F487211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 974 | 772 | 427 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300041498|Ga0451841_0234680|Ga0451841_0234680_209_982 |
| Length | 257 |
| Sequence | MASRRNNDARGKGLEGAVLALHMRLEMKEIAMTDTGTGHFEQDTKRLSLSRRSFVGGLAVVAALAFIGMPIEPAQAQQSVVAQKIANHFASVKTMSGEFVQFGPRGEQTGGKFFISRPGKIRFNYDAPSPMRVISDGRTVVIGNQKMKTWDVYPLSKTPLKLLLSDEIDLSGKMVRDVKEEPDLITIVLGDRTIFGDATITLMFDPKTYDLRQWTITDNQGKDTSVMVFNVKTGMQFDDKVFKVPYEVIPGTAAYRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 12 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 17 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 22 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 23 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 24 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 29 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 32 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 33 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 34 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 35 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 36 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 37 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 38 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 39 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 40 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 41 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 42 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 43 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 44 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 45 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 46 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 47 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 48 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 49 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 50 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 51 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 52 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 53 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 54 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 55 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 56 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 57 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 58 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 59 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 60 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 61 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 62 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 63 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 64 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 65 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 66 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 67 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 68 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 69 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 70 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 71 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 72 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 73 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 74 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 75 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 76 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 77 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 78 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 79 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 80 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 81 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 82 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 83 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 84 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 85 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 86 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 87 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 88 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 89 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 90 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 91 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 92 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 93 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 94 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 95 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 96 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 97 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 98 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 99 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 100 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 101 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 102 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 103 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 104 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 105 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 106 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 107 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 108 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 109 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 110 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 111 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 112 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 113 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 114 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 115 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 116 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 117 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 118 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 119 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 120 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 121 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 122 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 123 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 124 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 125 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 126 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 127 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 128 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 129 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 130 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 131 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 132 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 133 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 134 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 135 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 136 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 137 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 138 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 139 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 140 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 141 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 142 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 143 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 144 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 145 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 146 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 147 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 148 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 149 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 150 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 151 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 152 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 153 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 154 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 155 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 156 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 157 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 158 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 159 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 160 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 161 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 162 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 163 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 164 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 165 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 166 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 167 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 168 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 169 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 170 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 171 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 172 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 173 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 174 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 175 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 176 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 177 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 178 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 179 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 180 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 181 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 182 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 183 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 184 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 185 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 186 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 187 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 188 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 189 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 190 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 191 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 192 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 193 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 194 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 195 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 196 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 197 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 198 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 199 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 200 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 201 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 202 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 203 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 204 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 205 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 206 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 207 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 208 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 209 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 210 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 211 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 212 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 213 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 214 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 215 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 216 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 217 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 218 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 219 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 220 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 221 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 222 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 223 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 224 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 225 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 226 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 227 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 228 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 229 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 230 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 231 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 232 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 233 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 234 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 235 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 236 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 237 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 238 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 239 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 240 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 241 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 242 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 243 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 244 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 245 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 246 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 247 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 248 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 249 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 250 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 251 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 252 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 253 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 254 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 255 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 256 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 257 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 258 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 259 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 260 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 261 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 262 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 263 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 264 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 265 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 266 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 267 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 268 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 269 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 270 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 271 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 272 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 273 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 274 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 275 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 276 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 277 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 278 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 279 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 280 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 281 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 282 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 283 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 284 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 285 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 286 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 287 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 288 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 289 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 290 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 291 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 292 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 293 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 294 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 295 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 296 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 297 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 298 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 299 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 300 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 301 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 302 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 303 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 304 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 305 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 306 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 307 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 308 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 309 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 310 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 311 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 312 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 313 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 314 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 315 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 316 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 317 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 318 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 319 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 320 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 321 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 322 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 323 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 324 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 325 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 326 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 327 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 328 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 329 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 330 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 331 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 332 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 333 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 334 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 335 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 336 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 337 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 338 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 339 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 340 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 341 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 342 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 343 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 344 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 345 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 346 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 347 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 348 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 349 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 350 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 351 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 352 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 353 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 354 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 355 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 356 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 357 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 358 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 359 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 360 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 361 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 362 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 363 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 364 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 365 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 366 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 367 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 368 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 369 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 370 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 371 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 372 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 373 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 374 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 375 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 376 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 377 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 378 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 379 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 380 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 381 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 382 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 383 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 384 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 385 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 386 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 387 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 388 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 389 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 390 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 391 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 392 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 393 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 394 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 395 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 396 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 397 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 398 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 399 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 400 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 401 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 402 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 403 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 404 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 405 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 406 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 407 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 408 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 409 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 410 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 411 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 412 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 413 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 414 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 415 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 416 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 417 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 418 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 419 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 420 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 421 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 422 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 423 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 424 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 425 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 426 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 427 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 428 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 429 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 430 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 431 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 432 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 433 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 434 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 435 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 436 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 437 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 438 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 439 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 440 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 441 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 442 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 443 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 444 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 445 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 446 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 447 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 448 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 449 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 450 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 451 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 452 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 453 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 454 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 455 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 456 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 457 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 458 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 459 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 460 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 461 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 462 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 463 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 464 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 465 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 466 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 467 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 468 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 469 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 470 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 471 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 472 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 473 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 474 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 475 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 476 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 477 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 478 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 479 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 480 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 481 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 482 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 483 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 484 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 485 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 486 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 487 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 488 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 489 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 490 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 491 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 492 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 493 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 494 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 495 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 496 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 497 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 498 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 499 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 500 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 501 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 502 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 503 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 504 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 505 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 506 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 507 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 508 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 509 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 510 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 511 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 512 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 513 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 514 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 515 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 516 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 517 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 518 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 519 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 520 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 521 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 522 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 524 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 525 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 526 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 527 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 528 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 529 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 530 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 531 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 532 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 533 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 534 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 535 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 537 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 538 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 539 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 541 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 542 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 543 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 544 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 545 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 548 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 550 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 551 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 553 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 554 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 555 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 556 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 557 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 558 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 560 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 561 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 562 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 563 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 564 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 566 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 569 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 570 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 576 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 578 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 581 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 582 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 583 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 584 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 585 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 586 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 587 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 588 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 589 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 590 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 591 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 592 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 593 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 594 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 595 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 596 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 597 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 598 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 599 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 600 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 601 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 602 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 603 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 604 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 605 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 606 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 607 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 608 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 609 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 610 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 611 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 612 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 613 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 614 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 615 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 616 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 617 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 618 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 619 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 620 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 665 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 666 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 667 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 668 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 669 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 670 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 671 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 672 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 673 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 674 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 675 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 676 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 677 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 678 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 679 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 681 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 683 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 688 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 690 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 691 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 692 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 693 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 695 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 696 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 697 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 698 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 699 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 702 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 703 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 704 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 705 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 706 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 707 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 708 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 709 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 710 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 711 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 712 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 713 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 714 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 715 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 716 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 717 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 718 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 719 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 720 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 721 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 722 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 723 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 724 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 725 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 726 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 727 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 728 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 729 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 730 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 731 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 732 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 733 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 734 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 735 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 736 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 737 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 738 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 739 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 740 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 741 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 742 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 743 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 744 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 745 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 746 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 747 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 748 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 749 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 750 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 751 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 752 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 753 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 754 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 755 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 756 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 757 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 758 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 759 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 760 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 761 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 762 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 763 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 764 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 765 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 766 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 767 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 768 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 769 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 770 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 771 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 772 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 42.81 |
| Metatranscriptomes | 1.13 |
| Isolates | 56.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.51 |
| Bulb | 0 |
| Endosphere | 16.63 |
| Nodule | 43.94 |
| Rhizoplane | 1.64 |
| Rhizosphere | 21.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1002834 | 3300002739 | Bacteria | 2749 |
| 2 | JGI25152J39213_1002324 | 3300002773 | Bacteria | 7310 |
| 3 | JGI25159J45721_1000017 | 3300002987 | Bacteria | 136127 |
| 4 | JGI25159J45721_1004034 | 3300002987 | Bacteria | 4994 |
| 5 | JGI25159J45721_1021911 | 3300002987 | Bacteria | 1193 |
| 6 | JGI25151J46595_10007018 | 3300003187 | Bacteria | 5574 |
| 7 | JGI25151J46595_10010459 | 3300003187 | Bacteria | 4311 |
| 8 | JGI25151J46595_10059924 | 3300003187 | Bacteria | 1221 |
| 9 | JGI25153J46596_10020535 | 3300003215 | Bacteria | 2496 |
| 10 | JGI25153J46596_10031626 | 3300003215 | Bacteria | 1777 |
| 11 | rootH1_10034948 | 3300003316 | Bacteria | 1280 |
| 12 | JGI25160J50197_1000027 | 3300003354 | Bacteria | 182809 |
| 13 | JGI25160J50197_1001577 | 3300003354 | Bacteria | 11246 |
| 14 | JGI25160J50197_1001979 | 3300003354 | Bacteria | 9773 |
| 15 | JGI25161J50226_1000327 | 3300003374 | Bacteria | 25949 |
| 16 | JGI25161J50226_1000531 | 3300003374 | Bacteria | 16373 |
| 17 | JGI25161J50226_1006452 | 3300003374 | Bacteria | 2119 |
| 18 | Ga0006562J51391_1022330 | 3300003578 | Bacteria | 1402 |
| 19 | Ga0055526_1000643 | 3300003771 | Bacteria | 27115 |
| 20 | Ga0055526_1005398 | 3300003771 | Bacteria | 7358 |
| 21 | Ga0055526_1005433 | 3300003771 | Bacteria | 7329 |
| 22 | Ga0055526_1005536 | 3300003771 | Bacteria | 7219 |
| 23 | Ga0055526_1017612 | 3300003771 | Bacteria | 2719 |
| 24 | Ga0055524_1002302 | 3300003775 | Bacteria | 9956 |
| 25 | Ga0055524_1003673 | 3300003775 | Bacteria | 7355 |
| 26 | Ga0055524_1005096 | 3300003775 | Bacteria | 5940 |
| 27 | Ga0055524_1011296 | 3300003775 | Bacteria | 3503 |
| 28 | Ga0055524_1048603 | 3300003775 | Bacteria | 988 |
| 29 | Ga0055536_1017490 | 3300003781 | Bacteria | 2344 |
| 30 | Ga0055528_1000099 | 3300003790 | Bacteria | 68463 |
| 31 | Ga0055528_1003438 | 3300003790 | Bacteria | 7948 |
| 32 | Ga0055528_1013626 | 3300003790 | Bacteria | 3068 |
| 33 | Ga0055528_1014903 | 3300003790 | Bacteria | 2841 |
| 34 | Ga0055528_1021135 | 3300003790 | Bacteria | 2078 |
| 35 | Ga0055528_1023836 | 3300003790 | Bacteria | 1853 |
| 36 | Ga0055530_10013633 | 3300003791 | Bacteria | 2761 |
| 37 | Ga0055530_10016995 | 3300003791 | Bacteria | 2294 |
| 38 | Ga0055540_1001518 | 3300003792 | Bacteria | 13685 |
| 39 | Ga0055540_1011023 | 3300003792 | Bacteria | 2953 |
| 40 | Ga0055540_1014849 | 3300003792 | Bacteria | 2299 |
| 41 | Ga0055540_1025164 | 3300003792 | Bacteria | 1463 |
| 42 | Ga0055531_10004886 | 3300003794 | Bacteria | 7984 |
| 43 | Ga0055531_10006983 | 3300003794 | Bacteria | 6271 |
| 44 | Ga0058692_1003573 | 3300003856 | Bacteria | 4777 |
| 45 | Ga0055543_1000030 | 3300004625 | Bacteria | 130849 |
| 46 | Ga0055543_1000062 | 3300004625 | Bacteria | 98034 |
| 47 | Ga0055543_1000683 | 3300004625 | Bacteria | 17717 |
| 48 | Ga0065165_1000122 | 3300005262 | Bacteria | 132524 |
| 49 | Ga0065165_1006272 | 3300005262 | Bacteria | 6307 |
| 50 | Ga0065165_1009106 | 3300005262 | Bacteria | 4508 |
| 51 | Ga0065165_1029849 | 3300005262 | Bacteria | 1741 |
| 52 | Ga0065704_10227534 | 3300005289 | Bacteria | 1054 |
| 53 | Ga0070668_100459624 | 3300005347 | Bacteria | 1096 |
| 54 | Ga0070669_100322310 | 3300005353 | Bacteria | 1248 |
| 55 | Ga0070663_100022278 | 3300005455 | Bacteria | 4233 |
| 56 | Ga0070665_100006303 | 3300005548 | Bacteria | 12112 |
| 57 | Ga0070665_100006674 | 3300005548 | Bacteria | 11735 |
| 58 | Ga0070665_100042480 | 3300005548 | Bacteria | 4570 |
| 59 | Ga0070665_100073568 | 3300005548 | Bacteria | 3423 |
| 60 | Ga0081455_10214110 | 3300005937 | Bacteria | 1433 |
| 61 | Ga0075365_10002199 | 3300006038 | Bacteria | 9406 |
| 62 | Ga0075365_10030487 | 3300006038 | Bacteria | 3454 |
| 63 | Ga0075365_10063834 | 3300006038 | Bacteria | 2466 |
| 64 | Ga0075368_10070007 | 3300006042 | Bacteria | 1415 |
| 65 | Ga0075363_100175330 | 3300006048 | Bacteria | 1218 |
| 66 | Ga0075364_10012700 | 3300006051 | Bacteria | 5162 |
| 67 | Ga0075362_10010559 | 3300006177 | Bacteria | 3609 |
| 68 | Ga0075362_10022089 | 3300006177 | Bacteria | 2677 |
| 69 | Ga0075367_10081119 | 3300006178 | Bacteria | 1963 |
| 70 | Ga0075369_10002960 | 3300006186 | Bacteria | 6137 |
| 71 | Ga0075369_10002996 | 3300006186 | Bacteria | 6104 |
| 72 | Ga0075369_10012747 | 3300006186 | Bacteria | 3322 |
| 73 | Ga0075369_10071463 | 3300006186 | Bacteria | 1527 |
| 74 | Ga0075366_10008756 | 3300006195 | Bacteria | 5634 |
| 75 | Ga0075366_10364364 | 3300006195 | Bacteria | 888 |
| 76 | Ga0075370_10176647 | 3300006353 | Bacteria | 1256 |
| 77 | Ga0075370_10218378 | 3300006353 | Bacteria | 1126 |
| 78 | Ga0079104_1000195 | 3300006946 | Bacteria | 85244 |
| 79 | Ga0079104_1003980 | 3300006946 | Bacteria | 6577 |
| 80 | Ga0079104_1011776 | 3300006946 | Bacteria | 2790 |
| 81 | Ga0099826_10001615 | 3300006948 | Bacteria | 13773 |
| 82 | Ga0105243_10243624 | 3300009148 | Bacteria | 1601 |
| 83 | Ga0123340_1053783 | 3300009763 | Bacteria | 1368 |
| 84 | Ga0123341_1000009 | 3300009765 | Bacteria | 122597 |
| 85 | Ga0123341_1044992 | 3300009765 | Bacteria | 2698 |
| 86 | Ga0123342_1005742 | 3300009766 | Bacteria | 17739 |
| 87 | Ga0123342_1014739 | 3300009766 | Bacteria | 7359 |
| 88 | Ga0105246_10024870 | 3300011119 | Bacteria | 3898 |
| 89 | Ga0157322_1000554 | 3300012490 | Bacteria | 1460 |
| 90 | Ga0157314_1007373 | 3300012500 | Bacteria | 885 |
| 91 | Ga0157313_1001433 | 3300012503 | Bacteria | 1285 |
| 92 | Ga0157326_1003420 | 3300012513 | Bacteria | 1671 |
| 93 | Ga0157373_10023861 | 3300013100 | Bacteria | 4432 |
| 94 | Ga0157373_10107542 | 3300013100 | Bacteria | 1961 |
| 95 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 96 | Ga0157371_10147068 | 3300013102 | Bacteria | 1679 |
| 97 | Ga0157370_10000469 | 3300013104 | Bacteria | 50288 |
| 98 | Ga0157370_10110472 | 3300013104 | Bacteria | 2570 |
| 99 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 100 | Ga0163162_10791940 | 3300013306 | Bacteria | 1066 |
| 101 | Ga0183365_10029 | 3300015684 | Bacteria | 2921 |
| 102 | Ga0183363_1019 | 3300015690 | Bacteria | 61083 |
| 103 | Ga0163161_10425723 | 3300017792 | Bacteria | 1069 |
| 104 | Ga0214544_1000024 | 3300021320 | Bacteria | 163562 |
| 105 | Ga0214542_1000008 | 3300021321 | Bacteria | 278895 |
| 106 | Ga0214542_1013885 | 3300021321 | Bacteria | 9351 |
| 107 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 108 | Ga0214543_1000031 | 3300021327 | Bacteria | 206436 |
| 109 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 110 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 111 | Ga0209436_100018 | 3300025208 | Bacteria | 113499 |
| 112 | Ga0209436_100540 | 3300025208 | Bacteria | 16420 |
| 113 | Ga0209563_102086 | 3300025230 | Bacteria | 4725 |
| 114 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 115 | Ga0209129_1001394 | 3300025258 | Bacteria | 13509 |
| 116 | Ga0209129_1002591 | 3300025258 | Bacteria | 8663 |
| 117 | Ga0209129_1015400 | 3300025258 | Bacteria | 1576 |
| 118 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 119 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 120 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 121 | Ga0209673_1001738 | 3300025273 | Bacteria | 18304 |
| 122 | Ga0209673_1002049 | 3300025273 | Bacteria | 15257 |
| 123 | Ga0209673_1012763 | 3300025273 | Bacteria | 3361 |
| 124 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 125 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 126 | Ga0209130_1011628 | 3300025284 | Bacteria | 2347 |
| 127 | Ga0209675_1036862 | 3300025291 | Bacteria | 1104 |
| 128 | Ga0209676_1000406 | 3300025292 | Bacteria | 77603 |
| 129 | Ga0209676_1011701 | 3300025292 | Bacteria | 3512 |
| 130 | Ga0209676_1034641 | 3300025292 | Bacteria | 1490 |
| 131 | Ga0209676_1046264 | 3300025292 | Bacteria | 1178 |
| 132 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 133 | Ga0209025_1000241 | 3300025294 | Bacteria | 128329 |
| 134 | Ga0209025_1000335 | 3300025294 | Bacteria | 103615 |
| 135 | Ga0209025_1001416 | 3300025294 | Bacteria | 31774 |
| 136 | Ga0209025_1002567 | 3300025294 | Bacteria | 18887 |
| 137 | Ga0209564_1000111 | 3300025295 | Bacteria | 212210 |
| 138 | Ga0209564_1001330 | 3300025295 | Bacteria | 26421 |
| 139 | Ga0209564_1002296 | 3300025295 | Bacteria | 15576 |
| 140 | Ga0209564_1005228 | 3300025295 | Bacteria | 7506 |
| 141 | Ga0209564_1011899 | 3300025295 | Bacteria | 3850 |
| 142 | Ga0209564_1012761 | 3300025295 | Bacteria | 3633 |
| 143 | Ga0209758_1000896 | 3300025297 | Bacteria | 40464 |
| 144 | Ga0209758_1001119 | 3300025297 | Bacteria | 34539 |
| 145 | Ga0209758_1001936 | 3300025297 | Bacteria | 22483 |
| 146 | Ga0209758_1002583 | 3300025297 | Bacteria | 18175 |
| 147 | Ga0209050_1003192 | 3300025298 | Bacteria | 12413 |
| 148 | Ga0209050_1010152 | 3300025298 | Bacteria | 4684 |
| 149 | Ga0209256_1000773 | 3300025299 | Bacteria | 41485 |
| 150 | Ga0209256_1003224 | 3300025299 | Bacteria | 11772 |
| 151 | Ga0209256_1003248 | 3300025299 | Bacteria | 11690 |
| 152 | Ga0209256_1003350 | 3300025299 | Bacteria | 11360 |
| 153 | Ga0209256_1007011 | 3300025299 | Bacteria | 5722 |
| 154 | Ga0209256_1010945 | 3300025299 | Bacteria | 3712 |
| 155 | Ga0209256_1030564 | 3300025299 | Bacteria | 1486 |
| 156 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 157 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 158 | Ga0207426_1000348 | 3300025302 | Bacteria | 85294 |
| 159 | Ga0209051_1000276 | 3300025303 | Bacteria | 84192 |
| 160 | Ga0209051_1002411 | 3300025303 | Bacteria | 13446 |
| 161 | Ga0209051_1014339 | 3300025303 | Bacteria | 3705 |
| 162 | Ga0209051_1019151 | 3300025303 | Bacteria | 2999 |
| 163 | Ga0209051_1021514 | 3300025303 | Bacteria | 2742 |
| 164 | Ga0209051_1089400 | 3300025303 | Bacteria | 861 |
| 165 | Ga0209257_1002672 | 3300025304 | Bacteria | 17103 |
| 166 | Ga0209257_1005271 | 3300025304 | Bacteria | 9217 |
| 167 | Ga0209257_1022797 | 3300025304 | Bacteria | 2221 |
| 168 | Ga0209257_1071898 | 3300025304 | Bacteria | 909 |
| 169 | Ga0207681_10205936 | 3300025923 | Bacteria | 1513 |
| 170 | Ga0207668_10371521 | 3300025972 | Bacteria | 1201 |
| 171 | Ga0207678_10274835 | 3300026067 | Bacteria | 1445 |
| 172 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 173 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 174 | Ga0209281_1000955 | 3300027111 | Bacteria | 23510 |
| 175 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 176 | Ga0209371_1005695 | 3300027312 | Bacteria | 4867 |
| 177 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 178 | Ga0209282_1001575 | 3300027666 | Bacteria | 12592 |
| 179 | Ga0209813_10034213 | 3300027866 | Bacteria | 1515 |
| 180 | Ga0268266_10005017 | 3300028379 | Bacteria | 12498 |
| 181 | Ga0268266_10045610 | 3300028379 | Bacteria | 3750 |
| 182 | Ga0268266_10184961 | 3300028379 | Bacteria | 1899 |
| 183 | Ga0268266_10416053 | 3300028379 | Bacteria | 1273 |
| 184 | Ga0307515_10004852 | 3300028794 | Bacteria | 27508 |
| 185 | Ga0307515_10016477 | 3300028794 | Bacteria | 13524 |
| 186 | Ga0307515_10289506 | 3300028794 | Bacteria | 1335 |
| 187 | Ga0307515_10401845 | 3300028794 | Bacteria | 995 |
| 188 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 189 | Ga0268256_1005626 | 3300030500 | Bacteria | 4867 |
| 190 | Ga0268256_1027137 | 3300030500 | Bacteria | 1430 |
| 191 | Ga0307513_10351635 | 3300031456 | Bacteria | 1221 |
| 192 | Ga0307408_100082644 | 3300031548 | Bacteria | 2404 |
| 193 | Ga0307408_100556022 | 3300031548 | Bacteria | 1013 |
| 194 | Ga0307405_10001184 | 3300031731 | Bacteria | 10761 |
| 195 | Ga0307405_10114168 | 3300031731 | Bacteria | 1835 |
| 196 | Ga0307406_10018127 | 3300031901 | Bacteria | 4108 |
| 197 | Ga0307406_10175534 | 3300031901 | Bacteria | 1555 |
| 198 | Ga0307412_10604306 | 3300031911 | Bacteria | 929 |
| 199 | Ga0307412_10662089 | 3300031911 | Bacteria | 892 |
| 200 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 201 | Ga0307409_100121494 | 3300031995 | Bacteria | 2213 |
| 202 | Ga0307409_100400516 | 3300031995 | Bacteria | 1311 |
| 203 | Ga0307416_100841465 | 3300032002 | Bacteria | 1015 |
| 204 | Ga0307414_10064453 | 3300032004 | Bacteria | 2609 |
| 205 | Ga0307411_10418280 | 3300032005 | Bacteria | 1113 |
| 206 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 207 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 208 | Ga0373935_0182831 | 3300035692 | Bacteria | 1440 |
| 209 | Ga0373947_0375044 | 3300035725 | Bacteria | 957 |
| 210 | Ga0373925_0001135 | 3300037068 | Bacteria | 23635 |
| 211 | Ga0395905_0012935 | 3300037471 | Bacteria | 8022 |
| 212 | Ga0395905_0045508 | 3300037471 | Bacteria | 4115 |
| 213 | Ga0439436_0021820 | 3300041404 | Bacteria | 1899 |
| 214 | Ga0439436_0024821 | 3300041404 | Bacteria | 1767 |
| 215 | Ga0439436_0040189 | 3300041404 | Bacteria | 1342 |
| 216 | Ga0439439_0059039 | 3300041406 | Bacteria | 1016 |
| 217 | Ga0439466_0024036 | 3300041411 | Bacteria | 2140 |
| 218 | Ga0439465_0008121 | 3300041413 | Bacteria | 3314 |
| 219 | Ga0439465_0016593 | 3300041413 | Bacteria | 2297 |
| 220 | Ga0439465_0045089 | 3300041413 | Bacteria | 1433 |
| 221 | Ga0451797_0377651 | 3300041453 | Bacteria | 745 |
| 222 | Ga0451795_0185263 | 3300041456 | Bacteria | 943 |
| 223 | Ga0451833_1171735 | 3300041491 | Bacteria | 939 |
| 224 | Ga0451839_1307106 | 3300041496 | Bacteria | 1412 |
| 225 | Ga0451841_0234680 | 3300041498 | Bacteria | 1146 |
| 226 | Ga0451841_0643035 | 3300041498 | Bacteria | 2061 |
| 227 | Ga0451847_0449155 | 3300041503 | Bacteria | 1070 |
| 228 | Ga0451849_0061017 | 3300041505 | Bacteria | 1783 |
| 229 | Ga0451851_0052458 | 3300041507 | Bacteria | 1699 |
| 230 | Ga0451853_3609191 | 3300041512 | Bacteria | 948 |
| 231 | Ga0439433_0029146 | 3300041999 | Bacteria | 1259 |
| 232 | Ga0439445_0023871 | 3300042004 | Bacteria | 1551 |
| 233 | Ga0439432_035964 | 3300042006 | Bacteria | 1586 |
| 234 | Ga0439449_0027762 | 3300042007 | Bacteria | 2111 |
| 235 | Ga0439449_0042768 | 3300042007 | Bacteria | 1683 |
| 236 | Ga0439449_0070391 | 3300042007 | Bacteria | 1289 |
| 237 | Ga0439452_035526 | 3300042010 | Bacteria | 1199 |
| 238 | Ga0450920_018296 | 3300042122 | Bacteria | 1341 |
| 239 | Ga0450906_001942 | 3300042145 | Bacteria | 4520 |
| 240 | Ga0450918_002052 | 3300042531 | Bacteria | 3852 |
| 241 | Ga0466970_0185964 | 3300044765 | Bacteria | 1153 |
| 242 | Ga0495629_0021063 | 3300046459 | Bacteria | 4652 |
| 243 | Ga0495638_0046858 | 3300046460 | Bacteria | 2713 |
| 244 | Ga0495651_0263144 | 3300046462 | Bacteria | 1173 |
| 245 | Ga0495605_0063077 | 3300046474 | Bacteria | 1769 |
| 246 | Ga0495605_0064505 | 3300046474 | Bacteria | 1744 |
| 247 | Ga0495662_0002196 | 3300046476 | Bacteria | 9820 |
| 248 | Ga0495664_0075784 | 3300046477 | Bacteria | 2013 |
| 249 | Ga0495585_0052303 | 3300046492 | Bacteria | 2261 |
| 250 | Ga0495585_0069684 | 3300046492 | Bacteria | 1919 |
| 251 | Ga0495596_0029987 | 3300046500 | Bacteria | 2179 |
| 252 | Ga0495607_0093888 | 3300046501 | Bacteria | 1619 |
| 253 | Ga0495607_0123208 | 3300046501 | Bacteria | 1358 |
| 254 | Ga0495583_0008838 | 3300046506 | Bacteria | 6096 |
| 255 | Ga0495583_0027490 | 3300046506 | Bacteria | 2808 |
| 256 | Ga0495606_0004841 | 3300046507 | Bacteria | 13213 |
| 257 | Ga0495606_0023480 | 3300046507 | Bacteria | 4466 |
| 258 | Ga0495606_0038290 | 3300046507 | Bacteria | 3246 |
| 259 | Ga0495606_0093671 | 3300046507 | Bacteria | 1842 |
| 260 | Ga0495610_0004675 | 3300046512 | Bacteria | 10016 |
| 261 | Ga0495616_0049134 | 3300046513 | Bacteria | 2116 |
| 262 | Ga0495628_0323437 | 3300046516 | Bacteria | 1138 |
| 263 | Ga0495630_0493610 | 3300046517 | Bacteria | 939 |
| 264 | Ga0495631_0076482 | 3300046518 | Bacteria | 1445 |
| 265 | Ga0495632_0012381 | 3300046519 | Bacteria | 4923 |
| 266 | Ga0495643_0017636 | 3300046522 | Bacteria | 4168 |
| 267 | Ga0495648_0075848 | 3300046524 | Bacteria | 1932 |
| 268 | Ga0495648_0096933 | 3300046524 | Bacteria | 1637 |
| 269 | Ga0495654_0000231 | 3300046530 | Bacteria | 52162 |
| 270 | Ga0495654_0139768 | 3300046530 | Bacteria | 1080 |
| 271 | Ga0495654_0179787 | 3300046530 | Bacteria | 917 |
| 272 | Ga0495597_0018375 | 3300046542 | Bacteria | 3281 |
| 273 | Ga0495633_0018967 | 3300046558 | Bacteria | 3482 |
| 274 | Ga0495633_0094714 | 3300046558 | Bacteria | 1387 |
| 275 | Ga0495633_0100472 | 3300046558 | Bacteria | 1343 |
| 276 | Ga0495633_0122295 | 3300046558 | Bacteria | 1206 |
| 277 | Ga0495656_0048765 | 3300046615 | Bacteria | 1801 |
| 278 | Ga0495656_0060490 | 3300046615 | Bacteria | 1651 |
| 279 | Ga0495634_0147610 | 3300046642 | Bacteria | 1489 |
| 280 | Ga0495611_0076418 | 3300046648 | Bacteria | 1535 |
| 281 | Ga0495625_0174510 | 3300046660 | Bacteria | 1433 |
| 282 | Ga0495625_0284719 | 3300046660 | Bacteria | 1062 |
| 283 | Ga0495625_0397050 | 3300046660 | Bacteria | 862 |
| 284 | Ga0495635_0076020 | 3300046663 | Bacteria | 2301 |
| 285 | Ga0495661_0062968 | 3300046665 | Bacteria | 2195 |
| 286 | Ga0495661_0304767 | 3300046665 | Bacteria | 796 |
| 287 | Ga0495588_0001500 | 3300046674 | Bacteria | 9995 |
| 288 | Ga0495588_0084686 | 3300046674 | Bacteria | 1657 |
| 289 | Ga0495657_0055172 | 3300046675 | Bacteria | 2652 |
| 290 | Ga0495624_0048415 | 3300046690 | Bacteria | 2698 |
| 291 | Ga0495670_0067595 | 3300046691 | Bacteria | 1804 |
| 292 | Ga0495670_0087181 | 3300046691 | Bacteria | 1595 |
| 293 | Ga0495671_0047425 | 3300046692 | Bacteria | 2147 |
| 294 | Ga0495671_0095584 | 3300046692 | Bacteria | 1454 |
| 295 | Ga0495649_0041540 | 3300046694 | Bacteria | 2515 |
| 296 | Ga0495589_0181131 | 3300046794 | Bacteria | 999 |
| 297 | Ga0495600_0012554 | 3300046809 | Bacteria | 5300 |
| 298 | Ga0495660_0032470 | 3300046810 | Bacteria | 2931 |
| 299 | Ga0495604_0008757 | 3300047317 | Bacteria | 7996 |
| 300 | Ga0495674_0259817 | 3300047319 | Bacteria | 1427 |
| 301 | Ga0495679_042957 | 3300047446 | Bacteria | 1392 |
| 302 | Ga0495685_039926 | 3300047447 | Bacteria | 1606 |
| 303 | Ga0495673_0106409 | 3300047469 | Bacteria | 1127 |
| 304 | Ga0495681_0013535 | 3300047470 | Bacteria | 4726 |
| 305 | Ga0495681_0115224 | 3300047470 | Bacteria | 1159 |
| 306 | Ga0495686_0005368 | 3300047472 | Bacteria | 10133 |
| 307 | Ga0495686_0010402 | 3300047472 | Bacteria | 6622 |
| 308 | Ga0495686_0011801 | 3300047472 | Bacteria | 6147 |
| 309 | Ga0495686_0052740 | 3300047472 | Bacteria | 2549 |
| 310 | Ga0496106_0001539 | 3300048909 | Bacteria | 17349 |
| 311 | Ga0496106_0063105 | 3300048909 | Bacteria | 2815 |
| 312 | Ga0496107_0184142 | 3300048910 | Bacteria | 1551 |
| 313 | Ga0496111_0004183 | 3300048914 | Bacteria | 9080 |
| 314 | Ga0496113_0055444 | 3300048916 | Bacteria | 2971 |
| 315 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 316 | Ga0496116_0107877 | 3300048919 | Bacteria | 1645 |
| 317 | Ga0496116_0223078 | 3300048919 | Bacteria | 963 |
| 318 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 319 | Ga0496117_0005347 | 3300048920 | Bacteria | 13534 |
| 320 | Ga0496117_0008737 | 3300048920 | Bacteria | 9569 |
| 321 | Ga0496117_0147223 | 3300048920 | Bacteria | 1400 |
| 322 | Ga0496118_0003281 | 3300048921 | Bacteria | 20588 |
| 323 | Ga0496118_0038447 | 3300048921 | Bacteria | 3835 |
| 324 | Ga0496119_0047363 | 3300048922 | Bacteria | 2675 |
| 325 | Ga0496120_0001350 | 3300048923 | Bacteria | 30183 |
| 326 | Ga0496120_0006260 | 3300048923 | Bacteria | 9188 |
| 327 | Ga0496120_0070276 | 3300048923 | Bacteria | 1926 |
| 328 | Ga0496120_0305439 | 3300048923 | Bacteria | 727 |
| 329 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 330 | Ga0496121_0029870 | 3300048924 | Bacteria | 5022 |
| 331 | Ga0496121_0053928 | 3300048924 | Bacteria | 3364 |
| 332 | Ga0496121_0063751 | 3300048924 | Bacteria | 3008 |
| 333 | Ga0496121_0247956 | 3300048924 | Bacteria | 1237 |
| 334 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 335 | Ga0496122_0000984 | 3300048925 | Bacteria | 50862 |
| 336 | Ga0496122_0004338 | 3300048925 | Bacteria | 17735 |
| 337 | Ga0496122_0056159 | 3300048925 | Bacteria | 2938 |
| 338 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 339 | Ga0496123_0000062 | 3300048926 | Bacteria | 219882 |
| 340 | Ga0496123_0000290 | 3300048926 | Bacteria | 98053 |
| 341 | Ga0496123_0028666 | 3300048926 | Bacteria | 4115 |
| 342 | Ga0496123_0161416 | 3300048926 | Bacteria | 1194 |
| 343 | Ga0496124_0001510 | 3300048927 | Bacteria | 33896 |
| 344 | Ga0496124_0007783 | 3300048927 | Bacteria | 11317 |
| 345 | Ga0496124_0065069 | 3300048927 | Bacteria | 3042 |
| 346 | Ga0496124_0066095 | 3300048927 | Bacteria | 3013 |
| 347 | Ga0496124_0077454 | 3300048927 | Bacteria | 2742 |
| 348 | Ga0496124_0080888 | 3300048927 | Bacteria | 2672 |
| 349 | Ga0496124_0133806 | 3300048927 | Bacteria | 1966 |
| 350 | Ga0496124_0189034 | 3300048927 | Bacteria | 1578 |
| 351 | Ga0496124_0226918 | 3300048927 | Bacteria | 1399 |
| 352 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 353 | Ga0496125_0007081 | 3300048928 | Bacteria | 11973 |
| 354 | Ga0496125_0065387 | 3300048928 | Bacteria | 2881 |
| 355 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 356 | Ga0496126_0001347 | 3300048929 | Bacteria | 38995 |
| 357 | Ga0496126_0030825 | 3300048929 | Bacteria | 5076 |
| 358 | Ga0496126_0082000 | 3300048929 | Bacteria | 2851 |
| 359 | Ga0496126_0130745 | 3300048929 | Bacteria | 2169 |
| 360 | Ga0496126_0150463 | 3300048929 | Bacteria | 1995 |
| 361 | Ga0495678_022752 | 3300049459 | Bacteria | 2736 |
| 362 | Ga0501316_020356 | 3300049532 | Bacteria | 832 |
| 363 | Ga0501335_004751 | 3300049551 | Bacteria | 1198 |
| 364 | Ga0501032_0052710 | 3300049569 | Bacteria | 2741 |
| 365 | Ga0501033_0003534 | 3300049570 | Bacteria | 12786 |
| 366 | Ga0501033_0036210 | 3300049570 | Bacteria | 3699 |
| 367 | Ga0501034_0446120 | 3300049571 | Bacteria | 1212 |
| 368 | Ga0501038_0187833 | 3300049574 | Bacteria | 1664 |
| 369 | Ga0501043_0029008 | 3300049579 | Bacteria | 4344 |
| 370 | Ga0501046_0123027 | 3300049580 | Bacteria | 1973 |
| 371 | Ga0501070_0083601 | 3300049586 | Bacteria | 2643 |
| 372 | Ga0501073_0112082 | 3300049589 | Bacteria | 1892 |
| 373 | Ga0501238_013334 | 3300049671 | Bacteria | 1119 |
| 374 | Ga0501238_020333 | 3300049671 | Bacteria | 936 |
| 375 | Ga0501083_0021315 | 3300049744 | Bacteria | 4502 |
| 376 | Ga0501280_001610 | 3300049776 | Bacteria | 4059 |
| 377 | Ga0501035_0000551 | 3300049822 | Bacteria | 41644 |
| 378 | Ga0501035_0229477 | 3300049822 | Bacteria | 1582 |
| 379 | nmdc:mga03n38_120870_c1 | 3300050490 | Bacteria | 1287 |
| 380 | nmdc:mga03n38_300735_c1 | 3300050490 | Bacteria | 862 |
| 381 | nmdc:mga00v17_243645_c1 | 3300050491 | Bacteria | 1166 |
| 382 | nmdc:mga00v17_491828_c1 | 3300050491 | Bacteria | 795 |
| 383 | nmdc:mga00v17_545_c1 | 3300050491 | Bacteria | 21081 |
| 384 | nmdc:mga00v17_7169_c1 | 3300050491 | Bacteria | 5939 |
| 385 | nmdc:mga0yw44_127892_c1 | 3300050492 | Bacteria | 1642 |
| 386 | nmdc:mga0yw44_20321_c1 | 3300050492 | Bacteria | 3683 |
| 387 | nmdc:mga0yw44_334496_c1 | 3300050492 | Bacteria | 1018 |
| 388 | nmdc:mga0yw44_88586_c1 | 3300050492 | Bacteria | 1952 |
| 389 | nmdc:mga06z11_171671_c1 | 3300050494 | Bacteria | 1246 |
| 390 | nmdc:mga06z11_88095_c1 | 3300050494 | Bacteria | 1680 |
| 391 | nmdc:mga0sz30_551_c1 | 3300050516 | Bacteria | 13992 |
| 392 | nmdc:mga0sz30_9548_c1 | 3300050516 | Bacteria | 1861 |
| 393 | Ga0495601_0088286 | 3300053077 | Bacteria | 1994 |
| 394 | Ga0495619_0175564 | 3300053085 | Bacteria | 1482 |
| 395 | Ga0500643_017348 | 3300053087 | Bacteria | 2413 |
| 396 | Ga0500560_003212 | 3300053107 | Bacteria | 3271 |
| 397 | Ga0500562_059141 | 3300053108 | Bacteria | 1029 |
| 398 | Ga0500618_000232 | 3300053125 | Bacteria | 43742 |
| 399 | Ga0500618_004939 | 3300053125 | Bacteria | 4139 |
| 400 | Ga0500618_007819 | 3300053125 | Bacteria | 3021 |
| 401 | Ga0500618_014809 | 3300053125 | Bacteria | 1983 |
| 402 | Ga0500618_045151 | 3300053125 | Bacteria | 1005 |
| 403 | Ga0500658_0000735 | 3300053134 | Bacteria | 13496 |
| 404 | Ga0500658_0026139 | 3300053134 | Bacteria | 2247 |
| 405 | Ga0500559_0048346 | 3300053136 | Bacteria | 1870 |
| 406 | Ga0500561_0000030 | 3300053137 | Bacteria | 29291 |
| 407 | Ga0500568_0007940 | 3300053139 | Bacteria | 5157 |
| 408 | Ga0500590_011317 | 3300053148 | Bacteria | 4515 |
| 409 | Ga0500604_0014189 | 3300053151 | Bacteria | 2167 |
| 410 | Ga0500604_0054772 | 3300053151 | Bacteria | 1239 |
| 411 | Ga0500616_0012716 | 3300053153 | Bacteria | 4918 |
| 412 | Ga0500616_0021142 | 3300053153 | Bacteria | 3652 |
| 413 | Ga0500622_0000541 | 3300053156 | Bacteria | 34818 |
| 414 | Ga0500622_0029751 | 3300053156 | Bacteria | 2870 |
| 415 | Ga0500627_0124400 | 3300053158 | Bacteria | 1164 |
| 416 | Ga0500633_0023461 | 3300053160 | Bacteria | 1904 |
| 417 | Ga0500634_0020365 | 3300053161 | Bacteria | 3586 |
| 418 | Ga0500636_0000040 | 3300053177 | Bacteria | 69881 |
| 419 | Ga0587080_018640 | 3300059503 | Bacteria | 1117 |
| 420 | Ga0587082_054916 | 3300059504 | Bacteria | 770 |
| 421 | Ga0587088_032581 | 3300059508 | Bacteria | 940 |
| 422 | Ga0587090_048732 | 3300059510 | Bacteria | 770 |
| 423 | Ga0587091_041448 | 3300059511 | Bacteria | 909 |
| 424 | Ga0587098_015505 | 3300059604 | Bacteria | 911 |
| 425 | Ga0587068_017695 | 3300059641 | Bacteria | 1141 |
| 426 | Ga0587069_027150 | 3300059642 | Bacteria | 901 |
| 427 | Ga0501082_0122222 | 3300060353 | Bacteria | 2257 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8004300914 | 8004304990 | 184 |
| 2 | 3300048925 | Ga0496122_0004338 | Ga0496122_0004338_565_1281 | 186 |
| 3 | 3300053107 | Ga0500560_003212 | Ga0500560_003212_128_853 | 192 |
| 4 | 3300005548 | Ga0070665_100073568 | Ga0070665_1000735682 | 200 |
| 5 | 3300028379 | Ga0268266_10184961 | Ga0268266_101849612 | 200 |
| 6 | 3300048924 | Ga0496121_0053928 | Ga0496121_0053928_1943_2590 | 200 |
| 7 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_158897_159577 | 200 |
| 8 | 3300049671 | Ga0501238_020333 | Ga0501238_020333_266_913 | 200 |
| 9 | 3300053108 | Ga0500562_059141 | Ga0500562_059141_150_818 | 200 |
| 10 | 3300006038 | Ga0075365_10030487 | Ga0075365_100304874 | 201 |
| 11 | 3300006038 | Ga0075365_10063834 | Ga0075365_100638341 | 201 |
| 12 | 3300006177 | Ga0075362_10022089 | Ga0075362_100220894 | 201 |
| 13 | 3300006186 | Ga0075369_10012747 | Ga0075369_100127474 | 201 |
| 14 | 3300009763 | Ga0123340_1053783 | Ga0123340_10537832 | 201 |
| 15 | 3300009765 | Ga0123341_1044992 | Ga0123341_10449922 | 201 |
| 16 | 3300009766 | Ga0123342_1005742 | Ga0123342_10057421 | 201 |
| 17 | 3300025230 | Ga0209563_102086 | Ga0209563_1020862 | 201 |
| 18 | 3300046530 | Ga0495654_0000231 | Ga0495654_0000231_21206_21844 | 201 |
| 19 | 3300046674 | Ga0495588_0001500 | Ga0495588_0001500_2317_3042 | 201 |
| 20 | 3300047472 | Ga0495686_0011801 | Ga0495686_0011801_1871_2509 | 201 |
| 21 | 3300053125 | Ga0500618_000232 | Ga0500618_000232_1790_2428 | 201 |
| 22 | 3300017792 | Ga0163161_10425723 | Ga0163161_104257231 | 202 |
| 23 | 3300032005 | Ga0307411_10418280 | Ga0307411_104182801 | 202 |
| 24 | 3300048914 | Ga0496111_0004183 | Ga0496111_0004183_4819_5532 | 202 |
| 25 | 3300048920 | Ga0496117_0008737 | Ga0496117_0008737_7267_7962 | 202 |
| 26 | 3300048926 | Ga0496123_0028666 | Ga0496123_0028666_3267_3908 | 202 |
| 27 | 3300048927 | Ga0496124_0066095 | Ga0496124_0066095_1767_2480 | 202 |
| 28 | iso_pu_bacteria | 2599185236 | 2599720350 | 202 |
| 29 | 3300005937 | Ga0081455_10214110 | Ga0081455_102141102 | 203 |
| 30 | 3300048923 | Ga0496120_0305439 | Ga0496120_0305439_97_717 | 203 |
| 31 | iso_pu_bacteria | 2837651117 | 2837651327 | 203 |
| 32 | 3300005548 | Ga0070665_100042480 | Ga0070665_1000424805 | 204 |
| 33 | 3300006946 | Ga0079104_1000195 | Ga0079104_100019514 | 204 |
| 34 | 3300027111 | Ga0209281_1000028 | Ga0209281_100002814 | 204 |
| 35 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028428 | 204 |
| 36 | 3300028379 | Ga0268266_10416053 | Ga0268266_104160532 | 204 |
| 37 | 3300031456 | Ga0307513_10351635 | Ga0307513_103516352 | 204 |
| 38 | 3300041406 | Ga0439439_0059039 | Ga0439439_0059039_11_643 | 204 |
| 39 | 3300044765 | Ga0466970_0185964 | Ga0466970_0185964_480_1127 | 204 |
| 40 | 3300046530 | Ga0495654_0179787 | Ga0495654_0179787_202_849 | 204 |
| 41 | 3300048921 | Ga0496118_0038447 | Ga0496118_0038447_1316_1984 | 204 |
| 42 | 3300048926 | Ga0496123_0000062 | Ga0496123_0000062_73467_74180 | 204 |
| 43 | 3300048927 | Ga0496124_0080888 | Ga0496124_0080888_761_1474 | 204 |
| 44 | 3300050491 | nmdc:mga00v17_491828_c1 | nmdc:mga00v17_491828_c1_27_674 | 204 |
| 45 | iso_pu_bacteria | 2821123053 | 2821128739 | 204 |
| 46 | iso_pu_bacteria | 2838736955 | 2838741755 | 204 |
| 47 | iso_pu_bacteria | 2841840854 | 2841845411 | 204 |
| 48 | iso_pu_bacteria | 2842140634 | 2842145114 | 204 |
| 49 | iso_pu_bacteria | 2857531043 | 2857534108 | 204 |
| 50 | 3300003771 | Ga0055526_1005398 | Ga0055526_10053989 | 205 |
| 51 | 3300003790 | Ga0055528_1003438 | Ga0055528_10034389 | 205 |
| 52 | 3300006051 | Ga0075364_10012700 | Ga0075364_100127004 | 205 |
| 53 | 3300025273 | Ga0209673_1000050 | Ga0209673_100005030 | 205 |
| 54 | 3300025295 | Ga0209564_1002296 | Ga0209564_10022963 | 205 |
| 55 | 3300025299 | Ga0209256_1003224 | Ga0209256_100322412 | 205 |
| 56 | 3300048919 | Ga0496116_0223078 | Ga0496116_0223078_115_810 | 205 |
| 57 | 3300048923 | Ga0496120_0006260 | Ga0496120_0006260_7712_8407 | 205 |
| 58 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_214927_215607 | 205 |
| 59 | 3300048927 | Ga0496124_0226918 | Ga0496124_0226918_573_1253 | 205 |
| 60 | 3300049570 | Ga0501033_0003534 | Ga0501033_0003534_11349_12005 | 205 |
| 61 | 3300049822 | Ga0501035_0000551 | Ga0501035_0000551_39236_39892 | 205 |
| 62 | 3300050491 | nmdc:mga00v17_7169_c1 | nmdc:mga00v17_7169_c1_3781_4461 | 205 |
| 63 | 3300053125 | Ga0500618_004939 | Ga0500618_004939_2896_3567 | 205 |
| 64 | iso_pu_bacteria | 2818991461 | 2819686949 | 205 |
| 65 | iso_pu_bacteria | 2889790730 | 2889791534 | 205 |
| 66 | iso_pu_bacteria | 2889914905 | 2889917278 | 205 |
| 67 | 3300013102 | Ga0157371_10147068 | Ga0157371_101470682 | 206 |
| 68 | 3300013104 | Ga0157370_10110472 | Ga0157370_101104723 | 206 |
| 69 | 3300048927 | Ga0496124_0189034 | Ga0496124_0189034_13_672 | 206 |
| 70 | iso_pu_bacteria | 2600254933 | 2600373223 | 206 |
| 71 | iso_pu_bacteria | 2643221558 | 2643813779 | 206 |
| 72 | iso_pu_bacteria | 8018150411 | 8018153380 | 206 |
| 73 | 3300003215 | JGI25153J46596_10031626 | JGI25153J46596_100316262 | 207 |
| 74 | 3300003781 | Ga0055536_1017490 | Ga0055536_10174902 | 207 |
| 75 | 3300003791 | Ga0055530_10013633 | Ga0055530_100136332 | 207 |
| 76 | 3300003792 | Ga0055540_1014849 | Ga0055540_10148492 | 207 |
| 77 | 3300003794 | Ga0055531_10006983 | Ga0055531_100069836 | 207 |
| 78 | 3300025292 | Ga0209676_1011701 | Ga0209676_10117012 | 207 |
| 79 | 3300025297 | Ga0209758_1001119 | Ga0209758_100111911 | 207 |
| 80 | 3300025303 | Ga0209051_1021514 | Ga0209051_10215142 | 207 |
| 81 | 3300025303 | Ga0209051_1089400 | Ga0209051_10894001 | 207 |
| 82 | 3300025304 | Ga0209257_1022797 | Ga0209257_10227972 | 207 |
| 83 | 3300031548 | Ga0307408_100556022 | Ga0307408_1005560222 | 207 |
| 84 | 3300031731 | Ga0307405_10114168 | Ga0307405_101141682 | 207 |
| 85 | 3300032004 | Ga0307414_10064453 | Ga0307414_100644533 | 207 |
| 86 | 3300042006 | Ga0439432_035964 | Ga0439432_035964_576_1244 | 207 |
| 87 | 3300049671 | Ga0501238_013334 | Ga0501238_013334_113_769 | 207 |
| 88 | 3300053087 | Ga0500643_017348 | Ga0500643_017348_289_945 | 207 |
| 89 | 3300053153 | Ga0500616_0012716 | Ga0500616_0012716_913_1569 | 207 |
| 90 | iso_pu_bacteria | 2510917026 | 2511169591 | 207 |
| 91 | iso_pu_bacteria | 2585427633 | 2585997796 | 207 |
| 92 | iso_pu_bacteria | 2585427634 | 2586002382 | 207 |
| 93 | iso_pu_bacteria | 2643221637 | 2644209450 | 207 |
| 94 | iso_pu_bacteria | 2643221718 | 2644652978 | 207 |
| 95 | iso_pu_bacteria | 2842871566 | 2842873933 | 207 |
| 96 | iso_pu_bacteria | 2854896431 | 2854901705 | 207 |
| 97 | iso_pu_bacteria | 2854916844 | 2854919497 | 207 |
| 98 | iso_pu_bacteria | 2919171160 | 2919175770 | 207 |
| 99 | iso_pu_bacteria | 2928521798 | 2928522828 | 207 |
| 100 | iso_pu_bacteria | 2954011201 | 2954013807 | 207 |
| 101 | iso_pu_bacteria | 8056875544 | 8056878205 | 207 |
| 102 | 3300006038 | Ga0075365_10002199 | Ga0075365_100021999 | 208 |
| 103 | 3300013306 | Ga0163162_10791940 | Ga0163162_107919402 | 208 |
| 104 | 3300041413 | Ga0439465_0045089 | Ga0439465_0045089_388_1056 | 208 |
| 105 | 3300046507 | Ga0495606_0093671 | Ga0495606_0093671_638_1312 | 208 |
| 106 | 3300048929 | Ga0496126_0082000 | Ga0496126_0082000_1173_1832 | 208 |
| 107 | 3300050492 | nmdc:mga0yw44_20321_c1 | nmdc:mga0yw44_20321_c1_1238_1960 | 208 |
| 108 | 3300046501 | Ga0495607_0123208 | Ga0495607_0123208_384_1046 | 209 |
| 109 | 3300046615 | Ga0495656_0048765 | Ga0495656_0048765_494_1168 | 209 |
| 110 | 3300046660 | Ga0495625_0397050 | Ga0495625_0397050_34_708 | 209 |
| 111 | 3300046691 | Ga0495670_0087181 | Ga0495670_0087181_517_1191 | 209 |
| 112 | 3300047472 | Ga0495686_0010402 | Ga0495686_0010402_3843_4583 | 209 |
| 113 | 3300053125 | Ga0500618_014809 | Ga0500618_014809_1125_1787 | 209 |
| 114 | 3300053125 | Ga0500618_045151 | Ga0500618_045151_311_973 | 209 |
| 115 | iso_pu_bacteria | 8055431914 | 8055435546 | 209 |
| 116 | 3300031731 | Ga0307405_10001184 | Ga0307405_100011845 | 210 |
| 117 | 3300046474 | Ga0495605_0063077 | Ga0495605_0063077_625_1299 | 210 |
| 118 | 3300046492 | Ga0495585_0069684 | Ga0495585_0069684_461_1135 | 210 |
| 119 | 3300046506 | Ga0495583_0008838 | Ga0495583_0008838_4857_5531 | 210 |
| 120 | 3300046507 | Ga0495606_0038290 | Ga0495606_0038290_733_1407 | 210 |
| 121 | 3300046518 | Ga0495631_0076482 | Ga0495631_0076482_597_1271 | 210 |
| 122 | 3300046558 | Ga0495633_0100472 | Ga0495633_0100472_46_720 | 210 |
| 123 | 3300046660 | Ga0495625_0174510 | Ga0495625_0174510_189_863 | 210 |
| 124 | 3300046674 | Ga0495588_0084686 | Ga0495588_0084686_669_1343 | 210 |
| 125 | 3300048924 | Ga0496121_0247956 | Ga0496121_0247956_369_1022 | 210 |
| 126 | 3300059504 | Ga0587082_054916 | Ga0587082_054916_85_759 | 210 |
| 127 | 3300059642 | Ga0587069_027150 | Ga0587069_027150_70_744 | 210 |
| 128 | iso_pu_bacteria | 3003930520 | 3003930992 | 210 |
| 129 | iso_pu_bacteria | 8005658619 | 8005660828 | 210 |
| 130 | 3300002987 | JGI25159J45721_1021911 | JGI25159J45721_10219112 | 211 |
| 131 | 3300003187 | JGI25151J46595_10010459 | JGI25151J46595_100104592 | 211 |
| 132 | 3300003316 | rootH1_10034948 | rootH1_100349482 | 211 |
| 133 | 3300003771 | Ga0055526_1017612 | Ga0055526_10176122 | 211 |
| 134 | 3300003775 | Ga0055524_1011296 | Ga0055524_10112962 | 211 |
| 135 | 3300003790 | Ga0055528_1000099 | Ga0055528_100009939 | 211 |
| 136 | 3300005262 | Ga0065165_1006272 | Ga0065165_10062722 | 211 |
| 137 | 3300006353 | Ga0075370_10176647 | Ga0075370_101766472 | 211 |
| 138 | 3300025258 | Ga0209129_1000118 | Ga0209129_10001189 | 211 |
| 139 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033225 | 211 |
| 140 | 3300025284 | Ga0209130_1011628 | Ga0209130_10116282 | 211 |
| 141 | 3300025292 | Ga0209676_1046264 | Ga0209676_10462642 | 211 |
| 142 | 3300025294 | Ga0209025_1002567 | Ga0209025_100256719 | 211 |
| 143 | 3300025295 | Ga0209564_1011899 | Ga0209564_10118995 | 211 |
| 144 | 3300025299 | Ga0209256_1003350 | Ga0209256_100335010 | 211 |
| 145 | 3300025304 | Ga0209257_1071898 | Ga0209257_10718981 | 211 |
| 146 | 3300028794 | Ga0307515_10289506 | Ga0307515_102895061 | 211 |
| 147 | 3300048909 | Ga0496106_0063105 | Ga0496106_0063105_1548_2216 | 211 |
| 148 | 3300048910 | Ga0496107_0184142 | Ga0496107_0184142_251_919 | 211 |
| 149 | 3300048924 | Ga0496121_0063751 | Ga0496121_0063751_1017_1685 | 211 |
| 150 | 3300048925 | Ga0496122_0056159 | Ga0496122_0056159_76_744 | 211 |
| 151 | 3300048926 | Ga0496123_0161416 | Ga0496123_0161416_376_1044 | 211 |
| 152 | 3300048927 | Ga0496124_0077454 | Ga0496124_0077454_1926_2594 | 211 |
| 153 | 3300048929 | Ga0496126_0150463 | Ga0496126_0150463_716_1384 | 211 |
| 154 | 3300053125 | Ga0500618_007819 | Ga0500618_007819_1937_2611 | 211 |
| 155 | iso_pu_bacteria | 2510917028 | 2511184009 | 211 |
| 156 | iso_pu_bacteria | 2513237088 | 2513596839 | 211 |
| 157 | iso_pu_bacteria | 2513237138 | 2513867491 | 211 |
| 158 | iso_pu_bacteria | 2513237146 | 2513928425 | 211 |
| 159 | iso_pu_bacteria | 2534681796 | 2535519035 | 211 |
| 160 | iso_pu_bacteria | 2558860983 | 2561467150 | 211 |
| 161 | iso_pu_bacteria | 2582581867 | 2585399760 | 211 |
| 162 | iso_pu_bacteria | 2585427590 | 2585820847 | 211 |
| 163 | iso_pu_bacteria | 2599185170 | 2599420134 | 211 |
| 164 | iso_pu_bacteria | 2738541317 | 2738947026 | 211 |
| 165 | iso_pu_bacteria | 2791355261 | 2793327294 | 211 |
| 166 | iso_pu_bacteria | 2838035591 | 2838040342 | 211 |
| 167 | iso_pu_bacteria | 2838661181 | 2838667757 | 211 |
| 168 | iso_pu_bacteria | 2894652903 | 2894653805 | 211 |
| 169 | iso_pu_bacteria | 2913308742 | 2913312147 | 211 |
| 170 | iso_pu_bacteria | 2923556063 | 2923559479 | 211 |
| 171 | iso_pu_bacteria | 2933016740 | 2933017658 | 211 |
| 172 | iso_pu_bacteria | 2996887358 | 2996890252 | 211 |
| 173 | iso_pu_bacteria | 8005258706 | 8005262435 | 211 |
| 174 | iso_pu_bacteria | 8005321885 | 8005324779 | 211 |
| 175 | iso_pu_bacteria | 8005382845 | 8005387764 | 211 |
| 176 | iso_pu_bacteria | 8005395548 | 8005400799 | 211 |
| 177 | iso_pu_bacteria | 8005542996 | 8005546684 | 211 |
| 178 | 3300002773 | JGI25152J39213_1002324 | JGI25152J39213_10023244 | 212 |
| 179 | 3300002987 | JGI25159J45721_1004034 | JGI25159J45721_10040342 | 212 |
| 180 | 3300003215 | JGI25153J46596_10020535 | JGI25153J46596_100205352 | 212 |
| 181 | 3300003354 | JGI25160J50197_1001577 | JGI25160J50197_10015779 | 212 |
| 182 | 3300003354 | JGI25160J50197_1001979 | JGI25160J50197_10019796 | 212 |
| 183 | 3300003374 | JGI25161J50226_1000327 | JGI25161J50226_100032728 | 212 |
| 184 | 3300003374 | JGI25161J50226_1006452 | JGI25161J50226_10064522 | 212 |
| 185 | 3300003771 | Ga0055526_1005433 | Ga0055526_10054332 | 212 |
| 186 | 3300003771 | Ga0055526_1005536 | Ga0055526_10055362 | 212 |
| 187 | 3300003775 | Ga0055524_1003673 | Ga0055524_10036732 | 212 |
| 188 | 3300003775 | Ga0055524_1005096 | Ga0055524_10050966 | 212 |
| 189 | 3300003790 | Ga0055528_1013626 | Ga0055528_10136262 | 212 |
| 190 | 3300003790 | Ga0055528_1014903 | Ga0055528_10149032 | 212 |
| 191 | 3300003790 | Ga0055528_1021135 | Ga0055528_10211352 | 212 |
| 192 | 3300003790 | Ga0055528_1023836 | Ga0055528_10238361 | 212 |
| 193 | 3300003792 | Ga0055540_1001518 | Ga0055540_10015184 | 212 |
| 194 | 3300003792 | Ga0055540_1025164 | Ga0055540_10251641 | 212 |
| 195 | 3300004625 | Ga0055543_1000062 | Ga0055543_100006266 | 212 |
| 196 | 3300004625 | Ga0055543_1000683 | Ga0055543_100068313 | 212 |
| 197 | 3300005262 | Ga0065165_1009106 | Ga0065165_10091063 | 212 |
| 198 | 3300005262 | Ga0065165_1029849 | Ga0065165_10298492 | 212 |
| 199 | 3300005455 | Ga0070663_100022278 | Ga0070663_1000222782 | 212 |
| 200 | 3300006048 | Ga0075363_100175330 | Ga0075363_1001753302 | 212 |
| 201 | 3300006186 | Ga0075369_10002960 | Ga0075369_100029609 | 212 |
| 202 | 3300006195 | Ga0075366_10008756 | Ga0075366_100087566 | 212 |
| 203 | 3300006195 | Ga0075366_10364364 | Ga0075366_103643642 | 212 |
| 204 | 3300006353 | Ga0075370_10218378 | Ga0075370_102183782 | 212 |
| 205 | 3300009765 | Ga0123341_1000009 | Ga0123341_1000009110 | 212 |
| 206 | 3300009766 | Ga0123342_1014739 | Ga0123342_10147395 | 212 |
| 207 | 3300012490 | Ga0157322_1000554 | Ga0157322_10005542 | 212 |
| 208 | 3300012500 | Ga0157314_1007373 | Ga0157314_10073731 | 212 |
| 209 | 3300012503 | Ga0157313_1001433 | Ga0157313_10014332 | 212 |
| 210 | 3300012513 | Ga0157326_1003420 | Ga0157326_10034202 | 212 |
| 211 | 3300025208 | Ga0209436_100018 | Ga0209436_10001836 | 212 |
| 212 | 3300025258 | Ga0209129_1001394 | Ga0209129_10013943 | 212 |
| 213 | 3300025258 | Ga0209129_1002591 | Ga0209129_100259113 | 212 |
| 214 | 3300025258 | Ga0209129_1015400 | Ga0209129_10154002 | 212 |
| 215 | 3300025273 | Ga0209673_1000052 | Ga0209673_1000052164 | 212 |
| 216 | 3300025273 | Ga0209673_1001738 | Ga0209673_10017383 | 212 |
| 217 | 3300025273 | Ga0209673_1002049 | Ga0209673_10020493 | 212 |
| 218 | 3300025273 | Ga0209673_1012763 | Ga0209673_10127632 | 212 |
| 219 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009256 | 212 |
| 220 | 3300025291 | Ga0209675_1036862 | Ga0209675_10368622 | 212 |
| 221 | 3300025292 | Ga0209676_1034641 | Ga0209676_10346412 | 212 |
| 222 | 3300025294 | Ga0209025_1000335 | Ga0209025_100033531 | 212 |
| 223 | 3300025295 | Ga0209564_1001330 | Ga0209564_100133010 | 212 |
| 224 | 3300025295 | Ga0209564_1005228 | Ga0209564_10052289 | 212 |
| 225 | 3300025295 | Ga0209564_1012761 | Ga0209564_10127612 | 212 |
| 226 | 3300025297 | Ga0209758_1000896 | Ga0209758_100089611 | 212 |
| 227 | 3300025297 | Ga0209758_1001936 | Ga0209758_100193612 | 212 |
| 228 | 3300025297 | Ga0209758_1002583 | Ga0209758_100258315 | 212 |
| 229 | 3300025298 | Ga0209050_1010152 | Ga0209050_10101522 | 212 |
| 230 | 3300025299 | Ga0209256_1003248 | Ga0209256_100324811 | 212 |
| 231 | 3300025299 | Ga0209256_1007011 | Ga0209256_10070116 | 212 |
| 232 | 3300025299 | Ga0209256_1010945 | Ga0209256_10109452 | 212 |
| 233 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041194 | 212 |
| 234 | 3300025302 | Ga0207426_1000348 | Ga0207426_100034868 | 212 |
| 235 | 3300025303 | Ga0209051_1000276 | Ga0209051_100027628 | 212 |
| 236 | 3300025303 | Ga0209051_1014339 | Ga0209051_10143392 | 212 |
| 237 | 3300025303 | Ga0209051_1019151 | Ga0209051_10191513 | 212 |
| 238 | 3300025304 | Ga0209257_1005271 | Ga0209257_10052718 | 212 |
| 239 | 3300026067 | Ga0207678_10274835 | Ga0207678_102748352 | 212 |
| 240 | 3300027866 | Ga0209813_10034213 | Ga0209813_100342132 | 212 |
| 241 | 3300028794 | Ga0307515_10401845 | Ga0307515_104018452 | 212 |
| 242 | 3300041413 | Ga0439465_0016593 | Ga0439465_0016593_1188_1856 | 212 |
| 243 | 3300041453 | Ga0451797_0377651 | Ga0451797_0377651_38_706 | 212 |
| 244 | 3300041456 | Ga0451795_0185263 | Ga0451795_0185263_157_825 | 212 |
| 245 | 3300041491 | Ga0451833_1171735 | Ga0451833_1171735_219_887 | 212 |
| 246 | 3300041496 | Ga0451839_1307106 | Ga0451839_1307106_173_841 | 212 |
| 247 | 3300041498 | Ga0451841_0643035 | Ga0451841_0643035_607_1275 | 212 |
| 248 | 3300041503 | Ga0451847_0449155 | Ga0451847_0449155_294_962 | 212 |
| 249 | 3300041505 | Ga0451849_0061017 | Ga0451849_0061017_262_930 | 212 |
| 250 | 3300041507 | Ga0451851_0052458 | Ga0451851_0052458_577_1245 | 212 |
| 251 | 3300041512 | Ga0451853_3609191 | Ga0451853_3609191_193_861 | 212 |
| 252 | 3300042010 | Ga0439452_035526 | Ga0439452_035526_470_1138 | 212 |
| 253 | 3300046474 | Ga0495605_0064505 | Ga0495605_0064505_408_1076 | 212 |
| 254 | 3300046492 | Ga0495585_0052303 | Ga0495585_0052303_202_870 | 212 |
| 255 | 3300046500 | Ga0495596_0029987 | Ga0495596_0029987_1142_1810 | 212 |
| 256 | 3300046501 | Ga0495607_0093888 | Ga0495607_0093888_420_1088 | 212 |
| 257 | 3300046506 | Ga0495583_0027490 | Ga0495583_0027490_1442_2110 | 212 |
| 258 | 3300046507 | Ga0495606_0023480 | Ga0495606_0023480_3457_4125 | 212 |
| 259 | 3300046512 | Ga0495610_0004675 | Ga0495610_0004675_3564_4238 | 212 |
| 260 | 3300046513 | Ga0495616_0049134 | Ga0495616_0049134_661_1329 | 212 |
| 261 | 3300046519 | Ga0495632_0012381 | Ga0495632_0012381_3671_4339 | 212 |
| 262 | 3300046522 | Ga0495643_0017636 | Ga0495643_0017636_505_1173 | 212 |
| 263 | 3300046524 | Ga0495648_0075848 | Ga0495648_0075848_323_991 | 212 |
| 264 | 3300046524 | Ga0495648_0096933 | Ga0495648_0096933_457_1125 | 212 |
| 265 | 3300046530 | Ga0495654_0139768 | Ga0495654_0139768_30_698 | 212 |
| 266 | 3300046542 | Ga0495597_0018375 | Ga0495597_0018375_585_1253 | 212 |
| 267 | 3300046558 | Ga0495633_0018967 | Ga0495633_0018967_2217_2885 | 212 |
| 268 | 3300046615 | Ga0495656_0060490 | Ga0495656_0060490_462_1130 | 212 |
| 269 | 3300046648 | Ga0495611_0076418 | Ga0495611_0076418_651_1319 | 212 |
| 270 | 3300046665 | Ga0495661_0062968 | Ga0495661_0062968_714_1382 | 212 |
| 271 | 3300046665 | Ga0495661_0304767 | Ga0495661_0304767_49_717 | 212 |
| 272 | 3300046691 | Ga0495670_0067595 | Ga0495670_0067595_282_950 | 212 |
| 273 | 3300046692 | Ga0495671_0047425 | Ga0495671_0047425_555_1223 | 212 |
| 274 | 3300046694 | Ga0495649_0041540 | Ga0495649_0041540_1511_2179 | 212 |
| 275 | 3300046794 | Ga0495589_0181131 | Ga0495589_0181131_235_903 | 212 |
| 276 | 3300046810 | Ga0495660_0032470 | Ga0495660_0032470_1156_1824 | 212 |
| 277 | 3300047446 | Ga0495679_042957 | Ga0495679_042957_377_1045 | 212 |
| 278 | 3300047447 | Ga0495685_039926 | Ga0495685_039926_381_1049 | 212 |
| 279 | 3300047469 | Ga0495673_0106409 | Ga0495673_0106409_26_700 | 212 |
| 280 | 3300047470 | Ga0495681_0115224 | Ga0495681_0115224_202_870 | 212 |
| 281 | 3300047472 | Ga0495686_0005368 | Ga0495686_0005368_5754_6428 | 212 |
| 282 | 3300047472 | Ga0495686_0052740 | Ga0495686_0052740_1697_2365 | 212 |
| 283 | 3300048909 | Ga0496106_0001539 | Ga0496106_0001539_4607_5281 | 212 |
| 284 | 3300048927 | Ga0496124_0065069 | Ga0496124_0065069_1394_2068 | 212 |
| 285 | 3300048927 | Ga0496124_0133806 | Ga0496124_0133806_786_1460 | 212 |
| 286 | 3300049459 | Ga0495678_022752 | Ga0495678_022752_1635_2303 | 212 |
| 287 | 3300049569 | Ga0501032_0052710 | Ga0501032_0052710_775_1449 | 212 |
| 288 | 3300049571 | Ga0501034_0446120 | Ga0501034_0446120_450_1124 | 212 |
| 289 | 3300049589 | Ga0501073_0112082 | Ga0501073_0112082_669_1343 | 212 |
| 290 | 3300049744 | Ga0501083_0021315 | Ga0501083_0021315_66_740 | 212 |
| 291 | 3300050490 | nmdc:mga03n38_120870_c1 | nmdc:mga03n38_120870_c1_399_1067 | 212 |
| 292 | 3300050492 | nmdc:mga0yw44_127892_c1 | nmdc:mga0yw44_127892_c1_431_1099 | 212 |
| 293 | 3300053134 | Ga0500658_0000735 | Ga0500658_0000735_3798_4466 | 212 |
| 294 | 3300053134 | Ga0500658_0026139 | Ga0500658_0026139_1230_1904 | 212 |
| 295 | 3300053139 | Ga0500568_0007940 | Ga0500568_0007940_3453_4127 | 212 |
| 296 | 3300053151 | Ga0500604_0014189 | Ga0500604_0014189_867_1541 | 212 |
| 297 | 3300053153 | Ga0500616_0021142 | Ga0500616_0021142_2698_3366 | 212 |
| 298 | 3300053156 | Ga0500622_0029751 | Ga0500622_0029751_1484_2152 | 212 |
| 299 | 3300053158 | Ga0500627_0124400 | Ga0500627_0124400_56_724 | 212 |
| 300 | 3300053160 | Ga0500633_0023461 | Ga0500633_0023461_496_1170 | 212 |
| 301 | 3300053161 | Ga0500634_0020365 | Ga0500634_0020365_2389_3072 | 212 |
| 302 | 3300059503 | Ga0587080_018640 | Ga0587080_018640_398_1066 | 212 |
| 303 | 3300059511 | Ga0587091_041448 | Ga0587091_041448_194_862 | 212 |
| 304 | 3300060353 | Ga0501082_0122222 | Ga0501082_0122222_731_1405 | 212 |
| 305 | iso_pu_bacteria | 2509276021 | 2509389396 | 212 |
| 306 | iso_pu_bacteria | 2509276033 | 2509446203 | 212 |
| 307 | iso_pu_bacteria | 2510065019 | 2510135255 | 212 |
| 308 | iso_pu_bacteria | 2510461076 | 2510896710 | 212 |
| 309 | iso_pu_bacteria | 2513237084 | 2513571638 | 212 |
| 310 | iso_pu_bacteria | 2513237085 | 2513578673 | 212 |
| 311 | iso_pu_bacteria | 2513237093 | 2513630143 | 212 |
| 312 | iso_pu_bacteria | 2513237103 | 2513711359 | 212 |
| 313 | iso_pu_bacteria | 2513237162 | 2514019411 | 212 |
| 314 | iso_pu_bacteria | 2515075009 | 2515114413 | 212 |
| 315 | iso_pu_bacteria | 2515154113 | 2515635417 | 212 |
| 316 | iso_pu_bacteria | 2515154114 | 2515643175 | 212 |
| 317 | iso_pu_bacteria | 2515154116 | 2515657639 | 212 |
| 318 | iso_pu_bacteria | 2515154134 | 2515741598 | 212 |
| 319 | iso_pu_bacteria | 2516653077 | 2517038065 | 212 |
| 320 | iso_pu_bacteria | 2516653085 | 2517078328 | 212 |
| 321 | iso_pu_bacteria | 2517093000 | 2517097087 | 212 |
| 322 | iso_pu_bacteria | 2517287029 | 2517408528 | 212 |
| 323 | iso_pu_bacteria | 2519899620 | 2520376412 | 212 |
| 324 | iso_pu_bacteria | 2529292951 | 2530647340 | 212 |
| 325 | iso_pu_bacteria | 2582581298 | 2585223932 | 212 |
| 326 | iso_pu_bacteria | 2582581304 | 2585257349 | 212 |
| 327 | iso_pu_bacteria | 2585427526 | 2585526034 | 212 |
| 328 | iso_pu_bacteria | 2585427528 | 2585540789 | 212 |
| 329 | iso_pu_bacteria | 2585427529 | 2585549155 | 212 |
| 330 | iso_pu_bacteria | 2585427593 | 2585839059 | 212 |
| 331 | iso_pu_bacteria | 2585427594 | 2585844910 | 212 |
| 332 | iso_pu_bacteria | 2599185156 | 2599335057 | 212 |
| 333 | iso_pu_bacteria | 2615840624 | 2616296306 | 212 |
| 334 | iso_pu_bacteria | 2643221555 | 2643795631 | 212 |
| 335 | iso_pu_bacteria | 2643221599 | 2644002483 | 212 |
| 336 | iso_pu_bacteria | 2643221634 | 2644194810 | 212 |
| 337 | iso_pu_bacteria | 2643221643 | 2644240492 | 212 |
| 338 | iso_pu_bacteria | 2643221689 | 2644499257 | 212 |
| 339 | iso_pu_bacteria | 2718217882 | 2719182972 | 212 |
| 340 | iso_pu_bacteria | 2718217927 | 2719387687 | 212 |
| 341 | iso_pu_bacteria | 2718217997 | 2719667317 | 212 |
| 342 | iso_pu_bacteria | 2718218009 | 2719733689 | 212 |
| 343 | iso_pu_bacteria | 2718218199 | 2720493737 | 212 |
| 344 | iso_pu_bacteria | 2718218232 | 2720615193 | 212 |
| 345 | iso_pu_bacteria | 2718218233 | 2720621986 | 212 |
| 346 | iso_pu_bacteria | 2718218235 | 2720633336 | 212 |
| 347 | iso_pu_bacteria | 2718218269 | 2720777034 | 212 |
| 348 | iso_pu_bacteria | 2718218363 | 2721149084 | 212 |
| 349 | iso_pu_bacteria | 2718218365 | 2721160482 | 212 |
| 350 | iso_pu_bacteria | 2718218366 | 2721165897 | 212 |
| 351 | iso_pu_bacteria | 2718218423 | 2721401321 | 212 |
| 352 | iso_pu_bacteria | 2721755514 | 2722842067 | 212 |
| 353 | iso_pu_bacteria | 2721755556 | 2723028632 | 212 |
| 354 | iso_pu_bacteria | 2721755684 | 2723562236 | 212 |
| 355 | iso_pu_bacteria | 2721755685 | 2723568939 | 212 |
| 356 | iso_pu_bacteria | 2721755809 | 2724040135 | 212 |
| 357 | iso_pu_bacteria | 2721755810 | 2724046445 | 212 |
| 358 | iso_pu_bacteria | 2721755819 | 2724091641 | 212 |
| 359 | iso_pu_bacteria | 2721755822 | 2724106204 | 212 |
| 360 | iso_pu_bacteria | 2721755823 | 2724112010 | 212 |
| 361 | iso_pu_bacteria | 2724679232 | 2725947547 | 212 |
| 362 | iso_pu_bacteria | 2728369352 | 2730109568 | 212 |
| 363 | iso_pu_bacteria | 2728369365 | 2730166207 | 212 |
| 364 | iso_pu_bacteria | 2728369397 | 2730300114 | 212 |
| 365 | iso_pu_bacteria | 2738541293 | 2738801176 | 212 |
| 366 | iso_pu_bacteria | 2738541333 | 2739037285 | 212 |
| 367 | iso_pu_bacteria | 2765235942 | 2766064258 | 212 |
| 368 | iso_pu_bacteria | 2791355256 | 2793295618 | 212 |
| 369 | iso_pu_bacteria | 2791355259 | 2793313367 | 212 |
| 370 | iso_pu_bacteria | 2791355260 | 2793320730 | 212 |
| 371 | iso_pu_bacteria | 2791355262 | 2793332247 | 212 |
| 372 | iso_pu_bacteria | 2791355263 | 2793338824 | 212 |
| 373 | iso_pu_bacteria | 2791355264 | 2793346609 | 212 |
| 374 | iso_pu_bacteria | 2791355265 | 2793353852 | 212 |
| 375 | iso_pu_bacteria | 2791355266 | 2793359386 | 212 |
| 376 | iso_pu_bacteria | 2791355267 | 2793365914 | 212 |
| 377 | iso_pu_bacteria | 2802429605 | 2805926224 | 212 |
| 378 | iso_pu_bacteria | 2802429606 | 2805933950 | 212 |
| 379 | iso_pu_bacteria | 2802429633 | 2806047377 | 212 |
| 380 | iso_pu_bacteria | 2802429634 | 2806054232 | 212 |
| 381 | iso_pu_bacteria | 2802429635 | 2806060184 | 212 |
| 382 | iso_pu_bacteria | 2802429636 | 2806068795 | 212 |
| 383 | iso_pu_bacteria | 2802429637 | 2806076401 | 212 |
| 384 | iso_pu_bacteria | 2838016132 | 2838018323 | 212 |
| 385 | iso_pu_bacteria | 2838022645 | 2838024004 | 212 |
| 386 | iso_pu_bacteria | 2838042994 | 2838047851 | 212 |
| 387 | iso_pu_bacteria | 2838048938 | 2838050816 | 212 |
| 388 | iso_pu_bacteria | 2838061910 | 2838062584 | 212 |
| 389 | iso_pu_bacteria | 2838068647 | 2838072133 | 212 |
| 390 | iso_pu_bacteria | 2838668709 | 2838672173 | 212 |
| 391 | iso_pu_bacteria | 2838680041 | 2838683869 | 212 |
| 392 | iso_pu_bacteria | 2838686498 | 2838690292 | 212 |
| 393 | iso_pu_bacteria | 2838694306 | 2838698397 | 212 |
| 394 | iso_pu_bacteria | 2838701080 | 2838704957 | 212 |
| 395 | iso_pu_bacteria | 2838707686 | 2838711512 | 212 |
| 396 | iso_pu_bacteria | 2838729681 | 2838732067 | 212 |
| 397 | iso_pu_bacteria | 2838742623 | 2838744963 | 212 |
| 398 | iso_pu_bacteria | 2840764183 | 2840766320 | 212 |
| 399 | iso_pu_bacteria | 2841851746 | 2841856021 | 212 |
| 400 | iso_pu_bacteria | 2841864319 | 2841867748 | 212 |
| 401 | iso_pu_bacteria | 2842077413 | 2842081313 | 212 |
| 402 | iso_pu_bacteria | 2842110456 | 2842116845 | 212 |
| 403 | iso_pu_bacteria | 2842118031 | 2842121910 | 212 |
| 404 | iso_pu_bacteria | 2842146304 | 2842148807 | 212 |
| 405 | iso_pu_bacteria | 2842156927 | 2842161190 | 212 |
| 406 | iso_pu_bacteria | 2842163707 | 2842166702 | 212 |
| 407 | iso_pu_bacteria | 2842180545 | 2842184807 | 212 |
| 408 | iso_pu_bacteria | 2842192696 | 2842194873 | 212 |
| 409 | iso_pu_bacteria | 2842198810 | 2842201597 | 212 |
| 410 | iso_pu_bacteria | 2842205361 | 2842207429 | 212 |
| 411 | iso_pu_bacteria | 2842217011 | 2842221790 | 212 |
| 412 | iso_pu_bacteria | 2842229732 | 2842232389 | 212 |
| 413 | iso_pu_bacteria | 2842237096 | 2842240924 | 212 |
| 414 | iso_pu_bacteria | 2842243621 | 2842246805 | 212 |
| 415 | iso_pu_bacteria | 2842250916 | 2842254638 | 212 |
| 416 | iso_pu_bacteria | 2842257432 | 2842261094 | 212 |
| 417 | iso_pu_bacteria | 2842264693 | 2842269648 | 212 |
| 418 | iso_pu_bacteria | 2842271015 | 2842274312 | 212 |
| 419 | iso_pu_bacteria | 2842278818 | 2842280860 | 212 |
| 420 | iso_pu_bacteria | 2842285085 | 2842288528 | 212 |
| 421 | iso_pu_bacteria | 2842291075 | 2842294970 | 212 |
| 422 | iso_pu_bacteria | 2842304105 | 2842305846 | 212 |
| 423 | iso_pu_bacteria | 2842311132 | 2842311422 | 212 |
| 424 | iso_pu_bacteria | 2842317721 | 2842321120 | 212 |
| 425 | iso_pu_bacteria | 2842341865 | 2842346571 | 212 |
| 426 | iso_pu_bacteria | 2842363717 | 2842366261 | 212 |
| 427 | iso_pu_bacteria | 2842370503 | 2842375012 | 212 |
| 428 | iso_pu_bacteria | 2842377471 | 2842381369 | 212 |
| 429 | iso_pu_bacteria | 2842384541 | 2842388439 | 212 |
| 430 | iso_pu_bacteria | 2842395702 | 2842395934 | 212 |
| 431 | iso_pu_bacteria | 2842402390 | 2842406126 | 212 |
| 432 | iso_pu_bacteria | 2842409023 | 2842412711 | 212 |
| 433 | iso_pu_bacteria | 2842415677 | 2842419410 | 212 |
| 434 | iso_pu_bacteria | 2842422224 | 2842425765 | 212 |
| 435 | iso_pu_bacteria | 2842428310 | 2842433590 | 212 |
| 436 | iso_pu_bacteria | 2842434925 | 2842439918 | 212 |
| 437 | iso_pu_bacteria | 2842441272 | 2842446547 | 212 |
| 438 | iso_pu_bacteria | 2842447887 | 2842448769 | 212 |
| 439 | iso_pu_bacteria | 2842462802 | 2842467944 | 212 |
| 440 | iso_pu_bacteria | 2842469257 | 2842474527 | 212 |
| 441 | iso_pu_bacteria | 2842489311 | 2842491173 | 212 |
| 442 | iso_pu_bacteria | 2842495871 | 2842498510 | 212 |
| 443 | iso_pu_bacteria | 2842922631 | 2842926246 | 212 |
| 444 | iso_pu_bacteria | 2844454524 | 2844457009 | 212 |
| 445 | iso_pu_bacteria | 2857516855 | 2857519583 | 212 |
| 446 | iso_pu_bacteria | 2919100787 | 2919105396 | 212 |
| 447 | iso_pu_bacteria | 2933570622 | 2933572351 | 212 |
| 448 | iso_pu_bacteria | 2933586486 | 2933593150 | 212 |
| 449 | iso_pu_bacteria | 2933599457 | 2933603014 | 212 |
| 450 | iso_pu_bacteria | 2935894831 | 2935897952 | 212 |
| 451 | iso_pu_bacteria | 2935901341 | 2935903626 | 212 |
| 452 | iso_pu_bacteria | 2936367885 | 2936369897 | 212 |
| 453 | iso_pu_bacteria | 2936375103 | 2936379082 | 212 |
| 454 | iso_pu_bacteria | 2936381700 | 2936381941 | 212 |
| 455 | iso_pu_bacteria | 2989771324 | 2989771560 | 212 |
| 456 | iso_pu_bacteria | 2996893221 | 2996897005 | 212 |
| 457 | iso_pu_bacteria | 3005445848 | 3005449668 | 212 |
| 458 | iso_pu_bacteria | 3005452660 | 3005455959 | 212 |
| 459 | iso_pu_bacteria | 639633055 | 639650439 | 212 |
| 460 | iso_pu_bacteria | 8005275841 | 8005282442 | 212 |
| 461 | iso_pu_bacteria | 8005282627 | 8005286740 | 212 |
| 462 | iso_pu_bacteria | 8005289223 | 8005295091 | 212 |
| 463 | iso_pu_bacteria | 8005301065 | 8005305970 | 212 |
| 464 | iso_pu_bacteria | 8005307578 | 8005313707 | 212 |
| 465 | iso_pu_bacteria | 8005376324 | 8005381560 | 212 |
| 466 | iso_pu_bacteria | 8005430974 | 8005431114 | 212 |
| 467 | iso_pu_bacteria | 8005460587 | 8005465105 | 212 |
| 468 | iso_pu_bacteria | 8005497431 | 8005497683 | 212 |
| 469 | iso_pu_bacteria | 8005556819 | 8005561181 | 212 |
| 470 | iso_pu_bacteria | 8005563573 | 8005565805 | 212 |
| 471 | iso_pu_bacteria | 8005570704 | 8005571853 | 212 |
| 472 | iso_pu_bacteria | 8005619151 | 8005623415 | 212 |
| 473 | iso_pu_bacteria | 8005626139 | 8005631004 | 212 |
| 474 | iso_pu_bacteria | 8005668836 | 8005669088 | 212 |
| 475 | iso_pu_bacteria | 8005688590 | 8005694331 | 212 |
| 476 | iso_pu_bacteria | 8005695170 | 8005695744 | 212 |
| 477 | iso_pu_bacteria | 8018127388 | 8018128918 | 212 |
| 478 | iso_pu_bacteria | 8018163183 | 8018165080 | 212 |
| 479 | iso_pu_bacteria | 8018176218 | 8018177160 | 212 |
| 480 | iso_pu_bacteria | 8023680758 | 8023686547 | 212 |
| 481 | iso_pu_bacteria | 8024479707 | 8024484378 | 212 |
| 482 | iso_pu_bacteria | 8024501048 | 8024502018 | 212 |
| 483 | iso_pu_bacteria | 8056375014 | 8056380424 | 212 |
| 484 | iso_pu_bacteria | 8056382006 | 8056385253 | 212 |
| 485 | iso_pu_bacteria | 8057874678 | 8057879297 | 212 |
| 486 | 3300013100 | Ga0157373_10023861 | Ga0157373_100238612 | 213 |
| 487 | 3300037471 | Ga0395905_0012935 | Ga0395905_0012935_1022_1687 | 213 |
| 488 | 3300037471 | Ga0395905_0045508 | Ga0395905_0045508_2951_3622 | 213 |
| 489 | 3300046507 | Ga0495606_0004841 | Ga0495606_0004841_9184_9858 | 213 |
| 490 | 3300048924 | Ga0496121_0029870 | Ga0496121_0029870_2680_3354 | 213 |
| 491 | 3300053136 | Ga0500559_0048346 | Ga0500559_0048346_722_1390 | 213 |
| 492 | iso_pu_bacteria | 2643221653 | 2644299787 | 213 |
| 493 | iso_pu_bacteria | 2643221719 | 2644658014 | 213 |
| 494 | iso_pu_bacteria | 2775506902 | 2776269618 | 213 |
| 495 | iso_pu_bacteria | 2775506904 | 2776282549 | 213 |
| 496 | iso_pu_bacteria | 2818991272 | 2819244571 | 213 |
| 497 | iso_pu_bacteria | 2989776772 | 2989780171 | 213 |
| 498 | iso_pu_bacteria | 8005246636 | 8005249315 | 213 |
| 499 | 3300003187 | JGI25151J46595_10059924 | JGI25151J46595_100599242 | 214 |
| 500 | 3300003578 | Ga0006562J51391_1022330 | Ga0006562J51391_10223302 | 214 |
| 501 | 3300003856 | Ga0058692_1003573 | Ga0058692_10035732 | 214 |
| 502 | 3300005289 | Ga0065704_10227534 | Ga0065704_102275341 | 214 |
| 503 | 3300005347 | Ga0070668_100459624 | Ga0070668_1004596241 | 214 |
| 504 | 3300005353 | Ga0070669_100322310 | Ga0070669_1003223101 | 214 |
| 505 | 3300005548 | Ga0070665_100006674 | Ga0070665_1000066748 | 214 |
| 506 | 3300006042 | Ga0075368_10070007 | Ga0075368_100700072 | 214 |
| 507 | 3300006177 | Ga0075362_10010559 | Ga0075362_100105594 | 214 |
| 508 | 3300006178 | Ga0075367_10081119 | Ga0075367_100811192 | 214 |
| 509 | 3300006186 | Ga0075369_10002996 | Ga0075369_100029964 | 214 |
| 510 | 3300006186 | Ga0075369_10071463 | Ga0075369_100714632 | 214 |
| 511 | 3300006948 | Ga0099826_10001615 | Ga0099826_100016156 | 214 |
| 512 | 3300009148 | Ga0105243_10243624 | Ga0105243_102436242 | 214 |
| 513 | 3300011119 | Ga0105246_10024870 | Ga0105246_100248702 | 214 |
| 514 | 3300013100 | Ga0157373_10107542 | Ga0157373_101075422 | 214 |
| 515 | 3300013102 | Ga0157371_10000071 | Ga0157371_1000007122 | 214 |
| 516 | 3300013104 | Ga0157370_10000469 | Ga0157370_1000046916 | 214 |
| 517 | 3300025294 | Ga0209025_1001416 | Ga0209025_10014163 | 214 |
| 518 | 3300025923 | Ga0207681_10205936 | Ga0207681_102059362 | 214 |
| 519 | 3300025972 | Ga0207668_10371521 | Ga0207668_103715212 | 214 |
| 520 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037200 | 214 |
| 521 | 3300027312 | Ga0209371_1005695 | Ga0209371_10056953 | 214 |
| 522 | 3300027666 | Ga0209282_1001575 | Ga0209282_10015758 | 214 |
| 523 | 3300028379 | Ga0268266_10005017 | Ga0268266_100050173 | 214 |
| 524 | 3300030500 | Ga0268256_1000039 | Ga0268256_1000039108 | 214 |
| 525 | 3300030500 | Ga0268256_1005626 | Ga0268256_10056263 | 214 |
| 526 | 3300030500 | Ga0268256_1027137 | Ga0268256_10271372 | 214 |
| 527 | 3300031911 | Ga0307412_10662089 | Ga0307412_106620891 | 214 |
| 528 | 3300031995 | Ga0307409_100121494 | Ga0307409_1001214941 | 214 |
| 529 | 3300035692 | Ga0373935_0182831 | Ga0373935_0182831_338_1003 | 214 |
| 530 | 3300035725 | Ga0373947_0375044 | Ga0373947_0375044_16_744 | 214 |
| 531 | 3300037068 | Ga0373925_0001135 | Ga0373925_0001135_19068_19796 | 214 |
| 532 | 3300046460 | Ga0495638_0046858 | Ga0495638_0046858_21_686 | 214 |
| 533 | 3300046558 | Ga0495633_0094714 | Ga0495633_0094714_69_794 | 214 |
| 534 | 3300046692 | Ga0495671_0095584 | Ga0495671_0095584_197_922 | 214 |
| 535 | 3300047470 | Ga0495681_0013535 | Ga0495681_0013535_733_1458 | 214 |
| 536 | 3300048916 | Ga0496113_0055444 | Ga0496113_0055444_652_1359 | 214 |
| 537 | 3300048919 | Ga0496116_0107877 | Ga0496116_0107877_772_1479 | 214 |
| 538 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_244622_245329 | 214 |
| 539 | 3300048921 | Ga0496118_0003281 | Ga0496118_0003281_9114_9821 | 214 |
| 540 | 3300048922 | Ga0496119_0047363 | Ga0496119_0047363_1958_2665 | 214 |
| 541 | 3300048923 | Ga0496120_0001350 | Ga0496120_0001350_9114_9821 | 214 |
| 542 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_244610_245317 | 214 |
| 543 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_135719_136426 | 214 |
| 544 | 3300048927 | Ga0496124_0001510 | Ga0496124_0001510_5984_6691 | 214 |
| 545 | 3300048928 | Ga0496125_0065387 | Ga0496125_0065387_1189_1896 | 214 |
| 546 | 3300048929 | Ga0496126_0130745 | Ga0496126_0130745_894_1601 | 214 |
| 547 | 3300050490 | nmdc:mga03n38_300735_c1 | nmdc:mga03n38_300735_c1_37_744 | 214 |
| 548 | 3300050491 | nmdc:mga00v17_243645_c1 | nmdc:mga00v17_243645_c1_101_826 | 214 |
| 549 | 3300050491 | nmdc:mga00v17_545_c1 | nmdc:mga00v17_545_c1_6744_7451 | 214 |
| 550 | 3300050492 | nmdc:mga0yw44_88586_c1 | nmdc:mga0yw44_88586_c1_401_1108 | 214 |
| 551 | 3300050494 | nmdc:mga06z11_171671_c1 | nmdc:mga06z11_171671_c1_440_1147 | 214 |
| 552 | 3300050494 | nmdc:mga06z11_88095_c1 | nmdc:mga06z11_88095_c1_818_1492 | 214 |
| 553 | 3300050516 | nmdc:mga0sz30_551_c1 | nmdc:mga0sz30_551_c1_6542_7249 | 214 |
| 554 | 3300050516 | nmdc:mga0sz30_9548_c1 | nmdc:mga0sz30_9548_c1_49_774 | 214 |
| 555 | 3300053137 | Ga0500561_0000030 | Ga0500561_0000030_17761_18468 | 214 |
| 556 | 3300059508 | Ga0587088_032581 | Ga0587088_032581_146_871 | 214 |
| 557 | 3300059604 | Ga0587098_015505 | Ga0587098_015505_98_823 | 214 |
| 558 | 3300059641 | Ga0587068_017695 | Ga0587068_017695_333_1058 | 214 |
| 559 | iso_pu_bacteria | 2512047086 | 2512534588 | 214 |
| 560 | iso_pu_bacteria | 2537561587 | 2537873620 | 214 |
| 561 | iso_pu_bacteria | 2554235003 | 2554248921 | 214 |
| 562 | iso_pu_bacteria | 2558860242 | 2559296009 | 214 |
| 563 | iso_pu_bacteria | 2599185210 | 2599603198 | 214 |
| 564 | iso_pu_bacteria | 2600255279 | 2601610897 | 214 |
| 565 | iso_pu_bacteria | 2600255308 | 2601747671 | 214 |
| 566 | iso_pu_bacteria | 2643221582 | 2643921533 | 214 |
| 567 | iso_pu_bacteria | 2643221693 | 2644521587 | 214 |
| 568 | iso_pu_bacteria | 2765235802 | 2765465673 | 214 |
| 569 | iso_pu_bacteria | 2775507049 | 2776915579 | 214 |
| 570 | iso_pu_bacteria | 2808606387 | 2808988165 | 214 |
| 571 | iso_pu_bacteria | 2818991439 | 2819561019 | 214 |
| 572 | iso_pu_bacteria | 2838675328 | 2838678612 | 214 |
| 573 | iso_pu_bacteria | 2838714209 | 2838718300 | 214 |
| 574 | iso_pu_bacteria | 2838719591 | 2838722908 | 214 |
| 575 | iso_pu_bacteria | 2838724970 | 2838728366 | 214 |
| 576 | iso_pu_bacteria | 2841846520 | 2841850464 | 214 |
| 577 | iso_pu_bacteria | 2841859092 | 2841863283 | 214 |
| 578 | iso_pu_bacteria | 2842124991 | 2842129026 | 214 |
| 579 | iso_pu_bacteria | 2842130223 | 2842133505 | 214 |
| 580 | iso_pu_bacteria | 2842152218 | 2842155584 | 214 |
| 581 | iso_pu_bacteria | 2842170452 | 2842174458 | 214 |
| 582 | iso_pu_bacteria | 2842175837 | 2842179119 | 214 |
| 583 | iso_pu_bacteria | 2842187318 | 2842190724 | 214 |
| 584 | iso_pu_bacteria | 2842211629 | 2842214952 | 214 |
| 585 | iso_pu_bacteria | 2842224351 | 2842227673 | 214 |
| 586 | iso_pu_bacteria | 2842515876 | 2842519980 | 214 |
| 587 | iso_pu_bacteria | 2899792073 | 2899795380 | 214 |
| 588 | iso_pu_bacteria | 2899845264 | 2899849359 | 214 |
| 589 | iso_pu_bacteria | 2916028427 | 2916031303 | 214 |
| 590 | iso_pu_bacteria | 2919114240 | 2919118443 | 214 |
| 591 | iso_pu_bacteria | 2924214083 | 2924219899 | 214 |
| 592 | iso_pu_bacteria | 2924221636 | 2924225890 | 214 |
| 593 | iso_pu_bacteria | 2926754445 | 2926754972 | 214 |
| 594 | iso_pu_bacteria | 2926760298 | 2926762136 | 214 |
| 595 | iso_pu_bacteria | 2933006813 | 2933010568 | 214 |
| 596 | iso_pu_bacteria | 2933011516 | 2933015760 | 214 |
| 597 | iso_pu_bacteria | 2933594066 | 2933597502 | 214 |
| 598 | iso_pu_bacteria | 2979089926 | 2979092594 | 214 |
| 599 | iso_pu_bacteria | 2979095461 | 2979100015 | 214 |
| 600 | iso_pu_bacteria | 2979100975 | 2979104566 | 214 |
| 601 | iso_pu_bacteria | 2984509177 | 2984513638 | 214 |
| 602 | iso_pu_bacteria | 2984518228 | 2984522782 | 214 |
| 603 | iso_pu_bacteria | 2984537506 | 2984542088 | 214 |
| 604 | iso_pu_bacteria | 2984601300 | 2984601518 | 214 |
| 605 | iso_pu_bacteria | 650716007 | 650741225 | 214 |
| 606 | iso_pu_bacteria | 8003570095 | 8003573714 | 214 |
| 607 | 3300005548 | Ga0070665_100006303 | Ga0070665_10000630310 | 215 |
| 608 | 3300028379 | Ga0268266_10045610 | Ga0268266_100456104 | 215 |
| 609 | 3300046459 | Ga0495629_0021063 | Ga0495629_0021063_3315_3989 | 215 |
| 610 | 3300046462 | Ga0495651_0263144 | Ga0495651_0263144_384_1058 | 215 |
| 611 | 3300046476 | Ga0495662_0002196 | Ga0495662_0002196_533_1207 | 215 |
| 612 | 3300046477 | Ga0495664_0075784 | Ga0495664_0075784_34_708 | 215 |
| 613 | 3300046516 | Ga0495628_0323437 | Ga0495628_0323437_157_831 | 215 |
| 614 | 3300046517 | Ga0495630_0493610 | Ga0495630_0493610_222_896 | 215 |
| 615 | 3300046642 | Ga0495634_0147610 | Ga0495634_0147610_234_908 | 215 |
| 616 | 3300046663 | Ga0495635_0076020 | Ga0495635_0076020_424_1098 | 215 |
| 617 | 3300046675 | Ga0495657_0055172 | Ga0495657_0055172_298_972 | 215 |
| 618 | 3300046690 | Ga0495624_0048415 | Ga0495624_0048415_138_812 | 215 |
| 619 | 3300046809 | Ga0495600_0012554 | Ga0495600_0012554_1755_2429 | 215 |
| 620 | 3300047317 | Ga0495604_0008757 | Ga0495604_0008757_2620_3294 | 215 |
| 621 | 3300047319 | Ga0495674_0259817 | Ga0495674_0259817_174_848 | 215 |
| 622 | 3300049551 | Ga0501335_004751 | Ga0501335_004751_363_1031 | 215 |
| 623 | 3300049776 | Ga0501280_001610 | Ga0501280_001610_2397_3065 | 215 |
| 624 | 3300053077 | Ga0495601_0088286 | Ga0495601_0088286_84_758 | 215 |
| 625 | 3300053085 | Ga0495619_0175564 | Ga0495619_0175564_684_1358 | 215 |
| 626 | 3300053148 | Ga0500590_011317 | Ga0500590_011317_462_1136 | 215 |
| 627 | 3300053177 | Ga0500636_0000040 | Ga0500636_0000040_36347_37060 | 215 |
| 628 | iso_pu_bacteria | 2508501122 | 2509109558 | 215 |
| 629 | iso_pu_bacteria | 2509276019 | 2509378119 | 215 |
| 630 | iso_pu_bacteria | 2510065057 | 2510305433 | 215 |
| 631 | iso_pu_bacteria | 2511231052 | 2511498443 | 215 |
| 632 | iso_pu_bacteria | 2512875026 | 2512973598 | 215 |
| 633 | iso_pu_bacteria | 2513237086 | 2513583606 | 215 |
| 634 | iso_pu_bacteria | 2513237089 | 2513601884 | 215 |
| 635 | iso_pu_bacteria | 2513237091 | 2513615680 | 215 |
| 636 | iso_pu_bacteria | 2513237140 | 2513885018 | 215 |
| 637 | iso_pu_bacteria | 2513237143 | 2513905227 | 215 |
| 638 | iso_pu_bacteria | 2513237156 | 2513987177 | 215 |
| 639 | iso_pu_bacteria | 2513237160 | 2514003516 | 215 |
| 640 | iso_pu_bacteria | 2515154107 | 2515611026 | 215 |
| 641 | iso_pu_bacteria | 2516143018 | 2516205617 | 215 |
| 642 | iso_pu_bacteria | 2516653046 | 2516894721 | 215 |
| 643 | iso_pu_bacteria | 2517487022 | 2517571398 | 215 |
| 644 | iso_pu_bacteria | 2524023207 | 2524450456 | 215 |
| 645 | iso_pu_bacteria | 2551306084 | 2551676578 | 215 |
| 646 | iso_pu_bacteria | 2551306084 | 2551680202 | 215 |
| 647 | iso_pu_bacteria | 2551306085 | 2551685033 | 215 |
| 648 | iso_pu_bacteria | 2551306086 | 2551692779 | 215 |
| 649 | iso_pu_bacteria | 2551306087 | 2551703413 | 215 |
| 650 | iso_pu_bacteria | 2551306089 | 2551711328 | 215 |
| 651 | iso_pu_bacteria | 2551306090 | 2551723775 | 215 |
| 652 | iso_pu_bacteria | 2551306091 | 2551729752 | 215 |
| 653 | iso_pu_bacteria | 2551306092 | 2551733635 | 215 |
| 654 | iso_pu_bacteria | 2551306093 | 2551744537 | 215 |
| 655 | iso_pu_bacteria | 2558860100 | 2558867381 | 215 |
| 656 | iso_pu_bacteria | 2643221688 | 2644493064 | 215 |
| 657 | iso_pu_bacteria | 2657244999 | 2657682492 | 215 |
| 658 | iso_pu_bacteria | 2690316117 | 2692320223 | 215 |
| 659 | iso_pu_bacteria | 2751185821 | 2753462480 | 215 |
| 660 | iso_pu_bacteria | 2791355082 | 2792582158 | 215 |
| 661 | iso_pu_bacteria | 2791355091 | 2792621938 | 215 |
| 662 | iso_pu_bacteria | 2791355092 | 2792628805 | 215 |
| 663 | iso_pu_bacteria | 2791355094 | 2792640008 | 215 |
| 664 | iso_pu_bacteria | 2791355253 | 2793281045 | 215 |
| 665 | iso_pu_bacteria | 2802428858 | 2802717234 | 215 |
| 666 | iso_pu_bacteria | 2802428859 | 2802724777 | 215 |
| 667 | iso_pu_bacteria | 2802428860 | 2802729528 | 215 |
| 668 | iso_pu_bacteria | 2802428861 | 2802736874 | 215 |
| 669 | iso_pu_bacteria | 2802428862 | 2802743279 | 215 |
| 670 | iso_pu_bacteria | 2802428863 | 2802749595 | 215 |
| 671 | iso_pu_bacteria | 2802429268 | 2804753617 | 215 |
| 672 | iso_pu_bacteria | 2838074704 | 2838078201 | 215 |
| 673 | iso_pu_bacteria | 2847417321 | 2847420737 | 215 |
| 674 | iso_pu_bacteria | 2848992105 | 2848995569 | 215 |
| 675 | iso_pu_bacteria | 2850079185 | 2850082618 | 215 |
| 676 | iso_pu_bacteria | 2855825444 | 2855827361 | 215 |
| 677 | iso_pu_bacteria | 2855839649 | 2855842729 | 215 |
| 678 | iso_pu_bacteria | 2855872281 | 2855878095 | 215 |
| 679 | iso_pu_bacteria | 2858800743 | 2858802069 | 215 |
| 680 | iso_pu_bacteria | 2891373044 | 2891373903 | 215 |
| 681 | iso_pu_bacteria | 2896384573 | 2896390230 | 215 |
| 682 | iso_pu_bacteria | 2904578770 | 2904580030 | 215 |
| 683 | iso_pu_bacteria | 2913295892 | 2913300097 | 215 |
| 684 | iso_pu_bacteria | 2915980308 | 2915982447 | 215 |
| 685 | iso_pu_bacteria | 2915986958 | 2915989668 | 215 |
| 686 | iso_pu_bacteria | 2915993759 | 2915996497 | 215 |
| 687 | iso_pu_bacteria | 2916000859 | 2916005918 | 215 |
| 688 | iso_pu_bacteria | 2916007675 | 2916010559 | 215 |
| 689 | iso_pu_bacteria | 2916014648 | 2916018325 | 215 |
| 690 | iso_pu_bacteria | 2916021584 | 2916024334 | 215 |
| 691 | iso_pu_bacteria | 2916035215 | 2916037727 | 215 |
| 692 | iso_pu_bacteria | 2916041962 | 2916045940 | 215 |
| 693 | iso_pu_bacteria | 2916048683 | 2916054336 | 215 |
| 694 | iso_pu_bacteria | 2916055098 | 2916058493 | 215 |
| 695 | iso_pu_bacteria | 2916061851 | 2916065034 | 215 |
| 696 | iso_pu_bacteria | 2916068649 | 2916073364 | 215 |
| 697 | iso_pu_bacteria | 2916076590 | 2916077701 | 215 |
| 698 | iso_pu_bacteria | 2919119836 | 2919120297 | 215 |
| 699 | iso_pu_bacteria | 2921201388 | 2921204618 | 215 |
| 700 | iso_pu_bacteria | 2921208531 | 2921208975 | 215 |
| 701 | iso_pu_bacteria | 2921237296 | 2921239852 | 215 |
| 702 | iso_pu_bacteria | 2921244191 | 2921245839 | 215 |
| 703 | iso_pu_bacteria | 2921250672 | 2921252957 | 215 |
| 704 | iso_pu_bacteria | 2921257292 | 2921259040 | 215 |
| 705 | iso_pu_bacteria | 2921263974 | 2921267085 | 215 |
| 706 | iso_pu_bacteria | 2921282425 | 2921285642 | 215 |
| 707 | iso_pu_bacteria | 2921289301 | 2921296664 | 215 |
| 708 | iso_pu_bacteria | 2921296804 | 2921303335 | 215 |
| 709 | iso_pu_bacteria | 2924144063 | 2924146652 | 215 |
| 710 | iso_pu_bacteria | 2924150972 | 2924157753 | 215 |
| 711 | iso_pu_bacteria | 2924158325 | 2924161611 | 215 |
| 712 | iso_pu_bacteria | 2924165586 | 2924169709 | 215 |
| 713 | iso_pu_bacteria | 2924172951 | 2924177304 | 215 |
| 714 | iso_pu_bacteria | 2924179722 | 2924185094 | 215 |
| 715 | iso_pu_bacteria | 2924186466 | 2924186890 | 215 |
| 716 | iso_pu_bacteria | 2924193448 | 2924193628 | 215 |
| 717 | iso_pu_bacteria | 2924200457 | 2924201812 | 215 |
| 718 | iso_pu_bacteria | 2924207177 | 2924210271 | 215 |
| 719 | iso_pu_bacteria | 2924228884 | 2924231697 | 215 |
| 720 | iso_pu_bacteria | 2936996657 | 2936998988 | 215 |
| 721 | iso_pu_bacteria | 2937002841 | 2937006755 | 215 |
| 722 | iso_pu_bacteria | 2937009748 | 2937014654 | 215 |
| 723 | iso_pu_bacteria | 2937016420 | 2937019044 | 215 |
| 724 | iso_pu_bacteria | 2937023124 | 2937025995 | 215 |
| 725 | iso_pu_bacteria | 2937029754 | 2937031877 | 215 |
| 726 | iso_pu_bacteria | 2937036028 | 2937036192 | 215 |
| 727 | iso_pu_bacteria | 2937042894 | 2937045737 | 215 |
| 728 | iso_pu_bacteria | 2937049772 | 2937053444 | 215 |
| 729 | iso_pu_bacteria | 2937056579 | 2937060101 | 215 |
| 730 | iso_pu_bacteria | 2937063883 | 2937067740 | 215 |
| 731 | iso_pu_bacteria | 2937071275 | 2937072758 | 215 |
| 732 | iso_pu_bacteria | 2937078374 | 2937082028 | 215 |
| 733 | iso_pu_bacteria | 2937084907 | 2937089966 | 215 |
| 734 | iso_pu_bacteria | 2937091812 | 2937097312 | 215 |
| 735 | iso_pu_bacteria | 2937098957 | 2937101235 | 215 |
| 736 | iso_pu_bacteria | 2937106411 | 2937109168 | 215 |
| 737 | iso_pu_bacteria | 2937113482 | 2937116029 | 215 |
| 738 | iso_pu_bacteria | 2937119839 | 2937123223 | 215 |
| 739 | iso_pu_bacteria | 2937126314 | 2937127775 | 215 |
| 740 | iso_pu_bacteria | 2957375807 | 2957381848 | 215 |
| 741 | iso_pu_bacteria | 2957382221 | 2957384659 | 215 |
| 742 | iso_pu_bacteria | 2957388812 | 2957391429 | 215 |
| 743 | iso_pu_bacteria | 2957395598 | 2957400761 | 215 |
| 744 | iso_pu_bacteria | 2957402308 | 2957404399 | 215 |
| 745 | iso_pu_bacteria | 2957408893 | 2957411855 | 215 |
| 746 | iso_pu_bacteria | 2957415311 | 2957416680 | 215 |
| 747 | iso_pu_bacteria | 2957422303 | 2957427202 | 215 |
| 748 | iso_pu_bacteria | 2957430029 | 2957432058 | 215 |
| 749 | iso_pu_bacteria | 2957437181 | 2957442106 | 215 |
| 750 | iso_pu_bacteria | 2957443900 | 2957450260 | 215 |
| 751 | iso_pu_bacteria | 2957450854 | 2957456869 | 215 |
| 752 | iso_pu_bacteria | 2957457609 | 2957461252 | 215 |
| 753 | iso_pu_bacteria | 2957464669 | 2957470889 | 215 |
| 754 | iso_pu_bacteria | 2957471148 | 2957474199 | 215 |
| 755 | iso_pu_bacteria | 2957478035 | 2957481712 | 215 |
| 756 | iso_pu_bacteria | 2957484790 | 2957489814 | 215 |
| 757 | iso_pu_bacteria | 2957491536 | 2957494578 | 215 |
| 758 | iso_pu_bacteria | 2957498199 | 2957503996 | 215 |
| 759 | iso_pu_bacteria | 2957505466 | 2957512178 | 215 |
| 760 | iso_pu_bacteria | 2960584000 | 2960590344 | 215 |
| 761 | iso_pu_bacteria | 2960591022 | 2960592216 | 215 |
| 762 | iso_pu_bacteria | 2960597568 | 2960599225 | 215 |
| 763 | iso_pu_bacteria | 2960603979 | 2960609735 | 215 |
| 764 | iso_pu_bacteria | 2960610863 | 2960613248 | 215 |
| 765 | iso_pu_bacteria | 2960617483 | 2960618271 | 215 |
| 766 | iso_pu_bacteria | 2960624210 | 2960628448 | 215 |
| 767 | iso_pu_bacteria | 2960631154 | 2960633421 | 215 |
| 768 | iso_pu_bacteria | 2960637947 | 2960645080 | 215 |
| 769 | iso_pu_bacteria | 2960645483 | 2960651355 | 215 |
| 770 | iso_pu_bacteria | 2960652885 | 2960660047 | 215 |
| 771 | iso_pu_bacteria | 2960660292 | 2960666798 | 215 |
| 772 | iso_pu_bacteria | 2960667422 | 2960673970 | 215 |
| 773 | iso_pu_bacteria | 2960674078 | 2960674651 | 215 |
| 774 | iso_pu_bacteria | 2960680706 | 2960682323 | 215 |
| 775 | iso_pu_bacteria | 2960687367 | 2960691555 | 215 |
| 776 | iso_pu_bacteria | 2960693952 | 2960698251 | 215 |
| 777 | iso_pu_bacteria | 2964607997 | 2964613175 | 215 |
| 778 | iso_pu_bacteria | 2964615318 | 2964619335 | 215 |
| 779 | iso_pu_bacteria | 2964621998 | 2964624783 | 215 |
| 780 | iso_pu_bacteria | 2964628898 | 2964635078 | 215 |
| 781 | iso_pu_bacteria | 2964636051 | 2964639813 | 215 |
| 782 | iso_pu_bacteria | 2964643177 | 2964645896 | 215 |
| 783 | iso_pu_bacteria | 2964649959 | 2964654864 | 215 |
| 784 | iso_pu_bacteria | 2964656573 | 2964657100 | 215 |
| 785 | iso_pu_bacteria | 2964663802 | 2964668972 | 215 |
| 786 | iso_pu_bacteria | 2964670856 | 2964672334 | 215 |
| 787 | iso_pu_bacteria | 2964678106 | 2964681215 | 215 |
| 788 | iso_pu_bacteria | 2964685014 | 2964690951 | 215 |
| 789 | iso_pu_bacteria | 2964691889 | 2964694555 | 215 |
| 790 | iso_pu_bacteria | 2964698721 | 2964701355 | 215 |
| 791 | iso_pu_bacteria | 2964705432 | 2964707971 | 215 |
| 792 | iso_pu_bacteria | 2964712639 | 2964712803 | 215 |
| 793 | iso_pu_bacteria | 2964719344 | 2964722211 | 215 |
| 794 | iso_pu_bacteria | 2967664464 | 2967667737 | 215 |
| 795 | iso_pu_bacteria | 2967671571 | 2967676950 | 215 |
| 796 | iso_pu_bacteria | 2967678726 | 2967681680 | 215 |
| 797 | iso_pu_bacteria | 2967686174 | 2967690267 | 215 |
| 798 | iso_pu_bacteria | 2967693043 | 2967695437 | 215 |
| 799 | iso_pu_bacteria | 2967699805 | 2967704852 | 215 |
| 800 | iso_pu_bacteria | 2967706974 | 2967712499 | 215 |
| 801 | iso_pu_bacteria | 2967714385 | 2967719524 | 215 |
| 802 | iso_pu_bacteria | 2967721400 | 2967726892 | 215 |
| 803 | iso_pu_bacteria | 2967728569 | 2967732059 | 215 |
| 804 | iso_pu_bacteria | 2967735183 | 2967738321 | 215 |
| 805 | iso_pu_bacteria | 2967742019 | 2967748168 | 215 |
| 806 | iso_pu_bacteria | 2967748971 | 2967752554 | 215 |
| 807 | iso_pu_bacteria | 2967755722 | 2967762278 | 215 |
| 808 | iso_pu_bacteria | 2967762386 | 2967766436 | 215 |
| 809 | iso_pu_bacteria | 2967769361 | 2967772871 | 215 |
| 810 | iso_pu_bacteria | 2967775926 | 2967781638 | 215 |
| 811 | iso_pu_bacteria | 2970019648 | 2970020003 | 215 |
| 812 | iso_pu_bacteria | 2970026789 | 2970029517 | 215 |
| 813 | iso_pu_bacteria | 2970033650 | 2970035187 | 215 |
| 814 | iso_pu_bacteria | 2970047711 | 2970052405 | 215 |
| 815 | iso_pu_bacteria | 2970054988 | 2970060370 | 215 |
| 816 | iso_pu_bacteria | 2970061556 | 2970068213 | 215 |
| 817 | iso_pu_bacteria | 2970068827 | 2970075220 | 215 |
| 818 | iso_pu_bacteria | 2970076120 | 2970076924 | 215 |
| 819 | iso_pu_bacteria | 2970082768 | 2970086306 | 215 |
| 820 | iso_pu_bacteria | 2970088815 | 2970092886 | 215 |
| 821 | iso_pu_bacteria | 2970095765 | 2970101291 | 215 |
| 822 | iso_pu_bacteria | 2970102677 | 2970105335 | 215 |
| 823 | iso_pu_bacteria | 2970109326 | 2970112942 | 215 |
| 824 | iso_pu_bacteria | 2970116247 | 2970116796 | 215 |
| 825 | iso_pu_bacteria | 2970122695 | 2970123955 | 215 |
| 826 | iso_pu_bacteria | 2970129317 | 2970133664 | 215 |
| 827 | iso_pu_bacteria | 2970136068 | 2970141000 | 215 |
| 828 | iso_pu_bacteria | 2970143518 | 2970143621 | 215 |
| 829 | iso_pu_bacteria | 2970149975 | 2970152885 | 215 |
| 830 | iso_pu_bacteria | 2970156795 | 2970163303 | 215 |
| 831 | iso_pu_bacteria | 2970164137 | 2970167276 | 215 |
| 832 | iso_pu_bacteria | 2970170962 | 2970174770 | 215 |
| 833 | iso_pu_bacteria | 2970177841 | 2970178162 | 215 |
| 834 | iso_pu_bacteria | 2970184632 | 2970190760 | 215 |
| 835 | iso_pu_bacteria | 2970191845 | 2970198057 | 215 |
| 836 | iso_pu_bacteria | 2977516862 | 2977520081 | 215 |
| 837 | iso_pu_bacteria | 2977523885 | 2977525505 | 215 |
| 838 | iso_pu_bacteria | 2977530762 | 2977535101 | 215 |
| 839 | iso_pu_bacteria | 2977537788 | 2977540341 | 215 |
| 840 | iso_pu_bacteria | 2977544691 | 2977550646 | 215 |
| 841 | iso_pu_bacteria | 2977551784 | 2977553232 | 215 |
| 842 | iso_pu_bacteria | 2977558990 | 2977562127 | 215 |
| 843 | iso_pu_bacteria | 2977565890 | 2977571050 | 215 |
| 844 | iso_pu_bacteria | 2977572785 | 2977578638 | 215 |
| 845 | iso_pu_bacteria | 2977579622 | 2977585578 | 215 |
| 846 | iso_pu_bacteria | 2989349275 | 2989354931 | 215 |
| 847 | iso_pu_bacteria | 643692032 | 643827335 | 215 |
| 848 | iso_pu_bacteria | 648276728 | 648737169 | 215 |
| 849 | iso_pu_bacteria | 8003992118 | 8003995311 | 215 |
| 850 | iso_pu_bacteria | 8003999396 | 8004003060 | 215 |
| 851 | iso_pu_bacteria | 8024486573 | 8024490862 | 215 |
| 852 | iso_pu_bacteria | 8049293176 | 8049296187 | 215 |
| 853 | 3300025294 | Ga0209025_1000042 | Ga0209025_1000042292 | 216 |
| 854 | 3300031901 | Ga0307406_10018127 | Ga0307406_100181272 | 216 |
| 855 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_127822_128547 | 216 |
| 856 | 3300048920 | Ga0496117_0005347 | Ga0496117_0005347_4712_5386 | 216 |
| 857 | 3300048920 | Ga0496117_0147223 | Ga0496117_0147223_472_1197 | 216 |
| 858 | 3300048923 | Ga0496120_0070276 | Ga0496120_0070276_1038_1712 | 216 |
| 859 | 3300048925 | Ga0496122_0000984 | Ga0496122_0000984_47379_48053 | 216 |
| 860 | 3300048926 | Ga0496123_0000290 | Ga0496123_0000290_17950_18624 | 216 |
| 861 | 3300048927 | Ga0496124_0007783 | Ga0496124_0007783_7602_8276 | 216 |
| 862 | 3300048928 | Ga0496125_0007081 | Ga0496125_0007081_8482_9156 | 216 |
| 863 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_127797_128522 | 216 |
| 864 | 3300048929 | Ga0496126_0001347 | Ga0496126_0001347_12357_13031 | 216 |
| 865 | 3300048929 | Ga0496126_0030825 | Ga0496126_0030825_617_1285 | 216 |
| 866 | 3300049570 | Ga0501033_0036210 | Ga0501033_0036210_615_1364 | 216 |
| 867 | 3300049574 | Ga0501038_0187833 | Ga0501038_0187833_118_867 | 216 |
| 868 | 3300049579 | Ga0501043_0029008 | Ga0501043_0029008_2955_3704 | 216 |
| 869 | 3300049580 | Ga0501046_0123027 | Ga0501046_0123027_236_931 | 216 |
| 870 | 3300049586 | Ga0501070_0083601 | Ga0501070_0083601_348_1037 | 216 |
| 871 | 3300049822 | Ga0501035_0229477 | Ga0501035_0229477_130_879 | 216 |
| 872 | 3300050492 | nmdc:mga0yw44_334496_c1 | nmdc:mga0yw44_334496_c1_18_698 | 216 |
| 873 | 3300059510 | Ga0587090_048732 | Ga0587090_048732_58_723 | 216 |
| 874 | iso_pu_bacteria | 2599185352 | 2600193385 | 216 |
| 875 | iso_pu_bacteria | 2643221557 | 2643808083 | 216 |
| 876 | iso_pu_bacteria | 2643221568 | 2643854867 | 216 |
| 877 | iso_pu_bacteria | 2643221610 | 2644068728 | 216 |
| 878 | iso_pu_bacteria | 2643221618 | 2644110132 | 216 |
| 879 | iso_pu_bacteria | 2643221626 | 2644150408 | 216 |
| 880 | iso_pu_bacteria | 2643221655 | 2644313012 | 216 |
| 881 | iso_pu_bacteria | 2643221659 | 2644336560 | 216 |
| 882 | iso_pu_bacteria | 2643221668 | 2644379517 | 216 |
| 883 | iso_pu_bacteria | 2643221675 | 2644419798 | 216 |
| 884 | iso_pu_bacteria | 2643221680 | 2644453155 | 216 |
| 885 | iso_pu_bacteria | 2643221698 | 2644546206 | 216 |
| 886 | iso_pu_bacteria | 2643221712 | 2644618742 | 216 |
| 887 | iso_pu_bacteria | 2643221723 | 2644677111 | 216 |
| 888 | iso_pu_bacteria | 2643221726 | 2644688817 | 216 |
| 889 | iso_pu_bacteria | 2844163670 | 2844164337 | 216 |
| 890 | iso_pu_bacteria | 2919166419 | 2919170504 | 216 |
| 891 | iso_pu_bacteria | 2920760137 | 2920760356 | 216 |
| 892 | iso_pu_bacteria | 2920822456 | 2920825914 | 216 |
| 893 | iso_pu_bacteria | 2941499720 | 2941501332 | 216 |
| 894 | iso_pu_bacteria | 2978969890 | 2978972699 | 216 |
| 895 | iso_pu_bacteria | 2984587000 | 2984590951 | 216 |
| 896 | 3300031548 | Ga0307408_100082644 | Ga0307408_1000826442 | 217 |
| 897 | 3300031911 | Ga0307412_10604306 | Ga0307412_106043061 | 217 |
| 898 | 3300041404 | Ga0439436_0021820 | Ga0439436_0021820_714_1394 | 217 |
| 899 | 3300041411 | Ga0439466_0024036 | Ga0439466_0024036_412_1092 | 217 |
| 900 | 3300041413 | Ga0439465_0008121 | Ga0439465_0008121_1161_1841 | 217 |
| 901 | 3300041999 | Ga0439433_0029146 | Ga0439433_0029146_531_1211 | 217 |
| 902 | 3300042004 | Ga0439445_0023871 | Ga0439445_0023871_492_1172 | 217 |
| 903 | 3300042007 | Ga0439449_0070391 | Ga0439449_0070391_546_1226 | 217 |
| 904 | 3300042122 | Ga0450920_018296 | Ga0450920_018296_588_1268 | 217 |
| 905 | 3300042145 | Ga0450906_001942 | Ga0450906_001942_3457_4137 | 217 |
| 906 | 3300042531 | Ga0450918_002052 | Ga0450918_002052_2618_3298 | 217 |
| 907 | iso_pu_bacteria | 2513237159 | 2513998503 | 217 |
| 908 | iso_pu_bacteria | 2842521101 | 2842524468 | 217 |
| 909 | iso_pu_bacteria | 2899803654 | 2899808027 | 217 |
| 910 | iso_pu_bacteria | 2996336353 | 2996339677 | 217 |
| 911 | 3300028794 | Ga0307515_10016477 | Ga0307515_1001647712 | 218 |
| 912 | 3300046558 | Ga0495633_0122295 | Ga0495633_0122295_196_891 | 218 |
| 913 | 3300046660 | Ga0495625_0284719 | Ga0495625_0284719_171_944 | 218 |
| 914 | 3300053156 | Ga0500622_0000541 | Ga0500622_0000541_31068_31799 | 218 |
| 915 | iso_pu_bacteria | 2582581865 | 2585387962 | 218 |
| 916 | iso_pu_bacteria | 2582581866 | 2585396057 | 218 |
| 917 | iso_pu_bacteria | 8054558443 | 8054560992 | 218 |
| 918 | 3300006946 | Ga0079104_1003980 | Ga0079104_10039802 | 219 |
| 919 | 3300006946 | Ga0079104_1011776 | Ga0079104_10117762 | 219 |
| 920 | 3300021320 | Ga0214544_1000024 | Ga0214544_100002425 | 219 |
| 921 | 3300021321 | Ga0214542_1000008 | Ga0214542_1000008167 | 219 |
| 922 | 3300021321 | Ga0214542_1013885 | Ga0214542_10138855 | 219 |
| 923 | 3300021327 | Ga0214543_1000015 | Ga0214543_100001561 | 219 |
| 924 | 3300021327 | Ga0214543_1000031 | Ga0214543_100003198 | 219 |
| 925 | 3300022739 | Ga0228711_1000004 | Ga0228711_100000484 | 219 |
| 926 | 3300022740 | Ga0228710_1000002 | Ga0228710_100000232 | 219 |
| 927 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030228 | 219 |
| 928 | 3300027111 | Ga0209281_1000955 | Ga0209281_100095512 | 219 |
| 929 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004228 | 219 |
| 930 | 3300028794 | Ga0307515_10004852 | Ga0307515_1000485214 | 219 |
| 931 | 3300031901 | Ga0307406_10175534 | Ga0307406_101755342 | 219 |
| 932 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001156 | 219 |
| 933 | 3300031995 | Ga0307409_100400516 | Ga0307409_1004005161 | 219 |
| 934 | 3300032002 | Ga0307416_100841465 | Ga0307416_1008414652 | 219 |
| 935 | 3300033430 | Ga0315913_1000004 | Ga0315913_1000004145 | 219 |
| 936 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002229 | 219 |
| 937 | 3300041404 | Ga0439436_0024821 | Ga0439436_0024821_650_1327 | 219 |
| 938 | 3300041404 | Ga0439436_0040189 | Ga0439436_0040189_38_718 | 219 |
| 939 | 3300042007 | Ga0439449_0027762 | Ga0439449_0027762_671_1348 | 219 |
| 940 | 3300042007 | Ga0439449_0042768 | Ga0439449_0042768_39_719 | 219 |
| 941 | 3300049532 | Ga0501316_020356 | Ga0501316_020356_33_710 | 219 |
| 942 | 3300053151 | Ga0500604_0054772 | Ga0500604_0054772_36_734 | 219 |
| 943 | iso_pu_bacteria | 2582581283 | 2585166740 | 219 |
| 944 | iso_pu_bacteria | 2643221607 | 2644052026 | 219 |
| 945 | iso_pu_bacteria | 2643221636 | 2644201417 | 219 |
| 946 | iso_pu_bacteria | 2643221686 | 2644484478 | 219 |
| 947 | 3300002739 | JGI25158J39367_1002834 | JGI25158J39367_10028341 | 220 |
| 948 | 3300002987 | JGI25159J45721_1000017 | JGI25159J45721_1000017118 | 220 |
| 949 | 3300003187 | JGI25151J46595_10007018 | JGI25151J46595_100070182 | 220 |
| 950 | 3300003354 | JGI25160J50197_1000027 | JGI25160J50197_100002767 | 220 |
| 951 | 3300003374 | JGI25161J50226_1000531 | JGI25161J50226_10005316 | 220 |
| 952 | 3300003771 | Ga0055526_1000643 | Ga0055526_100064325 | 220 |
| 953 | 3300003775 | Ga0055524_1002302 | Ga0055524_10023022 | 220 |
| 954 | 3300003775 | Ga0055524_1048603 | Ga0055524_10486031 | 220 |
| 955 | 3300003791 | Ga0055530_10016995 | Ga0055530_100169952 | 220 |
| 956 | 3300003792 | Ga0055540_1011023 | Ga0055540_10110232 | 220 |
| 957 | 3300003794 | Ga0055531_10004886 | Ga0055531_100048862 | 220 |
| 958 | 3300004625 | Ga0055543_1000030 | Ga0055543_100003075 | 220 |
| 959 | 3300005262 | Ga0065165_1000122 | Ga0065165_1000122118 | 220 |
| 960 | 3300013249 | Ga0171463_1004 | Ga0171463_1004178 | 220 |
| 961 | 3300015684 | Ga0183365_10029 | Ga0183365_100292 | 220 |
| 962 | 3300015690 | Ga0183363_1019 | Ga0183363_101955 | 220 |
| 963 | 3300025208 | Ga0209436_100540 | Ga0209436_10054015 | 220 |
| 964 | 3300025284 | Ga0209130_1000027 | Ga0209130_1000027202 | 220 |
| 965 | 3300025292 | Ga0209676_1000406 | Ga0209676_100040637 | 220 |
| 966 | 3300025294 | Ga0209025_1000241 | Ga0209025_100024135 | 220 |
| 967 | 3300025295 | Ga0209564_1000111 | Ga0209564_1000111183 | 220 |
| 968 | 3300025298 | Ga0209050_1003192 | Ga0209050_10031929 | 220 |
| 969 | 3300025299 | Ga0209256_1000773 | Ga0209256_100077318 | 220 |
| 970 | 3300025299 | Ga0209256_1030564 | Ga0209256_10305642 | 220 |
| 971 | 3300025302 | Ga0207426_1000072 | Ga0207426_1000072113 | 220 |
| 972 | 3300025303 | Ga0209051_1002411 | Ga0209051_10024118 | 220 |
| 973 | 3300025304 | Ga0209257_1002672 | Ga0209257_100267217 | 220 |
| 974 | 3300041498 | Ga0451841_0234680 | Ga0451841_0234680_209_982 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8veh-assembly4.cif.gz_D | crystal structure of outer membrane lipoprotein carrier protein (lola) from rickettsia bellii | 0.8517 | 44 | 215 |
| 1ua8-assembly1.cif.gz_A | crystal structure of the lipoprotein localization factor, lola | 0.8059 | 43 | 209 |
| 2w7q-assembly1.cif.gz_A | structure of pseudomonas aeruginosa lola | 0.7997 | 45 | 209 |
| 8v1k-assembly2.cif.gz_B | crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis | 0.7986 | 46 | 207 |
| 3ksn-assembly1.cif.gz_A | crystal structure of the lipoprotein localization factor, lola | 0.7979 | 45 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7785 | 43 | 209 | 2.50.20.10 |
| 2w7qB00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7694 | 45 | 210 | 2.50.20.10 |
| 3r6kA02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Positive stranded ssRNA viruses | 0.7632 | 57 | 81 | 2.40.30.120 |
| af_Q2FYX8_1_83_2.170.210.20 | Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain | 0.753 | 140 | 179 | 2.170.210.20 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7244 | 43 | 209 | 2.50.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523FM76-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9461 | 50 | 209 |
|
| AF-A0A383BQ27-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.9355 | 45 | 156 |
|
| AF-A0A5C7UHI7-F1-model_v4 | deleted | 0.9345 | 50 | 211 |
|
| AF-A0A526ZY58-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9279 | 103 | 219 |
|
| AF-A0A435AFI0-F1-model_v4 | deleted | 0.9271 | 44 | 213 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar