F487250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 278 | 976 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10238573|Ga0065704_102385732 |
| Length | 127 |
| Sequence | MINSNLGFGVWDLGFPNLIAMATPSQASPSPWLQFVPFVLVLGIFYFIILLPMKKRQQKVQAFLGALKVNDKVITSGGIYGTITKVSDASVQLQVANNVRIDVSRAAIVGYQGQEPVGEALSQSKTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 196 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 200 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 201 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 204 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 205 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 209 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 210 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 213 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 214 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 234 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 255 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 262 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 263 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 98.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1010804 | 3300001977 | Bacteria | 1347 |
| 2 | JGI24035J26624_1009785 | 3300002126 | Unclassified | 947 |
| 3 | JGI24033J26618_1022121 | 3300002155 | Archaea | 821 |
| 4 | JGI24034J26672_10083343 | 3300002239 | Archaea | 586 |
| 5 | JGI24751J29686_10039974 | 3300002459 | Archaea | 971 |
| 6 | JGI24751J29686_10063087 | 3300002459 | Bacteria | 763 |
| 7 | Ga0058861_11795853 | 3300004800 | Unclassified | 820 |
| 8 | Ga0065714_10085582 | 3300005288 | Bacteria | 2142 |
| 9 | Ga0065714_10131696 | 3300005288 | Unclassified | 1244 |
| 10 | Ga0065714_10139313 | 3300005288 | Bacteria | 1184 |
| 11 | Ga0065704_10238573 | 3300005289 | Bacteria | 1022 |
| 12 | Ga0065704_10263811 | 3300005289 | Archaea | 956 |
| 13 | Ga0065704_10280339 | 3300005289 | Unclassified | 924 |
| 14 | Ga0065712_10009945 | 3300005290 | Bacteria | 3847 |
| 15 | Ga0065712_10026972 | 3300005290 | Bacteria | 1634 |
| 16 | Ga0065712_10068029 | 3300005290 | Bacteria | 16684 |
| 17 | Ga0065712_10074468 | 3300005290 | Bacteria | 4086 |
| 18 | Ga0065712_10172488 | 3300005290 | Bacteria | 1236 |
| 19 | Ga0065715_10004827 | 3300005293 | Bacteria | 3943 |
| 20 | Ga0065715_10007485 | 3300005293 | Bacteria | 6998 |
| 21 | Ga0065715_10071301 | 3300005293 | Unclassified | 634 |
| 22 | Ga0065715_10156526 | 3300005293 | Bacteria | 1671 |
| 23 | Ga0065715_10179119 | 3300005293 | Bacteria | 1489 |
| 24 | Ga0065707_10008321 | 3300005295 | Bacteria | 2505 |
| 25 | Ga0065707_10012615 | 3300005295 | Bacteria | 2600 |
| 26 | Ga0065707_10036311 | 3300005295 | Bacteria | 1232 |
| 27 | Ga0065707_10177573 | 3300005295 | Bacteria | 1440 |
| 28 | Ga0065707_10294736 | 3300005295 | Bacteria | 1017 |
| 29 | Ga0065707_10513075 | 3300005295 | Unclassified | 747 |
| 30 | Ga0070658_10681076 | 3300005327 | Unclassified | 892 |
| 31 | Ga0070676_10004892 | 3300005328 | Bacteria | 7098 |
| 32 | Ga0070676_10028131 | 3300005328 | Bacteria | 3192 |
| 33 | Ga0070676_10116384 | 3300005328 | Bacteria | 1672 |
| 34 | Ga0070676_10209629 | 3300005328 | Bacteria | 1282 |
| 35 | Ga0070683_100307950 | 3300005329 | Bacteria | 1507 |
| 36 | Ga0070683_100339982 | 3300005329 | Unclassified | 1429 |
| 37 | Ga0070683_101058910 | 3300005329 | Unclassified | 779 |
| 38 | Ga0070690_100020399 | 3300005330 | Bacteria | 4037 |
| 39 | Ga0070690_100195332 | 3300005330 | Bacteria | 1405 |
| 40 | Ga0070690_100236311 | 3300005330 | Bacteria | 1287 |
| 41 | Ga0070690_100538619 | 3300005330 | Bacteria | 878 |
| 42 | Ga0070670_100002473 | 3300005331 | Bacteria | 15248 |
| 43 | Ga0070670_100006795 | 3300005331 | Bacteria | 9685 |
| 44 | Ga0070670_100308078 | 3300005331 | Bacteria | 1386 |
| 45 | Ga0070670_100372748 | 3300005331 | Bacteria | 1257 |
| 46 | Ga0070670_100721919 | 3300005331 | Bacteria | 897 |
| 47 | Ga0070677_10355963 | 3300005333 | Bacteria | 760 |
| 48 | Ga0070677_10902812 | 3300005333 | Archaea | 511 |
| 49 | Ga0068869_100015575 | 3300005334 | Bacteria | 5105 |
| 50 | Ga0068869_100134140 | 3300005334 | Bacteria | 1906 |
| 51 | Ga0068869_100168473 | 3300005334 | Bacteria | 1710 |
| 52 | Ga0068869_100351982 | 3300005334 | Bacteria | 1201 |
| 53 | Ga0070666_10017347 | 3300005335 | Bacteria | 4615 |
| 54 | Ga0070666_10045843 | 3300005335 | Bacteria | 2931 |
| 55 | Ga0070666_10427074 | 3300005335 | Bacteria | 955 |
| 56 | Ga0070666_10576985 | 3300005335 | Bacteria | 819 |
| 57 | Ga0070680_100967993 | 3300005336 | Unclassified | 735 |
| 58 | Ga0068868_100028174 | 3300005338 | Bacteria | 4292 |
| 59 | Ga0068868_100590139 | 3300005338 | Bacteria | 983 |
| 60 | Ga0068868_101184660 | 3300005338 | Unclassified | 706 |
| 61 | Ga0070660_101366093 | 3300005339 | Unclassified | 602 |
| 62 | Ga0070660_101829905 | 3300005339 | Bacteria | 517 |
| 63 | Ga0070689_100013831 | 3300005340 | Bacteria | 5847 |
| 64 | Ga0070689_100113078 | 3300005340 | Bacteria | 2162 |
| 65 | Ga0070689_100219937 | 3300005340 | Bacteria | 1557 |
| 66 | Ga0070689_100457581 | 3300005340 | Bacteria | 1087 |
| 67 | Ga0070689_100462733 | 3300005340 | Bacteria | 1081 |
| 68 | Ga0070689_100496396 | 3300005340 | Bacteria | 1045 |
| 69 | Ga0070689_100622486 | 3300005340 | Bacteria | 937 |
| 70 | Ga0070689_101957773 | 3300005340 | Bacteria | 536 |
| 71 | Ga0070689_102055714 | 3300005340 | Unclassified | 523 |
| 72 | Ga0070691_10276112 | 3300005341 | Bacteria | 910 |
| 73 | Ga0070687_100012056 | 3300005343 | Bacteria | 3803 |
| 74 | Ga0070687_100120732 | 3300005343 | Bacteria | 1499 |
| 75 | Ga0070687_100149692 | 3300005343 | Bacteria | 1369 |
| 76 | Ga0070687_100801030 | 3300005343 | Bacteria | 667 |
| 77 | Ga0070661_100284445 | 3300005344 | Bacteria | 1283 |
| 78 | Ga0070661_100311862 | 3300005344 | Bacteria | 1227 |
| 79 | Ga0070661_100434878 | 3300005344 | Bacteria | 1042 |
| 80 | Ga0070692_10314873 | 3300005345 | Bacteria | 960 |
| 81 | Ga0070692_10571464 | 3300005345 | Bacteria | 744 |
| 82 | Ga0070692_10844979 | 3300005345 | Unclassified | 629 |
| 83 | Ga0070668_100054752 | 3300005347 | Bacteria | 3077 |
| 84 | Ga0070668_100171496 | 3300005347 | Bacteria | 1767 |
| 85 | Ga0070668_100415741 | 3300005347 | Bacteria | 1151 |
| 86 | Ga0070668_100781962 | 3300005347 | Bacteria | 847 |
| 87 | Ga0070668_101305000 | 3300005347 | Bacteria | 660 |
| 88 | Ga0070669_100024441 | 3300005353 | Bacteria | 4331 |
| 89 | Ga0070669_100046285 | 3300005353 | Bacteria | 3172 |
| 90 | Ga0070669_100094522 | 3300005353 | Bacteria | 2246 |
| 91 | Ga0070669_100216571 | 3300005353 | Bacteria | 1513 |
| 92 | Ga0070669_100348850 | 3300005353 | Bacteria | 1201 |
| 93 | Ga0070669_100572461 | 3300005353 | Bacteria | 944 |
| 94 | Ga0070669_100655190 | 3300005353 | Bacteria | 884 |
| 95 | Ga0070669_101010391 | 3300005353 | Unclassified | 714 |
| 96 | Ga0070669_101745864 | 3300005353 | Bacteria | 543 |
| 97 | Ga0070675_100010643 | 3300005354 | Bacteria | 7191 |
| 98 | Ga0070675_100026955 | 3300005354 | Bacteria | 4614 |
| 99 | Ga0070675_100031699 | 3300005354 | Bacteria | 4275 |
| 100 | Ga0070675_100051450 | 3300005354 | Bacteria | 3385 |
| 101 | Ga0070675_100051531 | 3300005354 | Bacteria | 3382 |
| 102 | Ga0070675_100054369 | 3300005354 | Bacteria | 3294 |
| 103 | Ga0070675_100192394 | 3300005354 | Bacteria | 1768 |
| 104 | Ga0070675_100210327 | 3300005354 | Bacteria | 1691 |
| 105 | Ga0070675_100267127 | 3300005354 | Bacteria | 1500 |
| 106 | Ga0070675_100389407 | 3300005354 | Bacteria | 1242 |
| 107 | Ga0070675_100747922 | 3300005354 | Bacteria | 892 |
| 108 | Ga0070675_101161058 | 3300005354 | Unclassified | 711 |
| 109 | Ga0070675_101232846 | 3300005354 | Bacteria | 689 |
| 110 | Ga0070675_101523782 | 3300005354 | Unclassified | 617 |
| 111 | Ga0070671_100182084 | 3300005355 | Unclassified | 1779 |
| 112 | Ga0070671_100411174 | 3300005355 | Bacteria | 1158 |
| 113 | Ga0070671_100690875 | 3300005355 | Bacteria | 885 |
| 114 | Ga0070671_100724560 | 3300005355 | Bacteria | 863 |
| 115 | Ga0070674_100013105 | 3300005356 | Bacteria | 5114 |
| 116 | Ga0070674_100535233 | 3300005356 | Bacteria | 981 |
| 117 | Ga0070674_100754336 | 3300005356 | Bacteria | 836 |
| 118 | Ga0070674_101397833 | 3300005356 | Archaea | 627 |
| 119 | Ga0070673_100002298 | 3300005364 | Bacteria | 11610 |
| 120 | Ga0070673_100011536 | 3300005364 | Bacteria | 6035 |
| 121 | Ga0070673_100041539 | 3300005364 | Bacteria | 3538 |
| 122 | Ga0070673_100044468 | 3300005364 | Bacteria | 3439 |
| 123 | Ga0070673_100058219 | 3300005364 | Bacteria | 3054 |
| 124 | Ga0070673_100178201 | 3300005364 | Bacteria | 1818 |
| 125 | Ga0070673_100227528 | 3300005364 | Bacteria | 1617 |
| 126 | Ga0070673_100727245 | 3300005364 | Bacteria | 913 |
| 127 | Ga0070673_101641790 | 3300005364 | Unclassified | 608 |
| 128 | Ga0070688_100102547 | 3300005365 | Bacteria | 1889 |
| 129 | Ga0070688_100132670 | 3300005365 | Bacteria | 1683 |
| 130 | Ga0070688_100363799 | 3300005365 | Bacteria | 1062 |
| 131 | Ga0070688_100687743 | 3300005365 | Bacteria | 791 |
| 132 | Ga0070688_100723809 | 3300005365 | Unclassified | 772 |
| 133 | Ga0070688_100749471 | 3300005365 | Bacteria | 760 |
| 134 | Ga0070659_100097397 | 3300005366 | Bacteria | 2364 |
| 135 | Ga0070659_101025996 | 3300005366 | Unclassified | 725 |
| 136 | Ga0070659_101199739 | 3300005366 | Bacteria | 671 |
| 137 | Ga0070659_101696806 | 3300005366 | Unclassified | 565 |
| 138 | Ga0070667_100022929 | 3300005367 | Bacteria | 5175 |
| 139 | Ga0070667_100231914 | 3300005367 | Bacteria | 1646 |
| 140 | Ga0070667_101549870 | 3300005367 | Unclassified | 623 |
| 141 | Ga0070667_101602042 | 3300005367 | Unclassified | 612 |
| 142 | Ga0070714_100001653 | 3300005435 | Bacteria | 16226 |
| 143 | Ga0070701_10084109 | 3300005438 | Bacteria | 1730 |
| 144 | Ga0070705_101031282 | 3300005440 | Unclassified | 669 |
| 145 | Ga0070705_101040559 | 3300005440 | Bacteria | 667 |
| 146 | Ga0070705_101177031 | 3300005440 | Bacteria | 630 |
| 147 | Ga0070700_100181401 | 3300005441 | Bacteria | 1465 |
| 148 | Ga0070700_100541694 | 3300005441 | Bacteria | 903 |
| 149 | Ga0070700_100782494 | 3300005441 | Bacteria | 767 |
| 150 | Ga0070694_100274786 | 3300005444 | Bacteria | 1283 |
| 151 | Ga0070694_100321052 | 3300005444 | Bacteria | 1192 |
| 152 | Ga0070694_100740583 | 3300005444 | Archaea | 802 |
| 153 | Ga0070694_101047917 | 3300005444 | Bacteria | 679 |
| 154 | Ga0070694_101322810 | 3300005444 | Unclassified | 606 |
| 155 | Ga0070663_100259133 | 3300005455 | Bacteria | 1379 |
| 156 | Ga0070678_100014125 | 3300005456 | Bacteria | 5028 |
| 157 | Ga0070678_100173722 | 3300005456 | Bacteria | 1757 |
| 158 | Ga0070678_100195696 | 3300005456 | Unclassified | 1665 |
| 159 | Ga0070678_100679285 | 3300005456 | Bacteria | 926 |
| 160 | Ga0070678_100830645 | 3300005456 | Bacteria | 841 |
| 161 | Ga0070678_102237291 | 3300005456 | Unclassified | 519 |
| 162 | Ga0070678_102237483 | 3300005456 | Unclassified | 519 |
| 163 | Ga0070662_100027802 | 3300005457 | Bacteria | 3931 |
| 164 | Ga0070662_100049208 | 3300005457 | Bacteria | 3039 |
| 165 | Ga0070662_100089007 | 3300005457 | Bacteria | 2315 |
| 166 | Ga0070662_100175462 | 3300005457 | Bacteria | 1686 |
| 167 | Ga0070662_100274708 | 3300005457 | Bacteria | 1362 |
| 168 | Ga0070662_101042959 | 3300005457 | Bacteria | 701 |
| 169 | Ga0070681_11071047 | 3300005458 | Unclassified | 727 |
| 170 | Ga0070681_11600664 | 3300005458 | Unclassified | 577 |
| 171 | Ga0068867_100075291 | 3300005459 | Bacteria | 2532 |
| 172 | Ga0068867_100199926 | 3300005459 | Unclassified | 1599 |
| 173 | Ga0068867_100235396 | 3300005459 | Bacteria | 1482 |
| 174 | Ga0068867_100424721 | 3300005459 | Bacteria | 1127 |
| 175 | Ga0070685_10044463 | 3300005466 | Bacteria | 2542 |
| 176 | Ga0070685_10085366 | 3300005466 | Bacteria | 1901 |
| 177 | Ga0070685_10140010 | 3300005466 | Bacteria | 1522 |
| 178 | Ga0070685_10189349 | 3300005466 | Unclassified | 1330 |
| 179 | Ga0070685_10492493 | 3300005466 | Bacteria | 866 |
| 180 | Ga0070707_100649286 | 3300005468 | Bacteria | 1018 |
| 181 | Ga0070698_101398033 | 3300005471 | Bacteria | 651 |
| 182 | Ga0070698_101768074 | 3300005471 | Unclassified | 571 |
| 183 | Ga0070699_100057206 | 3300005518 | Bacteria | 3378 |
| 184 | Ga0070699_100310293 | 3300005518 | Bacteria | 1416 |
| 185 | Ga0070679_100746102 | 3300005530 | Bacteria | 922 |
| 186 | Ga0070679_101264771 | 3300005530 | Unclassified | 683 |
| 187 | Ga0070684_100351027 | 3300005535 | Bacteria | 1357 |
| 188 | Ga0070697_100042970 | 3300005536 | Bacteria | 3658 |
| 189 | Ga0070697_100148337 | 3300005536 | Bacteria | 1976 |
| 190 | Ga0070672_100070216 | 3300005543 | Bacteria | 2783 |
| 191 | Ga0070672_100153693 | 3300005543 | Bacteria | 1905 |
| 192 | Ga0070672_100239578 | 3300005543 | Bacteria | 1525 |
| 193 | Ga0070672_100302331 | 3300005543 | Bacteria | 1356 |
| 194 | Ga0070672_100327978 | 3300005543 | Bacteria | 1302 |
| 195 | Ga0070672_100734927 | 3300005543 | Archaea | 865 |
| 196 | Ga0070686_100023123 | 3300005544 | Bacteria | 3712 |
| 197 | Ga0070686_100065493 | 3300005544 | Bacteria | 2361 |
| 198 | Ga0070686_100452164 | 3300005544 | Bacteria | 988 |
| 199 | Ga0070686_100920107 | 3300005544 | Archaea | 713 |
| 200 | Ga0070695_100001180 | 3300005545 | Bacteria | 14364 |
| 201 | Ga0070695_100134955 | 3300005545 | Bacteria | 1705 |
| 202 | Ga0070693_101410087 | 3300005547 | Unclassified | 542 |
| 203 | Ga0070665_100363420 | 3300005548 | Bacteria | 1453 |
| 204 | Ga0070665_102249190 | 3300005548 | Bacteria | 549 |
| 205 | Ga0070704_100003047 | 3300005549 | Bacteria | 9536 |
| 206 | Ga0070704_100129380 | 3300005549 | Bacteria | 1954 |
| 207 | Ga0070704_100131876 | 3300005549 | Bacteria | 1938 |
| 208 | Ga0070704_100339769 | 3300005549 | Bacteria | 1264 |
| 209 | Ga0070704_100689817 | 3300005549 | Bacteria | 905 |
| 210 | Ga0070664_100000586 | 3300005564 | Bacteria | 27743 |
| 211 | Ga0070664_100028549 | 3300005564 | Bacteria | 4642 |
| 212 | Ga0070664_100045139 | 3300005564 | Bacteria | 3722 |
| 213 | Ga0070664_100094627 | 3300005564 | Bacteria | 2591 |
| 214 | Ga0070664_100113742 | 3300005564 | Bacteria | 2364 |
| 215 | Ga0070664_100153819 | 3300005564 | Bacteria | 2031 |
| 216 | Ga0070664_100193616 | 3300005564 | Bacteria | 1812 |
| 217 | Ga0070664_100906184 | 3300005564 | Bacteria | 827 |
| 218 | Ga0070664_101119940 | 3300005564 | Bacteria | 742 |
| 219 | Ga0070664_101176678 | 3300005564 | Bacteria | 723 |
| 220 | Ga0070664_101815782 | 3300005564 | Unclassified | 578 |
| 221 | Ga0068857_100094387 | 3300005577 | Bacteria | 2679 |
| 222 | Ga0068857_100634226 | 3300005577 | Bacteria | 1012 |
| 223 | Ga0068857_100695118 | 3300005577 | Bacteria | 966 |
| 224 | Ga0068857_102504351 | 3300005577 | Unclassified | 507 |
| 225 | Ga0068857_102562388 | 3300005577 | Archaea | 501 |
| 226 | Ga0068854_100446566 | 3300005578 | Unclassified | 1079 |
| 227 | Ga0068854_100775348 | 3300005578 | Bacteria | 834 |
| 228 | Ga0068854_101212023 | 3300005578 | Bacteria | 677 |
| 229 | Ga0068854_101927090 | 3300005578 | Bacteria | 544 |
| 230 | Ga0068854_102232259 | 3300005578 | Unclassified | 507 |
| 231 | Ga0070702_100058054 | 3300005615 | Bacteria | 2240 |
| 232 | Ga0070702_100602296 | 3300005615 | Unclassified | 824 |
| 233 | Ga0070702_100873489 | 3300005615 | Archaea | 702 |
| 234 | Ga0068852_100694770 | 3300005616 | Bacteria | 1027 |
| 235 | Ga0068852_101082062 | 3300005616 | Bacteria | 822 |
| 236 | Ga0068859_100016878 | 3300005617 | Bacteria | 7328 |
| 237 | Ga0068859_100027171 | 3300005617 | Bacteria | 5742 |
| 238 | Ga0068859_100031700 | 3300005617 | Bacteria | 5308 |
| 239 | Ga0068859_100137409 | 3300005617 | Bacteria | 2518 |
| 240 | Ga0068859_100137882 | 3300005617 | Bacteria | 2513 |
| 241 | Ga0068859_100154339 | 3300005617 | Bacteria | 2372 |
| 242 | Ga0068859_100269810 | 3300005617 | Unclassified | 1794 |
| 243 | Ga0068859_100285022 | 3300005617 | Bacteria | 1745 |
| 244 | Ga0068859_100554065 | 3300005617 | Bacteria | 1244 |
| 245 | Ga0068859_100616260 | 3300005617 | Bacteria | 1178 |
| 246 | Ga0068859_100722804 | 3300005617 | Unclassified | 1086 |
| 247 | Ga0068864_100012301 | 3300005618 | Bacteria | 7073 |
| 248 | Ga0068864_100013736 | 3300005618 | Bacteria | 6717 |
| 249 | Ga0068864_100244407 | 3300005618 | Bacteria | 1664 |
| 250 | Ga0068864_100526900 | 3300005618 | Unclassified | 1140 |
| 251 | Ga0068864_100715766 | 3300005618 | Bacteria | 979 |
| 252 | Ga0068864_100921277 | 3300005618 | Bacteria | 864 |
| 253 | Ga0068864_100943079 | 3300005618 | Unclassified | 854 |
| 254 | Ga0068864_101993177 | 3300005618 | Unclassified | 587 |
| 255 | Ga0068866_10331526 | 3300005718 | Archaea | 961 |
| 256 | Ga0068866_11030466 | 3300005718 | Unclassified | 586 |
| 257 | Ga0068861_100064192 | 3300005719 | Bacteria | 2824 |
| 258 | Ga0068861_100088426 | 3300005719 | Bacteria | 2440 |
| 259 | Ga0068861_100113088 | 3300005719 | Bacteria | 2178 |
| 260 | Ga0068851_10608267 | 3300005834 | Bacteria | 666 |
| 261 | Ga0068870_10037950 | 3300005840 | Bacteria | 2485 |
| 262 | Ga0068870_10146966 | 3300005840 | Bacteria | 1385 |
| 263 | Ga0068870_10500800 | 3300005840 | Bacteria | 810 |
| 264 | Ga0068870_10930615 | 3300005840 | Bacteria | 616 |
| 265 | Ga0068863_100046319 | 3300005841 | Bacteria | 4127 |
| 266 | Ga0068863_100079308 | 3300005841 | Bacteria | 3110 |
| 267 | Ga0068863_100632378 | 3300005841 | Archaea | 1061 |
| 268 | Ga0068863_101079771 | 3300005841 | Unclassified | 807 |
| 269 | Ga0068858_100073462 | 3300005842 | Bacteria | 3174 |
| 270 | Ga0068858_100090118 | 3300005842 | Bacteria | 2853 |
| 271 | Ga0068858_100258874 | 3300005842 | Bacteria | 1654 |
| 272 | Ga0068858_100408647 | 3300005842 | Bacteria | 1305 |
| 273 | Ga0068858_101026418 | 3300005842 | Bacteria | 808 |
| 274 | Ga0068860_100202145 | 3300005843 | Bacteria | 1925 |
| 275 | Ga0068860_100309486 | 3300005843 | Bacteria | 1549 |
| 276 | Ga0068860_101379386 | 3300005843 | Bacteria | 726 |
| 277 | Ga0068862_100070124 | 3300005844 | Bacteria | 3026 |
| 278 | Ga0068862_100084833 | 3300005844 | Bacteria | 2752 |
| 279 | Ga0068862_100394176 | 3300005844 | Bacteria | 1294 |
| 280 | Ga0068862_100443243 | 3300005844 | Bacteria | 1223 |
| 281 | Ga0068862_100650127 | 3300005844 | Bacteria | 1017 |
| 282 | Ga0068862_100806812 | 3300005844 | Bacteria | 917 |
| 283 | Ga0068862_101295591 | 3300005844 | Unclassified | 730 |
| 284 | Ga0068862_101846704 | 3300005844 | Bacteria | 614 |
| 285 | Ga0081539_10029084 | 3300005985 | Bacteria | 3462 |
| 286 | Ga0075432_10223521 | 3300006058 | Unclassified | 754 |
| 287 | Ga0075432_10254257 | 3300006058 | Unclassified | 714 |
| 288 | Ga0070716_100295681 | 3300006173 | Bacteria | 1124 |
| 289 | Ga0070712_100334364 | 3300006175 | Bacteria | 1235 |
| 290 | Ga0097621_100860532 | 3300006237 | Bacteria | 843 |
| 291 | Ga0097621_100879077 | 3300006237 | Bacteria | 834 |
| 292 | Ga0068871_100053491 | 3300006358 | Bacteria | 3273 |
| 293 | Ga0068871_100335133 | 3300006358 | Bacteria | 1335 |
| 294 | Ga0068871_100431941 | 3300006358 | Bacteria | 1178 |
| 295 | Ga0068871_100462484 | 3300006358 | Bacteria | 1139 |
| 296 | Ga0068871_101319808 | 3300006358 | Bacteria | 679 |
| 297 | Ga0075428_100000284 | 3300006844 | Bacteria | 49693 |
| 298 | Ga0075428_100001176 | 3300006844 | Bacteria | 28020 |
| 299 | Ga0075428_100030746 | 3300006844 | Bacteria | 5937 |
| 300 | Ga0075428_100055909 | 3300006844 | Bacteria | 4323 |
| 301 | Ga0075428_100061209 | 3300006844 | Bacteria | 4122 |
| 302 | Ga0075428_100062542 | 3300006844 | Bacteria | 4075 |
| 303 | Ga0075428_100092312 | 3300006844 | Bacteria | 3301 |
| 304 | Ga0075428_100109766 | 3300006844 | Bacteria | 3005 |
| 305 | Ga0075428_100412681 | 3300006844 | Bacteria | 1447 |
| 306 | Ga0075428_100574562 | 3300006844 | Bacteria | 1205 |
| 307 | Ga0075430_100007284 | 3300006846 | Bacteria | 9338 |
| 308 | Ga0075430_100016847 | 3300006846 | Bacteria | 6225 |
| 309 | Ga0075430_100034006 | 3300006846 | Bacteria | 4325 |
| 310 | Ga0075430_100045040 | 3300006846 | Bacteria | 3729 |
| 311 | Ga0075430_100051294 | 3300006846 | Bacteria | 3478 |
| 312 | Ga0075430_100052018 | 3300006846 | Bacteria | 3449 |
| 313 | Ga0075430_100090817 | 3300006846 | Bacteria | 2554 |
| 314 | Ga0075430_100265976 | 3300006846 | Bacteria | 1420 |
| 315 | Ga0075430_100333305 | 3300006846 | Bacteria | 1254 |
| 316 | Ga0075430_100440196 | 3300006846 | Bacteria | 1076 |
| 317 | Ga0075430_100726594 | 3300006846 | Bacteria | 819 |
| 318 | Ga0075431_100003965 | 3300006847 | Bacteria | 14420 |
| 319 | Ga0075431_100007807 | 3300006847 | Bacteria | 10657 |
| 320 | Ga0075431_100008897 | 3300006847 | Bacteria | 10058 |
| 321 | Ga0075431_100009529 | 3300006847 | Bacteria | 9755 |
| 322 | Ga0075431_100020930 | 3300006847 | Bacteria | 6683 |
| 323 | Ga0075431_100062847 | 3300006847 | Bacteria | 3831 |
| 324 | Ga0075431_100126095 | 3300006847 | Bacteria | 2641 |
| 325 | Ga0075431_100536181 | 3300006847 | Bacteria | 1159 |
| 326 | Ga0075431_100627278 | 3300006847 | Unclassified | 1057 |
| 327 | Ga0075433_10006016 | 3300006852 | Bacteria | 9559 |
| 328 | Ga0075433_10010139 | 3300006852 | Bacteria | 7554 |
| 329 | Ga0075433_10051341 | 3300006852 | Bacteria | 3591 |
| 330 | Ga0075433_10065223 | 3300006852 | Bacteria | 3194 |
| 331 | Ga0075433_10098544 | 3300006852 | Bacteria | 2588 |
| 332 | Ga0075433_10455126 | 3300006852 | Bacteria | 1128 |
| 333 | Ga0075433_10562871 | 3300006852 | Bacteria | 1001 |
| 334 | Ga0075433_11103709 | 3300006852 | Bacteria | 690 |
| 335 | Ga0075434_100010577 | 3300006871 | Bacteria | 8657 |
| 336 | Ga0075434_100016832 | 3300006871 | Bacteria | 7033 |
| 337 | Ga0075434_100017717 | 3300006871 | Bacteria | 6866 |
| 338 | Ga0075434_100040403 | 3300006871 | Bacteria | 4618 |
| 339 | Ga0075434_100078955 | 3300006871 | Bacteria | 3288 |
| 340 | Ga0075434_100144644 | 3300006871 | Bacteria | 2398 |
| 341 | Ga0075434_100160283 | 3300006871 | Bacteria | 2269 |
| 342 | Ga0075434_100291799 | 3300006871 | Bacteria | 1651 |
| 343 | Ga0075434_100584670 | 3300006871 | Bacteria | 1136 |
| 344 | Ga0075434_101301769 | 3300006871 | Unclassified | 738 |
| 345 | Ga0075429_100004197 | 3300006880 | Bacteria | 12338 |
| 346 | Ga0075429_100009769 | 3300006880 | Bacteria | 8318 |
| 347 | Ga0075429_100025829 | 3300006880 | Bacteria | 5100 |
| 348 | Ga0075429_100031404 | 3300006880 | Bacteria | 4616 |
| 349 | Ga0075429_100055647 | 3300006880 | Bacteria | 3442 |
| 350 | Ga0075429_100095838 | 3300006880 | Bacteria | 2588 |
| 351 | Ga0075429_100183248 | 3300006880 | Bacteria | 1835 |
| 352 | Ga0075429_100193064 | 3300006880 | Unclassified | 1784 |
| 353 | Ga0075429_100315394 | 3300006880 | Bacteria | 1368 |
| 354 | Ga0075429_100557032 | 3300006880 | Unclassified | 1005 |
| 355 | Ga0075429_100777492 | 3300006880 | Unclassified | 839 |
| 356 | Ga0075429_100779165 | 3300006880 | Bacteria | 838 |
| 357 | Ga0075429_101514358 | 3300006880 | Unclassified | 583 |
| 358 | Ga0068865_100105404 | 3300006881 | Bacteria | 2071 |
| 359 | Ga0068865_100132505 | 3300006881 | Bacteria | 1869 |
| 360 | Ga0068865_100203585 | 3300006881 | Unclassified | 1538 |
| 361 | Ga0068865_100302455 | 3300006881 | Bacteria | 1281 |
| 362 | Ga0068865_101039397 | 3300006881 | Bacteria | 719 |
| 363 | Ga0068865_101566687 | 3300006881 | Bacteria | 592 |
| 364 | Ga0075436_100247270 | 3300006914 | Bacteria | 1269 |
| 365 | Ga0097620_100016878 | 3300006931 | Bacteria | 7328 |
| 366 | Ga0097620_100027171 | 3300006931 | Bacteria | 5742 |
| 367 | Ga0097620_100031701 | 3300006931 | Bacteria | 5308 |
| 368 | Ga0097620_100137405 | 3300006931 | Bacteria | 2518 |
| 369 | Ga0097620_100137872 | 3300006931 | Bacteria | 2513 |
| 370 | Ga0097620_100154336 | 3300006931 | Bacteria | 2372 |
| 371 | Ga0097620_100269821 | 3300006931 | Unclassified | 1794 |
| 372 | Ga0097620_100285032 | 3300006931 | Bacteria | 1745 |
| 373 | Ga0097620_100554102 | 3300006931 | Bacteria | 1244 |
| 374 | Ga0097620_100616189 | 3300006931 | Bacteria | 1178 |
| 375 | Ga0097620_100722727 | 3300006931 | Unclassified | 1086 |
| 376 | Ga0075435_100021650 | 3300007076 | Bacteria | 4948 |
| 377 | Ga0075435_100110594 | 3300007076 | Bacteria | 2285 |
| 378 | Ga0075435_100308202 | 3300007076 | Bacteria | 1355 |
| 379 | Ga0105250_10369461 | 3300009092 | Unclassified | 631 |
| 380 | Ga0105240_10152291 | 3300009093 | Bacteria | 2753 |
| 381 | Ga0105240_11096188 | 3300009093 | Unclassified | 847 |
| 382 | Ga0111539_10000306 | 3300009094 | Bacteria | 59726 |
| 383 | Ga0111539_10000755 | 3300009094 | Bacteria | 42078 |
| 384 | Ga0111539_10008742 | 3300009094 | Bacteria | 12847 |
| 385 | Ga0111539_10009063 | 3300009094 | Bacteria | 12594 |
| 386 | Ga0111539_10020960 | 3300009094 | Bacteria | 8047 |
| 387 | Ga0111539_10046513 | 3300009094 | Bacteria | 5189 |
| 388 | Ga0111539_10065215 | 3300009094 | Bacteria | 4304 |
| 389 | Ga0111539_10096271 | 3300009094 | Bacteria | 3477 |
| 390 | Ga0111539_10108999 | 3300009094 | Bacteria | 3249 |
| 391 | Ga0111539_10305421 | 3300009094 | Bacteria | 1852 |
| 392 | Ga0111539_10346671 | 3300009094 | Bacteria | 1728 |
| 393 | Ga0111539_10430974 | 3300009094 | Bacteria | 1535 |
| 394 | Ga0111539_11778179 | 3300009094 | Unclassified | 715 |
| 395 | Ga0111539_11986943 | 3300009094 | Bacteria | 674 |
| 396 | Ga0111539_12096497 | 3300009094 | Unclassified | 656 |
| 397 | Ga0111539_13075629 | 3300009094 | Unclassified | 539 |
| 398 | Ga0105245_10549944 | 3300009098 | Bacteria | 1176 |
| 399 | Ga0105245_11361450 | 3300009098 | Bacteria | 759 |
| 400 | Ga0105245_12821488 | 3300009098 | Bacteria | 538 |
| 401 | Ga0105245_12828056 | 3300009098 | Unclassified | 538 |
| 402 | Ga0105247_10042623 | 3300009101 | Bacteria | 2780 |
| 403 | Ga0105247_10498168 | 3300009101 | Bacteria | 887 |
| 404 | Ga0114129_10011461 | 3300009147 | Bacteria | 12623 |
| 405 | Ga0114129_10015037 | 3300009147 | Bacteria | 11018 |
| 406 | Ga0114129_10020716 | 3300009147 | Bacteria | 9344 |
| 407 | Ga0114129_10029973 | 3300009147 | Bacteria | 7704 |
| 408 | Ga0114129_10041091 | 3300009147 | Bacteria | 6518 |
| 409 | Ga0114129_10052707 | 3300009147 | Bacteria | 5710 |
| 410 | Ga0114129_10071381 | 3300009147 | Bacteria | 4842 |
| 411 | Ga0114129_10088461 | 3300009147 | Bacteria | 4293 |
| 412 | Ga0114129_10097771 | 3300009147 | Bacteria | 4064 |
| 413 | Ga0114129_10161305 | 3300009147 | Bacteria | 3062 |
| 414 | Ga0114129_11025944 | 3300009147 | Bacteria | 1037 |
| 415 | Ga0114129_13427606 | 3300009147 | Unclassified | 509 |
| 416 | Ga0105243_10489768 | 3300009148 | Bacteria | 1162 |
| 417 | Ga0105243_11098730 | 3300009148 | Bacteria | 803 |
| 418 | Ga0105243_11179696 | 3300009148 | Bacteria | 778 |
| 419 | Ga0105243_11459078 | 3300009148 | Bacteria | 707 |
| 420 | Ga0105243_12091718 | 3300009148 | Unclassified | 602 |
| 421 | Ga0105242_10485248 | 3300009176 | Bacteria | 1172 |
| 422 | Ga0105242_10543991 | 3300009176 | Bacteria | 1112 |
| 423 | Ga0105242_12058796 | 3300009176 | Unclassified | 614 |
| 424 | Ga0105242_12261840 | 3300009176 | Bacteria | 590 |
| 425 | Ga0105248_10286403 | 3300009177 | Unclassified | 1855 |
| 426 | Ga0105248_10381767 | 3300009177 | Bacteria | 1586 |
| 427 | Ga0105248_12497464 | 3300009177 | Bacteria | 589 |
| 428 | Ga0105237_12785171 | 3300009545 | Bacteria | 500 |
| 429 | Ga0105238_11290638 | 3300009551 | Unclassified | 756 |
| 430 | Ga0105249_10009569 | 3300009553 | Bacteria | 8493 |
| 431 | Ga0105249_10055766 | 3300009553 | Bacteria | 3617 |
| 432 | Ga0105249_10492529 | 3300009553 | Bacteria | 1270 |
| 433 | Ga0105249_10709139 | 3300009553 | Bacteria | 1067 |
| 434 | Ga0105249_11002137 | 3300009553 | Bacteria | 904 |
| 435 | Ga0105249_11012239 | 3300009553 | Bacteria | 900 |
| 436 | Ga0105249_12125889 | 3300009553 | Bacteria | 634 |
| 437 | Ga0105249_12528720 | 3300009553 | Bacteria | 586 |
| 438 | Ga0105246_10012256 | 3300011119 | Bacteria | 5345 |
| 439 | Ga0105246_10386002 | 3300011119 | Bacteria | 1159 |
| 440 | Ga0105246_10482864 | 3300011119 | Bacteria | 1049 |
| 441 | Ga0105246_11004191 | 3300011119 | Bacteria | 756 |
| 442 | Ga0157346_1009653 | 3300012480 | Unclassified | 687 |
| 443 | Ga0157323_1014743 | 3300012495 | Unclassified | 674 |
| 444 | Ga0157371_10376531 | 3300013102 | Bacteria | 1036 |
| 445 | Ga0157370_10680047 | 3300013104 | Bacteria | 940 |
| 446 | Ga0157369_11790139 | 3300013105 | Unclassified | 624 |
| 447 | Ga0157374_10058009 | 3300013296 | Bacteria | 3617 |
| 448 | Ga0157374_10338931 | 3300013296 | Unclassified | 1492 |
| 449 | Ga0157378_10445215 | 3300013297 | Bacteria | 1285 |
| 450 | Ga0157378_11308270 | 3300013297 | Bacteria | 766 |
| 451 | Ga0157378_11536325 | 3300013297 | Unclassified | 711 |
| 452 | Ga0157378_12146722 | 3300013297 | Bacteria | 609 |
| 453 | Ga0163162_10008524 | 3300013306 | Bacteria | 9993 |
| 454 | Ga0163162_10594590 | 3300013306 | Bacteria | 1233 |
| 455 | Ga0163162_10655876 | 3300013306 | Unclassified | 1173 |
| 456 | Ga0157372_11157983 | 3300013307 | Bacteria | 894 |
| 457 | Ga0157372_11377976 | 3300013307 | Bacteria | 813 |
| 458 | Ga0157375_10053871 | 3300013308 | Bacteria | 3960 |
| 459 | Ga0157375_10375202 | 3300013308 | Bacteria | 1589 |
| 460 | Ga0157375_10889915 | 3300013308 | Bacteria | 1035 |
| 461 | Ga0157375_10896538 | 3300013308 | Unclassified | 1031 |
| 462 | Ga0157375_12052295 | 3300013308 | Unclassified | 680 |
| 463 | Ga0157375_12916576 | 3300013308 | Unclassified | 571 |
| 464 | Ga0163163_10022722 | 3300014325 | Bacteria | 5943 |
| 465 | Ga0163163_10078874 | 3300014325 | Bacteria | 3290 |
| 466 | Ga0163163_10172038 | 3300014325 | Bacteria | 2213 |
| 467 | Ga0163163_10176303 | 3300014325 | Bacteria | 2184 |
| 468 | Ga0163163_11314973 | 3300014325 | Bacteria | 785 |
| 469 | Ga0163163_12870914 | 3300014325 | Bacteria | 538 |
| 470 | Ga0157380_10029501 | 3300014326 | Bacteria | 4192 |
| 471 | Ga0157380_10062932 | 3300014326 | Bacteria | 2974 |
| 472 | Ga0157380_10079032 | 3300014326 | Bacteria | 2685 |
| 473 | Ga0157380_10146465 | 3300014326 | Bacteria | 2036 |
| 474 | Ga0157380_10547370 | 3300014326 | Bacteria | 1134 |
| 475 | Ga0157380_11440734 | 3300014326 | Unclassified | 740 |
| 476 | Ga0157380_12581491 | 3300014326 | Unclassified | 574 |
| 477 | Ga0157380_13058894 | 3300014326 | Unclassified | 533 |
| 478 | Ga0157380_13531499 | 3300014326 | Bacteria | 501 |
| 479 | Ga0157377_10005968 | 3300014745 | Bacteria | 5769 |
| 480 | Ga0157377_10066351 | 3300014745 | Bacteria | 2074 |
| 481 | Ga0157377_10111326 | 3300014745 | Bacteria | 1646 |
| 482 | Ga0157377_10839215 | 3300014745 | Bacteria | 681 |
| 483 | Ga0157379_10003064 | 3300014968 | Bacteria | 14133 |
| 484 | Ga0157379_10005539 | 3300014968 | Bacteria | 10848 |
| 485 | Ga0157379_10074359 | 3300014968 | Bacteria | 3042 |
| 486 | Ga0157379_10622765 | 3300014968 | Bacteria | 1009 |
| 487 | Ga0157379_11933437 | 3300014968 | Bacteria | 582 |
| 488 | Ga0157376_10066871 | 3300014969 | Bacteria | 3039 |
| 489 | Ga0157376_10146519 | 3300014969 | Bacteria | 2124 |
| 490 | Ga0157376_10452981 | 3300014969 | Bacteria | 1252 |
| 491 | Ga0157376_11517805 | 3300014969 | Archaea | 703 |
| 492 | Ga0163161_10028324 | 3300017792 | Bacteria | 3978 |
| 493 | Ga0163161_10039607 | 3300017792 | Bacteria | 3384 |
| 494 | Ga0163161_10329549 | 3300017792 | Bacteria | 1209 |
| 495 | Ga0207672_1006080 | 3300025223 | Archaea | 694 |
| 496 | Ga0207697_10002059 | 3300025315 | Bacteria | 10589 |
| 497 | Ga0207697_10020303 | 3300025315 | Bacteria | 2720 |
| 498 | Ga0207697_10100323 | 3300025315 | Bacteria | 1233 |
| 499 | Ga0207697_10316673 | 3300025315 | Unclassified | 692 |
| 500 | Ga0207697_10425285 | 3300025315 | Unclassified | 589 |
| 501 | Ga0207696_1150937 | 3300025711 | Unclassified | 620 |
| 502 | Ga0207682_10061815 | 3300025893 | Unclassified | 1569 |
| 503 | Ga0207682_10353181 | 3300025893 | Unclassified | 693 |
| 504 | Ga0207682_10513646 | 3300025893 | Unclassified | 567 |
| 505 | Ga0207710_10165396 | 3300025900 | Bacteria | 1079 |
| 506 | Ga0207688_10011929 | 3300025901 | Bacteria | 4730 |
| 507 | Ga0207688_10117851 | 3300025901 | Bacteria | 1547 |
| 508 | Ga0207688_10203312 | 3300025901 | Archaea | 1188 |
| 509 | Ga0207688_10361160 | 3300025901 | Unclassified | 896 |
| 510 | Ga0207680_10140575 | 3300025903 | Bacteria | 1600 |
| 511 | Ga0207680_10272872 | 3300025903 | Bacteria | 1173 |
| 512 | Ga0207680_10530980 | 3300025903 | Bacteria | 839 |
| 513 | Ga0207680_10574123 | 3300025903 | Bacteria | 806 |
| 514 | Ga0207645_10051615 | 3300025907 | Bacteria | 2628 |
| 515 | Ga0207645_10071891 | 3300025907 | Bacteria | 2214 |
| 516 | Ga0207645_10140632 | 3300025907 | Bacteria | 1573 |
| 517 | Ga0207645_10208134 | 3300025907 | Bacteria | 1288 |
| 518 | Ga0207645_10465105 | 3300025907 | Bacteria | 854 |
| 519 | Ga0207643_10014099 | 3300025908 | Bacteria | 4339 |
| 520 | Ga0207643_10029188 | 3300025908 | Bacteria | 3067 |
| 521 | Ga0207643_10156941 | 3300025908 | Bacteria | 1367 |
| 522 | Ga0207643_10316273 | 3300025908 | Bacteria | 974 |
| 523 | Ga0207684_11442527 | 3300025910 | Bacteria | 562 |
| 524 | Ga0207695_10110371 | 3300025913 | Bacteria | 2731 |
| 525 | Ga0207695_10797727 | 3300025913 | Unclassified | 824 |
| 526 | Ga0207693_10381053 | 3300025915 | Bacteria | 1103 |
| 527 | Ga0207660_10463954 | 3300025917 | Unclassified | 1025 |
| 528 | Ga0207660_10535784 | 3300025917 | Bacteria | 952 |
| 529 | Ga0207662_10022979 | 3300025918 | Bacteria | 3579 |
| 530 | Ga0207662_10068981 | 3300025918 | Bacteria | 2136 |
| 531 | Ga0207662_10129759 | 3300025918 | Unclassified | 1588 |
| 532 | Ga0207662_10161409 | 3300025918 | Bacteria | 1432 |
| 533 | Ga0207657_10612677 | 3300025919 | Bacteria | 849 |
| 534 | Ga0207649_10023474 | 3300025920 | Bacteria | 3573 |
| 535 | Ga0207649_10123466 | 3300025920 | Bacteria | 1749 |
| 536 | Ga0207649_10207488 | 3300025920 | Bacteria | 1388 |
| 537 | Ga0207649_11285241 | 3300025920 | Unclassified | 579 |
| 538 | Ga0207652_10426207 | 3300025921 | Bacteria | 1196 |
| 539 | Ga0207646_10176874 | 3300025922 | Bacteria | 1927 |
| 540 | Ga0207681_10038068 | 3300025923 | Bacteria | 3183 |
| 541 | Ga0207681_10088080 | 3300025923 | Bacteria | 2210 |
| 542 | Ga0207681_10098151 | 3300025923 | Bacteria | 2107 |
| 543 | Ga0207681_10214078 | 3300025923 | Bacteria | 1487 |
| 544 | Ga0207681_10234283 | 3300025923 | Bacteria | 1426 |
| 545 | Ga0207681_10245883 | 3300025923 | Bacteria | 1395 |
| 546 | Ga0207681_10849554 | 3300025923 | Bacteria | 763 |
| 547 | Ga0207681_11337461 | 3300025923 | Bacteria | 601 |
| 548 | Ga0207650_10008408 | 3300025925 | Bacteria | 7046 |
| 549 | Ga0207650_10216970 | 3300025925 | Bacteria | 1538 |
| 550 | Ga0207650_10341737 | 3300025925 | Bacteria | 1229 |
| 551 | Ga0207650_10378069 | 3300025925 | Bacteria | 1169 |
| 552 | Ga0207650_11314223 | 3300025925 | Unclassified | 615 |
| 553 | Ga0207659_10004148 | 3300025926 | Bacteria | 8745 |
| 554 | Ga0207659_10009478 | 3300025926 | Bacteria | 6087 |
| 555 | Ga0207659_10016839 | 3300025926 | Bacteria | 4766 |
| 556 | Ga0207659_10036189 | 3300025926 | Bacteria | 3417 |
| 557 | Ga0207659_10036422 | 3300025926 | Bacteria | 3408 |
| 558 | Ga0207659_10107144 | 3300025926 | Bacteria | 2117 |
| 559 | Ga0207659_10144191 | 3300025926 | Bacteria | 1852 |
| 560 | Ga0207659_10246304 | 3300025926 | Bacteria | 1448 |
| 561 | Ga0207659_10248867 | 3300025926 | Bacteria | 1441 |
| 562 | Ga0207659_10260097 | 3300025926 | Bacteria | 1411 |
| 563 | Ga0207659_10501468 | 3300025926 | Bacteria | 1028 |
| 564 | Ga0207659_10697319 | 3300025926 | Bacteria | 869 |
| 565 | Ga0207659_11394337 | 3300025926 | Bacteria | 601 |
| 566 | Ga0207664_10028758 | 3300025929 | Bacteria | 4227 |
| 567 | Ga0207644_10073010 | 3300025931 | Bacteria | 2515 |
| 568 | Ga0207644_10662566 | 3300025931 | Bacteria | 869 |
| 569 | Ga0207644_10915089 | 3300025931 | Bacteria | 735 |
| 570 | Ga0207644_11118781 | 3300025931 | Bacteria | 662 |
| 571 | Ga0207690_10420306 | 3300025932 | Unclassified | 1069 |
| 572 | Ga0207690_10505589 | 3300025932 | Unclassified | 978 |
| 573 | Ga0207690_10836519 | 3300025932 | Unclassified | 762 |
| 574 | Ga0207706_10027855 | 3300025933 | Bacteria | 5051 |
| 575 | Ga0207706_10038926 | 3300025933 | Bacteria | 4217 |
| 576 | Ga0207706_10107569 | 3300025933 | Bacteria | 2454 |
| 577 | Ga0207706_10158425 | 3300025933 | Bacteria | 1991 |
| 578 | Ga0207706_10351216 | 3300025933 | Bacteria | 1282 |
| 579 | Ga0207706_11161877 | 3300025933 | Unclassified | 643 |
| 580 | Ga0207686_10748549 | 3300025934 | Unclassified | 780 |
| 581 | Ga0207686_10934872 | 3300025934 | Unclassified | 701 |
| 582 | Ga0207709_10956887 | 3300025935 | Bacteria | 698 |
| 583 | Ga0207670_10195723 | 3300025936 | Bacteria | 1532 |
| 584 | Ga0207670_10254989 | 3300025936 | Bacteria | 1357 |
| 585 | Ga0207670_10324941 | 3300025936 | Bacteria | 1211 |
| 586 | Ga0207670_10398434 | 3300025936 | Bacteria | 1100 |
| 587 | Ga0207670_10524131 | 3300025936 | Bacteria | 965 |
| 588 | Ga0207670_11038803 | 3300025936 | Unclassified | 690 |
| 589 | Ga0207669_10016067 | 3300025937 | Bacteria | 3792 |
| 590 | Ga0207669_10068122 | 3300025937 | Bacteria | 2221 |
| 591 | Ga0207669_10366017 | 3300025937 | Unclassified | 1119 |
| 592 | Ga0207669_10492500 | 3300025937 | Bacteria | 979 |
| 593 | Ga0207669_10765135 | 3300025937 | Unclassified | 799 |
| 594 | Ga0207669_11042207 | 3300025937 | Bacteria | 689 |
| 595 | Ga0207704_10543167 | 3300025938 | Bacteria | 943 |
| 596 | Ga0207704_10842829 | 3300025938 | Bacteria | 768 |
| 597 | Ga0207665_10175780 | 3300025939 | Bacteria | 1548 |
| 598 | Ga0207691_10006894 | 3300025940 | Bacteria | 10958 |
| 599 | Ga0207691_10023881 | 3300025940 | Bacteria | 5754 |
| 600 | Ga0207691_10051607 | 3300025940 | Bacteria | 3759 |
| 601 | Ga0207691_10051671 | 3300025940 | Bacteria | 3756 |
| 602 | Ga0207691_10111507 | 3300025940 | Bacteria | 2432 |
| 603 | Ga0207691_10125050 | 3300025940 | Bacteria | 2276 |
| 604 | Ga0207691_10302750 | 3300025940 | Unclassified | 1373 |
| 605 | Ga0207691_10525625 | 3300025940 | Bacteria | 1004 |
| 606 | Ga0207691_10641627 | 3300025940 | Bacteria | 898 |
| 607 | Ga0207691_10937716 | 3300025940 | Bacteria | 724 |
| 608 | Ga0207711_10107229 | 3300025941 | Bacteria | 2480 |
| 609 | Ga0207711_10116745 | 3300025941 | Bacteria | 2380 |
| 610 | Ga0207689_10006638 | 3300025942 | Bacteria | 10203 |
| 611 | Ga0207689_10066540 | 3300025942 | Bacteria | 2962 |
| 612 | Ga0207689_10073683 | 3300025942 | Bacteria | 2805 |
| 613 | Ga0207689_10164159 | 3300025942 | Bacteria | 1830 |
| 614 | Ga0207689_10207102 | 3300025942 | Bacteria | 1620 |
| 615 | Ga0207689_11272182 | 3300025942 | Unclassified | 618 |
| 616 | Ga0207661_10043583 | 3300025944 | Bacteria | 3542 |
| 617 | Ga0207679_10007694 | 3300025945 | Bacteria | 6844 |
| 618 | Ga0207679_10072733 | 3300025945 | Bacteria | 2598 |
| 619 | Ga0207679_10268894 | 3300025945 | Bacteria | 1457 |
| 620 | Ga0207679_10282284 | 3300025945 | Bacteria | 1424 |
| 621 | Ga0207679_10442857 | 3300025945 | Bacteria | 1151 |
| 622 | Ga0207679_10471757 | 3300025945 | Unclassified | 1116 |
| 623 | Ga0207679_10853464 | 3300025945 | Unclassified | 832 |
| 624 | Ga0207679_11176945 | 3300025945 | Bacteria | 703 |
| 625 | Ga0207651_10002212 | 3300025960 | Bacteria | 9201 |
| 626 | Ga0207651_10074395 | 3300025960 | Bacteria | 2419 |
| 627 | Ga0207651_10082130 | 3300025960 | Bacteria | 2325 |
| 628 | Ga0207651_10183494 | 3300025960 | Bacteria | 1662 |
| 629 | Ga0207651_10188674 | 3300025960 | Bacteria | 1642 |
| 630 | Ga0207651_10270489 | 3300025960 | Bacteria | 1399 |
| 631 | Ga0207651_10394009 | 3300025960 | Bacteria | 1176 |
| 632 | Ga0207651_11213175 | 3300025960 | Bacteria | 677 |
| 633 | Ga0207712_10023448 | 3300025961 | Bacteria | 4072 |
| 634 | Ga0207712_11111695 | 3300025961 | Bacteria | 704 |
| 635 | Ga0207712_12103689 | 3300025961 | Archaea | 505 |
| 636 | Ga0207668_10160384 | 3300025972 | Bacteria | 1752 |
| 637 | Ga0207668_10710017 | 3300025972 | Bacteria | 884 |
| 638 | Ga0207640_10132555 | 3300025981 | Bacteria | 1804 |
| 639 | Ga0207640_10148930 | 3300025981 | Unclassified | 1717 |
| 640 | Ga0207640_10857698 | 3300025981 | Bacteria | 791 |
| 641 | Ga0207640_11130389 | 3300025981 | Bacteria | 694 |
| 642 | Ga0207658_10043526 | 3300025986 | Bacteria | 3264 |
| 643 | Ga0207658_10148154 | 3300025986 | Bacteria | 1909 |
| 644 | Ga0207658_10435606 | 3300025986 | Bacteria | 1158 |
| 645 | Ga0207658_10532335 | 3300025986 | Bacteria | 1050 |
| 646 | Ga0207658_11962727 | 3300025986 | Unclassified | 533 |
| 647 | Ga0207677_10054266 | 3300026023 | Bacteria | 2734 |
| 648 | Ga0207677_10128062 | 3300026023 | Bacteria | 1922 |
| 649 | Ga0207677_10624927 | 3300026023 | Unclassified | 948 |
| 650 | Ga0207677_11740030 | 3300026023 | Unclassified | 578 |
| 651 | Ga0207703_10028221 | 3300026035 | Bacteria | 4422 |
| 652 | Ga0207703_10290096 | 3300026035 | Bacteria | 1489 |
| 653 | Ga0207703_10525303 | 3300026035 | Bacteria | 1114 |
| 654 | Ga0207678_10082154 | 3300026067 | Bacteria | 2757 |
| 655 | Ga0207678_10586738 | 3300026067 | Bacteria | 976 |
| 656 | Ga0207678_11021847 | 3300026067 | Unclassified | 732 |
| 657 | Ga0207708_10084950 | 3300026075 | Bacteria | 2434 |
| 658 | Ga0207708_10363917 | 3300026075 | Bacteria | 1189 |
| 659 | Ga0207708_10780312 | 3300026075 | Unclassified | 822 |
| 660 | Ga0207641_10204287 | 3300026088 | Bacteria | 1824 |
| 661 | Ga0207641_10653180 | 3300026088 | Archaea | 1033 |
| 662 | Ga0207641_10675788 | 3300026088 | Unclassified | 1015 |
| 663 | Ga0207641_11226263 | 3300026088 | Bacteria | 750 |
| 664 | Ga0207648_10023072 | 3300026089 | Bacteria | 5581 |
| 665 | Ga0207648_10031931 | 3300026089 | Bacteria | 4652 |
| 666 | Ga0207648_10119107 | 3300026089 | Bacteria | 2320 |
| 667 | Ga0207648_10138033 | 3300026089 | Bacteria | 2148 |
| 668 | Ga0207648_10391102 | 3300026089 | Bacteria | 1259 |
| 669 | Ga0207648_10568499 | 3300026089 | Bacteria | 1043 |
| 670 | Ga0207648_11254370 | 3300026089 | Unclassified | 696 |
| 671 | Ga0207676_10038193 | 3300026095 | Bacteria | 3662 |
| 672 | Ga0207676_10153225 | 3300026095 | Bacteria | 1988 |
| 673 | Ga0207676_10156361 | 3300026095 | Bacteria | 1970 |
| 674 | Ga0207676_10201180 | 3300026095 | Bacteria | 1760 |
| 675 | Ga0207676_10452835 | 3300026095 | Bacteria | 1210 |
| 676 | Ga0207676_10536862 | 3300026095 | Bacteria | 1116 |
| 677 | Ga0207674_10123356 | 3300026116 | Bacteria | 2557 |
| 678 | Ga0207674_10138458 | 3300026116 | Bacteria | 2395 |
| 679 | Ga0207674_10164806 | 3300026116 | Bacteria | 2170 |
| 680 | Ga0207674_10208160 | 3300026116 | Bacteria | 1905 |
| 681 | Ga0207674_11316252 | 3300026116 | Unclassified | 692 |
| 682 | Ga0207675_100035858 | 3300026118 | Bacteria | 4626 |
| 683 | Ga0207675_100057612 | 3300026118 | Bacteria | 3625 |
| 684 | Ga0207675_100072977 | 3300026118 | Bacteria | 3210 |
| 685 | Ga0207675_100080301 | 3300026118 | Bacteria | 3058 |
| 686 | Ga0207675_100222288 | 3300026118 | Bacteria | 1820 |
| 687 | Ga0207675_100555107 | 3300026118 | Bacteria | 1148 |
| 688 | Ga0207675_102041456 | 3300026118 | Bacteria | 590 |
| 689 | Ga0207683_10007767 | 3300026121 | Bacteria | 9177 |
| 690 | Ga0207683_10147538 | 3300026121 | Bacteria | 2122 |
| 691 | Ga0207683_10278216 | 3300026121 | Bacteria | 1529 |
| 692 | Ga0207683_10679813 | 3300026121 | Archaea | 954 |
| 693 | Ga0207683_10947911 | 3300026121 | Bacteria | 799 |
| 694 | Ga0207683_11251034 | 3300026121 | Unclassified | 687 |
| 695 | Ga0207683_11783227 | 3300026121 | Bacteria | 565 |
| 696 | Ga0207698_10914614 | 3300026142 | Bacteria | 885 |
| 697 | Ga0207698_11117337 | 3300026142 | Bacteria | 801 |
| 698 | Ga0207698_11238304 | 3300026142 | Bacteria | 760 |
| 699 | Ga0209999_1078874 | 3300027543 | Unclassified | 634 |
| 700 | Ga0210002_1039797 | 3300027617 | Bacteria | 797 |
| 701 | Ga0209974_10013867 | 3300027876 | Bacteria | 2685 |
| 702 | Ga0209974_10063137 | 3300027876 | Bacteria | 1256 |
| 703 | Ga0209974_10066431 | 3300027876 | Bacteria | 1225 |
| 704 | Ga0207428_10000690 | 3300027907 | Bacteria | 39183 |
| 705 | Ga0207428_10003602 | 3300027907 | Bacteria | 14959 |
| 706 | Ga0207428_10006364 | 3300027907 | Bacteria | 10922 |
| 707 | Ga0207428_10007135 | 3300027907 | Bacteria | 10222 |
| 708 | Ga0207428_10047890 | 3300027907 | Bacteria | 3432 |
| 709 | Ga0207428_10232302 | 3300027907 | Bacteria | 1380 |
| 710 | Ga0207428_10286830 | 3300027907 | Bacteria | 1221 |
| 711 | Ga0207428_10330353 | 3300027907 | Bacteria | 1124 |
| 712 | Ga0207428_10333215 | 3300027907 | Unclassified | 1119 |
| 713 | Ga0207428_10769437 | 3300027907 | Unclassified | 685 |
| 714 | Ga0268266_10377133 | 3300028379 | Bacteria | 1337 |
| 715 | Ga0268265_10283603 | 3300028380 | Bacteria | 1483 |
| 716 | Ga0268265_10314010 | 3300028380 | Bacteria | 1416 |
| 717 | Ga0268265_10461428 | 3300028380 | Bacteria | 1189 |
| 718 | Ga0268265_11624661 | 3300028380 | Unclassified | 651 |
| 719 | Ga0268265_12218439 | 3300028380 | Unclassified | 556 |
| 720 | Ga0268265_12636490 | 3300028380 | Bacteria | 508 |
| 721 | Ga0268264_10135603 | 3300028381 | Bacteria | 2188 |
| 722 | Ga0268264_10173986 | 3300028381 | Bacteria | 1950 |
| 723 | Ga0268264_10241736 | 3300028381 | Bacteria | 1673 |
| 724 | Ga0268264_10262106 | 3300028381 | Bacteria | 1611 |
| 725 | Ga0268264_10383459 | 3300028381 | Bacteria | 1346 |
| 726 | Ga0268264_11214925 | 3300028381 | Bacteria | 763 |
| 727 | Ga0268264_11552364 | 3300028381 | Bacteria | 673 |
| 728 | Ga0307408_100005337 | 3300031548 | Bacteria | 8608 |
| 729 | Ga0307408_100131640 | 3300031548 | Bacteria | 1952 |
| 730 | Ga0307408_100856354 | 3300031548 | Bacteria | 829 |
| 731 | Ga0307408_101727238 | 3300031548 | Unclassified | 597 |
| 732 | Ga0307405_10004965 | 3300031731 | Bacteria | 6355 |
| 733 | Ga0307405_10006136 | 3300031731 | Bacteria | 5884 |
| 734 | Ga0307405_10110521 | 3300031731 | Bacteria | 1861 |
| 735 | Ga0307405_10195963 | 3300031731 | Bacteria | 1463 |
| 736 | Ga0307413_10041777 | 3300031824 | Bacteria | 2688 |
| 737 | Ga0307413_10246706 | 3300031824 | Bacteria | 1322 |
| 738 | Ga0307410_10001041 | 3300031852 | Bacteria | 12033 |
| 739 | Ga0307410_10030463 | 3300031852 | Bacteria | 3449 |
| 740 | Ga0307410_10172661 | 3300031852 | Bacteria | 1630 |
| 741 | Ga0307410_10296611 | 3300031852 | Bacteria | 1274 |
| 742 | Ga0307410_10326807 | 3300031852 | Bacteria | 1219 |
| 743 | Ga0307406_10011560 | 3300031901 | Bacteria | 5016 |
| 744 | Ga0307406_10023602 | 3300031901 | Bacteria | 3662 |
| 745 | Ga0307406_10448903 | 3300031901 | Bacteria | 1034 |
| 746 | Ga0307407_10002185 | 3300031903 | Bacteria | 7538 |
| 747 | Ga0307407_10006683 | 3300031903 | Bacteria | 5156 |
| 748 | Ga0307407_10008661 | 3300031903 | Bacteria | 4685 |
| 749 | Ga0307407_10616850 | 3300031903 | Bacteria | 809 |
| 750 | Ga0307407_10653161 | 3300031903 | Unclassified | 788 |
| 751 | Ga0307412_10006626 | 3300031911 | Bacteria | 6562 |
| 752 | Ga0307412_10019036 | 3300031911 | Bacteria | 4147 |
| 753 | Ga0307412_10085240 | 3300031911 | Bacteria | 2195 |
| 754 | Ga0307412_10285258 | 3300031911 | Bacteria | 1298 |
| 755 | Ga0307409_100005560 | 3300031995 | Bacteria | 7279 |
| 756 | Ga0307409_100027658 | 3300031995 | Bacteria | 4024 |
| 757 | Ga0307409_100096351 | 3300031995 | Bacteria | 2440 |
| 758 | Ga0307409_100227714 | 3300031995 | Bacteria | 1687 |
| 759 | Ga0307409_102302079 | 3300031995 | Unclassified | 568 |
| 760 | Ga0307409_102441834 | 3300031995 | Bacteria | 552 |
| 761 | Ga0307416_100007599 | 3300032002 | Bacteria | 6912 |
| 762 | Ga0307416_100012407 | 3300032002 | Bacteria | 5741 |
| 763 | Ga0307416_100020499 | 3300032002 | Bacteria | 4720 |
| 764 | Ga0307416_100278820 | 3300032002 | Bacteria | 1647 |
| 765 | Ga0307416_100305556 | 3300032002 | Bacteria | 1584 |
| 766 | Ga0307416_100834867 | 3300032002 | Bacteria | 1019 |
| 767 | Ga0307416_101060604 | 3300032002 | Bacteria | 914 |
| 768 | Ga0307416_101554435 | 3300032002 | Bacteria | 767 |
| 769 | Ga0307414_10023679 | 3300032004 | Bacteria | 3900 |
| 770 | Ga0307414_10050145 | 3300032004 | Bacteria | 2890 |
| 771 | Ga0307414_10066944 | 3300032004 | Bacteria | 2570 |
| 772 | Ga0307414_10158817 | 3300032004 | Bacteria | 1793 |
| 773 | Ga0307411_10003369 | 3300032005 | Bacteria | 7402 |
| 774 | Ga0307411_10018126 | 3300032005 | Bacteria | 4031 |
| 775 | Ga0307411_10024943 | 3300032005 | Bacteria | 3573 |
| 776 | Ga0307411_10048122 | 3300032005 | Bacteria | 2762 |
| 777 | Ga0307411_10388768 | 3300032005 | Bacteria | 1150 |
| 778 | Ga0307411_10567011 | 3300032005 | Bacteria | 971 |
| 779 | Ga0307415_100012041 | 3300032126 | Bacteria | 4984 |
| 780 | Ga0307415_100087789 | 3300032126 | Bacteria | 2242 |
| 781 | Ga0307415_101113346 | 3300032126 | Bacteria | 740 |
| 782 | Ga0307415_101417589 | 3300032126 | Unclassified | 662 |
| 783 | Ga0373932_0184177 | 3300035112 | Unclassified | 734 |
| 784 | Ga0373960_0350446 | 3300035121 | Bacteria | 560 |
| 785 | Ga0373961_0096490 | 3300035241 | Bacteria | 952 |
| 786 | Ga0373931_0360102 | 3300035691 | Unclassified | 913 |
| 787 | Ga0439439_0030271 | 3300041406 | Bacteria | 1376 |
| 788 | Ga0439453_0003587 | 3300041408 | Bacteria | 2243 |
| 789 | Ga0451795_1213003 | 3300041456 | Bacteria | 726 |
| 790 | Ga0439433_0040335 | 3300041999 | Bacteria | 1086 |
| 791 | Ga0439433_0213453 | 3300041999 | Unclassified | 513 |
| 792 | Ga0439443_036869 | 3300042003 | Bacteria | 824 |
| 793 | Ga0439443_045458 | 3300042003 | Unclassified | 758 |
| 794 | Ga0439450_027769 | 3300042008 | Unclassified | 1255 |
| 795 | Ga0439456_068446 | 3300042013 | Bacteria | 785 |
| 796 | Ga0439457_039011 | 3300042014 | Bacteria | 1057 |
| 797 | Ga0450920_067381 | 3300042122 | Bacteria | 726 |
| 798 | Ga0450920_083914 | 3300042122 | Unclassified | 654 |
| 799 | Ga0450890_088259 | 3300042127 | Unclassified | 512 |
| 800 | Ga0450894_006981 | 3300042131 | Bacteria | 1456 |
| 801 | Ga0439446_0195039 | 3300042156 | Unclassified | 682 |
| 802 | Ga0439434_0038168 | 3300042435 | Bacteria | 1472 |
| 803 | Ga0439434_0330459 | 3300042435 | Unclassified | 530 |
| 804 | Ga0439435_0049424 | 3300042436 | Bacteria | 1200 |
| 805 | Ga0439435_0098848 | 3300042436 | Unclassified | 895 |
| 806 | Ga0439444_0050498 | 3300042437 | Bacteria | 844 |
| 807 | Ga0439464_0031568 | 3300042439 | Bacteria | 1487 |
| 808 | Ga0439464_0078464 | 3300042439 | Bacteria | 984 |
| 809 | Ga0439460_0129669 | 3300042461 | Bacteria | 830 |
| 810 | Ga0450916_006011 | 3300042530 | Bacteria | 1418 |
| 811 | Ga0439440_0120505 | 3300042993 | Unclassified | 730 |
| 812 | Ga0453683_0758109 | 3300044673 | Unclassified | 638 |
| 813 | Ga0466963_0473724 | 3300044694 | Bacteria | 884 |
| 814 | Ga0466964_0865252 | 3300044706 | Bacteria | 515 |
| 815 | Ga0451576_0519841 | 3300045051 | Bacteria | 1250 |
| 816 | Ga0451576_0587816 | 3300045051 | Bacteria | 1170 |
| 817 | Ga0466967_0230110 | 3300045976 | Bacteria | 1765 |
| 818 | Ga0495584_0034244 | 3300046491 | Unclassified | 2570 |
| 819 | Ga0495594_0065323 | 3300046499 | Bacteria | 2018 |
| 820 | Ga0495598_0070578 | 3300046537 | Bacteria | 1099 |
| 821 | Ga0495598_0113047 | 3300046537 | Unclassified | 912 |
| 822 | Ga0495598_0138449 | 3300046537 | Unclassified | 840 |
| 823 | Ga0495621_0420692 | 3300046539 | Unclassified | 569 |
| 824 | Ga0495656_0006702 | 3300046615 | Bacteria | 4043 |
| 825 | Ga0495636_0698195 | 3300047318 | Unclassified | 501 |
| 826 | Ga0495677_0353738 | 3300047445 | Unclassified | 580 |
| 827 | Ga0496103_0594593 | 3300048906 | Bacteria | 705 |
| 828 | Ga0496108_0720673 | 3300048911 | Bacteria | 864 |
| 829 | Ga0496108_0854356 | 3300048911 | Unclassified | 783 |
| 830 | Ga0496108_1496146 | 3300048911 | Bacteria | 562 |
| 831 | Ga0496109_0110924 | 3300048912 | Bacteria | 2551 |
| 832 | Ga0496109_0129207 | 3300048912 | Bacteria | 2357 |
| 833 | Ga0496109_0235737 | 3300048912 | Bacteria | 1722 |
| 834 | Ga0496111_0470664 | 3300048914 | Bacteria | 926 |
| 835 | Ga0496112_0176680 | 3300048915 | Bacteria | 2100 |
| 836 | Ga0496113_0049179 | 3300048916 | Bacteria | 3139 |
| 837 | Ga0496113_0508867 | 3300048916 | Unclassified | 967 |
| 838 | Ga0496114_0127115 | 3300048917 | Bacteria | 2198 |
| 839 | Ga0501291_071558 | 3300049514 | Bacteria | 673 |
| 840 | Ga0501292_027441 | 3300049515 | Bacteria | 944 |
| 841 | Ga0501299_066872 | 3300049522 | Unclassified | 772 |
| 842 | Ga0501031_0451062 | 3300049568 | Bacteria | 831 |
| 843 | Ga0501033_0556441 | 3300049570 | Bacteria | 790 |
| 844 | Ga0501036_0051933 | 3300049572 | Bacteria | 3472 |
| 845 | Ga0501036_0126418 | 3300049572 | Bacteria | 2159 |
| 846 | Ga0501038_1218417 | 3300049574 | Bacteria | 546 |
| 847 | Ga0501039_0016762 | 3300049575 | Bacteria | 5615 |
| 848 | Ga0501039_0120454 | 3300049575 | Bacteria | 2056 |
| 849 | Ga0501040_0357532 | 3300049576 | Unclassified | 1046 |
| 850 | Ga0501041_0002498 | 3300049577 | Bacteria | 10468 |
| 851 | Ga0501041_0002879 | 3300049577 | Bacteria | 9851 |
| 852 | Ga0501041_0590124 | 3300049577 | Bacteria | 709 |
| 853 | Ga0501042_0011677 | 3300049578 | Bacteria | 5934 |
| 854 | Ga0501042_0025943 | 3300049578 | Bacteria | 4118 |
| 855 | Ga0501042_0791502 | 3300049578 | Bacteria | 690 |
| 856 | Ga0501046_0189929 | 3300049580 | Bacteria | 1533 |
| 857 | Ga0501048_0617519 | 3300049582 | Unclassified | 778 |
| 858 | Ga0501068_0663943 | 3300049584 | Unclassified | 681 |
| 859 | Ga0501070_0818211 | 3300049586 | Bacteria | 731 |
| 860 | Ga0501071_0177634 | 3300049587 | Bacteria | 1595 |
| 861 | Ga0501071_0440219 | 3300049587 | Bacteria | 997 |
| 862 | Ga0501071_0728274 | 3300049587 | Bacteria | 764 |
| 863 | Ga0501074_0822061 | 3300049590 | Unclassified | 654 |
| 864 | Ga0501075_0128948 | 3300049591 | Bacteria | 1926 |
| 865 | Ga0501075_0365637 | 3300049591 | Bacteria | 1100 |
| 866 | Ga0501076_0011199 | 3300049592 | Bacteria | 6676 |
| 867 | Ga0501076_1513172 | 3300049592 | Unclassified | 551 |
| 868 | Ga0501076_1659453 | 3300049592 | Unclassified | 524 |
| 869 | Ga0501077_0057339 | 3300049593 | Bacteria | 2473 |
| 870 | Ga0501077_0094148 | 3300049593 | Bacteria | 1899 |
| 871 | Ga0501077_0407901 | 3300049593 | Bacteria | 869 |
| 872 | Ga0501202_059244 | 3300049652 | Unclassified | 862 |
| 873 | Ga0501257_056364 | 3300049686 | Bacteria | 987 |
| 874 | Ga0501258_042547 | 3300049687 | Unclassified | 611 |
| 875 | Ga0501221_198029 | 3300049704 | Unclassified | 557 |
| 876 | Ga0501079_0053734 | 3300049741 | Bacteria | 3107 |
| 877 | Ga0501079_0232707 | 3300049741 | Bacteria | 1439 |
| 878 | Ga0501079_0978269 | 3300049741 | Unclassified | 666 |
| 879 | Ga0501080_0273987 | 3300049742 | Bacteria | 1535 |
| 880 | Ga0501081_0011798 | 3300049743 | Bacteria | 5724 |
| 881 | Ga0501081_0034579 | 3300049743 | Bacteria | 3439 |
| 882 | Ga0501083_0595102 | 3300049744 | Bacteria | 720 |
| 883 | Ga0501265_059244 | 3300049762 | Unclassified | 621 |
| 884 | Ga0501274_044320 | 3300049771 | Unclassified | 542 |
| 885 | Ga0501035_0945422 | 3300049822 | Unclassified | 680 |
| 886 | Ga0501045_0263942 | 3300049824 | Bacteria | 1282 |
| 887 | Ga0501045_0862712 | 3300049824 | Bacteria | 666 |
| 888 | nmdc:mga05p37_1149796_c1 | 3300050507 | Bacteria | 807 |
| 889 | nmdc:mga05p37_1775854_c1 | 3300050507 | Unclassified | 597 |
| 890 | nmdc:mga05p37_277213_c1 | 3300050507 | Bacteria | 2001 |
| 891 | nmdc:mga05p37_62008_c1 | 3300050507 | Bacteria | 4602 |
| 892 | nmdc:mga05p37_62595_c1 | 3300050507 | Bacteria | 4579 |
| 893 | nmdc:mga05p37_6472_c1 | 3300050507 | Bacteria | 13815 |
| 894 | nmdc:mga05p37_68721_c1 | 3300050507 | Bacteria | 4357 |
| 895 | nmdc:mga05p37_717761_c1 | 3300050507 | Bacteria | 1108 |
| 896 | nmdc:mga05p37_7428_c1 | 3300050507 | Bacteria | 12930 |
| 897 | nmdc:mga05p37_78942_c1 | 3300050507 | Bacteria | 4053 |
| 898 | nmdc:mga05p37_93689_c1 | 3300050507 | Bacteria | 3701 |
| 899 | nmdc:mga05p37_954583_c1 | 3300050507 | Unclassified | 917 |
| 900 | nmdc:mga09592_159989_c1 | 3300050508 | Bacteria | 1945 |
| 901 | nmdc:mga09592_204154_c1 | 3300050508 | Bacteria | 1712 |
| 902 | nmdc:mga09592_20748_c1 | 3300050508 | Bacteria | 5407 |
| 903 | nmdc:mga09592_24473_c1 | 3300050508 | Bacteria | 4994 |
| 904 | nmdc:mga09592_287129_c1 | 3300050508 | Bacteria | 1427 |
| 905 | nmdc:mga09592_296869_c1 | 3300050508 | Bacteria | 1401 |
| 906 | nmdc:mga09592_3707_c1 | 3300050508 | Bacteria | 12320 |
| 907 | nmdc:mga09592_41340_c1 | 3300050508 | Bacteria | 3876 |
| 908 | nmdc:mga09592_4664_c1 | 3300050508 | Bacteria | 11097 |
| 909 | nmdc:mga09592_6060_c1 | 3300050508 | Bacteria | 9857 |
| 910 | nmdc:mga09592_704253_c1 | 3300050508 | Unclassified | 859 |
| 911 | nmdc:mga09592_761574_c1 | 3300050508 | Bacteria | 821 |
| 912 | nmdc:mga09592_771136_c1 | 3300050508 | Unclassified | 815 |
| 913 | nmdc:mga0qj67_1127171_c1 | 3300050509 | Bacteria | 612 |
| 914 | nmdc:mga0qj67_14220_c1 | 3300050509 | Bacteria | 6015 |
| 915 | nmdc:mga0qj67_144399_c1 | 3300050509 | Bacteria | 1930 |
| 916 | nmdc:mga0qj67_161722_c1 | 3300050509 | Bacteria | 1817 |
| 917 | nmdc:mga0qj67_2106_c1 | 3300050509 | Bacteria | 14178 |
| 918 | nmdc:mga0qj67_2598_c1 | 3300050509 | Bacteria | 12929 |
| 919 | nmdc:mga0qj67_260352_c1 | 3300050509 | Bacteria | 1407 |
| 920 | nmdc:mga0qj67_288054_c1 | 3300050509 | Bacteria | 1331 |
| 921 | nmdc:mga0qj67_41459_c1 | 3300050509 | Bacteria | 3621 |
| 922 | nmdc:mga0qj67_57517_c1 | 3300050509 | Bacteria | 3082 |
| 923 | nmdc:mga0qj67_808670_c1 | 3300050509 | Unclassified | 742 |
| 924 | nmdc:mga0qj67_8509_c1 | 3300050509 | Bacteria | 7613 |
| 925 | nmdc:mga0qj67_942996_c1 | 3300050509 | Unclassified | 679 |
| 926 | nmdc:mga06r32_10914_c1 | 3300050510 | Bacteria | 8179 |
| 927 | nmdc:mga06r32_13698_c1 | 3300050510 | Bacteria | 7355 |
| 928 | nmdc:mga06r32_18593_c1 | 3300050510 | Bacteria | 6365 |
| 929 | nmdc:mga06r32_192768_c1 | 3300050510 | Bacteria | 2025 |
| 930 | nmdc:mga06r32_4912_c1 | 3300050510 | Bacteria | 12044 |
| 931 | nmdc:mga06r32_576955_c1 | 3300050510 | Unclassified | 1097 |
| 932 | nmdc:mga06r32_722755_c1 | 3300050510 | Bacteria | 960 |
| 933 | nmdc:mga06r32_93975_c1 | 3300050510 | Bacteria | 2934 |
| 934 | nmdc:mga08y16_105_c1 | 3300050511 | Bacteria | 70187 |
| 935 | nmdc:mga08y16_18317_c1 | 3300050511 | Bacteria | 7378 |
| 936 | nmdc:mga08y16_190078_c1 | 3300050511 | Bacteria | 2130 |
| 937 | nmdc:mga08y16_1992_c1 | 3300050511 | Bacteria | 20862 |
| 938 | nmdc:mga08y16_2433_c2 | 3300050511 | Bacteria | 16697 |
| 939 | nmdc:mga08y16_298447_c1 | 3300050511 | Bacteria | 1661 |
| 940 | nmdc:mga08y16_33645_c1 | 3300050511 | Bacteria | 5382 |
| 941 | nmdc:mga08y16_360075_c1 | 3300050511 | Bacteria | 1493 |
| 942 | nmdc:mga08y16_48497_c1 | 3300050511 | Bacteria | 4445 |
| 943 | nmdc:mga08y16_727661_c1 | 3300050511 | Unclassified | 990 |
| 944 | nmdc:mga0n895_10056_c1 | 3300050512 | Bacteria | 8325 |
| 945 | nmdc:mga0n895_194937_c1 | 3300050512 | Bacteria | 2057 |
| 946 | nmdc:mga0n895_222478_c1 | 3300050512 | Bacteria | 1916 |
| 947 | nmdc:mga0n895_2345_c1 | 3300050512 | Bacteria | 14753 |
| 948 | nmdc:mga0n895_318942_c1 | 3300050512 | Bacteria | 1575 |
| 949 | nmdc:mga0n895_389882_c1 | 3300050512 | Bacteria | 1409 |
| 950 | nmdc:mga0n895_65296_c1 | 3300050512 | Bacteria | 3602 |
| 951 | nmdc:mga0n895_7550_c1 | 3300050512 | Bacteria | 9346 |
| 952 | nmdc:mga0n895_77955_c1 | 3300050512 | Bacteria | 3297 |
| 953 | nmdc:mga0n895_975192_c1 | 3300050512 | Unclassified | 830 |
| 954 | nmdc:mga0rr50_1349105_c1 | 3300050513 | Bacteria | 604 |
| 955 | nmdc:mga0rr50_272559_c1 | 3300050513 | Bacteria | 1411 |
| 956 | nmdc:mga0rr50_477152_c1 | 3300050513 | Bacteria | 1059 |
| 957 | nmdc:mga0rr50_50304_c1 | 3300050513 | Bacteria | 3088 |
| 958 | nmdc:mga08x19_228297_c1 | 3300050514 | Bacteria | 1281 |
| 959 | nmdc:mga08x19_47535_c1 | 3300050514 | Bacteria | 2747 |
| 960 | nmdc:mga0a205_1093_c1 | 3300050515 | Bacteria | 22518 |
| 961 | nmdc:mga0a205_11081_c1 | 3300050515 | Bacteria | 8296 |
| 962 | nmdc:mga0a205_1517634_c1 | 3300050515 | Bacteria | 518 |
| 963 | nmdc:mga0a205_20268_c1 | 3300050515 | Bacteria | 6272 |
| 964 | nmdc:mga0a205_51408_c1 | 3300050515 | Bacteria | 3978 |
| 965 | nmdc:mga0a205_547441_c1 | 3300050515 | Bacteria | 1012 |
| 966 | nmdc:mga0a205_721735_c1 | 3300050515 | Bacteria | 846 |
| 967 | nmdc:mga0a205_72556_c1 | 3300050515 | Bacteria | 3326 |
| 968 | nmdc:mga0a205_8089_c1 | 3300050515 | Bacteria | 9558 |
| 969 | Ga0501084_0023342 | 3300054114 | Bacteria | 5163 |
| 970 | Ga0501084_0044676 | 3300054114 | Bacteria | 3709 |
| 971 | Ga0590077_155665 | 3300059426 | Unclassified | 548 |
| 972 | Ga0587106_109685 | 3300059605 | Unclassified | 573 |
| 973 | Ga0501082_0075363 | 3300060353 | Bacteria | 2907 |
| 974 | Ga0530510_0003783 | 3300061734 | Bacteria | 10422 |
| 975 | Ga0530510_0279412 | 3300061734 | Bacteria | 1247 |
| 976 | Ga0530510_0839787 | 3300061734 | Unclassified | 701 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032002 | Ga0307416_101554435 | Ga0307416_1015544351 | 93 |
| 2 | 3300005290 | Ga0065712_10074468 | Ga0065712_100744683 | 95 |
| 3 | 3300005293 | Ga0065715_10071301 | Ga0065715_100713011 | 95 |
| 4 | 3300005340 | Ga0070689_101957773 | Ga0070689_1019577731 | 95 |
| 5 | 3300005355 | Ga0070671_100724560 | Ga0070671_1007245601 | 95 |
| 6 | 3300005364 | Ga0070673_100178201 | Ga0070673_1001782012 | 95 |
| 7 | 3300006852 | Ga0075433_10455126 | Ga0075433_104551262 | 95 |
| 8 | 3300006871 | Ga0075434_100160283 | Ga0075434_1001602832 | 95 |
| 9 | 3300025315 | Ga0207697_10316673 | Ga0207697_103166732 | 95 |
| 10 | 3300025918 | Ga0207662_10129759 | Ga0207662_101297592 | 95 |
| 11 | 3300025940 | Ga0207691_10937716 | Ga0207691_109377161 | 95 |
| 12 | 3300035241 | Ga0373961_0096490 | Ga0373961_0096490_278_616 | 95 |
| 13 | 3300048912 | Ga0496109_0129207 | Ga0496109_0129207_650_988 | 95 |
| 14 | 3300048914 | Ga0496111_0470664 | Ga0496111_0470664_424_762 | 95 |
| 15 | 3300050512 | nmdc:mga0n895_222478_c1 | nmdc:mga0n895_222478_c1_914_1252 | 95 |
| 16 | 3300050515 | nmdc:mga0a205_547441_c1 | nmdc:mga0a205_547441_c1_265_603 | 95 |
| 17 | 3300025931 | Ga0207644_11118781 | Ga0207644_111187812 | 96 |
| 18 | 3300005617 | Ga0068859_100285022 | Ga0068859_1002850222 | 97 |
| 19 | 3300005841 | Ga0068863_101079771 | Ga0068863_1010797711 | 97 |
| 20 | 3300005842 | Ga0068858_100073462 | Ga0068858_1000734622 | 97 |
| 21 | 3300005844 | Ga0068862_100806812 | Ga0068862_1008068121 | 97 |
| 22 | 3300006931 | Ga0097620_100285032 | Ga0097620_1002850322 | 97 |
| 23 | 3300013297 | Ga0157378_11536325 | Ga0157378_115363252 | 97 |
| 24 | 3300014325 | Ga0163163_10078874 | Ga0163163_100788743 | 97 |
| 25 | 3300014968 | Ga0157379_10005539 | Ga0157379_100055395 | 97 |
| 26 | 3300025986 | Ga0207658_11962727 | Ga0207658_119627271 | 97 |
| 27 | 3300026088 | Ga0207641_11226263 | Ga0207641_112262631 | 97 |
| 28 | 3300028380 | Ga0268265_12636490 | Ga0268265_126364901 | 97 |
| 29 | 3300048917 | Ga0496114_0127115 | Ga0496114_0127115_1663_2013 | 97 |
| 30 | 3300002459 | JGI24751J29686_10063087 | JGI24751J29686_100630871 | 99 |
| 31 | 3300005288 | Ga0065714_10085582 | Ga0065714_100855822 | 99 |
| 32 | 3300005293 | Ga0065715_10156526 | Ga0065715_101565262 | 99 |
| 33 | 3300005330 | Ga0070690_100195332 | Ga0070690_1001953322 | 99 |
| 34 | 3300005331 | Ga0070670_100006795 | Ga0070670_1000067956 | 99 |
| 35 | 3300005333 | Ga0070677_10355963 | Ga0070677_103559632 | 99 |
| 36 | 3300005340 | Ga0070689_100013831 | Ga0070689_1000138314 | 99 |
| 37 | 3300005343 | Ga0070687_100149692 | Ga0070687_1001496922 | 99 |
| 38 | 3300005347 | Ga0070668_100171496 | Ga0070668_1001714962 | 99 |
| 39 | 3300005353 | Ga0070669_100094522 | Ga0070669_1000945222 | 99 |
| 40 | 3300005354 | Ga0070675_100031699 | Ga0070675_1000316994 | 99 |
| 41 | 3300005364 | Ga0070673_100058219 | Ga0070673_1000582193 | 99 |
| 42 | 3300005440 | Ga0070705_101177031 | Ga0070705_1011770311 | 99 |
| 43 | 3300005456 | Ga0070678_102237483 | Ga0070678_1022374831 | 99 |
| 44 | 3300005457 | Ga0070662_100089007 | Ga0070662_1000890073 | 99 |
| 45 | 3300005466 | Ga0070685_10140010 | Ga0070685_101400102 | 99 |
| 46 | 3300005468 | Ga0070707_100649286 | Ga0070707_1006492862 | 99 |
| 47 | 3300005543 | Ga0070672_100239578 | Ga0070672_1002395782 | 99 |
| 48 | 3300005549 | Ga0070704_100129380 | Ga0070704_1001293802 | 99 |
| 49 | 3300005564 | Ga0070664_100153819 | Ga0070664_1001538192 | 99 |
| 50 | 3300005577 | Ga0068857_100094387 | Ga0068857_1000943872 | 99 |
| 51 | 3300005578 | Ga0068854_101212023 | Ga0068854_1012120232 | 99 |
| 52 | 3300005615 | Ga0070702_100602296 | Ga0070702_1006022962 | 99 |
| 53 | 3300005617 | Ga0068859_100031700 | Ga0068859_1000317002 | 99 |
| 54 | 3300005618 | Ga0068864_100013736 | Ga0068864_1000137362 | 99 |
| 55 | 3300005840 | Ga0068870_10500800 | Ga0068870_105008002 | 99 |
| 56 | 3300005841 | Ga0068863_100079308 | Ga0068863_1000793082 | 99 |
| 57 | 3300005842 | Ga0068858_100090118 | Ga0068858_1000901182 | 99 |
| 58 | 3300005843 | Ga0068860_100309486 | Ga0068860_1003094862 | 99 |
| 59 | 3300005844 | Ga0068862_100084833 | Ga0068862_1000848332 | 99 |
| 60 | 3300006880 | Ga0075429_100315394 | Ga0075429_1003153942 | 99 |
| 61 | 3300006881 | Ga0068865_100132505 | Ga0068865_1001325052 | 99 |
| 62 | 3300006931 | Ga0097620_100031701 | Ga0097620_1000317012 | 99 |
| 63 | 3300013308 | Ga0157375_10896538 | Ga0157375_108965382 | 99 |
| 64 | 3300014325 | Ga0163163_10022722 | Ga0163163_100227226 | 99 |
| 65 | 3300025315 | Ga0207697_10100323 | Ga0207697_101003232 | 99 |
| 66 | 3300025918 | Ga0207662_10161409 | Ga0207662_101614092 | 99 |
| 67 | 3300025923 | Ga0207681_10088080 | Ga0207681_100880802 | 99 |
| 68 | 3300025925 | Ga0207650_10008408 | Ga0207650_100084082 | 99 |
| 69 | 3300025926 | Ga0207659_10016839 | Ga0207659_100168394 | 99 |
| 70 | 3300025933 | Ga0207706_10107569 | Ga0207706_101075691 | 99 |
| 71 | 3300025940 | Ga0207691_10051671 | Ga0207691_100516713 | 99 |
| 72 | 3300025945 | Ga0207679_10268894 | Ga0207679_102688942 | 99 |
| 73 | 3300025960 | Ga0207651_10270489 | Ga0207651_102704891 | 99 |
| 74 | 3300025972 | Ga0207668_10160384 | Ga0207668_101603842 | 99 |
| 75 | 3300025981 | Ga0207640_11130389 | Ga0207640_111303892 | 99 |
| 76 | 3300026088 | Ga0207641_10204287 | Ga0207641_102042872 | 99 |
| 77 | 3300026089 | Ga0207648_11254370 | Ga0207648_112543702 | 99 |
| 78 | 3300026095 | Ga0207676_10038193 | Ga0207676_100381932 | 99 |
| 79 | 3300026116 | Ga0207674_10138458 | Ga0207674_101384583 | 99 |
| 80 | 3300026142 | Ga0207698_11238304 | Ga0207698_112383042 | 99 |
| 81 | 3300028381 | Ga0268264_11552364 | Ga0268264_115523642 | 99 |
| 82 | 3300042122 | Ga0450920_083914 | Ga0450920_083914_275_625 | 99 |
| 83 | 3300049591 | Ga0501075_0365637 | Ga0501075_0365637_405_752 | 99 |
| 84 | 3300050508 | nmdc:mga09592_296869_c1 | nmdc:mga09592_296869_c1_55_438 | 99 |
| 85 | 3300049824 | Ga0501045_0862712 | Ga0501045_0862712_18_368 | 100 |
| 86 | 3300050509 | nmdc:mga0qj67_288054_c1 | nmdc:mga0qj67_288054_c1_371_724 | 100 |
| 87 | 3300005354 | Ga0070675_101232846 | Ga0070675_1012328461 | 102 |
| 88 | 3300014326 | Ga0157380_11440734 | Ga0157380_114407342 | 103 |
| 89 | 3300031852 | Ga0307410_10296611 | Ga0307410_102966112 | 103 |
| 90 | 3300032002 | Ga0307416_100278820 | Ga0307416_1002788202 | 103 |
| 91 | 3300032005 | Ga0307411_10018126 | Ga0307411_100181262 | 103 |
| 92 | 3300049771 | Ga0501274_044320 | Ga0501274_044320_10_321 | 103 |
| 93 | 3300005444 | Ga0070694_101322810 | Ga0070694_1013228102 | 104 |
| 94 | 3300009148 | Ga0105243_11098730 | Ga0105243_110987302 | 104 |
| 95 | 3300014325 | Ga0163163_11314973 | Ga0163163_113149732 | 104 |
| 96 | 3300025926 | Ga0207659_11394337 | Ga0207659_113943372 | 104 |
| 97 | 3300026023 | Ga0207677_10128062 | Ga0207677_101280622 | 104 |
| 98 | 3300035691 | Ga0373931_0360102 | Ga0373931_0360102_432_761 | 104 |
| 99 | 3300042461 | Ga0439460_0129669 | Ga0439460_0129669_103_417 | 104 |
| 100 | 3300050511 | nmdc:mga08y16_360075_c1 | nmdc:mga08y16_360075_c1_386_709 | 104 |
| 101 | 3300050512 | nmdc:mga0n895_975192_c1 | nmdc:mga0n895_975192_c1_14_343 | 104 |
| 102 | 3300031548 | Ga0307408_100005337 | Ga0307408_1000053377 | 105 |
| 103 | 3300031548 | Ga0307408_100856354 | Ga0307408_1008563541 | 105 |
| 104 | 3300031731 | Ga0307405_10004965 | Ga0307405_100049656 | 105 |
| 105 | 3300031731 | Ga0307405_10110521 | Ga0307405_101105212 | 105 |
| 106 | 3300031824 | Ga0307413_10041777 | Ga0307413_100417772 | 105 |
| 107 | 3300031824 | Ga0307413_10246706 | Ga0307413_102467062 | 105 |
| 108 | 3300031852 | Ga0307410_10001041 | Ga0307410_100010413 | 105 |
| 109 | 3300031852 | Ga0307410_10030463 | Ga0307410_100304631 | 105 |
| 110 | 3300031852 | Ga0307410_10172661 | Ga0307410_101726612 | 105 |
| 111 | 3300031901 | Ga0307406_10011560 | Ga0307406_100115602 | 105 |
| 112 | 3300031901 | Ga0307406_10023602 | Ga0307406_100236024 | 105 |
| 113 | 3300031903 | Ga0307407_10002185 | Ga0307407_100021852 | 105 |
| 114 | 3300031903 | Ga0307407_10006683 | Ga0307407_100066833 | 105 |
| 115 | 3300031903 | Ga0307407_10008661 | Ga0307407_100086614 | 105 |
| 116 | 3300031911 | Ga0307412_10006626 | Ga0307412_100066263 | 105 |
| 117 | 3300031911 | Ga0307412_10019036 | Ga0307412_100190362 | 105 |
| 118 | 3300031995 | Ga0307409_100005560 | Ga0307409_1000055606 | 105 |
| 119 | 3300031995 | Ga0307409_100096351 | Ga0307409_1000963512 | 105 |
| 120 | 3300031995 | Ga0307409_100227714 | Ga0307409_1002277142 | 105 |
| 121 | 3300032002 | Ga0307416_100007599 | Ga0307416_1000075992 | 105 |
| 122 | 3300032002 | Ga0307416_100020499 | Ga0307416_1000204994 | 105 |
| 123 | 3300032004 | Ga0307414_10023679 | Ga0307414_100236792 | 105 |
| 124 | 3300032004 | Ga0307414_10050145 | Ga0307414_100501452 | 105 |
| 125 | 3300032004 | Ga0307414_10066944 | Ga0307414_100669443 | 105 |
| 126 | 3300032005 | Ga0307411_10003369 | Ga0307411_100033693 | 105 |
| 127 | 3300032005 | Ga0307411_10048122 | Ga0307411_100481223 | 105 |
| 128 | 3300032126 | Ga0307415_100012041 | Ga0307415_1000120415 | 105 |
| 129 | 3300041999 | Ga0439433_0040335 | Ga0439433_0040335_201_551 | 105 |
| 130 | 3300049522 | Ga0501299_066872 | Ga0501299_066872_287_619 | 105 |
| 131 | 3300049762 | Ga0501265_059244 | Ga0501265_059244_38_370 | 105 |
| 132 | 3300050514 | nmdc:mga08x19_228297_c1 | nmdc:mga08x19_228297_c1_942_1259 | 105 |
| 133 | 3300026067 | Ga0207678_11021847 | Ga0207678_110218472 | 106 |
| 134 | 3300059426 | Ga0590077_155665 | Ga0590077_155665_90_446 | 106 |
| 135 | 3300005345 | Ga0070692_10571464 | Ga0070692_105714642 | 107 |
| 136 | 3300005354 | Ga0070675_100747922 | Ga0070675_1007479222 | 107 |
| 137 | 3300005549 | Ga0070704_100689817 | Ga0070704_1006898172 | 107 |
| 138 | 3300005618 | Ga0068864_101993177 | Ga0068864_1019931772 | 107 |
| 139 | 3300006846 | Ga0075430_100007284 | Ga0075430_1000072843 | 107 |
| 140 | 3300006846 | Ga0075430_100440196 | Ga0075430_1004401962 | 107 |
| 141 | 3300006846 | Ga0075430_100726594 | Ga0075430_1007265942 | 107 |
| 142 | 3300006847 | Ga0075431_100008897 | Ga0075431_1000088974 | 107 |
| 143 | 3300006880 | Ga0075429_100095838 | Ga0075429_1000958382 | 107 |
| 144 | 3300009147 | Ga0114129_10015037 | Ga0114129_100150375 | 107 |
| 145 | 3300025936 | Ga0207670_10254989 | Ga0207670_102549892 | 107 |
| 146 | 3300027907 | Ga0207428_10330353 | Ga0207428_103303532 | 107 |
| 147 | 3300031548 | Ga0307408_100131640 | Ga0307408_1001316402 | 107 |
| 148 | 3300031852 | Ga0307410_10326807 | Ga0307410_103268071 | 107 |
| 149 | 3300031901 | Ga0307406_10448903 | Ga0307406_104489032 | 107 |
| 150 | 3300031911 | Ga0307412_10085240 | Ga0307412_100852403 | 107 |
| 151 | 3300032126 | Ga0307415_100087789 | Ga0307415_1000877892 | 107 |
| 152 | 3300041406 | Ga0439439_0030271 | Ga0439439_0030271_977_1300 | 107 |
| 153 | 3300041456 | Ga0451795_1213003 | Ga0451795_1213003_57_380 | 107 |
| 154 | 3300042013 | Ga0439456_068446 | Ga0439456_068446_280_618 | 107 |
| 155 | 3300042014 | Ga0439457_039011 | Ga0439457_039011_667_990 | 107 |
| 156 | 3300042131 | Ga0450894_006981 | Ga0450894_006981_674_997 | 107 |
| 157 | 3300049586 | Ga0501070_0818211 | Ga0501070_0818211_363_692 | 107 |
| 158 | 3300050507 | nmdc:mga05p37_62008_c1 | nmdc:mga05p37_62008_c1_118_456 | 107 |
| 159 | 3300050507 | nmdc:mga05p37_78942_c1 | nmdc:mga05p37_78942_c1_1107_1430 | 107 |
| 160 | 3300050508 | nmdc:mga09592_41340_c1 | nmdc:mga09592_41340_c1_2854_3192 | 107 |
| 161 | 3300050508 | nmdc:mga09592_6060_c1 | nmdc:mga09592_6060_c1_7040_7363 | 107 |
| 162 | 3300050509 | nmdc:mga0qj67_2598_c1 | nmdc:mga0qj67_2598_c1_7586_7924 | 107 |
| 163 | 3300050509 | nmdc:mga0qj67_260352_c1 | nmdc:mga0qj67_260352_c1_976_1299 | 107 |
| 164 | 3300050510 | nmdc:mga06r32_10914_c1 | nmdc:mga06r32_10914_c1_5269_5607 | 107 |
| 165 | 3300050510 | nmdc:mga06r32_13698_c1 | nmdc:mga06r32_13698_c1_2373_2696 | 107 |
| 166 | 3300050511 | nmdc:mga08y16_190078_c1 | nmdc:mga08y16_190078_c1_591_914 | 107 |
| 167 | 3300050512 | nmdc:mga0n895_2345_c1 | nmdc:mga0n895_2345_c1_3921_4256 | 107 |
| 168 | 3300050513 | nmdc:mga0rr50_50304_c1 | nmdc:mga0rr50_50304_c1_1501_1836 | 107 |
| 169 | 3300005295 | Ga0065707_10177573 | Ga0065707_101775732 | 108 |
| 170 | 3300005295 | Ga0065707_10513075 | Ga0065707_105130752 | 108 |
| 171 | 3300005330 | Ga0070690_100236311 | Ga0070690_1002363111 | 108 |
| 172 | 3300005331 | Ga0070670_100308078 | Ga0070670_1003080782 | 108 |
| 173 | 3300005335 | Ga0070666_10427074 | Ga0070666_104270742 | 108 |
| 174 | 3300005338 | Ga0068868_101184660 | Ga0068868_1011846602 | 108 |
| 175 | 3300005340 | Ga0070689_100496396 | Ga0070689_1004963962 | 108 |
| 176 | 3300005340 | Ga0070689_100622486 | Ga0070689_1006224862 | 108 |
| 177 | 3300005353 | Ga0070669_100348850 | Ga0070669_1003488502 | 108 |
| 178 | 3300005354 | Ga0070675_100054369 | Ga0070675_1000543692 | 108 |
| 179 | 3300005354 | Ga0070675_101161058 | Ga0070675_1011610582 | 108 |
| 180 | 3300005355 | Ga0070671_100411174 | Ga0070671_1004111742 | 108 |
| 181 | 3300005364 | Ga0070673_100227528 | Ga0070673_1002275282 | 108 |
| 182 | 3300005365 | Ga0070688_100132670 | Ga0070688_1001326702 | 108 |
| 183 | 3300005366 | Ga0070659_101696806 | Ga0070659_1016968061 | 108 |
| 184 | 3300005367 | Ga0070667_100231914 | Ga0070667_1002319142 | 108 |
| 185 | 3300005456 | Ga0070678_100195696 | Ga0070678_1001956962 | 108 |
| 186 | 3300005457 | Ga0070662_100175462 | Ga0070662_1001754622 | 108 |
| 187 | 3300005466 | Ga0070685_10189349 | Ga0070685_101893491 | 108 |
| 188 | 3300005466 | Ga0070685_10492493 | Ga0070685_104924932 | 108 |
| 189 | 3300005518 | Ga0070699_100057206 | Ga0070699_1000572062 | 108 |
| 190 | 3300005536 | Ga0070697_100042970 | Ga0070697_1000429703 | 108 |
| 191 | 3300005543 | Ga0070672_100327978 | Ga0070672_1003279782 | 108 |
| 192 | 3300005564 | Ga0070664_100193616 | Ga0070664_1001936162 | 108 |
| 193 | 3300005617 | Ga0068859_100137409 | Ga0068859_1001374092 | 108 |
| 194 | 3300005617 | Ga0068859_100616260 | Ga0068859_1006162602 | 108 |
| 195 | 3300005844 | Ga0068862_100394176 | Ga0068862_1003941761 | 108 |
| 196 | 3300006173 | Ga0070716_100295681 | Ga0070716_1002956812 | 108 |
| 197 | 3300006358 | Ga0068871_100335133 | Ga0068871_1003351332 | 108 |
| 198 | 3300006871 | Ga0075434_100017717 | Ga0075434_1000177173 | 108 |
| 199 | 3300006871 | Ga0075434_100291799 | Ga0075434_1002917992 | 108 |
| 200 | 3300006914 | Ga0075436_100247270 | Ga0075436_1002472702 | 108 |
| 201 | 3300006931 | Ga0097620_100137405 | Ga0097620_1001374052 | 108 |
| 202 | 3300006931 | Ga0097620_100616189 | Ga0097620_1006161892 | 108 |
| 203 | 3300007076 | Ga0075435_100021650 | Ga0075435_1000216505 | 108 |
| 204 | 3300009094 | Ga0111539_10000755 | Ga0111539_1000075523 | 108 |
| 205 | 3300009094 | Ga0111539_10430974 | Ga0111539_104309742 | 108 |
| 206 | 3300009098 | Ga0105245_12828056 | Ga0105245_128280561 | 108 |
| 207 | 3300009147 | Ga0114129_10011461 | Ga0114129_100114612 | 108 |
| 208 | 3300009176 | Ga0105242_12058796 | Ga0105242_120587962 | 108 |
| 209 | 3300009551 | Ga0105238_11290638 | Ga0105238_112906382 | 108 |
| 210 | 3300013297 | Ga0157378_12146722 | Ga0157378_121467221 | 108 |
| 211 | 3300014326 | Ga0157380_12581491 | Ga0157380_125814911 | 108 |
| 212 | 3300014326 | Ga0157380_13531499 | Ga0157380_135314992 | 108 |
| 213 | 3300014745 | Ga0157377_10839215 | Ga0157377_108392152 | 108 |
| 214 | 3300014968 | Ga0157379_10622765 | Ga0157379_106227652 | 108 |
| 215 | 3300025315 | Ga0207697_10425285 | Ga0207697_104252852 | 108 |
| 216 | 3300025893 | Ga0207682_10353181 | Ga0207682_103531812 | 108 |
| 217 | 3300025901 | Ga0207688_10117851 | Ga0207688_101178512 | 108 |
| 218 | 3300025907 | Ga0207645_10071891 | Ga0207645_100718912 | 108 |
| 219 | 3300025923 | Ga0207681_10098151 | Ga0207681_100981512 | 108 |
| 220 | 3300025925 | Ga0207650_10378069 | Ga0207650_103780692 | 108 |
| 221 | 3300025926 | Ga0207659_10246304 | Ga0207659_102463042 | 108 |
| 222 | 3300025934 | Ga0207686_10934872 | Ga0207686_109348722 | 108 |
| 223 | 3300025936 | Ga0207670_10398434 | Ga0207670_103984342 | 108 |
| 224 | 3300025936 | Ga0207670_11038803 | Ga0207670_110388032 | 108 |
| 225 | 3300025937 | Ga0207669_10492500 | Ga0207669_104925002 | 108 |
| 226 | 3300025939 | Ga0207665_10175780 | Ga0207665_101757802 | 108 |
| 227 | 3300025940 | Ga0207691_10051607 | Ga0207691_100516074 | 108 |
| 228 | 3300025942 | Ga0207689_11272182 | Ga0207689_112721821 | 108 |
| 229 | 3300025945 | Ga0207679_10442857 | Ga0207679_104428572 | 108 |
| 230 | 3300025960 | Ga0207651_10183494 | Ga0207651_101834942 | 108 |
| 231 | 3300025981 | Ga0207640_10148930 | Ga0207640_101489302 | 108 |
| 232 | 3300026035 | Ga0207703_10525303 | Ga0207703_105253032 | 108 |
| 233 | 3300026095 | Ga0207676_10452835 | Ga0207676_104528352 | 108 |
| 234 | 3300026121 | Ga0207683_10147538 | Ga0207683_101475382 | 108 |
| 235 | 3300027907 | Ga0207428_10006364 | Ga0207428_100063642 | 108 |
| 236 | 3300027907 | Ga0207428_10232302 | Ga0207428_102323022 | 108 |
| 237 | 3300028380 | Ga0268265_10283603 | Ga0268265_102836032 | 108 |
| 238 | 3300028381 | Ga0268264_10173986 | Ga0268264_101739862 | 108 |
| 239 | 3300032002 | Ga0307416_101060604 | Ga0307416_1010606042 | 108 |
| 240 | 3300041999 | Ga0439433_0213453 | Ga0439433_0213453_123_449 | 108 |
| 241 | 3300044694 | Ga0466963_0473724 | Ga0466963_0473724_156_491 | 108 |
| 242 | 3300045051 | Ga0451576_0587816 | Ga0451576_0587816_209_547 | 108 |
| 243 | 3300048906 | Ga0496103_0594593 | Ga0496103_0594593_347_685 | 108 |
| 244 | 3300048915 | Ga0496112_0176680 | Ga0496112_0176680_670_1008 | 108 |
| 245 | 3300050507 | nmdc:mga05p37_62595_c1 | nmdc:mga05p37_62595_c1_3780_4118 | 108 |
| 246 | 3300050508 | nmdc:mga09592_704253_c1 | nmdc:mga09592_704253_c1_234_578 | 108 |
| 247 | 3300050511 | nmdc:mga08y16_2433_c2 | nmdc:mga08y16_2433_c2_15503_15841 | 108 |
| 248 | 3300050511 | nmdc:mga08y16_48497_c1 | nmdc:mga08y16_48497_c1_3043_3387 | 108 |
| 249 | 3300050512 | nmdc:mga0n895_318942_c1 | nmdc:mga0n895_318942_c1_29_367 | 108 |
| 250 | 3300050514 | nmdc:mga08x19_47535_c1 | nmdc:mga08x19_47535_c1_575_913 | 108 |
| 251 | 3300050515 | nmdc:mga0a205_11081_c1 | nmdc:mga0a205_11081_c1_6088_6426 | 108 |
| 252 | 3300005327 | Ga0070658_10681076 | Ga0070658_106810761 | 109 |
| 253 | 3300005329 | Ga0070683_101058910 | Ga0070683_1010589101 | 109 |
| 254 | 3300005331 | Ga0070670_100372748 | Ga0070670_1003727482 | 109 |
| 255 | 3300005339 | Ga0070660_101829905 | Ga0070660_1018299051 | 109 |
| 256 | 3300005344 | Ga0070661_100284445 | Ga0070661_1002844452 | 109 |
| 257 | 3300005344 | Ga0070661_100434878 | Ga0070661_1004348782 | 109 |
| 258 | 3300005345 | Ga0070692_10314873 | Ga0070692_103148732 | 109 |
| 259 | 3300005353 | Ga0070669_101010391 | Ga0070669_1010103912 | 109 |
| 260 | 3300005354 | Ga0070675_100210327 | Ga0070675_1002103272 | 109 |
| 261 | 3300005354 | Ga0070675_100389407 | Ga0070675_1003894072 | 109 |
| 262 | 3300005354 | Ga0070675_101523782 | Ga0070675_1015237821 | 109 |
| 263 | 3300005356 | Ga0070674_100535233 | Ga0070674_1005352332 | 109 |
| 264 | 3300005364 | Ga0070673_101641790 | Ga0070673_1016417901 | 109 |
| 265 | 3300005366 | Ga0070659_100097397 | Ga0070659_1000973973 | 109 |
| 266 | 3300005366 | Ga0070659_101025996 | Ga0070659_1010259961 | 109 |
| 267 | 3300005366 | Ga0070659_101199739 | Ga0070659_1011997392 | 109 |
| 268 | 3300005456 | Ga0070678_100830645 | Ga0070678_1008306452 | 109 |
| 269 | 3300005457 | Ga0070662_101042959 | Ga0070662_1010429592 | 109 |
| 270 | 3300005458 | Ga0070681_11071047 | Ga0070681_110710472 | 109 |
| 271 | 3300005530 | Ga0070679_101264771 | Ga0070679_1012647711 | 109 |
| 272 | 3300005535 | Ga0070684_100351027 | Ga0070684_1003510272 | 109 |
| 273 | 3300005536 | Ga0070697_100148337 | Ga0070697_1001483372 | 109 |
| 274 | 3300005543 | Ga0070672_100153693 | Ga0070672_1001536931 | 109 |
| 275 | 3300005545 | Ga0070695_100001180 | Ga0070695_1000011803 | 109 |
| 276 | 3300005548 | Ga0070665_102249190 | Ga0070665_1022491902 | 109 |
| 277 | 3300005549 | Ga0070704_100003047 | Ga0070704_10000304710 | 109 |
| 278 | 3300005564 | Ga0070664_100028549 | Ga0070664_1000285494 | 109 |
| 279 | 3300005564 | Ga0070664_100045139 | Ga0070664_1000451393 | 109 |
| 280 | 3300005564 | Ga0070664_101119940 | Ga0070664_1011199402 | 109 |
| 281 | 3300005578 | Ga0068854_102232259 | Ga0068854_1022322591 | 109 |
| 282 | 3300005616 | Ga0068852_101082062 | Ga0068852_1010820622 | 109 |
| 283 | 3300005618 | Ga0068864_100943079 | Ga0068864_1009430791 | 109 |
| 284 | 3300005834 | Ga0068851_10608267 | Ga0068851_106082672 | 109 |
| 285 | 3300005843 | Ga0068860_101379386 | Ga0068860_1013793862 | 109 |
| 286 | 3300006237 | Ga0097621_100860532 | Ga0097621_1008605322 | 109 |
| 287 | 3300006237 | Ga0097621_100879077 | Ga0097621_1008790772 | 109 |
| 288 | 3300006358 | Ga0068871_100431941 | Ga0068871_1004319412 | 109 |
| 289 | 3300006844 | Ga0075428_100055909 | Ga0075428_1000559094 | 109 |
| 290 | 3300006852 | Ga0075433_10065223 | Ga0075433_100652232 | 109 |
| 291 | 3300006880 | Ga0075429_100183248 | Ga0075429_1001832482 | 109 |
| 292 | 3300006881 | Ga0068865_101566687 | Ga0068865_1015666872 | 109 |
| 293 | 3300009098 | Ga0105245_11361450 | Ga0105245_113614502 | 109 |
| 294 | 3300009147 | Ga0114129_10088461 | Ga0114129_100884612 | 109 |
| 295 | 3300009148 | Ga0105243_10489768 | Ga0105243_104897682 | 109 |
| 296 | 3300009176 | Ga0105242_10485248 | Ga0105242_104852482 | 109 |
| 297 | 3300009176 | Ga0105242_10543991 | Ga0105242_105439912 | 109 |
| 298 | 3300009177 | Ga0105248_12497464 | Ga0105248_124974642 | 109 |
| 299 | 3300011119 | Ga0105246_11004191 | Ga0105246_110041911 | 109 |
| 300 | 3300013104 | Ga0157370_10680047 | Ga0157370_106800472 | 109 |
| 301 | 3300013105 | Ga0157369_11790139 | Ga0157369_117901392 | 109 |
| 302 | 3300013296 | Ga0157374_10058009 | Ga0157374_100580092 | 109 |
| 303 | 3300013297 | Ga0157378_11308270 | Ga0157378_113082701 | 109 |
| 304 | 3300013306 | Ga0163162_10594590 | Ga0163162_105945902 | 109 |
| 305 | 3300013308 | Ga0157375_10053871 | Ga0157375_100538714 | 109 |
| 306 | 3300014745 | Ga0157377_10066351 | Ga0157377_100663512 | 109 |
| 307 | 3300014969 | Ga0157376_10146519 | Ga0157376_101465193 | 109 |
| 308 | 3300014969 | Ga0157376_10452981 | Ga0157376_104529811 | 109 |
| 309 | 3300017792 | Ga0163161_10329549 | Ga0163161_103295492 | 109 |
| 310 | 3300025893 | Ga0207682_10513646 | Ga0207682_105136462 | 109 |
| 311 | 3300025910 | Ga0207684_11442527 | Ga0207684_114425271 | 109 |
| 312 | 3300025920 | Ga0207649_10207488 | Ga0207649_102074882 | 109 |
| 313 | 3300025920 | Ga0207649_11285241 | Ga0207649_112852412 | 109 |
| 314 | 3300025922 | Ga0207646_10176874 | Ga0207646_101768742 | 109 |
| 315 | 3300025925 | Ga0207650_10341737 | Ga0207650_103417372 | 109 |
| 316 | 3300025925 | Ga0207650_11314223 | Ga0207650_113142232 | 109 |
| 317 | 3300025926 | Ga0207659_10144191 | Ga0207659_101441912 | 109 |
| 318 | 3300025926 | Ga0207659_10248867 | Ga0207659_102488671 | 109 |
| 319 | 3300025931 | Ga0207644_10662566 | Ga0207644_106625662 | 109 |
| 320 | 3300025932 | Ga0207690_10505589 | Ga0207690_105055891 | 109 |
| 321 | 3300025932 | Ga0207690_10836519 | Ga0207690_108365192 | 109 |
| 322 | 3300025933 | Ga0207706_10351216 | Ga0207706_103512162 | 109 |
| 323 | 3300025933 | Ga0207706_11161877 | Ga0207706_111618772 | 109 |
| 324 | 3300025934 | Ga0207686_10748549 | Ga0207686_107485491 | 109 |
| 325 | 3300025937 | Ga0207669_10366017 | Ga0207669_103660172 | 109 |
| 326 | 3300025938 | Ga0207704_10842829 | Ga0207704_108428292 | 109 |
| 327 | 3300025940 | Ga0207691_10111507 | Ga0207691_101115072 | 109 |
| 328 | 3300025940 | Ga0207691_10302750 | Ga0207691_103027502 | 109 |
| 329 | 3300025945 | Ga0207679_10072733 | Ga0207679_100727331 | 109 |
| 330 | 3300025945 | Ga0207679_10282284 | Ga0207679_102822842 | 109 |
| 331 | 3300025945 | Ga0207679_10853464 | Ga0207679_108534642 | 109 |
| 332 | 3300025986 | Ga0207658_10148154 | Ga0207658_101481542 | 109 |
| 333 | 3300026089 | Ga0207648_10391102 | Ga0207648_103911022 | 109 |
| 334 | 3300026089 | Ga0207648_10568499 | Ga0207648_105684992 | 109 |
| 335 | 3300026095 | Ga0207676_10536862 | Ga0207676_105368622 | 109 |
| 336 | 3300026121 | Ga0207683_10947911 | Ga0207683_109479111 | 109 |
| 337 | 3300026121 | Ga0207683_11783227 | Ga0207683_117832272 | 109 |
| 338 | 3300026142 | Ga0207698_10914614 | Ga0207698_109146142 | 109 |
| 339 | 3300031903 | Ga0307407_10653161 | Ga0307407_106531611 | 109 |
| 340 | 3300031911 | Ga0307412_10285258 | Ga0307412_102852582 | 109 |
| 341 | 3300031995 | Ga0307409_102441834 | Ga0307409_1024418342 | 109 |
| 342 | 3300032126 | Ga0307415_101113346 | Ga0307415_1011133461 | 109 |
| 343 | 3300044706 | Ga0466964_0865252 | Ga0466964_0865252_97_438 | 109 |
| 344 | 3300046499 | Ga0495594_0065323 | Ga0495594_0065323_1458_1787 | 109 |
| 345 | 3300046539 | Ga0495621_0420692 | Ga0495621_0420692_77_406 | 109 |
| 346 | 3300047318 | Ga0495636_0698195 | Ga0495636_0698195_22_372 | 109 |
| 347 | 3300048911 | Ga0496108_1496146 | Ga0496108_1496146_175_504 | 109 |
| 348 | 3300049593 | Ga0501077_0407901 | Ga0501077_0407901_32_376 | 109 |
| 349 | 3300050507 | nmdc:mga05p37_68721_c1 | nmdc:mga05p37_68721_c1_1584_1925 | 109 |
| 350 | 3300061734 | Ga0530510_0839787 | Ga0530510_0839787_83_427 | 109 |
| 351 | 3300005295 | Ga0065707_10294736 | Ga0065707_102947361 | 110 |
| 352 | 3300005334 | Ga0068869_100134140 | Ga0068869_1001341402 | 110 |
| 353 | 3300005365 | Ga0070688_100749471 | Ga0070688_1007494712 | 110 |
| 354 | 3300005367 | Ga0070667_101602042 | Ga0070667_1016020421 | 110 |
| 355 | 3300005435 | Ga0070714_100001653 | Ga0070714_1000016532 | 110 |
| 356 | 3300005458 | Ga0070681_11600664 | Ga0070681_116006642 | 110 |
| 357 | 3300005459 | Ga0068867_100424721 | Ga0068867_1004247212 | 110 |
| 358 | 3300005471 | Ga0070698_101768074 | Ga0070698_1017680741 | 110 |
| 359 | 3300005564 | Ga0070664_100906184 | Ga0070664_1009061842 | 110 |
| 360 | 3300005578 | Ga0068854_100446566 | Ga0068854_1004465662 | 110 |
| 361 | 3300005578 | Ga0068854_100775348 | Ga0068854_1007753481 | 110 |
| 362 | 3300005617 | Ga0068859_100016878 | Ga0068859_1000168786 | 110 |
| 363 | 3300005617 | Ga0068859_100154339 | Ga0068859_1001543392 | 110 |
| 364 | 3300005618 | Ga0068864_100715766 | Ga0068864_1007157662 | 110 |
| 365 | 3300005840 | Ga0068870_10930615 | Ga0068870_109306151 | 110 |
| 366 | 3300005842 | Ga0068858_100408647 | Ga0068858_1004086472 | 110 |
| 367 | 3300005842 | Ga0068858_101026418 | Ga0068858_1010264181 | 110 |
| 368 | 3300005844 | Ga0068862_101846704 | Ga0068862_1018467041 | 110 |
| 369 | 3300006175 | Ga0070712_100334364 | Ga0070712_1003343642 | 110 |
| 370 | 3300006358 | Ga0068871_101319808 | Ga0068871_1013198082 | 110 |
| 371 | 3300006844 | Ga0075428_100062542 | Ga0075428_1000625424 | 110 |
| 372 | 3300006844 | Ga0075428_100109766 | Ga0075428_1001097662 | 110 |
| 373 | 3300006844 | Ga0075428_100412681 | Ga0075428_1004126812 | 110 |
| 374 | 3300006846 | Ga0075430_100016847 | Ga0075430_1000168472 | 110 |
| 375 | 3300006847 | Ga0075431_100126095 | Ga0075431_1001260952 | 110 |
| 376 | 3300006847 | Ga0075431_100627278 | Ga0075431_1006272781 | 110 |
| 377 | 3300006871 | Ga0075434_100584670 | Ga0075434_1005846702 | 110 |
| 378 | 3300006880 | Ga0075429_100025829 | Ga0075429_1000258292 | 110 |
| 379 | 3300006931 | Ga0097620_100016878 | Ga0097620_1000168782 | 110 |
| 380 | 3300006931 | Ga0097620_100154336 | Ga0097620_1001543362 | 110 |
| 381 | 3300009093 | Ga0105240_10152291 | Ga0105240_101522913 | 110 |
| 382 | 3300009093 | Ga0105240_11096188 | Ga0105240_110961882 | 110 |
| 383 | 3300009094 | Ga0111539_10305421 | Ga0111539_103054212 | 110 |
| 384 | 3300009101 | Ga0105247_10042623 | Ga0105247_100426232 | 110 |
| 385 | 3300009101 | Ga0105247_10498168 | Ga0105247_104981682 | 110 |
| 386 | 3300009147 | Ga0114129_10097771 | Ga0114129_100977712 | 110 |
| 387 | 3300009148 | Ga0105243_12091718 | Ga0105243_120917181 | 110 |
| 388 | 3300009177 | Ga0105248_10381767 | Ga0105248_103817672 | 110 |
| 389 | 3300009545 | Ga0105237_12785171 | Ga0105237_127851711 | 110 |
| 390 | 3300009553 | Ga0105249_10709139 | Ga0105249_107091392 | 110 |
| 391 | 3300009553 | Ga0105249_12528720 | Ga0105249_125287201 | 110 |
| 392 | 3300011119 | Ga0105246_10386002 | Ga0105246_103860022 | 110 |
| 393 | 3300013307 | Ga0157372_11157983 | Ga0157372_111579832 | 110 |
| 394 | 3300014325 | Ga0163163_12870914 | Ga0163163_128709141 | 110 |
| 395 | 3300014326 | Ga0157380_10146465 | Ga0157380_101464652 | 110 |
| 396 | 3300014326 | Ga0157380_10547370 | Ga0157380_105473702 | 110 |
| 397 | 3300014968 | Ga0157379_10003064 | Ga0157379_1000306410 | 110 |
| 398 | 3300014968 | Ga0157379_11933437 | Ga0157379_119334371 | 110 |
| 399 | 3300025900 | Ga0207710_10165396 | Ga0207710_101653962 | 110 |
| 400 | 3300025903 | Ga0207680_10530980 | Ga0207680_105309802 | 110 |
| 401 | 3300025913 | Ga0207695_10110371 | Ga0207695_101103712 | 110 |
| 402 | 3300025913 | Ga0207695_10797727 | Ga0207695_107977272 | 110 |
| 403 | 3300025915 | Ga0207693_10381053 | Ga0207693_103810532 | 110 |
| 404 | 3300025929 | Ga0207664_10028758 | Ga0207664_100287584 | 110 |
| 405 | 3300025941 | Ga0207711_10116745 | Ga0207711_101167453 | 110 |
| 406 | 3300025942 | Ga0207689_10164159 | Ga0207689_101641592 | 110 |
| 407 | 3300025961 | Ga0207712_11111695 | Ga0207712_111116952 | 110 |
| 408 | 3300025981 | Ga0207640_10132555 | Ga0207640_101325552 | 110 |
| 409 | 3300025981 | Ga0207640_10857698 | Ga0207640_108576981 | 110 |
| 410 | 3300026023 | Ga0207677_11740030 | Ga0207677_117400302 | 110 |
| 411 | 3300026035 | Ga0207703_10028221 | Ga0207703_100282214 | 110 |
| 412 | 3300026035 | Ga0207703_10290096 | Ga0207703_102900962 | 110 |
| 413 | 3300026089 | Ga0207648_10138033 | Ga0207648_101380332 | 110 |
| 414 | 3300026118 | Ga0207675_100555107 | Ga0207675_1005551072 | 110 |
| 415 | 3300028381 | Ga0268264_10135603 | Ga0268264_101356033 | 110 |
| 416 | 3300028381 | Ga0268264_11214925 | Ga0268264_112149251 | 110 |
| 417 | 3300031548 | Ga0307408_101727238 | Ga0307408_1017272381 | 110 |
| 418 | 3300031731 | Ga0307405_10195963 | Ga0307405_101959632 | 110 |
| 419 | 3300031995 | Ga0307409_102302079 | Ga0307409_1023020791 | 110 |
| 420 | 3300032004 | Ga0307414_10158817 | Ga0307414_101588172 | 110 |
| 421 | 3300032005 | Ga0307411_10024943 | Ga0307411_100249433 | 110 |
| 422 | 3300032126 | Ga0307415_101417589 | Ga0307415_1014175892 | 110 |
| 423 | 3300042003 | Ga0439443_036869 | Ga0439443_036869_115_456 | 110 |
| 424 | 3300042156 | Ga0439446_0195039 | Ga0439446_0195039_109_462 | 110 |
| 425 | 3300042435 | Ga0439434_0330459 | Ga0439434_0330459_167_508 | 110 |
| 426 | 3300044673 | Ga0453683_0758109 | Ga0453683_0758109_84_428 | 110 |
| 427 | 3300045976 | Ga0466967_0230110 | Ga0466967_0230110_943_1287 | 110 |
| 428 | 3300049515 | Ga0501292_027441 | Ga0501292_027441_358_711 | 110 |
| 429 | 3300049568 | Ga0501031_0451062 | Ga0501031_0451062_89_430 | 110 |
| 430 | 3300049570 | Ga0501033_0556441 | Ga0501033_0556441_80_421 | 110 |
| 431 | 3300049572 | Ga0501036_0126418 | Ga0501036_0126418_1210_1551 | 110 |
| 432 | 3300049574 | Ga0501038_1218417 | Ga0501038_1218417_63_404 | 110 |
| 433 | 3300049575 | Ga0501039_0016762 | Ga0501039_0016762_4436_4777 | 110 |
| 434 | 3300049577 | Ga0501041_0002879 | Ga0501041_0002879_5274_5615 | 110 |
| 435 | 3300049578 | Ga0501042_0025943 | Ga0501042_0025943_274_615 | 110 |
| 436 | 3300049580 | Ga0501046_0189929 | Ga0501046_0189929_897_1238 | 110 |
| 437 | 3300049587 | Ga0501071_0177634 | Ga0501071_0177634_825_1166 | 110 |
| 438 | 3300049591 | Ga0501075_0128948 | Ga0501075_0128948_1362_1703 | 110 |
| 439 | 3300049593 | Ga0501077_0057339 | Ga0501077_0057339_1659_2000 | 110 |
| 440 | 3300049686 | Ga0501257_056364 | Ga0501257_056364_202_543 | 110 |
| 441 | 3300049741 | Ga0501079_0053734 | Ga0501079_0053734_646_987 | 110 |
| 442 | 3300049743 | Ga0501081_0034579 | Ga0501081_0034579_2813_3154 | 110 |
| 443 | 3300049822 | Ga0501035_0945422 | Ga0501035_0945422_63_404 | 110 |
| 444 | 3300050507 | nmdc:mga05p37_277213_c1 | nmdc:mga05p37_277213_c1_488_829 | 110 |
| 445 | 3300050508 | nmdc:mga09592_4664_c1 | nmdc:mga09592_4664_c1_6247_6588 | 110 |
| 446 | 3300050509 | nmdc:mga0qj67_2106_c1 | nmdc:mga0qj67_2106_c1_11103_11444 | 110 |
| 447 | 3300050510 | nmdc:mga06r32_18593_c1 | nmdc:mga06r32_18593_c1_1708_2049 | 110 |
| 448 | 3300050510 | nmdc:mga06r32_576955_c1 | nmdc:mga06r32_576955_c1_519_860 | 110 |
| 449 | 3300050511 | nmdc:mga08y16_298447_c1 | nmdc:mga08y16_298447_c1_529_870 | 110 |
| 450 | 3300050512 | nmdc:mga0n895_389882_c1 | nmdc:mga0n895_389882_c1_206_571 | 110 |
| 451 | 3300050515 | nmdc:mga0a205_721735_c1 | nmdc:mga0a205_721735_c1_283_648 | 110 |
| 452 | 3300054114 | Ga0501084_0044676 | Ga0501084_0044676_319_660 | 110 |
| 453 | 3300059605 | Ga0587106_109685 | Ga0587106_109685_95_442 | 110 |
| 454 | 3300061734 | Ga0530510_0003783 | Ga0530510_0003783_8733_9074 | 110 |
| 455 | 3300005329 | Ga0070683_100307950 | Ga0070683_1003079502 | 111 |
| 456 | 3300005340 | Ga0070689_102055714 | Ga0070689_1020557141 | 111 |
| 457 | 3300005354 | Ga0070675_100051531 | Ga0070675_1000515313 | 111 |
| 458 | 3300005364 | Ga0070673_100041539 | Ga0070673_1000415392 | 111 |
| 459 | 3300005365 | Ga0070688_100363799 | Ga0070688_1003637992 | 111 |
| 460 | 3300005544 | Ga0070686_100452164 | Ga0070686_1004521642 | 111 |
| 461 | 3300005564 | Ga0070664_100094627 | Ga0070664_1000946272 | 111 |
| 462 | 3300005985 | Ga0081539_10029084 | Ga0081539_100290842 | 111 |
| 463 | 3300006358 | Ga0068871_100462484 | Ga0068871_1004624841 | 111 |
| 464 | 3300006844 | Ga0075428_100061209 | Ga0075428_1000612091 | 111 |
| 465 | 3300006852 | Ga0075433_10098544 | Ga0075433_100985443 | 111 |
| 466 | 3300006852 | Ga0075433_10562871 | Ga0075433_105628712 | 111 |
| 467 | 3300006871 | Ga0075434_100078955 | Ga0075434_1000789553 | 111 |
| 468 | 3300006880 | Ga0075429_100193064 | Ga0075429_1001930642 | 111 |
| 469 | 3300006881 | Ga0068865_101039397 | Ga0068865_1010393972 | 111 |
| 470 | 3300009147 | Ga0114129_10029973 | Ga0114129_100299734 | 111 |
| 471 | 3300009553 | Ga0105249_12125889 | Ga0105249_121258892 | 111 |
| 472 | 3300013308 | Ga0157375_12916576 | Ga0157375_129165762 | 111 |
| 473 | 3300025908 | Ga0207643_10156941 | Ga0207643_101569412 | 111 |
| 474 | 3300025926 | Ga0207659_10260097 | Ga0207659_102600972 | 111 |
| 475 | 3300025940 | Ga0207691_10641627 | Ga0207691_106416272 | 111 |
| 476 | 3300025944 | Ga0207661_10043583 | Ga0207661_100435834 | 111 |
| 477 | 3300025960 | Ga0207651_10074395 | Ga0207651_100743952 | 111 |
| 478 | 3300046491 | Ga0495584_0034244 | Ga0495584_0034244_129_473 | 111 |
| 479 | 3300050507 | nmdc:mga05p37_7428_c1 | nmdc:mga05p37_7428_c1_11359_11703 | 111 |
| 480 | 3300050508 | nmdc:mga09592_204154_c1 | nmdc:mga09592_204154_c1_279_623 | 111 |
| 481 | 3300050512 | nmdc:mga0n895_77955_c1 | nmdc:mga0n895_77955_c1_2649_2993 | 111 |
| 482 | 3300050515 | nmdc:mga0a205_51408_c1 | nmdc:mga0a205_51408_c1_1716_2060 | 111 |
| 483 | 3300005564 | Ga0070664_101815782 | Ga0070664_1018157822 | 112 |
| 484 | 3300009094 | Ga0111539_10008742 | Ga0111539_100087428 | 112 |
| 485 | 3300025926 | Ga0207659_10501468 | Ga0207659_105014682 | 112 |
| 486 | 3300050511 | nmdc:mga08y16_1992_c1 | nmdc:mga08y16_1992_c1_15393_15764 | 112 |
| 487 | 3300005440 | Ga0070705_101040559 | Ga0070705_1010405592 | 113 |
| 488 | 3300005545 | Ga0070695_100134955 | Ga0070695_1001349552 | 113 |
| 489 | 3300006844 | Ga0075428_100000284 | Ga0075428_10000028420 | 113 |
| 490 | 3300006846 | Ga0075430_100090817 | Ga0075430_1000908172 | 113 |
| 491 | 3300006846 | Ga0075430_100265976 | Ga0075430_1002659761 | 113 |
| 492 | 3300006847 | Ga0075431_100007807 | Ga0075431_1000078078 | 113 |
| 493 | 3300006847 | Ga0075431_100062847 | Ga0075431_1000628471 | 113 |
| 494 | 3300006852 | Ga0075433_10010139 | Ga0075433_100101392 | 113 |
| 495 | 3300006871 | Ga0075434_100010577 | Ga0075434_1000105776 | 113 |
| 496 | 3300006871 | Ga0075434_100016832 | Ga0075434_1000168324 | 113 |
| 497 | 3300006871 | Ga0075434_101301769 | Ga0075434_1013017691 | 113 |
| 498 | 3300006880 | Ga0075429_100004197 | Ga0075429_1000041977 | 113 |
| 499 | 3300006880 | Ga0075429_100055647 | Ga0075429_1000556473 | 113 |
| 500 | 3300007076 | Ga0075435_100308202 | Ga0075435_1003082022 | 113 |
| 501 | 3300009094 | Ga0111539_10009063 | Ga0111539_100090635 | 113 |
| 502 | 3300009094 | Ga0111539_10065215 | Ga0111539_100652154 | 113 |
| 503 | 3300009094 | Ga0111539_11986943 | Ga0111539_119869431 | 113 |
| 504 | 3300009147 | Ga0114129_10020716 | Ga0114129_100207167 | 113 |
| 505 | 3300009147 | Ga0114129_10041091 | Ga0114129_100410912 | 113 |
| 506 | 3300009147 | Ga0114129_10161305 | Ga0114129_101613053 | 113 |
| 507 | 3300009148 | Ga0105243_11179696 | Ga0105243_111796962 | 113 |
| 508 | 3300014326 | Ga0157380_10079032 | Ga0157380_100790322 | 113 |
| 509 | 3300025917 | Ga0207660_10535784 | Ga0207660_105357842 | 113 |
| 510 | 3300027907 | Ga0207428_10000690 | Ga0207428_1000069017 | 113 |
| 511 | 3300027907 | Ga0207428_10769437 | Ga0207428_107694372 | 113 |
| 512 | 3300031731 | Ga0307405_10006136 | Ga0307405_100061365 | 113 |
| 513 | 3300031995 | Ga0307409_100027658 | Ga0307409_1000276582 | 113 |
| 514 | 3300032002 | Ga0307416_100012407 | Ga0307416_1000124075 | 113 |
| 515 | 3300032002 | Ga0307416_100834867 | Ga0307416_1008348672 | 113 |
| 516 | 3300032005 | Ga0307411_10388768 | Ga0307411_103887681 | 113 |
| 517 | 3300042003 | Ga0439443_045458 | Ga0439443_045458_273_644 | 113 |
| 518 | 3300042122 | Ga0450920_067381 | Ga0450920_067381_252_623 | 113 |
| 519 | 3300042435 | Ga0439434_0038168 | Ga0439434_0038168_289_672 | 113 |
| 520 | 3300049514 | Ga0501291_071558 | Ga0501291_071558_163_534 | 113 |
| 521 | 3300049578 | Ga0501042_0791502 | Ga0501042_0791502_91_432 | 113 |
| 522 | 3300049592 | Ga0501076_1513172 | Ga0501076_1513172_19_390 | 113 |
| 523 | 3300049652 | Ga0501202_059244 | Ga0501202_059244_194_565 | 113 |
| 524 | 3300049687 | Ga0501258_042547 | Ga0501258_042547_209_580 | 113 |
| 525 | 3300050507 | nmdc:mga05p37_1775854_c1 | nmdc:mga05p37_1775854_c1_221_568 | 113 |
| 526 | 3300050507 | nmdc:mga05p37_717761_c1 | nmdc:mga05p37_717761_c1_311_682 | 113 |
| 527 | 3300050508 | nmdc:mga09592_287129_c1 | nmdc:mga09592_287129_c1_874_1245 | 113 |
| 528 | 3300050509 | nmdc:mga0qj67_144399_c1 | nmdc:mga0qj67_144399_c1_652_1023 | 113 |
| 529 | 3300050509 | nmdc:mga0qj67_942996_c1 | nmdc:mga0qj67_942996_c1_109_480 | 113 |
| 530 | 3300050512 | nmdc:mga0n895_10056_c1 | nmdc:mga0n895_10056_c1_1731_2078 | 113 |
| 531 | 3300050512 | nmdc:mga0n895_7550_c1 | nmdc:mga0n895_7550_c1_3833_4180 | 113 |
| 532 | 3300050513 | nmdc:mga0rr50_1349105_c1 | nmdc:mga0rr50_1349105_c1_141_488 | 113 |
| 533 | 3300050513 | nmdc:mga0rr50_272559_c1 | nmdc:mga0rr50_272559_c1_623_970 | 113 |
| 534 | 3300050515 | nmdc:mga0a205_20268_c1 | nmdc:mga0a205_20268_c1_4681_5028 | 113 |
| 535 | 3300050515 | nmdc:mga0a205_8089_c1 | nmdc:mga0a205_8089_c1_6926_7273 | 113 |
| 536 | 3300004800 | Ga0058861_11795853 | Ga0058861_117958532 | 114 |
| 537 | 3300005288 | Ga0065714_10139313 | Ga0065714_101393132 | 114 |
| 538 | 3300005289 | Ga0065704_10238573 | Ga0065704_102385732 | 114 |
| 539 | 3300005290 | Ga0065712_10026972 | Ga0065712_100269722 | 114 |
| 540 | 3300005290 | Ga0065712_10068029 | Ga0065712_1006802911 | 114 |
| 541 | 3300005293 | Ga0065715_10179119 | Ga0065715_101791192 | 114 |
| 542 | 3300005295 | Ga0065707_10012615 | Ga0065707_100126153 | 114 |
| 543 | 3300005328 | Ga0070676_10116384 | Ga0070676_101163842 | 114 |
| 544 | 3300005331 | Ga0070670_100721919 | Ga0070670_1007219192 | 114 |
| 545 | 3300005334 | Ga0068869_100351982 | Ga0068869_1003519822 | 114 |
| 546 | 3300005335 | Ga0070666_10576985 | Ga0070666_105769852 | 114 |
| 547 | 3300005336 | Ga0070680_100967993 | Ga0070680_1009679932 | 114 |
| 548 | 3300005338 | Ga0068868_100590139 | Ga0068868_1005901392 | 114 |
| 549 | 3300005340 | Ga0070689_100457581 | Ga0070689_1004575812 | 114 |
| 550 | 3300005340 | Ga0070689_100462733 | Ga0070689_1004627332 | 114 |
| 551 | 3300005341 | Ga0070691_10276112 | Ga0070691_102761122 | 114 |
| 552 | 3300005343 | Ga0070687_100801030 | Ga0070687_1008010301 | 114 |
| 553 | 3300005347 | Ga0070668_100781962 | Ga0070668_1007819622 | 114 |
| 554 | 3300005347 | Ga0070668_101305000 | Ga0070668_1013050001 | 114 |
| 555 | 3300005353 | Ga0070669_100216571 | Ga0070669_1002165711 | 114 |
| 556 | 3300005353 | Ga0070669_100572461 | Ga0070669_1005724612 | 114 |
| 557 | 3300005353 | Ga0070669_101745864 | Ga0070669_1017458642 | 114 |
| 558 | 3300005354 | Ga0070675_100026955 | Ga0070675_1000269553 | 114 |
| 559 | 3300005354 | Ga0070675_100192394 | Ga0070675_1001923942 | 114 |
| 560 | 3300005354 | Ga0070675_100267127 | Ga0070675_1002671272 | 114 |
| 561 | 3300005364 | Ga0070673_100002298 | Ga0070673_1000022987 | 114 |
| 562 | 3300005364 | Ga0070673_100727245 | Ga0070673_1007272452 | 114 |
| 563 | 3300005365 | Ga0070688_100102547 | Ga0070688_1001025473 | 114 |
| 564 | 3300005365 | Ga0070688_100687743 | Ga0070688_1006877431 | 114 |
| 565 | 3300005440 | Ga0070705_101031282 | Ga0070705_1010312821 | 114 |
| 566 | 3300005441 | Ga0070700_100782494 | Ga0070700_1007824941 | 114 |
| 567 | 3300005444 | Ga0070694_100274786 | Ga0070694_1002747861 | 114 |
| 568 | 3300005444 | Ga0070694_101047917 | Ga0070694_1010479171 | 114 |
| 569 | 3300005455 | Ga0070663_100259133 | Ga0070663_1002591332 | 114 |
| 570 | 3300005456 | Ga0070678_100679285 | Ga0070678_1006792852 | 114 |
| 571 | 3300005457 | Ga0070662_100274708 | Ga0070662_1002747082 | 114 |
| 572 | 3300005459 | Ga0068867_100235396 | Ga0068867_1002353962 | 114 |
| 573 | 3300005471 | Ga0070698_101398033 | Ga0070698_1013980331 | 114 |
| 574 | 3300005518 | Ga0070699_100310293 | Ga0070699_1003102932 | 114 |
| 575 | 3300005530 | Ga0070679_100746102 | Ga0070679_1007461022 | 114 |
| 576 | 3300005543 | Ga0070672_100070216 | Ga0070672_1000702162 | 114 |
| 577 | 3300005549 | Ga0070704_100131876 | Ga0070704_1001318761 | 114 |
| 578 | 3300005564 | Ga0070664_100113742 | Ga0070664_1001137423 | 114 |
| 579 | 3300005564 | Ga0070664_101176678 | Ga0070664_1011766782 | 114 |
| 580 | 3300005577 | Ga0068857_100695118 | Ga0068857_1006951182 | 114 |
| 581 | 3300005578 | Ga0068854_101927090 | Ga0068854_1019270902 | 114 |
| 582 | 3300005617 | Ga0068859_100027171 | Ga0068859_1000271716 | 114 |
| 583 | 3300005617 | Ga0068859_100554065 | Ga0068859_1005540652 | 114 |
| 584 | 3300005618 | Ga0068864_100244407 | Ga0068864_1002444071 | 114 |
| 585 | 3300005618 | Ga0068864_100921277 | Ga0068864_1009212772 | 114 |
| 586 | 3300005718 | Ga0068866_11030466 | Ga0068866_110304661 | 114 |
| 587 | 3300005719 | Ga0068861_100088426 | Ga0068861_1000884262 | 114 |
| 588 | 3300005844 | Ga0068862_100650127 | Ga0068862_1006501272 | 114 |
| 589 | 3300005844 | Ga0068862_101295591 | Ga0068862_1012955912 | 114 |
| 590 | 3300006058 | Ga0075432_10254257 | Ga0075432_102542572 | 114 |
| 591 | 3300006844 | Ga0075428_100030746 | Ga0075428_1000307464 | 114 |
| 592 | 3300006846 | Ga0075430_100051294 | Ga0075430_1000512942 | 114 |
| 593 | 3300006846 | Ga0075430_100052018 | Ga0075430_1000520182 | 114 |
| 594 | 3300006846 | Ga0075430_100333305 | Ga0075430_1003333052 | 114 |
| 595 | 3300006847 | Ga0075431_100009529 | Ga0075431_1000095294 | 114 |
| 596 | 3300006847 | Ga0075431_100020930 | Ga0075431_1000209305 | 114 |
| 597 | 3300006847 | Ga0075431_100536181 | Ga0075431_1005361812 | 114 |
| 598 | 3300006852 | Ga0075433_10051341 | Ga0075433_100513412 | 114 |
| 599 | 3300006852 | Ga0075433_11103709 | Ga0075433_111037092 | 114 |
| 600 | 3300006871 | Ga0075434_100040403 | Ga0075434_1000404034 | 114 |
| 601 | 3300006880 | Ga0075429_100031404 | Ga0075429_1000314042 | 114 |
| 602 | 3300006880 | Ga0075429_100777492 | Ga0075429_1007774922 | 114 |
| 603 | 3300006880 | Ga0075429_101514358 | Ga0075429_1015143582 | 114 |
| 604 | 3300006881 | Ga0068865_100105404 | Ga0068865_1001054042 | 114 |
| 605 | 3300006931 | Ga0097620_100027171 | Ga0097620_1000271716 | 114 |
| 606 | 3300006931 | Ga0097620_100554102 | Ga0097620_1005541022 | 114 |
| 607 | 3300009092 | Ga0105250_10369461 | Ga0105250_103694612 | 114 |
| 608 | 3300009094 | Ga0111539_10000306 | Ga0111539_100003066 | 114 |
| 609 | 3300009094 | Ga0111539_10020960 | Ga0111539_100209605 | 114 |
| 610 | 3300009094 | Ga0111539_10046513 | Ga0111539_100465132 | 114 |
| 611 | 3300009094 | Ga0111539_10346671 | Ga0111539_103466712 | 114 |
| 612 | 3300009094 | Ga0111539_11778179 | Ga0111539_117781792 | 114 |
| 613 | 3300009098 | Ga0105245_12821488 | Ga0105245_128214881 | 114 |
| 614 | 3300009147 | Ga0114129_10052707 | Ga0114129_100527075 | 114 |
| 615 | 3300009147 | Ga0114129_10071381 | Ga0114129_100713814 | 114 |
| 616 | 3300009147 | Ga0114129_11025944 | Ga0114129_110259442 | 114 |
| 617 | 3300009147 | Ga0114129_13427606 | Ga0114129_134276061 | 114 |
| 618 | 3300009148 | Ga0105243_11459078 | Ga0105243_114590782 | 114 |
| 619 | 3300009176 | Ga0105242_12261840 | Ga0105242_122618401 | 114 |
| 620 | 3300009553 | Ga0105249_10055766 | Ga0105249_100557664 | 114 |
| 621 | 3300009553 | Ga0105249_11002137 | Ga0105249_110021372 | 114 |
| 622 | 3300009553 | Ga0105249_11012239 | Ga0105249_110122392 | 114 |
| 623 | 3300011119 | Ga0105246_10482864 | Ga0105246_104828642 | 114 |
| 624 | 3300013102 | Ga0157371_10376531 | Ga0157371_103765312 | 114 |
| 625 | 3300013307 | Ga0157372_11377976 | Ga0157372_113779761 | 114 |
| 626 | 3300013308 | Ga0157375_10889915 | Ga0157375_108899152 | 114 |
| 627 | 3300014325 | Ga0163163_10176303 | Ga0163163_101763032 | 114 |
| 628 | 3300014326 | Ga0157380_10062932 | Ga0157380_100629322 | 114 |
| 629 | 3300025711 | Ga0207696_1150937 | Ga0207696_11509372 | 114 |
| 630 | 3300025903 | Ga0207680_10272872 | Ga0207680_102728722 | 114 |
| 631 | 3300025907 | Ga0207645_10465105 | Ga0207645_104651052 | 114 |
| 632 | 3300025908 | Ga0207643_10029188 | Ga0207643_100291883 | 114 |
| 633 | 3300025908 | Ga0207643_10316273 | Ga0207643_103162731 | 114 |
| 634 | 3300025917 | Ga0207660_10463954 | Ga0207660_104639542 | 114 |
| 635 | 3300025918 | Ga0207662_10068981 | Ga0207662_100689812 | 114 |
| 636 | 3300025920 | Ga0207649_10123466 | Ga0207649_101234662 | 114 |
| 637 | 3300025921 | Ga0207652_10426207 | Ga0207652_104262072 | 114 |
| 638 | 3300025923 | Ga0207681_10234283 | Ga0207681_102342832 | 114 |
| 639 | 3300025923 | Ga0207681_10245883 | Ga0207681_102458832 | 114 |
| 640 | 3300025923 | Ga0207681_10849554 | Ga0207681_108495542 | 114 |
| 641 | 3300025926 | Ga0207659_10004148 | Ga0207659_100041487 | 114 |
| 642 | 3300025926 | Ga0207659_10036422 | Ga0207659_100364224 | 114 |
| 643 | 3300025926 | Ga0207659_10697319 | Ga0207659_106973192 | 114 |
| 644 | 3300025933 | Ga0207706_10158425 | Ga0207706_101584252 | 114 |
| 645 | 3300025935 | Ga0207709_10956887 | Ga0207709_109568872 | 114 |
| 646 | 3300025936 | Ga0207670_10195723 | Ga0207670_101957232 | 114 |
| 647 | 3300025936 | Ga0207670_10524131 | Ga0207670_105241312 | 114 |
| 648 | 3300025937 | Ga0207669_10765135 | Ga0207669_107651352 | 114 |
| 649 | 3300025937 | Ga0207669_11042207 | Ga0207669_110422071 | 114 |
| 650 | 3300025940 | Ga0207691_10023881 | Ga0207691_100238813 | 114 |
| 651 | 3300025942 | Ga0207689_10207102 | Ga0207689_102071022 | 114 |
| 652 | 3300025945 | Ga0207679_11176945 | Ga0207679_111769452 | 114 |
| 653 | 3300025960 | Ga0207651_10002212 | Ga0207651_100022125 | 114 |
| 654 | 3300025960 | Ga0207651_10394009 | Ga0207651_103940092 | 114 |
| 655 | 3300025960 | Ga0207651_11213175 | Ga0207651_112131752 | 114 |
| 656 | 3300025972 | Ga0207668_10710017 | Ga0207668_107100172 | 114 |
| 657 | 3300025986 | Ga0207658_10532335 | Ga0207658_105323352 | 114 |
| 658 | 3300026067 | Ga0207678_10586738 | Ga0207678_105867382 | 114 |
| 659 | 3300026075 | Ga0207708_10363917 | Ga0207708_103639172 | 114 |
| 660 | 3300026075 | Ga0207708_10780312 | Ga0207708_107803121 | 114 |
| 661 | 3300026089 | Ga0207648_10119107 | Ga0207648_101191073 | 114 |
| 662 | 3300026095 | Ga0207676_10201180 | Ga0207676_102011802 | 114 |
| 663 | 3300026116 | Ga0207674_10164806 | Ga0207674_101648062 | 114 |
| 664 | 3300026116 | Ga0207674_11316252 | Ga0207674_113162522 | 114 |
| 665 | 3300026118 | Ga0207675_100057612 | Ga0207675_1000576122 | 114 |
| 666 | 3300026118 | Ga0207675_100072977 | Ga0207675_1000729773 | 114 |
| 667 | 3300026118 | Ga0207675_100222288 | Ga0207675_1002222882 | 114 |
| 668 | 3300026118 | Ga0207675_102041456 | Ga0207675_1020414562 | 114 |
| 669 | 3300027876 | Ga0209974_10013867 | Ga0209974_100138672 | 114 |
| 670 | 3300027876 | Ga0209974_10066431 | Ga0209974_100664312 | 114 |
| 671 | 3300027907 | Ga0207428_10003602 | Ga0207428_100036027 | 114 |
| 672 | 3300027907 | Ga0207428_10007135 | Ga0207428_100071354 | 114 |
| 673 | 3300027907 | Ga0207428_10047890 | Ga0207428_100478903 | 114 |
| 674 | 3300027907 | Ga0207428_10286830 | Ga0207428_102868302 | 114 |
| 675 | 3300028380 | Ga0268265_10314010 | Ga0268265_103140102 | 114 |
| 676 | 3300028380 | Ga0268265_10461428 | Ga0268265_104614282 | 114 |
| 677 | 3300028380 | Ga0268265_12218439 | Ga0268265_122184391 | 114 |
| 678 | 3300028381 | Ga0268264_10262106 | Ga0268264_102621062 | 114 |
| 679 | 3300031903 | Ga0307407_10616850 | Ga0307407_106168501 | 114 |
| 680 | 3300032002 | Ga0307416_100305556 | Ga0307416_1003055562 | 114 |
| 681 | 3300035121 | Ga0373960_0350446 | Ga0373960_0350446_143_508 | 114 |
| 682 | 3300041408 | Ga0439453_0003587 | Ga0439453_0003587_1831_2175 | 114 |
| 683 | 3300042436 | Ga0439435_0049424 | Ga0439435_0049424_531_875 | 114 |
| 684 | 3300042437 | Ga0439444_0050498 | Ga0439444_0050498_121_465 | 114 |
| 685 | 3300042439 | Ga0439464_0078464 | Ga0439464_0078464_435_779 | 114 |
| 686 | 3300042530 | Ga0450916_006011 | Ga0450916_006011_934_1278 | 114 |
| 687 | 3300042993 | Ga0439440_0120505 | Ga0439440_0120505_128_472 | 114 |
| 688 | 3300046537 | Ga0495598_0070578 | Ga0495598_0070578_87_434 | 114 |
| 689 | 3300046537 | Ga0495598_0113047 | Ga0495598_0113047_317_664 | 114 |
| 690 | 3300046615 | Ga0495656_0006702 | Ga0495656_0006702_1647_1994 | 114 |
| 691 | 3300048911 | Ga0496108_0720673 | Ga0496108_0720673_385_729 | 114 |
| 692 | 3300048912 | Ga0496109_0235737 | Ga0496109_0235737_1319_1663 | 114 |
| 693 | 3300048916 | Ga0496113_0049179 | Ga0496113_0049179_55_399 | 114 |
| 694 | 3300049572 | Ga0501036_0051933 | Ga0501036_0051933_2303_2647 | 114 |
| 695 | 3300049575 | Ga0501039_0120454 | Ga0501039_0120454_1138_1482 | 114 |
| 696 | 3300049576 | Ga0501040_0357532 | Ga0501040_0357532_513_857 | 114 |
| 697 | 3300049577 | Ga0501041_0002498 | Ga0501041_0002498_4122_4466 | 114 |
| 698 | 3300049578 | Ga0501042_0011677 | Ga0501042_0011677_1932_2276 | 114 |
| 699 | 3300049582 | Ga0501048_0617519 | Ga0501048_0617519_407_751 | 114 |
| 700 | 3300049584 | Ga0501068_0663943 | Ga0501068_0663943_212_556 | 114 |
| 701 | 3300049587 | Ga0501071_0728274 | Ga0501071_0728274_277_621 | 114 |
| 702 | 3300049590 | Ga0501074_0822061 | Ga0501074_0822061_260_604 | 114 |
| 703 | 3300049592 | Ga0501076_0011199 | Ga0501076_0011199_3529_3873 | 114 |
| 704 | 3300049592 | Ga0501076_1659453 | Ga0501076_1659453_80_424 | 114 |
| 705 | 3300049593 | Ga0501077_0094148 | Ga0501077_0094148_1286_1630 | 114 |
| 706 | 3300049704 | Ga0501221_198029 | Ga0501221_198029_35_379 | 114 |
| 707 | 3300049741 | Ga0501079_0232707 | Ga0501079_0232707_159_503 | 114 |
| 708 | 3300049742 | Ga0501080_0273987 | Ga0501080_0273987_495_839 | 114 |
| 709 | 3300049743 | Ga0501081_0011798 | Ga0501081_0011798_2964_3308 | 114 |
| 710 | 3300049824 | Ga0501045_0263942 | Ga0501045_0263942_484_828 | 114 |
| 711 | 3300050507 | nmdc:mga05p37_1149796_c1 | nmdc:mga05p37_1149796_c1_357_740 | 114 |
| 712 | 3300050507 | nmdc:mga05p37_6472_c1 | nmdc:mga05p37_6472_c1_2890_3234 | 114 |
| 713 | 3300050507 | nmdc:mga05p37_93689_c1 | nmdc:mga05p37_93689_c1_1158_1502 | 114 |
| 714 | 3300050508 | nmdc:mga09592_159989_c1 | nmdc:mga09592_159989_c1_198_542 | 114 |
| 715 | 3300050508 | nmdc:mga09592_20748_c1 | nmdc:mga09592_20748_c1_3961_4305 | 114 |
| 716 | 3300050508 | nmdc:mga09592_771136_c1 | nmdc:mga09592_771136_c1_152_496 | 114 |
| 717 | 3300050509 | nmdc:mga0qj67_1127171_c1 | nmdc:mga0qj67_1127171_c1_127_471 | 114 |
| 718 | 3300050509 | nmdc:mga0qj67_14220_c1 | nmdc:mga0qj67_14220_c1_3644_3988 | 114 |
| 719 | 3300050509 | nmdc:mga0qj67_41459_c1 | nmdc:mga0qj67_41459_c1_704_1048 | 114 |
| 720 | 3300050509 | nmdc:mga0qj67_808670_c1 | nmdc:mga0qj67_808670_c1_317_661 | 114 |
| 721 | 3300050510 | nmdc:mga06r32_722755_c1 | nmdc:mga06r32_722755_c1_351_695 | 114 |
| 722 | 3300050510 | nmdc:mga06r32_93975_c1 | nmdc:mga06r32_93975_c1_387_731 | 114 |
| 723 | 3300050511 | nmdc:mga08y16_105_c1 | nmdc:mga08y16_105_c1_7002_7346 | 114 |
| 724 | 3300050511 | nmdc:mga08y16_18317_c1 | nmdc:mga08y16_18317_c1_3169_3513 | 114 |
| 725 | 3300050511 | nmdc:mga08y16_33645_c1 | nmdc:mga08y16_33645_c1_2761_3105 | 114 |
| 726 | 3300050511 | nmdc:mga08y16_727661_c1 | nmdc:mga08y16_727661_c1_240_584 | 114 |
| 727 | 3300050512 | nmdc:mga0n895_194937_c1 | nmdc:mga0n895_194937_c1_1348_1692 | 114 |
| 728 | 3300050515 | nmdc:mga0a205_1517634_c1 | nmdc:mga0a205_1517634_c1_65_448 | 114 |
| 729 | 3300050515 | nmdc:mga0a205_72556_c1 | nmdc:mga0a205_72556_c1_364_708 | 114 |
| 730 | 3300054114 | Ga0501084_0023342 | Ga0501084_0023342_3659_4003 | 114 |
| 731 | 3300060353 | Ga0501082_0075363 | Ga0501082_0075363_1285_1629 | 114 |
| 732 | 3300061734 | Ga0530510_0279412 | Ga0530510_0279412_379_723 | 114 |
| 733 | 3300001977 | JGI24746J21847_1010804 | JGI24746J21847_10108042 | 115 |
| 734 | 3300002126 | JGI24035J26624_1009785 | JGI24035J26624_10097852 | 115 |
| 735 | 3300002155 | JGI24033J26618_1022121 | JGI24033J26618_10221212 | 115 |
| 736 | 3300002239 | JGI24034J26672_10083343 | JGI24034J26672_100833432 | 115 |
| 737 | 3300002459 | JGI24751J29686_10039974 | JGI24751J29686_100399742 | 115 |
| 738 | 3300005288 | Ga0065714_10131696 | Ga0065714_101316962 | 115 |
| 739 | 3300005289 | Ga0065704_10263811 | Ga0065704_102638112 | 115 |
| 740 | 3300005289 | Ga0065704_10280339 | Ga0065704_102803392 | 115 |
| 741 | 3300005290 | Ga0065712_10009945 | Ga0065712_100099453 | 115 |
| 742 | 3300005290 | Ga0065712_10172488 | Ga0065712_101724882 | 115 |
| 743 | 3300005293 | Ga0065715_10004827 | Ga0065715_100048273 | 115 |
| 744 | 3300005293 | Ga0065715_10007485 | Ga0065715_100074857 | 115 |
| 745 | 3300005295 | Ga0065707_10008321 | Ga0065707_100083213 | 115 |
| 746 | 3300005295 | Ga0065707_10036311 | Ga0065707_100363112 | 115 |
| 747 | 3300005328 | Ga0070676_10004892 | Ga0070676_100048923 | 115 |
| 748 | 3300005328 | Ga0070676_10028131 | Ga0070676_100281312 | 115 |
| 749 | 3300005328 | Ga0070676_10209629 | Ga0070676_102096292 | 115 |
| 750 | 3300005329 | Ga0070683_100339982 | Ga0070683_1003399822 | 115 |
| 751 | 3300005330 | Ga0070690_100020399 | Ga0070690_1000203992 | 115 |
| 752 | 3300005330 | Ga0070690_100538619 | Ga0070690_1005386192 | 115 |
| 753 | 3300005331 | Ga0070670_100002473 | Ga0070670_1000024733 | 115 |
| 754 | 3300005333 | Ga0070677_10902812 | Ga0070677_109028122 | 115 |
| 755 | 3300005334 | Ga0068869_100015575 | Ga0068869_1000155755 | 115 |
| 756 | 3300005334 | Ga0068869_100168473 | Ga0068869_1001684732 | 115 |
| 757 | 3300005335 | Ga0070666_10017347 | Ga0070666_100173474 | 115 |
| 758 | 3300005335 | Ga0070666_10045843 | Ga0070666_100458432 | 115 |
| 759 | 3300005338 | Ga0068868_100028174 | Ga0068868_1000281742 | 115 |
| 760 | 3300005339 | Ga0070660_101366093 | Ga0070660_1013660932 | 115 |
| 761 | 3300005340 | Ga0070689_100113078 | Ga0070689_1001130782 | 115 |
| 762 | 3300005340 | Ga0070689_100219937 | Ga0070689_1002199372 | 115 |
| 763 | 3300005343 | Ga0070687_100012056 | Ga0070687_1000120562 | 115 |
| 764 | 3300005343 | Ga0070687_100120732 | Ga0070687_1001207322 | 115 |
| 765 | 3300005344 | Ga0070661_100311862 | Ga0070661_1003118622 | 115 |
| 766 | 3300005345 | Ga0070692_10844979 | Ga0070692_108449791 | 115 |
| 767 | 3300005347 | Ga0070668_100054752 | Ga0070668_1000547524 | 115 |
| 768 | 3300005347 | Ga0070668_100415741 | Ga0070668_1004157412 | 115 |
| 769 | 3300005353 | Ga0070669_100024441 | Ga0070669_1000244414 | 115 |
| 770 | 3300005353 | Ga0070669_100046285 | Ga0070669_1000462852 | 115 |
| 771 | 3300005353 | Ga0070669_100655190 | Ga0070669_1006551901 | 115 |
| 772 | 3300005354 | Ga0070675_100010643 | Ga0070675_1000106434 | 115 |
| 773 | 3300005354 | Ga0070675_100051450 | Ga0070675_1000514504 | 115 |
| 774 | 3300005355 | Ga0070671_100182084 | Ga0070671_1001820842 | 115 |
| 775 | 3300005355 | Ga0070671_100690875 | Ga0070671_1006908752 | 115 |
| 776 | 3300005356 | Ga0070674_100013105 | Ga0070674_1000131053 | 115 |
| 777 | 3300005356 | Ga0070674_100754336 | Ga0070674_1007543361 | 115 |
| 778 | 3300005356 | Ga0070674_101397833 | Ga0070674_1013978331 | 115 |
| 779 | 3300005364 | Ga0070673_100011536 | Ga0070673_1000115362 | 115 |
| 780 | 3300005364 | Ga0070673_100044468 | Ga0070673_1000444682 | 115 |
| 781 | 3300005365 | Ga0070688_100723809 | Ga0070688_1007238092 | 115 |
| 782 | 3300005367 | Ga0070667_100022929 | Ga0070667_1000229296 | 115 |
| 783 | 3300005367 | Ga0070667_101549870 | Ga0070667_1015498702 | 115 |
| 784 | 3300005438 | Ga0070701_10084109 | Ga0070701_100841092 | 115 |
| 785 | 3300005441 | Ga0070700_100181401 | Ga0070700_1001814012 | 115 |
| 786 | 3300005441 | Ga0070700_100541694 | Ga0070700_1005416942 | 115 |
| 787 | 3300005444 | Ga0070694_100321052 | Ga0070694_1003210522 | 115 |
| 788 | 3300005444 | Ga0070694_100740583 | Ga0070694_1007405832 | 115 |
| 789 | 3300005456 | Ga0070678_100014125 | Ga0070678_1000141256 | 115 |
| 790 | 3300005456 | Ga0070678_100173722 | Ga0070678_1001737222 | 115 |
| 791 | 3300005456 | Ga0070678_102237291 | Ga0070678_1022372912 | 115 |
| 792 | 3300005457 | Ga0070662_100027802 | Ga0070662_1000278022 | 115 |
| 793 | 3300005457 | Ga0070662_100049208 | Ga0070662_1000492082 | 115 |
| 794 | 3300005459 | Ga0068867_100075291 | Ga0068867_1000752912 | 115 |
| 795 | 3300005459 | Ga0068867_100199926 | Ga0068867_1001999262 | 115 |
| 796 | 3300005466 | Ga0070685_10044463 | Ga0070685_100444632 | 115 |
| 797 | 3300005466 | Ga0070685_10085366 | Ga0070685_100853662 | 115 |
| 798 | 3300005543 | Ga0070672_100302331 | Ga0070672_1003023312 | 115 |
| 799 | 3300005543 | Ga0070672_100734927 | Ga0070672_1007349272 | 115 |
| 800 | 3300005544 | Ga0070686_100023123 | Ga0070686_1000231234 | 115 |
| 801 | 3300005544 | Ga0070686_100065493 | Ga0070686_1000654931 | 115 |
| 802 | 3300005544 | Ga0070686_100920107 | Ga0070686_1009201072 | 115 |
| 803 | 3300005547 | Ga0070693_101410087 | Ga0070693_1014100871 | 115 |
| 804 | 3300005548 | Ga0070665_100363420 | Ga0070665_1003634202 | 115 |
| 805 | 3300005549 | Ga0070704_100339769 | Ga0070704_1003397692 | 115 |
| 806 | 3300005564 | Ga0070664_100000586 | Ga0070664_1000005868 | 115 |
| 807 | 3300005577 | Ga0068857_100634226 | Ga0068857_1006342262 | 115 |
| 808 | 3300005577 | Ga0068857_102504351 | Ga0068857_1025043512 | 115 |
| 809 | 3300005577 | Ga0068857_102562388 | Ga0068857_1025623882 | 115 |
| 810 | 3300005615 | Ga0070702_100058054 | Ga0070702_1000580542 | 115 |
| 811 | 3300005615 | Ga0070702_100873489 | Ga0070702_1008734892 | 115 |
| 812 | 3300005616 | Ga0068852_100694770 | Ga0068852_1006947702 | 115 |
| 813 | 3300005617 | Ga0068859_100137882 | Ga0068859_1001378823 | 115 |
| 814 | 3300005617 | Ga0068859_100269810 | Ga0068859_1002698101 | 115 |
| 815 | 3300005617 | Ga0068859_100722804 | Ga0068859_1007228042 | 115 |
| 816 | 3300005618 | Ga0068864_100012301 | Ga0068864_1000123017 | 115 |
| 817 | 3300005618 | Ga0068864_100526900 | Ga0068864_1005269002 | 115 |
| 818 | 3300005718 | Ga0068866_10331526 | Ga0068866_103315262 | 115 |
| 819 | 3300005719 | Ga0068861_100064192 | Ga0068861_1000641923 | 115 |
| 820 | 3300005719 | Ga0068861_100113088 | Ga0068861_1001130882 | 115 |
| 821 | 3300005840 | Ga0068870_10037950 | Ga0068870_100379502 | 115 |
| 822 | 3300005840 | Ga0068870_10146966 | Ga0068870_101469662 | 115 |
| 823 | 3300005841 | Ga0068863_100046319 | Ga0068863_1000463192 | 115 |
| 824 | 3300005841 | Ga0068863_100632378 | Ga0068863_1006323782 | 115 |
| 825 | 3300005842 | Ga0068858_100258874 | Ga0068858_1002588742 | 115 |
| 826 | 3300005843 | Ga0068860_100202145 | Ga0068860_1002021452 | 115 |
| 827 | 3300005844 | Ga0068862_100070124 | Ga0068862_1000701242 | 115 |
| 828 | 3300005844 | Ga0068862_100443243 | Ga0068862_1004432432 | 115 |
| 829 | 3300006058 | Ga0075432_10223521 | Ga0075432_102235212 | 115 |
| 830 | 3300006358 | Ga0068871_100053491 | Ga0068871_1000534913 | 115 |
| 831 | 3300006844 | Ga0075428_100001176 | Ga0075428_1000011766 | 115 |
| 832 | 3300006844 | Ga0075428_100092312 | Ga0075428_1000923123 | 115 |
| 833 | 3300006844 | Ga0075428_100574562 | Ga0075428_1005745622 | 115 |
| 834 | 3300006846 | Ga0075430_100034006 | Ga0075430_1000340062 | 115 |
| 835 | 3300006846 | Ga0075430_100045040 | Ga0075430_1000450402 | 115 |
| 836 | 3300006847 | Ga0075431_100003965 | Ga0075431_1000039652 | 115 |
| 837 | 3300006852 | Ga0075433_10006016 | Ga0075433_100060166 | 115 |
| 838 | 3300006871 | Ga0075434_100144644 | Ga0075434_1001446441 | 115 |
| 839 | 3300006880 | Ga0075429_100009769 | Ga0075429_1000097694 | 115 |
| 840 | 3300006880 | Ga0075429_100557032 | Ga0075429_1005570322 | 115 |
| 841 | 3300006880 | Ga0075429_100779165 | Ga0075429_1007791651 | 115 |
| 842 | 3300006881 | Ga0068865_100203585 | Ga0068865_1002035852 | 115 |
| 843 | 3300006881 | Ga0068865_100302455 | Ga0068865_1003024551 | 115 |
| 844 | 3300006931 | Ga0097620_100137872 | Ga0097620_1001378723 | 115 |
| 845 | 3300006931 | Ga0097620_100269821 | Ga0097620_1002698212 | 115 |
| 846 | 3300006931 | Ga0097620_100722727 | Ga0097620_1007227272 | 115 |
| 847 | 3300007076 | Ga0075435_100110594 | Ga0075435_1001105943 | 115 |
| 848 | 3300009094 | Ga0111539_10096271 | Ga0111539_100962712 | 115 |
| 849 | 3300009094 | Ga0111539_10108999 | Ga0111539_101089994 | 115 |
| 850 | 3300009094 | Ga0111539_12096497 | Ga0111539_120964972 | 115 |
| 851 | 3300009094 | Ga0111539_13075629 | Ga0111539_130756291 | 115 |
| 852 | 3300009098 | Ga0105245_10549944 | Ga0105245_105499442 | 115 |
| 853 | 3300009177 | Ga0105248_10286403 | Ga0105248_102864032 | 115 |
| 854 | 3300009553 | Ga0105249_10009569 | Ga0105249_100095693 | 115 |
| 855 | 3300009553 | Ga0105249_10492529 | Ga0105249_104925292 | 115 |
| 856 | 3300011119 | Ga0105246_10012256 | Ga0105246_100122562 | 115 |
| 857 | 3300012480 | Ga0157346_1009653 | Ga0157346_10096532 | 115 |
| 858 | 3300012495 | Ga0157323_1014743 | Ga0157323_10147432 | 115 |
| 859 | 3300013296 | Ga0157374_10338931 | Ga0157374_103389312 | 115 |
| 860 | 3300013297 | Ga0157378_10445215 | Ga0157378_104452152 | 115 |
| 861 | 3300013306 | Ga0163162_10008524 | Ga0163162_100085248 | 115 |
| 862 | 3300013306 | Ga0163162_10655876 | Ga0163162_106558762 | 115 |
| 863 | 3300013308 | Ga0157375_10375202 | Ga0157375_103752021 | 115 |
| 864 | 3300013308 | Ga0157375_12052295 | Ga0157375_120522951 | 115 |
| 865 | 3300014325 | Ga0163163_10172038 | Ga0163163_101720383 | 115 |
| 866 | 3300014326 | Ga0157380_10029501 | Ga0157380_100295013 | 115 |
| 867 | 3300014326 | Ga0157380_13058894 | Ga0157380_130588941 | 115 |
| 868 | 3300014745 | Ga0157377_10005968 | Ga0157377_100059686 | 115 |
| 869 | 3300014745 | Ga0157377_10111326 | Ga0157377_101113262 | 115 |
| 870 | 3300014968 | Ga0157379_10074359 | Ga0157379_100743592 | 115 |
| 871 | 3300014969 | Ga0157376_10066871 | Ga0157376_100668713 | 115 |
| 872 | 3300014969 | Ga0157376_11517805 | Ga0157376_115178052 | 115 |
| 873 | 3300017792 | Ga0163161_10028324 | Ga0163161_100283244 | 115 |
| 874 | 3300017792 | Ga0163161_10039607 | Ga0163161_100396071 | 115 |
| 875 | 3300025223 | Ga0207672_1006080 | Ga0207672_10060802 | 115 |
| 876 | 3300025315 | Ga0207697_10002059 | Ga0207697_100020592 | 115 |
| 877 | 3300025315 | Ga0207697_10020303 | Ga0207697_100203032 | 115 |
| 878 | 3300025893 | Ga0207682_10061815 | Ga0207682_100618151 | 115 |
| 879 | 3300025901 | Ga0207688_10011929 | Ga0207688_100119295 | 115 |
| 880 | 3300025901 | Ga0207688_10203312 | Ga0207688_102033122 | 115 |
| 881 | 3300025901 | Ga0207688_10361160 | Ga0207688_103611602 | 115 |
| 882 | 3300025903 | Ga0207680_10140575 | Ga0207680_101405752 | 115 |
| 883 | 3300025903 | Ga0207680_10574123 | Ga0207680_105741232 | 115 |
| 884 | 3300025907 | Ga0207645_10051615 | Ga0207645_100516152 | 115 |
| 885 | 3300025907 | Ga0207645_10140632 | Ga0207645_101406322 | 115 |
| 886 | 3300025907 | Ga0207645_10208134 | Ga0207645_102081342 | 115 |
| 887 | 3300025908 | Ga0207643_10014099 | Ga0207643_100140994 | 115 |
| 888 | 3300025918 | Ga0207662_10022979 | Ga0207662_100229793 | 115 |
| 889 | 3300025919 | Ga0207657_10612677 | Ga0207657_106126772 | 115 |
| 890 | 3300025920 | Ga0207649_10023474 | Ga0207649_100234742 | 115 |
| 891 | 3300025923 | Ga0207681_10038068 | Ga0207681_100380682 | 115 |
| 892 | 3300025923 | Ga0207681_10214078 | Ga0207681_102140782 | 115 |
| 893 | 3300025923 | Ga0207681_11337461 | Ga0207681_113374612 | 115 |
| 894 | 3300025925 | Ga0207650_10216970 | Ga0207650_102169702 | 115 |
| 895 | 3300025926 | Ga0207659_10009478 | Ga0207659_100094782 | 115 |
| 896 | 3300025926 | Ga0207659_10036189 | Ga0207659_100361892 | 115 |
| 897 | 3300025926 | Ga0207659_10107144 | Ga0207659_101071442 | 115 |
| 898 | 3300025931 | Ga0207644_10073010 | Ga0207644_100730102 | 115 |
| 899 | 3300025931 | Ga0207644_10915089 | Ga0207644_109150892 | 115 |
| 900 | 3300025932 | Ga0207690_10420306 | Ga0207690_104203062 | 115 |
| 901 | 3300025933 | Ga0207706_10027855 | Ga0207706_100278552 | 115 |
| 902 | 3300025933 | Ga0207706_10038926 | Ga0207706_100389262 | 115 |
| 903 | 3300025936 | Ga0207670_10324941 | Ga0207670_103249412 | 115 |
| 904 | 3300025937 | Ga0207669_10016067 | Ga0207669_100160675 | 115 |
| 905 | 3300025937 | Ga0207669_10068122 | Ga0207669_100681222 | 115 |
| 906 | 3300025938 | Ga0207704_10543167 | Ga0207704_105431672 | 115 |
| 907 | 3300025940 | Ga0207691_10006894 | Ga0207691_1000689410 | 115 |
| 908 | 3300025940 | Ga0207691_10125050 | Ga0207691_101250502 | 115 |
| 909 | 3300025940 | Ga0207691_10525625 | Ga0207691_105256252 | 115 |
| 910 | 3300025941 | Ga0207711_10107229 | Ga0207711_101072292 | 115 |
| 911 | 3300025942 | Ga0207689_10006638 | Ga0207689_100066386 | 115 |
| 912 | 3300025942 | Ga0207689_10066540 | Ga0207689_100665402 | 115 |
| 913 | 3300025942 | Ga0207689_10073683 | Ga0207689_100736833 | 115 |
| 914 | 3300025945 | Ga0207679_10007694 | Ga0207679_100076947 | 115 |
| 915 | 3300025945 | Ga0207679_10471757 | Ga0207679_104717572 | 115 |
| 916 | 3300025960 | Ga0207651_10082130 | Ga0207651_100821303 | 115 |
| 917 | 3300025960 | Ga0207651_10188674 | Ga0207651_101886742 | 115 |
| 918 | 3300025961 | Ga0207712_10023448 | Ga0207712_100234486 | 115 |
| 919 | 3300025961 | Ga0207712_12103689 | Ga0207712_121036891 | 115 |
| 920 | 3300025986 | Ga0207658_10043526 | Ga0207658_100435262 | 115 |
| 921 | 3300025986 | Ga0207658_10435606 | Ga0207658_104356062 | 115 |
| 922 | 3300026023 | Ga0207677_10054266 | Ga0207677_100542663 | 115 |
| 923 | 3300026023 | Ga0207677_10624927 | Ga0207677_106249272 | 115 |
| 924 | 3300026067 | Ga0207678_10082154 | Ga0207678_100821543 | 115 |
| 925 | 3300026075 | Ga0207708_10084950 | Ga0207708_100849502 | 115 |
| 926 | 3300026088 | Ga0207641_10653180 | Ga0207641_106531802 | 115 |
| 927 | 3300026088 | Ga0207641_10675788 | Ga0207641_106757882 | 115 |
| 928 | 3300026089 | Ga0207648_10023072 | Ga0207648_100230722 | 115 |
| 929 | 3300026089 | Ga0207648_10031931 | Ga0207648_100319315 | 115 |
| 930 | 3300026095 | Ga0207676_10153225 | Ga0207676_101532252 | 115 |
| 931 | 3300026095 | Ga0207676_10156361 | Ga0207676_101563612 | 115 |
| 932 | 3300026116 | Ga0207674_10123356 | Ga0207674_101233562 | 115 |
| 933 | 3300026116 | Ga0207674_10208160 | Ga0207674_102081602 | 115 |
| 934 | 3300026118 | Ga0207675_100035858 | Ga0207675_1000358585 | 115 |
| 935 | 3300026118 | Ga0207675_100080301 | Ga0207675_1000803012 | 115 |
| 936 | 3300026121 | Ga0207683_10007767 | Ga0207683_100077675 | 115 |
| 937 | 3300026121 | Ga0207683_10278216 | Ga0207683_102782162 | 115 |
| 938 | 3300026121 | Ga0207683_10679813 | Ga0207683_106798132 | 115 |
| 939 | 3300026121 | Ga0207683_11251034 | Ga0207683_112510341 | 115 |
| 940 | 3300026142 | Ga0207698_11117337 | Ga0207698_111173371 | 115 |
| 941 | 3300027543 | Ga0209999_1078874 | Ga0209999_10788741 | 115 |
| 942 | 3300027617 | Ga0210002_1039797 | Ga0210002_10397971 | 115 |
| 943 | 3300027876 | Ga0209974_10063137 | Ga0209974_100631372 | 115 |
| 944 | 3300027907 | Ga0207428_10333215 | Ga0207428_103332152 | 115 |
| 945 | 3300028379 | Ga0268266_10377133 | Ga0268266_103771331 | 115 |
| 946 | 3300028380 | Ga0268265_11624661 | Ga0268265_116246612 | 115 |
| 947 | 3300028381 | Ga0268264_10241736 | Ga0268264_102417361 | 115 |
| 948 | 3300028381 | Ga0268264_10383459 | Ga0268264_103834592 | 115 |
| 949 | 3300032005 | Ga0307411_10567011 | Ga0307411_105670112 | 115 |
| 950 | 3300035112 | Ga0373932_0184177 | Ga0373932_0184177_61_408 | 115 |
| 951 | 3300042008 | Ga0439450_027769 | Ga0439450_027769_744_1091 | 115 |
| 952 | 3300042127 | Ga0450890_088259 | Ga0450890_088259_128_475 | 115 |
| 953 | 3300042436 | Ga0439435_0098848 | Ga0439435_0098848_141_488 | 115 |
| 954 | 3300042439 | Ga0439464_0031568 | Ga0439464_0031568_510_857 | 115 |
| 955 | 3300045051 | Ga0451576_0519841 | Ga0451576_0519841_560_907 | 115 |
| 956 | 3300046537 | Ga0495598_0138449 | Ga0495598_0138449_397_744 | 115 |
| 957 | 3300047445 | Ga0495677_0353738 | Ga0495677_0353738_69_416 | 115 |
| 958 | 3300048911 | Ga0496108_0854356 | Ga0496108_0854356_248_595 | 115 |
| 959 | 3300048912 | Ga0496109_0110924 | Ga0496109_0110924_918_1265 | 115 |
| 960 | 3300048916 | Ga0496113_0508867 | Ga0496113_0508867_363_710 | 115 |
| 961 | 3300049577 | Ga0501041_0590124 | Ga0501041_0590124_102_449 | 115 |
| 962 | 3300049587 | Ga0501071_0440219 | Ga0501071_0440219_431_778 | 115 |
| 963 | 3300049741 | Ga0501079_0978269 | Ga0501079_0978269_173_520 | 115 |
| 964 | 3300049744 | Ga0501083_0595102 | Ga0501083_0595102_31_378 | 115 |
| 965 | 3300050507 | nmdc:mga05p37_954583_c1 | nmdc:mga05p37_954583_c1_400_747 | 115 |
| 966 | 3300050508 | nmdc:mga09592_24473_c1 | nmdc:mga09592_24473_c1_2937_3284 | 115 |
| 967 | 3300050508 | nmdc:mga09592_3707_c1 | nmdc:mga09592_3707_c1_11700_12047 | 115 |
| 968 | 3300050508 | nmdc:mga09592_761574_c1 | nmdc:mga09592_761574_c1_47_394 | 115 |
| 969 | 3300050509 | nmdc:mga0qj67_161722_c1 | nmdc:mga0qj67_161722_c1_81_428 | 115 |
| 970 | 3300050509 | nmdc:mga0qj67_57517_c1 | nmdc:mga0qj67_57517_c1_2594_2941 | 115 |
| 971 | 3300050509 | nmdc:mga0qj67_8509_c1 | nmdc:mga0qj67_8509_c1_7012_7359 | 115 |
| 972 | 3300050510 | nmdc:mga06r32_192768_c1 | nmdc:mga06r32_192768_c1_927_1274 | 115 |
| 973 | 3300050510 | nmdc:mga06r32_4912_c1 | nmdc:mga06r32_4912_c1_9688_10035 | 115 |
| 974 | 3300050512 | nmdc:mga0n895_65296_c1 | nmdc:mga0n895_65296_c1_1839_2186 | 115 |
| 975 | 3300050513 | nmdc:mga0rr50_477152_c1 | nmdc:mga0rr50_477152_c1_61_408 | 115 |
| 976 | 3300050515 | nmdc:mga0a205_1093_c1 | nmdc:mga0a205_1093_c1_3159_3506 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p4f-assembly1.cif.gz_Z | structural insights into human co-transcriptional capping - structure 6 | 0.8706 | 60 | 101 |
| 6rm3-assembly1.cif.gz_SE0 | evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome | 0.8589 | 58 | 104 |
| 6nby-assembly1.cif.gz_S | t.elongatus ndh (composite model) | 0.8331 | 58 | 101 |
| 8p5d-assembly1.cif.gz_SE0 | spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging | 0.8324 | 58 | 101 |
| 5fhg-assembly2.cif.gz_B | structure of unliganded pif1 from bacteroides sp | 0.8149 | 58 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JMV5_458_522_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.88 | 58 | 101 | 2.30.30.30 |
| af_P9WL75_5_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8738 | 25 | 100 | 2.40.50.140 |
| 4ytlB01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8725 | 58 | 101 | 2.30.30.30 |
| af_O13936_472_519_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8704 | 58 | 100 | 2.30.30.30 |
| af_A4I326_463_511_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8615 | 58 | 98 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836TGG7-F1-model_v4 | Preprotein translocase subunit YajC | 0.9327 | 30 | 103 |
GO:0005886
GO:0015031 |
| AF-A0A7V7B1V3-F1-model_v4 | Preprotein translocase subunit YajC | 0.9231 | 25 | 105 |
GO:0005886
GO:0015031 |
| AF-A0A7C6GX53-F1-model_v4 | Preprotein translocase subunit YajC | 0.9196 | 25 | 104 |
GO:0005886
GO:0015031 |
| AF-A0A357NA30-F1-model_v4 | Preprotein translocase subunit YajC | 0.9196 | 24 | 103 |
GO:0005886
GO:0015031 |
| AF-A0A7C6S739-F1-model_v4 | Preprotein translocase subunit YajC | 0.9122 | 20 | 103 |
GO:0005886
GO:0015031 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar