Ga0068862_1003941761 108
196 3300006173 Ga0070716_100295681 Ga0070716_1002956812 108
197 3300006358 Ga0068871_100335133 Ga0068871_1003351332 108
198 3300006871 Ga0075434_100017717 Ga0075434_1000177173 108
199 3300006871 Ga0075434_100291799 Ga0075434_1002917992 108
200 3300006914 Ga0075436_100247270 Ga0075436_1002472702 108
201 3300006931 Ga0097620_100137405 Ga0097620_1001374052 108
202 3300006931 Ga0097620_100616189 Ga0097620_1006161892 108
203 3300007076 Ga0075435_100021650 Ga0075435_1000216505 108
204 3300009094 Ga0111539_10000755 Ga0111539_1000075523 108
205 3300009094 Ga0111539_10430974 Ga0111539_104309742 108
206 3300009098 Ga0105245_12828056 Ga0105245_128280561 108
207 3300009147 Ga0114129_10011461 Ga0114129_100114612 108
208 3300009176 Ga0105242_12058796 Ga0105242_120587962 108
209 3300009551 Ga0105238_11290638 Ga0105238_112906382 108
210 3300013297 Ga0157378_12146722 Ga0157378_121467221 108
211 3300014326 Ga0157380_12581491 Ga0157380_125814911 108
212 3300014326 Ga0157380_13531499 Ga0157380_135314992 108
213 3300014745 Ga0157377_10839215 Ga0157377_108392152 108
214 3300014968 Ga0157379_10622765 Ga0157379_106227652 108
215 3300025315 Ga0207697_10425285 Ga0207697_104252852 108
216 3300025893 Ga0207682_10353181 Ga0207682_103531812 108
217 3300025901 Ga0207688_10117851 Ga0207688_101178512 108
218 3300025907 Ga0207645_10071891 Ga0207645_100718912 108
219 3300025923 Ga0207681_10098151 Ga0207681_100981512 108
220 3300025925 Ga0207650_10378069 Ga0207650_103780692 108
221 3300025926 Ga0207659_10246304 Ga0207659_102463042 108
222 3300025934 Ga0207686_10934872 Ga0207686_109348722 108
223 3300025936 Ga0207670_10398434 Ga0207670_103984342 108
224 3300025936 Ga0207670_11038803 Ga0207670_110388032 108
225 3300025937 Ga0207669_10492500 Ga0207669_104925002 108
226 3300025939 Ga0207665_10175780 Ga0207665_101757802 108
227 3300025940 Ga0207691_10051607 Ga0207691_100516074 108
228 3300025942 Ga0207689_11272182 Ga0207689_112721821 108
229 3300025945 Ga0207679_10442857 Ga0207679_104428572 108
230 3300025960 Ga0207651_10183494 Ga0207651_101834942 108
231 3300025981 Ga0207640_10148930 Ga0207640_101489302 108
232 3300026035 Ga0207703_10525303 Ga0207703_105253032 108
233 3300026095 Ga0207676_10452835 Ga0207676_104528352 108
234 3300026121 Ga0207683_10147538 Ga0207683_101475382 108
235 3300027907 Ga0207428_10006364 Ga0207428_100063642 108
236 3300027907 Ga0207428_10232302 Ga0207428_102323022 108
237 3300028380 Ga0268265_10283603 Ga0268265_102836032 108
238 3300028381 Ga0268264_10173986 Ga0268264_101739862 108
239 3300032002 Ga0307416_101060604 Ga0307416_1010606042 108
240 3300041999 Ga0439433_0213453 Ga0439433_0213453_123_449 108
241 3300044694 Ga0466963_0473724 Ga0466963_0473724_156_491 108
242 3300045051 Ga0451576_0587816 Ga0451576_0587816_209_547 108
243 3300048906 Ga0496103_0594593 Ga0496103_0594593_347_685 108
244 3300048915 Ga0496112_0176680 Ga0496112_0176680_670_1008 108
245 3300050507 nmdc:mga05p37_62595_c1 nmdc:mga05p37_62595_c1_3780_4118 108
246 3300050508 nmdc:mga09592_704253_c1 nmdc:mga09592_704253_c1_234_578 108
247 3300050511 nmdc:mga08y16_2433_c2 nmdc:mga08y16_2433_c2_15503_15841 108
248 3300050511 nmdc:mga08y16_48497_c1 nmdc:mga08y16_48497_c1_3043_3387 108
249 3300050512 nmdc:mga0n895_318942_c1 nmdc:mga0n895_318942_c1_29_367 108
250 3300050514 nmdc:mga08x19_47535_c1 nmdc:mga08x19_47535_c1_575_913 108
251 3300050515 nmdc:mga0a205_11081_c1 nmdc:mga0a205_11081_c1_6088_6426 108
252 3300005327 Ga0070658_10681076 Ga0070658_106810761 109
253 3300005329 Ga0070683_101058910 Ga0070683_1010589101 109
254 3300005331 Ga0070670_100372748 Ga0070670_1003727482 109
255 3300005339 Ga0070660_101829905 Ga0070660_1018299051 109
256 3300005344 Ga0070661_100284445 Ga0070661_1002844452 109
257 3300005344 Ga0070661_100434878 Ga0070661_1004348782 109
258 3300005345 Ga0070692_10314873 Ga0070692_103148732 109
259 3300005353 Ga0070669_101010391 Ga0070669_1010103912 109
260 3300005354 Ga0070675_100210327 Ga0070675_1002103272 109
261 3300005354 Ga0070675_100389407 Ga0070675_1003894072 109
262 3300005354 Ga0070675_101523782 Ga0070675_1015237821 109
263 3300005356 Ga0070674_100535233 Ga0070674_1005352332 109
264 3300005364 Ga0070673_101641790 Ga0070673_1016417901 109
265 3300005366 Ga0070659_100097397 Ga0070659_1000973973 109
266 3300005366 Ga0070659_101025996 Ga0070659_1010259961 109
267 3300005366 Ga0070659_101199739 Ga0070659_1011997392 109
268 3300005456 Ga0070678_100830645 Ga0070678_1008306452 109
269 3300005457 Ga0070662_101042959 Ga0070662_1010429592 109
270 3300005458 Ga0070681_11071047 Ga0070681_110710472 109
271 3300005530 Ga0070679_101264771 Ga0070679_1012647711 109
272 3300005535 Ga0070684_100351027 Ga0070684_1003510272 109
273 3300005536 Ga0070697_100148337 Ga0070697_1001483372 109
274 3300005543 Ga0070672_100153693 Ga0070672_1001536931 109
275 3300005545 Ga0070695_100001180 Ga0070695_1000011803 109
276 3300005548 Ga0070665_102249190 Ga0070665_1022491902 109
277 3300005549 Ga0070704_100003047 Ga0070704_10000304710 109
278 3300005564 Ga0070664_100028549 Ga0070664_1000285494 109
279 3300005564 Ga0070664_100045139 Ga0070664_1000451393 109
280 3300005564 Ga0070664_101119940 Ga0070664_1011199402 109
281 3300005578 Ga0068854_102232259 Ga0068854_1022322591 109
282 3300005616 Ga0068852_101082062 Ga0068852_1010820622 109
283 3300005618 Ga0068864_100943079 Ga0068864_1009430791 109
284 3300005834 Ga0068851_10608267 Ga0068851_106082672 109
285 3300005843 Ga0068860_101379386 Ga0068860_1013793862 109
286 3300006237 Ga0097621_100860532 Ga0097621_1008605322 109
287 3300006237 Ga0097621_100879077 Ga0097621_1008790772 109
288 3300006358 Ga0068871_100431941 Ga0068871_1004319412 109
289 3300006844 Ga0075428_100055909 Ga0075428_1000559094 109
290 3300006852 Ga0075433_10065223 Ga0075433_100652232 109
291 3300006880 Ga0075429_100183248 Ga0075429_1001832482 109
292 3300006881 Ga0068865_101566687 Ga0068865_1015666872 109
293 3300009098 Ga0105245_11361450 Ga0105245_113614502 109
294 3300009147 Ga0114129_10088461 Ga0114129_100884612 109
295 3300009148 Ga0105243_10489768 Ga0105243_104897682 109
296 3300009176 Ga0105242_10485248 Ga0105242_104852482 109
297 3300009176 Ga0105242_10543991 Ga0105242_105439912 109
298 3300009177 Ga0105248_12497464 Ga0105248_124974642 109
299 3300011119 Ga0105246_11004191 Ga0105246_110041911 109
300 3300013104 Ga0157370_10680047 Ga0157370_106800472 109
301 3300013105 Ga0157369_11790139 Ga0157369_117901392 109
302 3300013296 Ga0157374_10058009 Ga0157374_100580092 109
303 3300013297 Ga0157378_11308270 Ga0157378_113082701 109
304 3300013306 Ga0163162_10594590 Ga0163162_105945902 109
305 3300013308 Ga0157375_10053871 Ga0157375_100538714 109
306 3300014745 Ga0157377_10066351 Ga0157377_100663512 109
307 3300014969 Ga0157376_10146519 Ga0157376_101465193 109
308 3300014969 Ga0157376_10452981 Ga0157376_104529811 109
309 3300017792 Ga0163161_10329549 Ga0163161_103295492 109
310 3300025893 Ga0207682_10513646 Ga0207682_105136462 109
311 3300025910 Ga0207684_11442527 Ga0207684_114425271 109
312 3300025920 Ga0207649_10207488 Ga0207649_102074882 109
313 3300025920 Ga0207649_11285241 Ga0207649_112852412 109
314 3300025922 Ga0207646_10176874 Ga0207646_101768742 109
315 3300025925 Ga0207650_10341737 Ga0207650_103417372 109
316 3300025925 Ga0207650_11314223 Ga0207650_113142232 109
317 3300025926 Ga0207659_10144191 Ga0207659_101441912 109
318 3300025926 Ga0207659_10248867 Ga0207659_102488671 109
319 3300025931 Ga0207644_10662566 Ga0207644_106625662 109
320 3300025932 Ga0207690_10505589 Ga0207690_105055891 109
321 3300025932 Ga0207690_10836519 Ga0207690_108365192 109
322 3300025933 Ga0207706_10351216 Ga0207706_103512162 109
323 3300025933 Ga0207706_11161877 Ga0207706_111618772 109
324 3300025934 Ga0207686_10748549 Ga0207686_107485491 109
325 3300025937 Ga0207669_10366017 Ga0207669_103660172 109
326 3300025938 Ga0207704_10842829 Ga0207704_108428292 109
327 3300025940 Ga0207691_10111507 Ga0207691_101115072 109
328 3300025940 Ga0207691_10302750 Ga0207691_103027502 109
329 3300025945 Ga0207679_10072733 Ga0207679_100727331 109
330 3300025945 Ga0207679_10282284 Ga0207679_102822842 109
331 3300025945 Ga0207679_10853464 Ga0207679_108534642 109
332 3300025986 Ga0207658_10148154 Ga0207658_101481542 109
333 3300026089 Ga0207648_10391102 Ga0207648_103911022 109
334 3300026089 Ga0207648_10568499 Ga0207648_105684992 109
335 3300026095 Ga0207676_10536862 Ga0207676_105368622 109
336 3300026121 Ga0207683_10947911 Ga0207683_109479111 109
337 3300026121 Ga0207683_11783227 Ga0207683_117832272 109
338 3300026142 Ga0207698_10914614 Ga0207698_109146142 109
339 3300031903 Ga0307407_10653161 Ga0307407_106531611 109
340 3300031911 Ga0307412_10285258 Ga0307412_102852582 109
341 3300031995 Ga0307409_102441834 Ga0307409_1024418342 109
342 3300032126 Ga0307415_101113346 Ga0307415_1011133461 109
343 3300044706 Ga0466964_0865252 Ga0466964_0865252_97_438 109
344 3300046499 Ga0495594_0065323 Ga0495594_0065323_1458_1787 109
345 3300046539 Ga0495621_0420692 Ga0495621_0420692_77_406 109
346 3300047318 Ga0495636_0698195 Ga0495636_0698195_22_372 109
347 3300048911 Ga0496108_1496146 Ga0496108_1496146_175_504 109
348 3300049593 Ga0501077_0407901 Ga0501077_0407901_32_376 109
349 3300050507 nmdc:mga05p37_68721_c1 nmdc:mga05p37_68721_c1_1584_1925 109
350 3300061734 Ga0530510_0839787 Ga0530510_0839787_83_427 109
351 3300005295 Ga0065707_10294736 Ga0065707_102947361 110
352 3300005334 Ga0068869_100134140 Ga0068869_1001341402 110
353 3300005365 Ga0070688_100749471 Ga0070688_1007494712 110
354 3300005367 Ga0070667_101602042 Ga0070667_1016020421 110
355 3300005435 Ga0070714_100001653 Ga0070714_1000016532 110
356 3300005458 Ga0070681_11600664 Ga0070681_116006642 110
357 3300005459 Ga0068867_100424721 Ga0068867_1004247212 110
358 3300005471 Ga0070698_101768074 Ga0070698_1017680741 110
359 3300005564 Ga0070664_100906184 Ga0070664_1009061842 110
360 3300005578 Ga0068854_100446566 Ga0068854_1004465662 110
361 3300005578 Ga0068854_100775348 Ga0068854_1007753481 110
362 3300005617 Ga0068859_100016878 Ga0068859_1000168786 110
363 3300005617 Ga0068859_100154339 Ga0068859_1001543392 110
364 3300005618 Ga0068864_100715766 Ga0068864_1007157662 110
365 3300005840 Ga0068870_10930615 Ga0068870_109306151 110
366 3300005842 Ga0068858_100408647 Ga0068858_1004086472 110
367 3300005842 Ga0068858_101026418 Ga0068858_1010264181 110
368 3300005844 Ga0068862_101846704 Ga0068862_1018467041 110
369 3300006175 Ga0070712_100334364 Ga0070712_1003343642 110
370 3300006358 Ga0068871_101319808 Ga0068871_1013198082 110
371 3300006844 Ga0075428_100062542 Ga0075428_1000625424 110
372 3300006844 Ga0075428_100109766 Ga0075428_1001097662 110
373 3300006844 Ga0075428_100412681 Ga0075428_1004126812 110
374 3300006846 Ga0075430_100016847 Ga0075430_1000168472 110
375 3300006847 Ga0075431_100126095 Ga0075431_1001260952 110
376 3300006847 Ga0075431_100627278 Ga0075431_1006272781 110
377 3300006871 Ga0075434_100584670 Ga0075434_1005846702 110
378 3300006880 Ga0075429_100025829 Ga0075429_1000258292 110
379 3300006931 Ga0097620_100016878 Ga0097620_1000168782 110
380 3300006931 Ga0097620_100154336 Ga0097620_1001543362 110
381 3300009093 Ga0105240_10152291 Ga0105240_101522913 110
382 3300009093 Ga0105240_11096188 Ga0105240_110961882 110
383 3300009094 Ga0111539_10305421 Ga0111539_103054212 110
384 3300009101 Ga0105247_10042623 Ga0105247_100426232 110
385 3300009101 Ga0105247_10498168 Ga0105247_104981682 110
386 3300009147 Ga0114129_10097771 Ga0114129_100977712 110
387 3300009148 Ga0105243_12091718 Ga0105243_120917181 110
388 3300009177 Ga0105248_10381767 Ga0105248_103817672 110
389 3300009545 Ga0105237_12785171 Ga0105237_127851711 110
390 3300009553 Ga0105249_10709139 Ga0105249_107091392 110
391 3300009553 Ga0105249_12528720 Ga0105249_125287201 110
392 3300011119 Ga0105246_10386002 Ga0105246_103860022 110
393 3300013307 Ga0157372_11157983 Ga0157372_111579832 110
394 3300014325 Ga0163163_12870914 Ga0163163_128709141 110
395 3300014326 Ga0157380_10146465 Ga0157380_101464652 110
396 3300014326 Ga0157380_10547370 Ga0157380_105473702 110
397 3300014968 Ga0157379_10003064 Ga0157379_1000306410 110
398 3300014968 Ga0157379_11933437 Ga0157379_119334371 110
399 3300025900 Ga0207710_10165396 Ga0207710_101653962 110
400 3300025903 Ga0207680_10530980 Ga0207680_105309802 110
401 3300025913 Ga0207695_10110371 Ga0207695_101103712 110
402 3300025913 Ga0207695_10797727 Ga0207695_107977272 110
403 3300025915 Ga0207693_10381053 Ga0207693_103810532 110
404 3300025929 Ga0207664_10028758 Ga0207664_100287584 110
405 3300025941 Ga0207711_10116745 Ga0207711_101167453 110
406 3300025942 Ga0207689_10164159 Ga0207689_101641592 110
407 3300025961 Ga0207712_11111695 Ga0207712_111116952 110
408 3300025981 Ga0207640_10132555 Ga0207640_101325552 110
409 3300025981 Ga0207640_10857698 Ga0207640_108576981 110
410 3300026023 Ga0207677_11740030 Ga0207677_117400302 110
411 3300026035 Ga0207703_10028221 Ga0207703_100282214 110
412 3300026035 Ga0207703_10290096 Ga0207703_102900962 110
413 3300026089 Ga0207648_10138033 Ga0207648_101380332 110
414 3300026118 Ga0207675_100555107 Ga0207675_1005551072 110
415 3300028381 Ga0268264_10135603 Ga0268264_101356033 110
416 3300028381 Ga0268264_11214925 Ga0268264_112149251 110
417 3300031548 Ga0307408_101727238 Ga0307408_1017272381 110
418 3300031731 Ga0307405_10195963 Ga0307405_101959632 110
419 3300031995 Ga0307409_102302079 Ga0307409_1023020791 110
420 3300032004 Ga0307414_10158817 Ga0307414_101588172 110
421 3300032005 Ga0307411_10024943 Ga0307411_100249433 110
422 3300032126 Ga0307415_101417589 Ga0307415_1014175892 110
423 3300042003 Ga0439443_036869 Ga0439443_036869_115_456 110
424 3300042156 Ga0439446_0195039 Ga0439446_0195039_109_462 110
425 3300042435 Ga0439434_0330459 Ga0439434_0330459_167_508 110
426 3300044673 Ga0453683_0758109 Ga0453683_0758109_84_428 110
427 3300045976 Ga0466967_0230110 Ga0466967_0230110_943_1287 110
428 3300049515 Ga0501292_027441 Ga0501292_027441_358_711 110
429 3300049568 Ga0501031_0451062 Ga0501031_0451062_89_430 110
430 3300049570 Ga0501033_0556441 Ga0501033_0556441_80_421 110
431 3300049572 Ga0501036_0126418 Ga0501036_0126418_1210_1551 110
432 3300049574 Ga0501038_1218417 Ga0501038_1218417_63_404 110
433 3300049575 Ga0501039_0016762 Ga0501039_0016762_4436_4777 110
434 3300049577 Ga0501041_0002879 Ga0501041_0002879_5274_5615 110
435 3300049578 Ga0501042_0025943 Ga0501042_0025943_274_615 110
436 3300049580 Ga0501046_0189929 Ga0501046_0189929_897_1238 110
437 3300049587 Ga0501071_0177634 Ga0501071_0177634_825_1166 110
438 3300049591 Ga0501075_0128948 Ga0501075_0128948_1362_1703 110
439 3300049593 Ga0501077_0057339 Ga0501077_0057339_1659_2000 110
440 3300049686 Ga0501257_056364 Ga0501257_056364_202_543 110
441 3300049741 Ga0501079_0053734 Ga0501079_0053734_646_987 110
442 3300049743 Ga0501081_0034579 Ga0501081_0034579_2813_3154 110
443 3300049822 Ga0501035_0945422 Ga0501035_0945422_63_404 110
444 3300050507 nmdc:mga05p37_277213_c1 nmdc:mga05p37_277213_c1_488_829 110
445 3300050508 nmdc:mga09592_4664_c1 nmdc:mga09592_4664_c1_6247_6588 110
446 3300050509 nmdc:mga0qj67_2106_c1 nmdc:mga0qj67_2106_c1_11103_11444 110
447 3300050510 nmdc:mga06r32_18593_c1 nmdc:mga06r32_18593_c1_1708_2049 110
448 3300050510 nmdc:mga06r32_576955_c1 nmdc:mga06r32_576955_c1_519_860 110
449 3300050511 nmdc:mga08y16_298447_c1 nmdc:mga08y16_298447_c1_529_870 110
450 3300050512 nmdc:mga0n895_389882_c1 nmdc:mga0n895_389882_c1_206_571 110
451 3300050515 nmdc:mga0a205_721735_c1 nmdc:mga0a205_721735_c1_283_648 110
452 3300054114 Ga0501084_0044676 Ga0501084_0044676_319_660 110
453 3300059605 Ga0587106_109685 Ga0587106_109685_95_442 110
454 3300061734 Ga0530510_0003783 Ga0530510_0003783_8733_9074 110
455 3300005329 Ga0070683_100307950 Ga0070683_1003079502 111
456 3300005340 Ga0070689_102055714 Ga0070689_1020557141 111
457 3300005354 Ga0070675_100051531 Ga0070675_1000515313 111
458 3300005364 Ga0070673_100041539 Ga0070673_1000415392 111
459 3300005365 Ga0070688_100363799 Ga0070688_1003637992 111
460 3300005544 Ga0070686_100452164 Ga0070686_1004521642 111
461 3300005564 Ga0070664_100094627 Ga0070664_1000946272 111
462 3300005985 Ga0081539_10029084 Ga0081539_100290842 111
463 3300006358 Ga0068871_100462484 Ga0068871_1004624841 111
464 3300006844 Ga0075428_100061209 Ga0075428_1000612091 111
465 3300006852 Ga0075433_10098544 Ga0075433_100985443 111
466 3300006852 Ga0075433_10562871 Ga0075433_105628712 111
467 3300006871 Ga0075434_100078955 Ga0075434_1000789553 111
468 3300006880 Ga0075429_100193064 Ga0075429_1001930642 111
469 3300006881 Ga0068865_101039397 Ga0068865_1010393972 111
470 3300009147 Ga0114129_10029973 Ga0114129_100299734 111
471 3300009553 Ga0105249_12125889 Ga0105249_121258892 111
472 3300013308 Ga0157375_12916576 Ga0157375_129165762 111
473 3300025908 Ga0207643_10156941 Ga0207643_101569412 111
474 3300025926 Ga0207659_10260097 Ga0207659_102600972 111
475 3300025940 Ga0207691_10641627 Ga0207691_106416272 111
476 3300025944 Ga0207661_10043583 Ga0207661_100435834 111
477 3300025960 Ga0207651_10074395 Ga0207651_100743952 111
478 3300046491 Ga0495584_0034244 Ga0495584_0034244_129_473 111
479 3300050507 nmdc:mga05p37_7428_c1 nmdc:mga05p37_7428_c1_11359_11703 111
480 3300050508 nmdc:mga09592_204154_c1 nmdc:mga09592_204154_c1_279_623 111
481 3300050512 nmdc:mga0n895_77955_c1 nmdc:mga0n895_77955_c1_2649_2993 111
482 3300050515 nmdc:mga0a205_51408_c1 nmdc:mga0a205_51408_c1_1716_2060 111
483 3300005564 Ga0070664_101815782 Ga0070664_1018157822 112
484 3300009094 Ga0111539_10008742 Ga0111539_100087428 112
485 3300025926 Ga0207659_10501468 Ga0207659_105014682 112
486 3300050511 nmdc:mga08y16_1992_c1 nmdc:mga08y16_1992_c1_15393_15764 112
487 3300005440 Ga0070705_101040559 Ga0070705_1010405592 113
488 3300005545 Ga0070695_100134955 Ga0070695_1001349552 113
489 3300006844 Ga0075428_100000284 Ga0075428_10000028420 113
490 3300006846 Ga0075430_100090817 Ga0075430_1000908172 113
491 3300006846 Ga0075430_100265976 Ga0075430_1002659761 113
492 3300006847 Ga0075431_100007807 Ga0075431_1000078078 113
493 3300006847 Ga0075431_100062847 Ga0075431_1000628471 113
494 3300006852 Ga0075433_10010139 Ga0075433_100101392 113
495 3300006871 Ga0075434_100010577 Ga0075434_1000105776 113
496 3300006871 Ga0075434_100016832 Ga0075434_1000168324 113
497 3300006871 Ga0075434_101301769 Ga0075434_1013017691 113
498 3300006880 Ga0075429_100004197 Ga0075429_1000041977 113
499 3300006880 Ga0075429_100055647 Ga0075429_1000556473 113
500 3300007076 Ga0075435_100308202 Ga0075435_1003082022 113
501 3300009094 Ga0111539_10009063 Ga0111539_100090635 113
502 3300009094 Ga0111539_10065215 Ga0111539_100652154 113
503 3300009094 Ga0111539_11986943 Ga0111539_119869431 113
504 3300009147 Ga0114129_10020716 Ga0114129_100207167 113
505 3300009147 Ga0114129_10041091 Ga0114129_100410912 113
506 3300009147 Ga0114129_10161305 Ga0114129_101613053 113
507 3300009148 Ga0105243_11179696 Ga0105243_111796962 113
508 3300014326 Ga0157380_10079032 Ga0157380_100790322 113
509 3300025917 Ga0207660_10535784 Ga0207660_105357842 113
510 3300027907 Ga0207428_10000690 Ga0207428_1000069017 113
511 3300027907 Ga0207428_10769437 Ga0207428_107694372 113
512 3300031731 Ga0307405_10006136 Ga0307405_100061365 113
513 3300031995 Ga0307409_100027658 Ga0307409_1000276582 113
514 3300032002 Ga0307416_100012407 Ga0307416_1000124075 113
515 3300032002 Ga0307416_100834867 Ga0307416_1008348672 113
516 3300032005 Ga0307411_10388768 Ga0307411_103887681 113
517 3300042003 Ga0439443_045458 Ga0439443_045458_273_644 113
518 3300042122 Ga0450920_067381 Ga0450920_067381_252_623 113
519 3300042435 Ga0439434_0038168 Ga0439434_0038168_289_672 113
520 3300049514 Ga0501291_071558 Ga0501291_071558_163_534 113
521 3300049578 Ga0501042_0791502 Ga0501042_0791502_91_432 113
522 3300049592 Ga0501076_1513172 Ga0501076_1513172_19_390 113
523 3300049652 Ga0501202_059244 Ga0501202_059244_194_565 113
524 3300049687 Ga0501258_042547 Ga0501258_042547_209_580 113
525 3300050507 nmdc:mga05p37_1775854_c1 nmdc:mga05p37_1775854_c1_221_568 113
526 3300050507 nmdc:mga05p37_717761_c1 nmdc:mga05p37_717761_c1_311_682 113
527 3300050508 nmdc:mga09592_287129_c1 nmdc:mga09592_287129_c1_874_1245 113
528 3300050509 nmdc:mga0qj67_144399_c1 nmdc:mga0qj67_144399_c1_652_1023 113
529 3300050509 nmdc:mga0qj67_942996_c1 nmdc:mga0qj67_942996_c1_109_480 113
530 3300050512 nmdc:mga0n895_10056_c1 nmdc:mga0n895_10056_c1_1731_2078 113
531 3300050512 nmdc:mga0n895_7550_c1 nmdc:mga0n895_7550_c1_3833_4180 113
532 3300050513 nmdc:mga0rr50_1349105_c1 nmdc:mga0rr50_1349105_c1_141_488 113
533 3300050513 nmdc:mga0rr50_272559_c1 nmdc:mga0rr50_272559_c1_623_970 113
534 3300050515 nmdc:mga0a205_20268_c1 nmdc:mga0a205_20268_c1_4681_5028 113
535 3300050515 nmdc:mga0a205_8089_c1 nmdc:mga0a205_8089_c1_6926_7273 113
536 3300004800 Ga0058861_11795853 Ga0058861_117958532 114
537 3300005288 Ga0065714_10139313 Ga0065714_101393132 114
538 3300005289 Ga0065704_10238573 Ga0065704_102385732 114
539 3300005290 Ga0065712_10026972 Ga0065712_100269722 114
540 3300005290 Ga0065712_10068029 Ga0065712_1006802911 114
541 3300005293 Ga0065715_10179119 Ga0065715_101791192 114
542 3300005295 Ga0065707_10012615 Ga0065707_100126153 114
543 3300005328 Ga0070676_10116384 Ga0070676_101163842 114
544 3300005331 Ga0070670_100721919 Ga0070670_1007219192 114
545 3300005334 Ga0068869_100351982 Ga0068869_1003519822 114
546 3300005335 Ga0070666_10576985 Ga0070666_105769852 114
547 3300005336 Ga0070680_100967993 Ga0070680_1009679932 114
548 3300005338 Ga0068868_100590139 Ga0068868_1005901392 114
549 3300005340 Ga0070689_100457581 Ga0070689_1004575812 114
550 3300005340 Ga0070689_100462733 Ga0070689_1004627332 114
551 3300005341 Ga0070691_10276112 Ga0070691_102761122 114
552 3300005343 Ga0070687_100801030 Ga0070687_1008010301 114
553 3300005347 Ga0070668_100781962 Ga0070668_1007819622 114
554 3300005347 Ga0070668_101305000 Ga0070668_1013050001 114
555 3300005353 Ga0070669_100216571 Ga0070669_1002165711 114
556 3300005353 Ga0070669_100572461 Ga0070669_1005724612 114
557 3300005353 Ga0070669_101745864 Ga0070669_1017458642 114
558 3300005354 Ga0070675_100026955 Ga0070675_1000269553 114
559 3300005354 Ga0070675_100192394 Ga0070675_1001923942 114
560 3300005354 Ga0070675_100267127 Ga0070675_1002671272 114
561 3300005364 Ga0070673_100002298 Ga0070673_1000022987 114
562 3300005364 Ga0070673_100727245 Ga0070673_1007272452 114
563 3300005365 Ga0070688_100102547 Ga0070688_1001025473 114
564 3300005365 Ga0070688_100687743 Ga0070688_1006877431 114
565 3300005440 Ga0070705_101031282 Ga0070705_1010312821 114
566 3300005441 Ga0070700_100782494 Ga0070700_1007824941 114
567 3300005444 Ga0070694_100274786 Ga0070694_1002747861 114
568 3300005444 Ga0070694_101047917 Ga0070694_1010479171 114
569 3300005455 Ga0070663_100259133 Ga0070663_1002591332 114
570 3300005456 Ga0070678_100679285 Ga0070678_1006792852 114
571 3300005457 Ga0070662_100274708 Ga0070662_1002747082 114
572 3300005459 Ga0068867_100235396 Ga0068867_1002353962 114
573 3300005471 Ga0070698_101398033 Ga0070698_1013980331 114
574 3300005518 Ga0070699_100310293 Ga0070699_1003102932 114
575 3300005530 Ga0070679_100746102 Ga0070679_1007461022 114
576 3300005543 Ga0070672_100070216 Ga0070672_1000702162 114
577 3300005549 Ga0070704_100131876 Ga0070704_1001318761 114
578 3300005564 Ga0070664_100113742 Ga0070664_1001137423 114
579 3300005564 Ga0070664_101176678 Ga0070664_1011766782 114
580 3300005577 Ga0068857_100695118 Ga0068857_1006951182 114
581 3300005578 Ga0068854_101927090 Ga0068854_1019270902 114
582 3300005617 Ga0068859_100027171 Ga0068859_1000271716 114
583 3300005617 Ga0068859_100554065 Ga0068859_1005540652 114
584 3300005618 Ga0068864_100244407 Ga0068864_1002444071 114
585 3300005618 Ga0068864_100921277 Ga0068864_1009212772 114
586 3300005718 Ga0068866_11030466 Ga0068866_110304661 114
587 3300005719 Ga0068861_100088426 Ga0068861_1000884262 114
588 3300005844 Ga0068862_100650127 Ga0068862_1006501272 114
589 3300005844 Ga0068862_101295591 Ga0068862_1012955912 114
590 3300006058 Ga0075432_10254257 Ga0075432_102542572 114
591 3300006844 Ga0075428_100030746 Ga0075428_1000307464 114
592 3300006846 Ga0075430_100051294 Ga0075430_1000512942 114
593 3300006846 Ga0075430_100052018 Ga0075430_1000520182 114
594 3300006846 Ga0075430_100333305 Ga0075430_1003333052 114
595 3300006847 Ga0075431_100009529 Ga0075431_1000095294 114
596 3300006847 Ga0075431_100020930 Ga0075431_1000209305 114
597 3300006847 Ga0075431_100536181 Ga0075431_1005361812 114
598 3300006852 Ga0075433_10051341 Ga0075433_100513412 114
599 3300006852 Ga0075433_11103709 Ga0075433_111037092 114
600 3300006871 Ga0075434_100040403 Ga0075434_1000404034 114
601 3300006880 Ga0075429_100031404 Ga0075429_1000314042 114
602 3300006880 Ga0075429_100777492 Ga0075429_1007774922 114
603 3300006880 Ga0075429_101514358 Ga0075429_1015143582 114
604 3300006881 Ga0068865_100105404 Ga0068865_1001054042 114
605 3300006931 Ga0097620_100027171 Ga0097620_1000271716 114
606 3300006931 Ga0097620_100554102 Ga0097620_1005541022 114
607 3300009092 Ga0105250_10369461 Ga0105250_103694612 114
608 3300009094 Ga0111539_10000306 Ga0111539_100003066 114
609 3300009094 Ga0111539_10020960 Ga0111539_100209605 114
610 3300009094 Ga0111539_10046513 Ga0111539_100465132 114
611 3300009094 Ga0111539_10346671 Ga0111539_103466712 114
612 3300009094 Ga0111539_11778179 Ga0111539_117781792 114
613 3300009098 Ga0105245_12821488 Ga0105245_128214881 114
614 3300009147 Ga0114129_10052707 Ga0114129_100527075 114
615 3300009147 Ga0114129_10071381 Ga0114129_100713814 114
616 3300009147 Ga0114129_11025944 Ga0114129_110259442 114
617 3300009147 Ga0114129_13427606 Ga0114129_134276061 114
618 3300009148 Ga0105243_11459078 Ga0105243_114590782 114
619 3300009176 Ga0105242_12261840 Ga0105242_122618401 114
620 3300009553 Ga0105249_10055766 Ga0105249_100557664 114
621 3300009553 Ga0105249_11002137 Ga0105249_110021372 114
622 3300009553 Ga0105249_11012239 Ga0105249_110122392 114
623 3300011119 Ga0105246_10482864 Ga0105246_104828642 114
624 3300013102 Ga0157371_10376531 Ga0157371_103765312 114
625 3300013307 Ga0157372_11377976 Ga0157372_113779761 114
626 3300013308 Ga0157375_10889915 Ga0157375_108899152 114
627 3300014325 Ga0163163_10176303 Ga0163163_101763032 114
628 3300014326 Ga0157380_10062932 Ga0157380_100629322 114
629 3300025711 Ga0207696_1150937 Ga0207696_11509372 114
630 3300025903 Ga0207680_10272872 Ga0207680_102728722 114
631 3300025907 Ga0207645_10465105 Ga0207645_104651052 114
632 3300025908 Ga0207643_10029188 Ga0207643_100291883 114
633 3300025908 Ga0207643_10316273 Ga0207643_103162731 114
634 3300025917 Ga0207660_10463954 Ga0207660_104639542 114
635 3300025918 Ga0207662_10068981 Ga0207662_100689812 114
636 3300025920 Ga0207649_10123466 Ga0207649_101234662 114
637 3300025921 Ga0207652_10426207 Ga0207652_104262072 114
638 3300025923 Ga0207681_10234283 Ga0207681_102342832 114
639 3300025923 Ga0207681_10245883 Ga0207681_102458832 114
640 3300025923 Ga0207681_10849554 Ga0207681_108495542 114
641 3300025926 Ga0207659_10004148 Ga0207659_100041487 114
642 3300025926 Ga0207659_10036422 Ga0207659_100364224 114
643 3300025926 Ga0207659_10697319 Ga0207659_106973192 114
644 3300025933 Ga0207706_10158425 Ga0207706_101584252 114
645 3300025935 Ga0207709_10956887 Ga0207709_109568872 114
646 3300025936 Ga0207670_10195723 Ga0207670_101957232 114
647 3300025936 Ga0207670_10524131 Ga0207670_105241312 114
648 3300025937 Ga0207669_10765135 Ga0207669_107651352 114
649 3300025937 Ga0207669_11042207 Ga0207669_110422071 114
650 3300025940 Ga0207691_10023881 Ga0207691_100238813 114
651 3300025942 Ga0207689_10207102 Ga0207689_102071022 114
652 3300025945 Ga0207679_11176945 Ga0207679_111769452 114
653 3300025960 Ga0207651_10002212 Ga0207651_100022125 114
654 3300025960 Ga0207651_10394009 Ga0207651_103940092 114
655 3300025960 Ga0207651_11213175 Ga0207651_112131752 114
656 3300025972 Ga0207668_10710017 Ga0207668_107100172 114
657 3300025986 Ga0207658_10532335 Ga0207658_105323352 114
658 3300026067 Ga0207678_10586738 Ga0207678_105867382 114
659 3300026075 Ga0207708_10363917 Ga0207708_103639172 114
660 3300026075 Ga0207708_10780312 Ga0207708_107803121 114
661 3300026089 Ga0207648_10119107 Ga0207648_101191073 114
662 3300026095 Ga0207676_10201180 Ga0207676_102011802 114
663 3300026116 Ga0207674_10164806 Ga0207674_101648062 114
664 3300026116 Ga0207674_11316252 Ga0207674_113162522 114
665 3300026118 Ga0207675_100057612 Ga0207675_1000576122 114
666 3300026118 Ga0207675_100072977 Ga0207675_1000729773 114
667 3300026118 Ga0207675_100222288 Ga0207675_1002222882 114
668 3300026118 Ga0207675_102041456 Ga0207675_1020414562 114
669 3300027876 Ga0209974_10013867 Ga0209974_100138672 114
670 3300027876 Ga0209974_10066431 Ga0209974_100664312 114
671 3300027907 Ga0207428_10003602 Ga0207428_100036027 114
672 3300027907 Ga0207428_10007135 Ga0207428_100071354 114
673 3300027907 Ga0207428_10047890 Ga0207428_100478903 114
674 3300027907 Ga0207428_10286830 Ga0207428_102868302 114
675 3300028380 Ga0268265_10314010 Ga0268265_103140102 114
676 3300028380 Ga0268265_10461428 Ga0268265_104614282 114
677 3300028380 Ga0268265_12218439 Ga0268265_122184391 114
678 3300028381 Ga0268264_10262106 Ga0268264_102621062 114
679 3300031903 Ga0307407_10616850 Ga0307407_106168501 114
680 3300032002 Ga0307416_100305556 Ga0307416_1003055562 114
681 3300035121 Ga0373960_0350446 Ga0373960_0350446_143_508 114
682 3300041408 Ga0439453_0003587 Ga0439453_0003587_1831_2175 114
683 3300042436 Ga0439435_0049424 Ga0439435_0049424_531_875 114
684 3300042437 Ga0439444_0050498 Ga0439444_0050498_121_465 114
685 3300042439 Ga0439464_0078464 Ga0439464_0078464_435_779 114
686 3300042530 Ga0450916_006011 Ga0450916_006011_934_1278 114
687 3300042993 Ga0439440_0120505 Ga0439440_0120505_128_472 114
688 3300046537 Ga0495598_0070578 Ga0495598_0070578_87_434 114
689 3300046537 Ga0495598_0113047 Ga0495598_0113047_317_664 114
690 3300046615 Ga0495656_0006702 Ga0495656_0006702_1647_1994 114
691 3300048911 Ga0496108_0720673 Ga0496108_0720673_385_729 114
692 3300048912 Ga0496109_0235737 Ga0496109_0235737_1319_1663 114
693 3300048916 Ga0496113_0049179 Ga0496113_0049179_55_399 114
694 3300049572 Ga0501036_0051933 Ga0501036_0051933_2303_2647 114
695 3300049575 Ga0501039_0120454 Ga0501039_0120454_1138_1482 114
696 3300049576 Ga0501040_0357532 Ga0501040_0357532_513_857 114
697 3300049577 Ga0501041_0002498 Ga0501041_0002498_4122_4466 114
698 3300049578 Ga0501042_0011677 Ga0501042_0011677_1932_2276 114
699 3300049582 Ga0501048_0617519 Ga0501048_0617519_407_751 114
700 3300049584 Ga0501068_0663943 Ga0501068_0663943_212_556 114
701 3300049587 Ga0501071_0728274 Ga0501071_0728274_277_621 114
702 3300049590 Ga0501074_0822061 Ga0501074_0822061_260_604 114
703 3300049592 Ga0501076_0011199 Ga0501076_0011199_3529_3873 114
704 3300049592 Ga0501076_1659453 Ga0501076_1659453_80_424 114
705 3300049593 Ga0501077_0094148 Ga0501077_0094148_1286_1630 114
706 3300049704 Ga0501221_198029 Ga0501221_198029_35_379 114
707 3300049741 Ga0501079_0232707 Ga0501079_0232707_159_503 114
708 3300049742 Ga0501080_0273987 Ga0501080_0273987_495_839 114
709 3300049743 Ga0501081_0011798 Ga0501081_0011798_2964_3308 114
710 3300049824 Ga0501045_0263942 Ga0501045_0263942_484_828 114
711 3300050507 nmdc:mga05p37_1149796_c1 nmdc:mga05p37_1149796_c1_357_740 114
712 3300050507 nmdc:mga05p37_6472_c1 nmdc:mga05p37_6472_c1_2890_3234 114
713 3300050507 nmdc:mga05p37_93689_c1 nmdc:mga05p37_93689_c1_1158_1502 114
714 3300050508 nmdc:mga09592_159989_c1 nmdc:mga09592_159989_c1_198_542 114
715 3300050508 nmdc:mga09592_20748_c1 nmdc:mga09592_20748_c1_3961_4305 114
716 3300050508 nmdc:mga09592_771136_c1 nmdc:mga09592_771136_c1_152_496 114
717 3300050509 nmdc:mga0qj67_1127171_c1 nmdc:mga0qj67_1127171_c1_127_471 114
718 3300050509 nmdc:mga0qj67_14220_c1 nmdc:mga0qj67_14220_c1_3644_3988 114
719 3300050509 nmdc:mga0qj67_41459_c1 nmdc:mga0qj67_41459_c1_704_1048 114
720 3300050509 nmdc:mga0qj67_808670_c1 nmdc:mga0qj67_808670_c1_317_661 114
721 3300050510 nmdc:mga06r32_722755_c1 nmdc:mga06r32_722755_c1_351_695 114
722 3300050510 nmdc:mga06r32_93975_c1 nmdc:mga06r32_93975_c1_387_731 114
723 3300050511 nmdc:mga08y16_105_c1 nmdc:mga08y16_105_c1_7002_7346 114
724 3300050511 nmdc:mga08y16_18317_c1 nmdc:mga08y16_18317_c1_3169_3513 114
725 3300050511 nmdc:mga08y16_33645_c1 nmdc:mga08y16_33645_c1_2761_3105 114
726 3300050511 nmdc:mga08y16_727661_c1 nmdc:mga08y16_727661_c1_240_584 114
727 3300050512 nmdc:mga0n895_194937_c1 nmdc:mga0n895_194937_c1_1348_1692 114
728 3300050515 nmdc:mga0a205_1517634_c1 nmdc:mga0a205_1517634_c1_65_448 114
729 3300050515 nmdc:mga0a205_72556_c1 nmdc:mga0a205_72556_c1_364_708 114
730 3300054114 Ga0501084_0023342 Ga0501084_0023342_3659_4003 114
731 3300060353 Ga0501082_0075363 Ga0501082_0075363_1285_1629 114
732 3300061734 Ga0530510_0279412 Ga0530510_0279412_379_723 114
733 3300001977 JGI24746J21847_1010804 JGI24746J21847_10108042 115
734 3300002126 JGI24035J26624_1009785 JGI24035J26624_10097852 115
735 3300002155 JGI24033J26618_1022121 JGI24033J26618_10221212 115
736 3300002239 JGI24034J26672_10083343 JGI24034J26672_100833432 115
737 3300002459 JGI24751J29686_10039974 JGI24751J29686_100399742 115
738 3300005288 Ga0065714_10131696 Ga0065714_101316962 115
739 3300005289 Ga0065704_10263811 Ga0065704_102638112 115
740 3300005289 Ga0065704_10280339 Ga0065704_102803392 115
741 3300005290 Ga0065712_10009945 Ga0065712_100099453 115
742 3300005290 Ga0065712_10172488 Ga0065712_101724882 115
743 3300005293 Ga0065715_10004827 Ga0065715_100048273 115
744 3300005293 Ga0065715_10007485 Ga0065715_100074857 115
745 3300005295 Ga0065707_10008321 Ga0065707_100083213 115
746 3300005295 Ga0065707_10036311 Ga0065707_100363112 115
747 3300005328 Ga0070676_10004892 Ga0070676_100048923 115
748 3300005328 Ga0070676_10028131 Ga0070676_100281312 115
749 3300005328 Ga0070676_10209629 Ga0070676_102096292 115
750 3300005329 Ga0070683_100339982 Ga0070683_1003399822 115
751 3300005330 Ga0070690_100020399 Ga0070690_1000203992 115
752 3300005330 Ga0070690_100538619 Ga0070690_1005386192 115
753 3300005331 Ga0070670_100002473 Ga0070670_1000024733 115
754 3300005333 Ga0070677_10902812 Ga0070677_109028122 115
755 3300005334 Ga0068869_100015575 Ga0068869_1000155755 115
756 3300005334 Ga0068869_100168473 Ga0068869_1001684732 115
757 3300005335 Ga0070666_10017347 Ga0070666_100173474 115
758 3300005335 Ga0070666_10045843 Ga0070666_100458432 115
759 3300005338 Ga0068868_100028174 Ga0068868_1000281742 115
760 3300005339 Ga0070660_101366093 Ga0070660_1013660932 115
761 3300005340 Ga0070689_100113078 Ga0070689_1001130782 115
762 3300005340 Ga0070689_100219937 Ga0070689_1002199372 115
763 3300005343 Ga0070687_100012056 Ga0070687_1000120562 115
764 3300005343 Ga0070687_100120732 Ga0070687_1001207322 115
765 3300005344 Ga0070661_100311862 Ga0070661_1003118622 115
766 3300005345 Ga0070692_10844979 Ga0070692_108449791 115
767 3300005347 Ga0070668_100054752 Ga0070668_1000547524 115
768 3300005347 Ga0070668_100415741 Ga0070668_1004157412 115
769 3300005353 Ga0070669_100024441 Ga0070669_1000244414 115
770 3300005353 Ga0070669_100046285 Ga0070669_1000462852 115
771 3300005353 Ga0070669_100655190 Ga0070669_1006551901 115
772 3300005354 Ga0070675_100010643 Ga0070675_1000106434 115
773 3300005354 Ga0070675_100051450 Ga0070675_1000514504 115
774 3300005355 Ga0070671_100182084 Ga0070671_1001820842 115
775 3300005355 Ga0070671_100690875 Ga0070671_1006908752 115
776 3300005356 Ga0070674_100013105 Ga0070674_1000131053 115
777 3300005356 Ga0070674_100754336 Ga0070674_1007543361 115
778 3300005356 Ga0070674_101397833 Ga0070674_1013978331 115
779 3300005364 Ga0070673_100011536 Ga0070673_1000115362 115
780 3300005364 Ga0070673_100044468 Ga0070673_1000444682 115
781 3300005365 Ga0070688_100723809 Ga0070688_1007238092 115
782 3300005367 Ga0070667_100022929 Ga0070667_1000229296 115
783 3300005367 Ga0070667_101549870 Ga0070667_1015498702 115
784 3300005438 Ga0070701_10084109 Ga0070701_100841092 115
785 3300005441 Ga0070700_100181401 Ga0070700_1001814012 115
786 3300005441 Ga0070700_100541694 Ga0070700_1005416942 115
787 3300005444 Ga0070694_100321052 Ga0070694_1003210522 115
788 3300005444 Ga0070694_100740583 Ga0070694_1007405832 115
789 3300005456 Ga0070678_100014125 Ga0070678_1000141256 115
790 3300005456 Ga0070678_100173722 Ga0070678_1001737222 115
791 3300005456 Ga0070678_102237291 Ga0070678_1022372912 115
792 3300005457 Ga0070662_100027802 Ga0070662_1000278022 115
793 3300005457 Ga0070662_100049208 Ga0070662_1000492082 115
794 3300005459 Ga0068867_100075291 Ga0068867_1000752912 115
795 3300005459 Ga0068867_100199926 Ga0068867_1001999262 115
796 3300005466 Ga0070685_10044463 Ga0070685_100444632 115
797 3300005466 Ga0070685_10085366 Ga0070685_100853662 115
798 3300005543 Ga0070672_100302331 Ga0070672_1003023312 115
799 3300005543 Ga0070672_100734927 Ga0070672_1007349272 115
800 3300005544 Ga0070686_100023123 Ga0070686_1000231234 115
801 3300005544 Ga0070686_100065493 Ga0070686_1000654931 115
802 3300005544 Ga0070686_100920107 Ga0070686_1009201072 115
803 3300005547 Ga0070693_101410087 Ga0070693_1014100871 115
804 3300005548 Ga0070665_100363420 Ga0070665_1003634202 115
805 3300005549 Ga0070704_100339769 Ga0070704_1003397692 115
806 3300005564 Ga0070664_100000586 Ga0070664_1000005868 115
807 3300005577 Ga0068857_100634226 Ga0068857_1006342262 115
808 3300005577 Ga0068857_102504351 Ga0068857_1025043512 115
809 3300005577 Ga0068857_102562388 Ga0068857_1025623882 115
810 3300005615 Ga0070702_100058054 Ga0070702_1000580542 115
811 3300005615 Ga0070702_100873489 Ga0070702_1008734892 115
812 3300005616 Ga0068852_100694770 Ga0068852_1006947702 115
813 3300005617 Ga0068859_100137882 Ga0068859_1001378823 115
814 3300005617 Ga0068859_100269810 Ga0068859_1002698101 115
815 3300005617 Ga0068859_100722804 Ga0068859_1007228042 115
816 3300005618 Ga0068864_100012301 Ga0068864_1000123017 115
817 3300005618 Ga0068864_100526900 Ga0068864_1005269002 115
818 3300005718 Ga0068866_10331526 Ga0068866_103315262 115
819 3300005719 Ga0068861_100064192 Ga0068861_1000641923 115
820 3300005719 Ga0068861_100113088 Ga0068861_1001130882 115
821 3300005840 Ga0068870_10037950 Ga0068870_100379502 115
822 3300005840 Ga0068870_10146966 Ga0068870_101469662 115
823 3300005841 Ga0068863_100046319 Ga0068863_1000463192 115
824 3300005841 Ga0068863_100632378 Ga0068863_1006323782 115
825 3300005842 Ga0068858_100258874 Ga0068858_1002588742 115
826 3300005843 Ga0068860_100202145 Ga0068860_1002021452 115
827 3300005844 Ga0068862_100070124 Ga0068862_1000701242 115
828 3300005844 Ga0068862_100443243 Ga0068862_1004432432 115
829 3300006058 Ga0075432_10223521 Ga0075432_102235212 115
830 3300006358 Ga0068871_100053491 Ga0068871_1000534913 115
831 3300006844 Ga0075428_100001176 Ga0075428_1000011766 115
832 3300006844 Ga0075428_100092312 Ga0075428_1000923123 115
833 3300006844 Ga0075428_100574562 Ga0075428_1005745622 115
834 3300006846 Ga0075430_100034006 Ga0075430_1000340062 115
835 3300006846 Ga0075430_100045040 Ga0075430_1000450402 115
836 3300006847 Ga0075431_100003965 Ga0075431_1000039652 115
837 3300006852 Ga0075433_10006016 Ga0075433_100060166 115
838 3300006871 Ga0075434_100144644 Ga0075434_1001446441 115
839 3300006880 Ga0075429_100009769 Ga0075429_1000097694 115
840 3300006880 Ga0075429_100557032 Ga0075429_1005570322 115
841 3300006880 Ga0075429_100779165 Ga0075429_1007791651 115
842 3300006881 Ga0068865_100203585 Ga0068865_1002035852 115
843 3300006881 Ga0068865_100302455 Ga0068865_1003024551 115
844 3300006931 Ga0097620_100137872 Ga0097620_1001378723 115
845 3300006931 Ga0097620_100269821 Ga0097620_1002698212 115
846 3300006931 Ga0097620_100722727 Ga0097620_1007227272 115
847 3300007076 Ga0075435_100110594 Ga0075435_1001105943 115
848 3300009094 Ga0111539_10096271 Ga0111539_100962712 115
849 3300009094 Ga0111539_10108999 Ga0111539_101089994 115
850 3300009094 Ga0111539_12096497 Ga0111539_120964972 115
851 3300009094 Ga0111539_13075629 Ga0111539_130756291 115
852 3300009098 Ga0105245_10549944 Ga0105245_105499442 115
853 3300009177 Ga0105248_10286403 Ga0105248_102864032 115
854 3300009553 Ga0105249_10009569 Ga0105249_100095693 115
855 3300009553 Ga0105249_10492529 Ga0105249_104925292 115
856 3300011119 Ga0105246_10012256 Ga0105246_100122562 115
857 3300012480 Ga0157346_1009653 Ga0157346_10096532 115
858 3300012495 Ga0157323_1014743 Ga0157323_10147432 115
859 3300013296 Ga0157374_10338931 Ga0157374_103389312 115
860 3300013297 Ga0157378_10445215 Ga0157378_104452152 115
861 3300013306 Ga0163162_10008524 Ga0163162_100085248 115
862 3300013306 Ga0163162_10655876 Ga0163162_106558762 115
863 3300013308 Ga0157375_10375202 Ga0157375_103752021 115
864 3300013308 Ga0157375_12052295 Ga0157375_120522951 115
865 3300014325 Ga0163163_10172038 Ga0163163_101720383 115
866 3300014326 Ga0157380_10029501 Ga0157380_100295013 115
867 3300014326 Ga0157380_13058894 Ga0157380_130588941 115
868 3300014745 Ga0157377_10005968 Ga0157377_100059686 115
869 3300014745 Ga0157377_10111326 Ga0157377_101113262 115
870 3300014968 Ga0157379_10074359 Ga0157379_100743592 115
871 3300014969 Ga0157376_10066871 Ga0157376_100668713 115
872 3300014969 Ga0157376_11517805 Ga0157376_115178052 115
873 3300017792 Ga0163161_10028324 Ga0163161_100283244 115
874 3300017792 Ga0163161_10039607 Ga0163161_100396071 115
875 3300025223 Ga0207672_1006080 Ga0207672_10060802 115
876 3300025315 Ga0207697_10002059 Ga0207697_100020592 115
877 3300025315 Ga0207697_10020303 Ga0207697_100203032 115
878 3300025893 Ga0207682_10061815 Ga0207682_100618151 115
879 3300025901 Ga0207688_10011929 Ga0207688_100119295 115
880 3300025901 Ga0207688_10203312 Ga0207688_102033122 115
881 3300025901 Ga0207688_10361160 Ga0207688_103611602 115
882 3300025903 Ga0207680_10140575 Ga0207680_101405752 115
883 3300025903 Ga0207680_10574123 Ga0207680_105741232 115
884 3300025907 Ga0207645_10051615 Ga0207645_100516152 115
885 3300025907 Ga0207645_10140632 Ga0207645_101406322 115
886 3300025907 Ga0207645_10208134 Ga0207645_102081342 115
887 3300025908 Ga0207643_10014099 Ga0207643_100140994 115
888 3300025918 Ga0207662_10022979 Ga0207662_100229793 115
889 3300025919 Ga0207657_10612677 Ga0207657_106126772 115
890 3300025920 Ga0207649_10023474 Ga0207649_100234742 115
891 3300025923 Ga0207681_10038068 Ga0207681_100380682 115
892 3300025923 Ga0207681_10214078 Ga0207681_102140782 115
893 3300025923 Ga0207681_11337461 Ga0207681_113374612 115
894 3300025925 Ga0207650_10216970 Ga0207650_102169702 115
895 3300025926 Ga0207659_10009478 Ga0207659_100094782 115
896 3300025926 Ga0207659_10036189 Ga0207659_100361892 115
897 3300025926 Ga0207659_10107144 Ga0207659_101071442 115
898 3300025931 Ga0207644_10073010 Ga0207644_100730102 115
899 3300025931 Ga0207644_10915089 Ga0207644_109150892 115
900 3300025932 Ga0207690_10420306 Ga0207690_104203062 115
901 3300025933 Ga0207706_10027855 Ga0207706_100278552 115
902 3300025933 Ga0207706_10038926 Ga0207706_100389262 115
903 3300025936 Ga0207670_10324941 Ga0207670_103249412 115
904 3300025937 Ga0207669_10016067 Ga0207669_100160675 115
905 3300025937 Ga0207669_10068122 Ga0207669_100681222 115
906 3300025938 Ga0207704_10543167 Ga0207704_105431672 115
907 3300025940 Ga0207691_10006894 Ga0207691_1000689410 115
908 3300025940 Ga0207691_10125050 Ga0207691_101250502 115
909 3300025940 Ga0207691_10525625 Ga0207691_105256252 115
910 3300025941 Ga0207711_10107229 Ga0207711_101072292 115
911 3300025942 Ga0207689_10006638 Ga0207689_100066386 115
912 3300025942 Ga0207689_10066540 Ga0207689_100665402 115
913 3300025942 Ga0207689_10073683 Ga0207689_100736833 115
914 3300025945 Ga0207679_10007694 Ga0207679_100076947 115
915 3300025945 Ga0207679_10471757 Ga0207679_104717572 115
916 3300025960 Ga0207651_10082130 Ga0207651_100821303 115
917 3300025960 Ga0207651_10188674 Ga0207651_101886742 115
918 3300025961 Ga0207712_10023448 Ga0207712_100234486 115
919 3300025961 Ga0207712_12103689 Ga0207712_121036891 115
920 3300025986 Ga0207658_10043526 Ga0207658_100435262 115
921 3300025986 Ga0207658_10435606 Ga0207658_104356062 115
922 3300026023 Ga0207677_10054266 Ga0207677_100542663 115
923 3300026023 Ga0207677_10624927 Ga0207677_106249272 115
924 3300026067 Ga0207678_10082154 Ga0207678_100821543 115
925 3300026075 Ga0207708_10084950 Ga0207708_100849502 115
926 3300026088 Ga0207641_10653180 Ga0207641_106531802 115
927 3300026088 Ga0207641_10675788 Ga0207641_106757882 115
928 3300026089 Ga0207648_10023072 Ga0207648_100230722 115
929 3300026089 Ga0207648_10031931 Ga0207648_100319315 115
930 3300026095 Ga0207676_10153225 Ga0207676_101532252 115
931 3300026095 Ga0207676_10156361 Ga0207676_101563612 115
932 3300026116 Ga0207674_10123356 Ga0207674_101233562 115
933 3300026116 Ga0207674_10208160 Ga0207674_102081602 115
934 3300026118 Ga0207675_100035858 Ga0207675_1000358585 115
935 3300026118 Ga0207675_100080301 Ga0207675_1000803012 115
936 3300026121 Ga0207683_10007767 Ga0207683_100077675 115
937 3300026121 Ga0207683_10278216 Ga0207683_102782162 115
938 3300026121 Ga0207683_10679813 Ga0207683_106798132 115
939 3300026121 Ga0207683_11251034 Ga0207683_112510341 115
940 3300026142 Ga0207698_11117337 Ga0207698_111173371 115
941 3300027543 Ga0209999_1078874 Ga0209999_10788741 115
942 3300027617 Ga0210002_1039797 Ga0210002_10397971 115
943 3300027876 Ga0209974_10063137 Ga0209974_100631372 115
944 3300027907 Ga0207428_10333215 Ga0207428_103332152 115
945 3300028379 Ga0268266_10377133 Ga0268266_103771331 115
946 3300028380 Ga0268265_11624661 Ga0268265_116246612 115
947 3300028381 Ga0268264_10241736 Ga0268264_102417361 115
948 3300028381 Ga0268264_10383459 Ga0268264_103834592 115
949 3300032005 Ga0307411_10567011 Ga0307411_105670112 115
950 3300035112 Ga0373932_0184177 Ga0373932_0184177_61_408 115
951 3300042008 Ga0439450_027769 Ga0439450_027769_744_1091 115
952 3300042127 Ga0450890_088259 Ga0450890_088259_128_475 115
953 3300042436 Ga0439435_0098848 Ga0439435_0098848_141_488 115
954 3300042439 Ga0439464_0031568 Ga0439464_0031568_510_857 115
955 3300045051 Ga0451576_0519841 Ga0451576_0519841_560_907 115
956 3300046537 Ga0495598_0138449 Ga0495598_0138449_397_744 115
957 3300047445 Ga0495677_0353738 Ga0495677_0353738_69_416 115
958 3300048911 Ga0496108_0854356 Ga0496108_0854356_248_595 115
959 3300048912 Ga0496109_0110924 Ga0496109_0110924_918_1265 115
960 3300048916 Ga0496113_0508867 Ga0496113_0508867_363_710 115
961 3300049577 Ga0501041_0590124 Ga0501041_0590124_102_449 115
962 3300049587 Ga0501071_0440219 Ga0501071_0440219_431_778 115
963 3300049741 Ga0501079_0978269 Ga0501079_0978269_173_520 115
964 3300049744 Ga0501083_0595102 Ga0501083_0595102_31_378 115
965 3300050507 nmdc:mga05p37_954583_c1 nmdc:mga05p37_954583_c1_400_747 115
966 3300050508 nmdc:mga09592_24473_c1 nmdc:mga09592_24473_c1_2937_3284 115
967 3300050508 nmdc:mga09592_3707_c1 nmdc:mga09592_3707_c1_11700_12047 115
968 3300050508 nmdc:mga09592_761574_c1 nmdc:mga09592_761574_c1_47_394 115
969 3300050509 nmdc:mga0qj67_161722_c1 nmdc:mga0qj67_161722_c1_81_428 115
970 3300050509 nmdc:mga0qj67_57517_c1 nmdc:mga0qj67_57517_c1_2594_2941 115
971 3300050509 nmdc:mga0qj67_8509_c1 nmdc:mga0qj67_8509_c1_7012_7359 115
972 3300050510 nmdc:mga06r32_192768_c1 nmdc:mga06r32_192768_c1_927_1274 115
973 3300050510 nmdc:mga06r32_4912_c1 nmdc:mga06r32_4912_c1_9688_10035 115
974 3300050512 nmdc:mga0n895_65296_c1 nmdc:mga0n895_65296_c1_1839_2186 115
975 3300050513 nmdc:mga0rr50_477152_c1 nmdc:mga0rr50_477152_c1_61_408 115
976 3300050515 nmdc:mga0a205_1093_c1 nmdc:mga0a205_1093_c1_3159_3506 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

33

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p4f-assembly1.cif.gz_Z structural insights into human co-transcriptional capping - structure 6 0.8706 60 101
6rm3-assembly1.cif.gz_SE0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.8589 58 104
6nby-assembly1.cif.gz_S t.elongatus ndh (composite model) 0.8331 58 101
8p5d-assembly1.cif.gz_SE0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.8324 58 101
5fhg-assembly2.cif.gz_B structure of unliganded pif1 from bacteroides sp 0.8149 58 95
ID Description Score Start End Superfamily
af_A0A1D6JMV5_458_522_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.88 58 101 2.30.30.30
af_P9WL75_5_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8738 25 100 2.40.50.140
4ytlB01 Mainly Beta;Roll;SH3 type barrels.; 0.8725 58 101 2.30.30.30
af_O13936_472_519_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8704 58 100 2.30.30.30
af_A4I326_463_511_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8615 58 98 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A836TGG7-F1-model_v4 Preprotein translocase subunit YajC 0.9327 30 103 GO:0005886
GO:0015031
AF-A0A7V7B1V3-F1-model_v4 Preprotein translocase subunit YajC 0.9231 25 105 GO:0005886
GO:0015031
AF-A0A7C6GX53-F1-model_v4 Preprotein translocase subunit YajC 0.9196 25 104 GO:0005886
GO:0015031
AF-A0A357NA30-F1-model_v4 Preprotein translocase subunit YajC 0.9196 24 103 GO:0005886
GO:0015031
AF-A0A7C6S739-F1-model_v4 Preprotein translocase subunit YajC 0.9122 20 103 GO:0005886
GO:0015031

Feature Viewer

pLDDT pTM Quality
82.54 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map