F487211

General Info

Members Datasets Scaffolds Average Seq Length
974 772 427 220

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0234680|Ga0451841_0234680_209_982
Length 257
Sequence MASRRNNDARGKGLEGAVLALHMRLEMKEIAMTDTGTGHFEQDTKRLSLSRRSFVGGLAVVAALAFIGMPIEPAQAQQSVVAQKIANHFASVKTMSGEFVQFGPRGEQTGGKFFISRPGKIRFNYDAPSPMRVISDGRTVVIGNQKMKTWDVYPLSKTPLKLLLSDEIDLSGKMVRDVKEEPDLITIVLGDRTIFGDATITLMFDPKTYDLRQWTITDNQGKDTSVMVFNVKTGMQFDDKVFKVPYEVIPGTAAYRD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516143018 Ensifer sp. BR816 Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
39 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2519899620 Rhizobium sp. Pop5 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
46 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
47 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
48 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
49 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
50 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
51 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
52 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
53 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
54 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
55 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
56 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
57 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
58 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
59 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
60 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
61 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
62 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
63 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
64 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
65 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
66 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
67 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
68 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
69 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
70 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
71 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
72 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
73 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
74 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
75 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
76 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
77 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
78 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
79 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
80 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
81 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
82 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
83 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
84 2643221557 Ensifer sp. Root558 Isolate Unclassified
85 2643221558 Rhizobium sp. Root149 Isolate Unclassified
86 2643221568 Rhizobium sp. Root564 Isolate Unclassified
87 2643221582 Rhizobium sp. Root651 Isolate Unclassified
88 2643221599 Rhizobium sp. Root708 Isolate Unclassified
89 2643221607 Rhizobium sp. Root73 Isolate Unclassified
90 2643221610 Ensifer sp. Root74 Isolate Unclassified
91 2643221618 Ensifer sp. Root231 Isolate Unclassified
92 2643221626 Ensifer sp. Root31 Isolate Unclassified
93 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
94 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
95 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
96 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
97 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
98 2643221655 Ensifer sp. Root1252 Isolate Unclassified
99 2643221659 Ensifer sp. Root127 Isolate Unclassified
100 2643221668 Ensifer sp. Root423 Isolate Unclassified
101 2643221675 Ensifer sp. Root1298 Isolate Unclassified
102 2643221680 Ensifer sp. Root1312 Isolate Unclassified
103 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
104 2643221688 Rhizobium sp. Root482 Isolate Unclassified
105 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
106 2643221693 Rhizobium sp. Root491 Isolate Unclassified
107 2643221698 Ensifer sp. Root142 Isolate Unclassified
108 2643221712 Ensifer sp. Root258 Isolate Unclassified
109 2643221718 Rhizobium sp. Root268 Isolate Unclassified
110 2643221719 Rhizobium sp. Root274 Isolate Unclassified
111 2643221723 Ensifer sp. Root278 Isolate Unclassified
112 2643221726 Ensifer sp. Root954 Isolate Unclassified
113 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
114 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
115 2718217882 Rhizobium sp. N741 Isolate Nodule
116 2718217927 Rhizobium sp. N324 Isolate Nodule
117 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
118 2718218009 Rhizobium sp. N561 Isolate Nodule
119 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
120 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
121 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
122 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
123 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
124 2718218363 Rhizobium sp. N113 Isolate Nodule
125 2718218365 Rhizobium sp. N731 Isolate Nodule
126 2718218366 Rhizobium sp. N621 Isolate Nodule
127 2718218423 Rhizobium sp. N941 Isolate Nodule
128 2721755514 Rhizobium sp. N6212 Isolate Nodule
129 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
130 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
131 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
132 2721755809 Rhizobium sp. N541 Isolate Nodule
133 2721755810 Rhizobium sp. N871 Isolate Nodule
134 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
135 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
136 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
137 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
138 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
139 2728369365 Rhizobium sp. N1341 Isolate Nodule
140 2728369397 Rhizobium sp. N1314 Isolate Nodule
141 2738541293 Rhizobium sp. GV031 Isolate Unclassified
142 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
143 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
144 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
145 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
146 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
147 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
148 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
149 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
150 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
151 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
152 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
153 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
154 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
155 2791355256 Rhizobium sp. M10 Isolate Nodule
156 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
157 2791355260 Rhizobium sp. L9 Isolate Nodule
158 2791355261 Rhizobium sp. J15 Isolate Nodule
159 2791355262 Rhizobium sp. M1 Isolate Nodule
160 2791355263 Rhizobium chutanense C5 Isolate Nodule
161 2791355264 Rhizobium sp. S9 Isolate Nodule
162 2791355265 Rhizobium sp. H4 Isolate Nodule
163 2791355266 Rhizobium sp. L43 Isolate Nodule
164 2791355267 Rhizobium sp. L18 Isolate Nodule
165 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
166 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
167 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
168 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
169 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
170 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
171 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
172 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
173 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
174 2802429633 Rhizobium anhuiense J3 Isolate Nodule
175 2802429634 Rhizobium anhuiense S10 Isolate Nodule
176 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
177 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
178 2802429637 Rhizobium anhuiense C15 Isolate Nodule
179 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
180 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
181 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
182 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
183 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
184 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
185 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
186 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
187 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
188 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
189 2838048938 Rhizobium pisi 27/80 Isolate Nodule
190 2838061910 Rhizobium phaseoli L15 Isolate Nodule
191 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
192 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
193 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
194 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
195 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
196 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
197 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
198 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
199 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
200 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
201 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
202 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
203 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
204 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
205 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
206 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
207 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
208 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
209 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
210 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
211 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
212 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
213 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
214 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
215 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
216 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
217 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
218 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
219 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
220 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
221 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
222 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
223 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
224 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
225 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
226 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
227 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
228 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
229 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
230 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
231 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
232 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
233 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
234 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
235 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
236 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
237 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
238 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
239 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
240 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
241 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
242 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
243 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
244 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
245 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
246 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
247 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
248 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
249 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
250 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
251 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
252 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
253 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
254 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
255 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
256 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
257 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
258 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
259 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
260 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
261 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
262 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
263 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
264 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
265 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
266 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
267 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
268 2844163670 Ensifer sp. 1H6 Isolate Unclassified
269 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
270 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
271 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
272 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
273 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
274 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
275 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
276 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
277 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
278 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
279 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
280 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
281 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
282 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
283 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
284 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
285 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
286 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
287 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
288 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
289 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
290 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
291 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
292 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
293 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
294 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
295 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
296 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
297 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
298 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
299 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
300 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
301 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
302 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
303 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
304 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
305 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
306 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
307 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
308 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
309 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
310 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
311 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
312 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
313 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
314 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
315 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
316 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
317 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
318 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
319 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
320 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
321 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
322 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
323 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
324 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
325 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
326 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
327 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
328 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
329 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
330 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
331 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
332 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
333 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
334 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
335 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
336 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
337 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
338 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
339 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
340 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
341 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
342 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
343 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
344 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
345 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
346 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
347 2933599457 Rhizobium phaseoli M3 Isolate Nodule
348 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
349 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
350 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
351 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
352 2936381700 Rhizobium chutanense C16 Isolate Unclassified
353 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
354 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
355 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
356 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
357 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
358 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
359 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
360 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
361 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
362 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
363 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
364 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
365 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
366 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
367 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
368 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
369 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
370 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
371 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
372 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
373 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
374 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
375 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
376 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
377 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
378 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
379 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
380 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
381 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
382 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
383 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
384 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
385 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
386 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
387 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
388 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
389 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
390 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
391 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
392 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
393 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
394 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
395 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
396 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
397 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
398 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
399 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
400 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
401 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
402 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
403 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
404 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
405 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
406 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
407 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
408 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
409 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
410 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
411 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
412 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
413 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
414 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
415 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
416 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
417 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
418 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
419 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
420 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
421 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
422 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
423 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
424 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
425 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
426 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
427 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
428 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
429 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
430 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
431 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
432 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
433 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
434 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
435 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
436 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
437 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
438 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
439 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
440 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
441 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
442 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
443 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
444 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
445 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
446 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
447 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
448 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
449 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
450 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
451 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
452 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
453 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
454 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
455 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
456 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
457 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
458 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
459 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
460 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
461 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
462 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
463 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
464 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
465 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
466 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
467 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
468 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
469 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
470 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
471 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
472 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
473 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
474 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
475 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
476 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
477 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
478 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
479 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
480 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
481 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
482 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
483 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
484 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
485 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
486 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
487 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
488 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
489 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
490 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
491 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
492 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
493 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
494 2996887358 Rhizobium sp. R711 Isolate Nodule
495 2996893221 Rhizobium sp. R635 Isolate Nodule
496 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
497 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
498 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
499 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
500 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
501 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
502 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
503 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
504 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
505 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
506 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
507 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
508 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
509 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
510 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
511 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
512 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
513 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
514 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
515 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
516 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
517 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
518 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
519 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
520 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
521 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
522 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
523 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
524 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
525 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
526 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
527 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
528 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
529 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
530 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
531 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
532 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
533 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
534 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
535 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
536 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
537 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
538 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
539 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
540 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
541 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
542 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
543 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
544 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
545 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
546 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
547 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
548 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
549 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
550 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
551 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
552 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
553 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
554 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
555 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
556 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
557 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
558 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
560 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
561 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
562 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
563 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
564 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
565 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
566 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
567 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
569 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
570 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
576 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
577 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
578 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
579 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
581 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
582 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
583 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
584 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
585 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
586 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
587 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
588 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
589 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
590 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
591 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
592 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
593 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
594 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
595 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
596 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
597 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
598 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
599 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
600 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
601 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
602 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
603 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
604 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
605 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
606 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
607 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
608 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
609 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
610 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
611 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
612 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
613 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
614 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
615 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
616 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
617 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
618 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
619 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
620 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
621 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
622 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
623 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
624 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
625 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
626 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
627 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
628 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
629 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
630 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
631 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
632 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
633 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
634 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
635 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
636 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
637 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
638 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
639 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
640 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
641 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
642 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
643 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
644 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
645 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
646 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
647 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
648 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
649 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
650 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
651 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
652 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
653 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
654 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
655 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
656 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
657 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
658 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
659 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
660 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
661 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
662 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
663 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
664 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
665 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
666 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
667 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
668 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
669 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
670 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
671 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
672 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
673 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
674 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
675 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
676 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
677 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
678 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
679 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
680 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
681 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
682 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
683 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
684 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
685 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
686 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
687 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
688 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
689 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
690 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
691 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
692 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
693 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
694 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
695 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
696 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
697 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
698 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
699 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
700 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
701 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
702 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
703 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
704 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
705 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
706 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
707 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
708 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
709 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
710 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
711 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
712 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
713 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
714 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
715 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
716 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
717 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
726 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
727 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
728 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
729 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
730 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
731 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
732 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
733 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
734 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
735 8005258706 Rhizobium sp. R693 Isolate Nodule
736 8005275841 Rhizobium sp. N4311 Isolate Nodule
737 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
738 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
739 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
740 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
741 8005321885 Rhizobium sp. R72 Isolate Nodule
742 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
743 8005382845 Rhizobium sp. R634 Isolate Nodule
744 8005395548 Rhizobium sp. R339 Isolate Nodule
745 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
746 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
747 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
748 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
749 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
750 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
751 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
752 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
753 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
754 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
755 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
756 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
757 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
758 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
759 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
760 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
761 8018176218 Rhizobium sp. N122 Isolate Nodule
762 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
763 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
764 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
765 8024501048 Rhizobium sp. H4 Isolate Nodule
766 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
767 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
768 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
769 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
770 8056382006 Rhizobium croatiense 13T Isolate Nodule
771 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
772 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.81
Metatranscriptomes 1.13
Isolates 56.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 16.63
Nodule 43.94
Rhizoplane 1.64
Rhizosphere 21.36
Stem 0
Stem Tuber 0
Unclassified 15.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002834 3300002739 Bacteria 2749
2 JGI25152J39213_1002324 3300002773 Bacteria 7310
3 JGI25159J45721_1000017 3300002987 Bacteria 136127
4 JGI25159J45721_1004034 3300002987 Bacteria 4994
5 JGI25159J45721_1021911 3300002987 Bacteria 1193
6 JGI25151J46595_10007018 3300003187 Bacteria 5574
7 JGI25151J46595_10010459 3300003187 Bacteria 4311
8 JGI25151J46595_10059924 3300003187 Bacteria 1221
9 JGI25153J46596_10020535 3300003215 Bacteria 2496
10 JGI25153J46596_10031626 3300003215 Bacteria 1777
11 rootH1_10034948 3300003316 Bacteria 1280
12 JGI25160J50197_1000027 3300003354 Bacteria 182809
13 JGI25160J50197_1001577 3300003354 Bacteria 11246
14 JGI25160J50197_1001979 3300003354 Bacteria 9773
15 JGI25161J50226_1000327 3300003374 Bacteria 25949
16 JGI25161J50226_1000531 3300003374 Bacteria 16373
17 JGI25161J50226_1006452 3300003374 Bacteria 2119
18 Ga0006562J51391_1022330 3300003578 Bacteria 1402
19 Ga0055526_1000643 3300003771 Bacteria 27115
20 Ga0055526_1005398 3300003771 Bacteria 7358
21 Ga0055526_1005433 3300003771 Bacteria 7329
22 Ga0055526_1005536 3300003771 Bacteria 7219
23 Ga0055526_1017612 3300003771 Bacteria 2719
24 Ga0055524_1002302 3300003775 Bacteria 9956
25 Ga0055524_1003673 3300003775 Bacteria 7355
26 Ga0055524_1005096 3300003775 Bacteria 5940
27 Ga0055524_1011296 3300003775 Bacteria 3503
28 Ga0055524_1048603 3300003775 Bacteria 988
29 Ga0055536_1017490 3300003781 Bacteria 2344
30 Ga0055528_1000099 3300003790 Bacteria 68463
31 Ga0055528_1003438 3300003790 Bacteria 7948
32 Ga0055528_1013626 3300003790 Bacteria 3068
33 Ga0055528_1014903 3300003790 Bacteria 2841
34 Ga0055528_1021135 3300003790 Bacteria 2078
35 Ga0055528_1023836 3300003790 Bacteria 1853
36 Ga0055530_10013633 3300003791 Bacteria 2761
37 Ga0055530_10016995 3300003791 Bacteria 2294
38 Ga0055540_1001518 3300003792 Bacteria 13685
39 Ga0055540_1011023 3300003792 Bacteria 2953
40 Ga0055540_1014849 3300003792 Bacteria 2299
41 Ga0055540_1025164 3300003792 Bacteria 1463
42 Ga0055531_10004886 3300003794 Bacteria 7984
43 Ga0055531_10006983 3300003794 Bacteria 6271
44 Ga0058692_1003573 3300003856 Bacteria 4777
45 Ga0055543_1000030 3300004625 Bacteria 130849
46 Ga0055543_1000062 3300004625 Bacteria 98034
47 Ga0055543_1000683 3300004625 Bacteria 17717
48 Ga0065165_1000122 3300005262 Bacteria 132524
49 Ga0065165_1006272 3300005262 Bacteria 6307
50 Ga0065165_1009106 3300005262 Bacteria 4508
51 Ga0065165_1029849 3300005262 Bacteria 1741
52 Ga0065704_10227534 3300005289 Bacteria 1054
53 Ga0070668_100459624 3300005347 Bacteria 1096
54 Ga0070669_100322310 3300005353 Bacteria 1248
55 Ga0070663_100022278 3300005455 Bacteria 4233
56 Ga0070665_100006303 3300005548 Bacteria 12112
57 Ga0070665_100006674 3300005548 Bacteria 11735
58 Ga0070665_100042480 3300005548 Bacteria 4570
59 Ga0070665_100073568 3300005548 Bacteria 3423
60 Ga0081455_10214110 3300005937 Bacteria 1433
61 Ga0075365_10002199 3300006038 Bacteria 9406
62 Ga0075365_10030487 3300006038 Bacteria 3454
63 Ga0075365_10063834 3300006038 Bacteria 2466
64 Ga0075368_10070007 3300006042 Bacteria 1415
65 Ga0075363_100175330 3300006048 Bacteria 1218
66 Ga0075364_10012700 3300006051 Bacteria 5162
67 Ga0075362_10010559 3300006177 Bacteria 3609
68 Ga0075362_10022089 3300006177 Bacteria 2677
69 Ga0075367_10081119 3300006178 Bacteria 1963
70 Ga0075369_10002960 3300006186 Bacteria 6137
71 Ga0075369_10002996 3300006186 Bacteria 6104
72 Ga0075369_10012747 3300006186 Bacteria 3322
73 Ga0075369_10071463 3300006186 Bacteria 1527
74 Ga0075366_10008756 3300006195 Bacteria 5634
75 Ga0075366_10364364 3300006195 Bacteria 888
76 Ga0075370_10176647 3300006353 Bacteria 1256
77 Ga0075370_10218378 3300006353 Bacteria 1126
78 Ga0079104_1000195 3300006946 Bacteria 85244
79 Ga0079104_1003980 3300006946 Bacteria 6577
80 Ga0079104_1011776 3300006946 Bacteria 2790
81 Ga0099826_10001615 3300006948 Bacteria 13773
82 Ga0105243_10243624 3300009148 Bacteria 1601
83 Ga0123340_1053783 3300009763 Bacteria 1368
84 Ga0123341_1000009 3300009765 Bacteria 122597
85 Ga0123341_1044992 3300009765 Bacteria 2698
86 Ga0123342_1005742 3300009766 Bacteria 17739
87 Ga0123342_1014739 3300009766 Bacteria 7359
88 Ga0105246_10024870 3300011119 Bacteria 3898
89 Ga0157322_1000554 3300012490 Bacteria 1460
90 Ga0157314_1007373 3300012500 Bacteria 885
91 Ga0157313_1001433 3300012503 Bacteria 1285
92 Ga0157326_1003420 3300012513 Bacteria 1671
93 Ga0157373_10023861 3300013100 Bacteria 4432
94 Ga0157373_10107542 3300013100 Bacteria 1961
95 Ga0157371_10000071 3300013102 Bacteria 164088
96 Ga0157371_10147068 3300013102 Bacteria 1679
97 Ga0157370_10000469 3300013104 Bacteria 50288
98 Ga0157370_10110472 3300013104 Bacteria 2570
99 Ga0171463_1004 3300013249 Bacteria 437207
100 Ga0163162_10791940 3300013306 Bacteria 1066
101 Ga0183365_10029 3300015684 Bacteria 2921
102 Ga0183363_1019 3300015690 Bacteria 61083
103 Ga0163161_10425723 3300017792 Bacteria 1069
104 Ga0214544_1000024 3300021320 Bacteria 163562
105 Ga0214542_1000008 3300021321 Bacteria 278895
106 Ga0214542_1013885 3300021321 Bacteria 9351
107 Ga0214543_1000015 3300021327 Bacteria 305679
108 Ga0214543_1000031 3300021327 Bacteria 206436
109 Ga0228711_1000004 3300022739 Bacteria 250146
110 Ga0228710_1000002 3300022740 Bacteria 287279
111 Ga0209436_100018 3300025208 Bacteria 113499
112 Ga0209436_100540 3300025208 Bacteria 16420
113 Ga0209563_102086 3300025230 Bacteria 4725
114 Ga0209129_1000118 3300025258 Bacteria 139972
115 Ga0209129_1001394 3300025258 Bacteria 13509
116 Ga0209129_1002591 3300025258 Bacteria 8663
117 Ga0209129_1015400 3300025258 Bacteria 1576
118 Ga0209673_1000033 3300025273 Bacteria 335369
119 Ga0209673_1000050 3300025273 Bacteria 285287
120 Ga0209673_1000052 3300025273 Bacteria 279795
121 Ga0209673_1001738 3300025273 Bacteria 18304
122 Ga0209673_1002049 3300025273 Bacteria 15257
123 Ga0209673_1012763 3300025273 Bacteria 3361
124 Ga0209130_1000009 3300025284 Bacteria 498952
125 Ga0209130_1000027 3300025284 Bacteria 327700
126 Ga0209130_1011628 3300025284 Bacteria 2347
127 Ga0209675_1036862 3300025291 Bacteria 1104
128 Ga0209676_1000406 3300025292 Bacteria 77603
129 Ga0209676_1011701 3300025292 Bacteria 3512
130 Ga0209676_1034641 3300025292 Bacteria 1490
131 Ga0209676_1046264 3300025292 Bacteria 1178
132 Ga0209025_1000042 3300025294 Bacteria 370577
133 Ga0209025_1000241 3300025294 Bacteria 128329
134 Ga0209025_1000335 3300025294 Bacteria 103615
135 Ga0209025_1001416 3300025294 Bacteria 31774
136 Ga0209025_1002567 3300025294 Bacteria 18887
137 Ga0209564_1000111 3300025295 Bacteria 212210
138 Ga0209564_1001330 3300025295 Bacteria 26421
139 Ga0209564_1002296 3300025295 Bacteria 15576
140 Ga0209564_1005228 3300025295 Bacteria 7506
141 Ga0209564_1011899 3300025295 Bacteria 3850
142 Ga0209564_1012761 3300025295 Bacteria 3633
143 Ga0209758_1000896 3300025297 Bacteria 40464
144 Ga0209758_1001119 3300025297 Bacteria 34539
145 Ga0209758_1001936 3300025297 Bacteria 22483
146 Ga0209758_1002583 3300025297 Bacteria 18175
147 Ga0209050_1003192 3300025298 Bacteria 12413
148 Ga0209050_1010152 3300025298 Bacteria 4684
149 Ga0209256_1000773 3300025299 Bacteria 41485
150 Ga0209256_1003224 3300025299 Bacteria 11772
151 Ga0209256_1003248 3300025299 Bacteria 11690
152 Ga0209256_1003350 3300025299 Bacteria 11360
153 Ga0209256_1007011 3300025299 Bacteria 5722
154 Ga0209256_1010945 3300025299 Bacteria 3712
155 Ga0209256_1030564 3300025299 Bacteria 1486
156 Ga0207426_1000041 3300025302 Bacteria 433536
157 Ga0207426_1000072 3300025302 Bacteria 327700
158 Ga0207426_1000348 3300025302 Bacteria 85294
159 Ga0209051_1000276 3300025303 Bacteria 84192
160 Ga0209051_1002411 3300025303 Bacteria 13446
161 Ga0209051_1014339 3300025303 Bacteria 3705
162 Ga0209051_1019151 3300025303 Bacteria 2999
163 Ga0209051_1021514 3300025303 Bacteria 2742
164 Ga0209051_1089400 3300025303 Bacteria 861
165 Ga0209257_1002672 3300025304 Bacteria 17103
166 Ga0209257_1005271 3300025304 Bacteria 9217
167 Ga0209257_1022797 3300025304 Bacteria 2221
168 Ga0209257_1071898 3300025304 Bacteria 909
169 Ga0207681_10205936 3300025923 Bacteria 1513
170 Ga0207668_10371521 3300025972 Bacteria 1201
171 Ga0207678_10274835 3300026067 Bacteria 1445
172 Ga0209281_1000028 3300027111 Bacteria 440027
173 Ga0209281_1000030 3300027111 Bacteria 425931
174 Ga0209281_1000955 3300027111 Bacteria 23510
175 Ga0209371_1000037 3300027312 Bacteria 367074
176 Ga0209371_1005695 3300027312 Bacteria 4867
177 Ga0209282_1000004 3300027666 Bacteria 425931
178 Ga0209282_1001575 3300027666 Bacteria 12592
179 Ga0209813_10034213 3300027866 Bacteria 1515
180 Ga0268266_10005017 3300028379 Bacteria 12498
181 Ga0268266_10045610 3300028379 Bacteria 3750
182 Ga0268266_10184961 3300028379 Bacteria 1899
183 Ga0268266_10416053 3300028379 Bacteria 1273
184 Ga0307515_10004852 3300028794 Bacteria 27508
185 Ga0307515_10016477 3300028794 Bacteria 13524
186 Ga0307515_10289506 3300028794 Bacteria 1335
187 Ga0307515_10401845 3300028794 Bacteria 995
188 Ga0268256_1000039 3300030500 Bacteria 354969
189 Ga0268256_1005626 3300030500 Bacteria 4867
190 Ga0268256_1027137 3300030500 Bacteria 1430
191 Ga0307513_10351635 3300031456 Bacteria 1221
192 Ga0307408_100082644 3300031548 Bacteria 2404
193 Ga0307408_100556022 3300031548 Bacteria 1013
194 Ga0307405_10001184 3300031731 Bacteria 10761
195 Ga0307405_10114168 3300031731 Bacteria 1835
196 Ga0307406_10018127 3300031901 Bacteria 4108
197 Ga0307406_10175534 3300031901 Bacteria 1555
198 Ga0307412_10604306 3300031911 Bacteria 929
199 Ga0307412_10662089 3300031911 Bacteria 892
200 Ga0315914_1000001 3300031967 Bacteria 416633
201 Ga0307409_100121494 3300031995 Bacteria 2213
202 Ga0307409_100400516 3300031995 Bacteria 1311
203 Ga0307416_100841465 3300032002 Bacteria 1015
204 Ga0307414_10064453 3300032004 Bacteria 2609
205 Ga0307411_10418280 3300032005 Bacteria 1113
206 Ga0315913_1000004 3300033430 Bacteria 192741
207 Ga0315915_1000002 3300033464 Bacteria 425854
208 Ga0373935_0182831 3300035692 Bacteria 1440
209 Ga0373947_0375044 3300035725 Bacteria 957
210 Ga0373925_0001135 3300037068 Bacteria 23635
211 Ga0395905_0012935 3300037471 Bacteria 8022
212 Ga0395905_0045508 3300037471 Bacteria 4115
213 Ga0439436_0021820 3300041404 Bacteria 1899
214 Ga0439436_0024821 3300041404 Bacteria 1767
215 Ga0439436_0040189 3300041404 Bacteria 1342
216 Ga0439439_0059039 3300041406 Bacteria 1016
217 Ga0439466_0024036 3300041411 Bacteria 2140
218 Ga0439465_0008121 3300041413 Bacteria 3314
219 Ga0439465_0016593 3300041413 Bacteria 2297
220 Ga0439465_0045089 3300041413 Bacteria 1433
221 Ga0451797_0377651 3300041453 Bacteria 745
222 Ga0451795_0185263 3300041456 Bacteria 943
223 Ga0451833_1171735 3300041491 Bacteria 939
224 Ga0451839_1307106 3300041496 Bacteria 1412
225 Ga0451841_0234680 3300041498 Bacteria 1146
226 Ga0451841_0643035 3300041498 Bacteria 2061
227 Ga0451847_0449155 3300041503 Bacteria 1070
228 Ga0451849_0061017 3300041505 Bacteria 1783
229 Ga0451851_0052458 3300041507 Bacteria 1699
230 Ga0451853_3609191 3300041512 Bacteria 948
231 Ga0439433_0029146 3300041999 Bacteria 1259
232 Ga0439445_0023871 3300042004 Bacteria 1551
233 Ga0439432_035964 3300042006 Bacteria 1586
234 Ga0439449_0027762 3300042007 Bacteria 2111
235 Ga0439449_0042768 3300042007 Bacteria 1683
236 Ga0439449_0070391 3300042007 Bacteria 1289
237 Ga0439452_035526 3300042010 Bacteria 1199
238 Ga0450920_018296 3300042122 Bacteria 1341
239 Ga0450906_001942 3300042145 Bacteria 4520
240 Ga0450918_002052 3300042531 Bacteria 3852
241 Ga0466970_0185964 3300044765 Bacteria 1153
242 Ga0495629_0021063 3300046459 Bacteria 4652
243 Ga0495638_0046858 3300046460 Bacteria 2713
244 Ga0495651_0263144 3300046462 Bacteria 1173
245 Ga0495605_0063077 3300046474 Bacteria 1769
246 Ga0495605_0064505 3300046474 Bacteria 1744
247 Ga0495662_0002196 3300046476 Bacteria 9820
248 Ga0495664_0075784 3300046477 Bacteria 2013
249 Ga0495585_0052303 3300046492 Bacteria 2261
250 Ga0495585_0069684 3300046492 Bacteria 1919
251 Ga0495596_0029987 3300046500 Bacteria 2179
252 Ga0495607_0093888 3300046501 Bacteria 1619
253 Ga0495607_0123208 3300046501 Bacteria 1358
254 Ga0495583_0008838 3300046506 Bacteria 6096
255 Ga0495583_0027490 3300046506 Bacteria 2808
256 Ga0495606_0004841 3300046507 Bacteria 13213
257 Ga0495606_0023480 3300046507 Bacteria 4466
258 Ga0495606_0038290 3300046507 Bacteria 3246
259 Ga0495606_0093671 3300046507 Bacteria 1842
260 Ga0495610_0004675 3300046512 Bacteria 10016
261 Ga0495616_0049134 3300046513 Bacteria 2116
262 Ga0495628_0323437 3300046516 Bacteria 1138
263 Ga0495630_0493610 3300046517 Bacteria 939
264 Ga0495631_0076482 3300046518 Bacteria 1445
265 Ga0495632_0012381 3300046519 Bacteria 4923
266 Ga0495643_0017636 3300046522 Bacteria 4168
267 Ga0495648_0075848 3300046524 Bacteria 1932
268 Ga0495648_0096933 3300046524 Bacteria 1637
269 Ga0495654_0000231 3300046530 Bacteria 52162
270 Ga0495654_0139768 3300046530 Bacteria 1080
271 Ga0495654_0179787 3300046530 Bacteria 917
272 Ga0495597_0018375 3300046542 Bacteria 3281
273 Ga0495633_0018967 3300046558 Bacteria 3482
274 Ga0495633_0094714 3300046558 Bacteria 1387
275 Ga0495633_0100472 3300046558 Bacteria 1343
276 Ga0495633_0122295 3300046558 Bacteria 1206
277 Ga0495656_0048765 3300046615 Bacteria 1801
278 Ga0495656_0060490 3300046615 Bacteria 1651
279 Ga0495634_0147610 3300046642 Bacteria 1489
280 Ga0495611_0076418 3300046648 Bacteria 1535
281 Ga0495625_0174510 3300046660 Bacteria 1433
282 Ga0495625_0284719 3300046660 Bacteria 1062
283 Ga0495625_0397050 3300046660 Bacteria 862
284 Ga0495635_0076020 3300046663 Bacteria 2301
285 Ga0495661_0062968 3300046665 Bacteria 2195
286 Ga0495661_0304767 3300046665 Bacteria 796
287 Ga0495588_0001500 3300046674 Bacteria 9995
288 Ga0495588_0084686 3300046674 Bacteria 1657
289 Ga0495657_0055172 3300046675 Bacteria 2652
290 Ga0495624_0048415 3300046690 Bacteria 2698
291 Ga0495670_0067595 3300046691 Bacteria 1804
292 Ga0495670_0087181 3300046691 Bacteria 1595
293 Ga0495671_0047425 3300046692 Bacteria 2147
294 Ga0495671_0095584 3300046692 Bacteria 1454
295 Ga0495649_0041540 3300046694 Bacteria 2515
296 Ga0495589_0181131 3300046794 Bacteria 999
297 Ga0495600_0012554 3300046809 Bacteria 5300
298 Ga0495660_0032470 3300046810 Bacteria 2931
299 Ga0495604_0008757 3300047317 Bacteria 7996
300 Ga0495674_0259817 3300047319 Bacteria 1427
301 Ga0495679_042957 3300047446 Bacteria 1392
302 Ga0495685_039926 3300047447 Bacteria 1606
303 Ga0495673_0106409 3300047469 Bacteria 1127
304 Ga0495681_0013535 3300047470 Bacteria 4726
305 Ga0495681_0115224 3300047470 Bacteria 1159
306 Ga0495686_0005368 3300047472 Bacteria 10133
307 Ga0495686_0010402 3300047472 Bacteria 6622
308 Ga0495686_0011801 3300047472 Bacteria 6147
309 Ga0495686_0052740 3300047472 Bacteria 2549
310 Ga0496106_0001539 3300048909 Bacteria 17349
311 Ga0496106_0063105 3300048909 Bacteria 2815
312 Ga0496107_0184142 3300048910 Bacteria 1551
313 Ga0496111_0004183 3300048914 Bacteria 9080
314 Ga0496113_0055444 3300048916 Bacteria 2971
315 Ga0496116_0000057 3300048919 Bacteria 281652
316 Ga0496116_0107877 3300048919 Bacteria 1645
317 Ga0496116_0223078 3300048919 Bacteria 963
318 Ga0496117_0000031 3300048920 Bacteria 381048
319 Ga0496117_0005347 3300048920 Bacteria 13534
320 Ga0496117_0008737 3300048920 Bacteria 9569
321 Ga0496117_0147223 3300048920 Bacteria 1400
322 Ga0496118_0003281 3300048921 Bacteria 20588
323 Ga0496118_0038447 3300048921 Bacteria 3835
324 Ga0496119_0047363 3300048922 Bacteria 2675
325 Ga0496120_0001350 3300048923 Bacteria 30183
326 Ga0496120_0006260 3300048923 Bacteria 9188
327 Ga0496120_0070276 3300048923 Bacteria 1926
328 Ga0496120_0305439 3300048923 Bacteria 727
329 Ga0496121_0000034 3300048924 Bacteria 377095
330 Ga0496121_0029870 3300048924 Bacteria 5022
331 Ga0496121_0053928 3300048924 Bacteria 3364
332 Ga0496121_0063751 3300048924 Bacteria 3008
333 Ga0496121_0247956 3300048924 Bacteria 1237
334 Ga0496122_0000023 3300048925 Bacteria 381035
335 Ga0496122_0000984 3300048925 Bacteria 50862
336 Ga0496122_0004338 3300048925 Bacteria 17735
337 Ga0496122_0056159 3300048925 Bacteria 2938
338 Ga0496123_0000027 3300048926 Bacteria 306773
339 Ga0496123_0000062 3300048926 Bacteria 219882
340 Ga0496123_0000290 3300048926 Bacteria 98053
341 Ga0496123_0028666 3300048926 Bacteria 4115
342 Ga0496123_0161416 3300048926 Bacteria 1194
343 Ga0496124_0001510 3300048927 Bacteria 33896
344 Ga0496124_0007783 3300048927 Bacteria 11317
345 Ga0496124_0065069 3300048927 Bacteria 3042
346 Ga0496124_0066095 3300048927 Bacteria 3013
347 Ga0496124_0077454 3300048927 Bacteria 2742
348 Ga0496124_0080888 3300048927 Bacteria 2672
349 Ga0496124_0133806 3300048927 Bacteria 1966
350 Ga0496124_0189034 3300048927 Bacteria 1578
351 Ga0496124_0226918 3300048927 Bacteria 1399
352 Ga0496125_0000030 3300048928 Bacteria 375023
353 Ga0496125_0007081 3300048928 Bacteria 11973
354 Ga0496125_0065387 3300048928 Bacteria 2881
355 Ga0496126_0000115 3300048929 Bacteria 188546
356 Ga0496126_0001347 3300048929 Bacteria 38995
357 Ga0496126_0030825 3300048929 Bacteria 5076
358 Ga0496126_0082000 3300048929 Bacteria 2851
359 Ga0496126_0130745 3300048929 Bacteria 2169
360 Ga0496126_0150463 3300048929 Bacteria 1995
361 Ga0495678_022752 3300049459 Bacteria 2736
362 Ga0501316_020356 3300049532 Bacteria 832
363 Ga0501335_004751 3300049551 Bacteria 1198
364 Ga0501032_0052710 3300049569 Bacteria 2741
365 Ga0501033_0003534 3300049570 Bacteria 12786
366 Ga0501033_0036210 3300049570 Bacteria 3699
367 Ga0501034_0446120 3300049571 Bacteria 1212
368 Ga0501038_0187833 3300049574 Bacteria 1664
369 Ga0501043_0029008 3300049579 Bacteria 4344
370 Ga0501046_0123027 3300049580 Bacteria 1973
371 Ga0501070_0083601 3300049586 Bacteria 2643
372 Ga0501073_0112082 3300049589 Bacteria 1892
373 Ga0501238_013334 3300049671 Bacteria 1119
374 Ga0501238_020333 3300049671 Bacteria 936
375 Ga0501083_0021315 3300049744 Bacteria 4502
376 Ga0501280_001610 3300049776 Bacteria 4059
377 Ga0501035_0000551 3300049822 Bacteria 41644
378 Ga0501035_0229477 3300049822 Bacteria 1582
379 nmdc:mga03n38_120870_c1 3300050490 Bacteria 1287
380 nmdc:mga03n38_300735_c1 3300050490 Bacteria 862
381 nmdc:mga00v17_243645_c1 3300050491 Bacteria 1166
382 nmdc:mga00v17_491828_c1 3300050491 Bacteria 795
383 nmdc:mga00v17_545_c1 3300050491 Bacteria 21081
384 nmdc:mga00v17_7169_c1 3300050491 Bacteria 5939
385 nmdc:mga0yw44_127892_c1 3300050492 Bacteria 1642
386 nmdc:mga0yw44_20321_c1 3300050492 Bacteria 3683
387 nmdc:mga0yw44_334496_c1 3300050492 Bacteria 1018
388 nmdc:mga0yw44_88586_c1 3300050492 Bacteria 1952
389 nmdc:mga06z11_171671_c1 3300050494 Bacteria 1246
390 nmdc:mga06z11_88095_c1 3300050494 Bacteria 1680
391 nmdc:mga0sz30_551_c1 3300050516 Bacteria 13992
392 nmdc:mga0sz30_9548_c1 3300050516 Bacteria 1861
393 Ga0495601_0088286 3300053077 Bacteria 1994
394 Ga0495619_0175564 3300053085 Bacteria 1482
395 Ga0500643_017348 3300053087 Bacteria 2413
396 Ga0500560_003212 3300053107 Bacteria 3271
397 Ga0500562_059141 3300053108 Bacteria 1029
398 Ga0500618_000232 3300053125 Bacteria 43742
399 Ga0500618_004939 3300053125 Bacteria 4139
400 Ga0500618_007819 3300053125 Bacteria 3021
401 Ga0500618_014809 3300053125 Bacteria 1983
402 Ga0500618_045151 3300053125 Bacteria 1005
403 Ga0500658_0000735 3300053134 Bacteria 13496
404 Ga0500658_0026139 3300053134 Bacteria 2247
405 Ga0500559_0048346 3300053136 Bacteria 1870
406 Ga0500561_0000030 3300053137 Bacteria 29291
407 Ga0500568_0007940 3300053139 Bacteria 5157
408 Ga0500590_011317 3300053148 Bacteria 4515
409 Ga0500604_0014189 3300053151 Bacteria 2167
410 Ga0500604_0054772 3300053151 Bacteria 1239
411 Ga0500616_0012716 3300053153 Bacteria 4918
412 Ga0500616_0021142 3300053153 Bacteria 3652
413 Ga0500622_0000541 3300053156 Bacteria 34818
414 Ga0500622_0029751 3300053156 Bacteria 2870
415 Ga0500627_0124400 3300053158 Bacteria 1164
416 Ga0500633_0023461 3300053160 Bacteria 1904
417 Ga0500634_0020365 3300053161 Bacteria 3586
418 Ga0500636_0000040 3300053177 Bacteria 69881
419 Ga0587080_018640 3300059503 Bacteria 1117
420 Ga0587082_054916 3300059504 Bacteria 770
421 Ga0587088_032581 3300059508 Bacteria 940
422 Ga0587090_048732 3300059510 Bacteria 770
423 Ga0587091_041448 3300059511 Bacteria 909
424 Ga0587098_015505 3300059604 Bacteria 911
425 Ga0587068_017695 3300059641 Bacteria 1141
426 Ga0587069_027150 3300059642 Bacteria 901
427 Ga0501082_0122222 3300060353 Bacteria 2257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8004300914 8004304990 184
2 3300048925 Ga0496122_0004338 Ga0496122_0004338_565_1281 186
3 3300053107 Ga0500560_003212 Ga0500560_003212_128_853 192
4 3300005548 Ga0070665_100073568 Ga0070665_1000735682 200
5 3300028379 Ga0268266_10184961 Ga0268266_101849612 200
6 3300048924 Ga0496121_0053928 Ga0496121_0053928_1943_2590 200
7 3300048928 Ga0496125_0000030 Ga0496125_0000030_158897_159577 200
8 3300049671 Ga0501238_020333 Ga0501238_020333_266_913 200
9 3300053108 Ga0500562_059141 Ga0500562_059141_150_818 200
10 3300006038 Ga0075365_10030487 Ga0075365_100304874 201
11 3300006038 Ga0075365_10063834 Ga0075365_100638341 201
12 3300006177 Ga0075362_10022089 Ga0075362_100220894 201
13 3300006186 Ga0075369_10012747 Ga0075369_100127474 201
14 3300009763 Ga0123340_1053783 Ga0123340_10537832 201
15 3300009765 Ga0123341_1044992 Ga0123341_10449922 201
16 3300009766 Ga0123342_1005742 Ga0123342_10057421 201
17 3300025230 Ga0209563_102086 Ga0209563_1020862 201
18 3300046530 Ga0495654_0000231 Ga0495654_0000231_21206_21844 201
19 3300046674 Ga0495588_0001500 Ga0495588_0001500_2317_3042 201
20 3300047472 Ga0495686_0011801 Ga0495686_0011801_1871_2509 201
21 3300053125 Ga0500618_000232 Ga0500618_000232_1790_2428 201
22 3300017792 Ga0163161_10425723 Ga0163161_104257231 202
23 3300032005 Ga0307411_10418280 Ga0307411_104182801 202
24 3300048914 Ga0496111_0004183 Ga0496111_0004183_4819_5532 202
25 3300048920 Ga0496117_0008737 Ga0496117_0008737_7267_7962 202
26 3300048926 Ga0496123_0028666 Ga0496123_0028666_3267_3908 202
27 3300048927 Ga0496124_0066095 Ga0496124_0066095_1767_2480 202
28 iso_pu_bacteria 2599185236 2599720350 202
29 3300005937 Ga0081455_10214110 Ga0081455_102141102 203
30 3300048923 Ga0496120_0305439 Ga0496120_0305439_97_717 203
31 iso_pu_bacteria 2837651117 2837651327 203
32 3300005548 Ga0070665_100042480 Ga0070665_1000424805 204
33 3300006946 Ga0079104_1000195 Ga0079104_100019514 204
34 3300027111 Ga0209281_1000028 Ga0209281_100002814 204
35 3300027111 Ga0209281_1000028 Ga0209281_1000028428 204
36 3300028379 Ga0268266_10416053 Ga0268266_104160532 204
37 3300031456 Ga0307513_10351635 Ga0307513_103516352 204
38 3300041406 Ga0439439_0059039 Ga0439439_0059039_11_643 204
39 3300044765 Ga0466970_0185964 Ga0466970_0185964_480_1127 204
40 3300046530 Ga0495654_0179787 Ga0495654_0179787_202_849 204
41 3300048921 Ga0496118_0038447 Ga0496118_0038447_1316_1984 204
42 3300048926 Ga0496123_0000062 Ga0496123_0000062_73467_74180 204
43 3300048927 Ga0496124_0080888 Ga0496124_0080888_761_1474 204
44 3300050491 nmdc:mga00v17_491828_c1 nmdc:mga00v17_491828_c1_27_674 204
45 iso_pu_bacteria 2821123053 2821128739 204
46 iso_pu_bacteria 2838736955 2838741755 204
47 iso_pu_bacteria 2841840854 2841845411 204
48 iso_pu_bacteria 2842140634 2842145114 204
49 iso_pu_bacteria 2857531043 2857534108 204
50 3300003771 Ga0055526_1005398 Ga0055526_10053989 205
51 3300003790 Ga0055528_1003438 Ga0055528_10034389 205
52 3300006051 Ga0075364_10012700 Ga0075364_100127004 205
53 3300025273 Ga0209673_1000050 Ga0209673_100005030 205
54 3300025295 Ga0209564_1002296 Ga0209564_10022963 205
55 3300025299 Ga0209256_1003224 Ga0209256_100322412 205
56 3300048919 Ga0496116_0223078 Ga0496116_0223078_115_810 205
57 3300048923 Ga0496120_0006260 Ga0496120_0006260_7712_8407 205
58 3300048924 Ga0496121_0000034 Ga0496121_0000034_214927_215607 205
59 3300048927 Ga0496124_0226918 Ga0496124_0226918_573_1253 205
60 3300049570 Ga0501033_0003534 Ga0501033_0003534_11349_12005 205
61 3300049822 Ga0501035_0000551 Ga0501035_0000551_39236_39892 205
62 3300050491 nmdc:mga00v17_7169_c1 nmdc:mga00v17_7169_c1_3781_4461 205
63 3300053125 Ga0500618_004939 Ga0500618_004939_2896_3567 205
64 iso_pu_bacteria 2818991461 2819686949 205
65 iso_pu_bacteria 2889790730 2889791534 205
66 iso_pu_bacteria 2889914905 2889917278 205
67 3300013102 Ga0157371_10147068 Ga0157371_101470682 206
68 3300013104 Ga0157370_10110472 Ga0157370_101104723 206
69 3300048927 Ga0496124_0189034 Ga0496124_0189034_13_672 206
70 iso_pu_bacteria 2600254933 2600373223 206
71 iso_pu_bacteria 2643221558 2643813779 206
72 iso_pu_bacteria 8018150411 8018153380 206
73 3300003215 JGI25153J46596_10031626 JGI25153J46596_100316262 207
74 3300003781 Ga0055536_1017490 Ga0055536_10174902 207
75 3300003791 Ga0055530_10013633 Ga0055530_100136332 207
76 3300003792 Ga0055540_1014849 Ga0055540_10148492 207
77 3300003794 Ga0055531_10006983 Ga0055531_100069836 207
78 3300025292 Ga0209676_1011701 Ga0209676_10117012 207
79 3300025297 Ga0209758_1001119 Ga0209758_100111911 207
80 3300025303 Ga0209051_1021514 Ga0209051_10215142 207
81 3300025303 Ga0209051_1089400 Ga0209051_10894001 207
82 3300025304 Ga0209257_1022797 Ga0209257_10227972 207
83 3300031548 Ga0307408_100556022 Ga0307408_1005560222 207
84 3300031731 Ga0307405_10114168 Ga0307405_101141682 207
85 3300032004 Ga0307414_10064453 Ga0307414_100644533 207
86 3300042006 Ga0439432_035964 Ga0439432_035964_576_1244 207
87 3300049671 Ga0501238_013334 Ga0501238_013334_113_769 207
88 3300053087 Ga0500643_017348 Ga0500643_017348_289_945 207
89 3300053153 Ga0500616_0012716 Ga0500616_0012716_913_1569 207
90 iso_pu_bacteria 2510917026 2511169591 207
91 iso_pu_bacteria 2585427633 2585997796 207
92 iso_pu_bacteria 2585427634 2586002382 207
93 iso_pu_bacteria 2643221637 2644209450 207
94 iso_pu_bacteria 2643221718 2644652978 207
95 iso_pu_bacteria 2842871566 2842873933 207
96 iso_pu_bacteria 2854896431 2854901705 207
97 iso_pu_bacteria 2854916844 2854919497 207
98 iso_pu_bacteria 2919171160 2919175770 207
99 iso_pu_bacteria 2928521798 2928522828 207
100 iso_pu_bacteria 2954011201 2954013807 207
101 iso_pu_bacteria 8056875544 8056878205 207
102 3300006038 Ga0075365_10002199 Ga0075365_100021999 208
103 3300013306 Ga0163162_10791940 Ga0163162_107919402 208
104 3300041413 Ga0439465_0045089 Ga0439465_0045089_388_1056 208
105 3300046507 Ga0495606_0093671 Ga0495606_0093671_638_1312 208
106 3300048929 Ga0496126_0082000 Ga0496126_0082000_1173_1832 208
107 3300050492 nmdc:mga0yw44_20321_c1 nmdc:mga0yw44_20321_c1_1238_1960 208
108 3300046501 Ga0495607_0123208 Ga0495607_0123208_384_1046 209
109 3300046615 Ga0495656_0048765 Ga0495656_0048765_494_1168 209
110 3300046660 Ga0495625_0397050 Ga0495625_0397050_34_708 209
111 3300046691 Ga0495670_0087181 Ga0495670_0087181_517_1191 209
112 3300047472 Ga0495686_0010402 Ga0495686_0010402_3843_4583 209
113 3300053125 Ga0500618_014809 Ga0500618_014809_1125_1787 209
114 3300053125 Ga0500618_045151 Ga0500618_045151_311_973 209
115 iso_pu_bacteria 8055431914 8055435546 209
116 3300031731 Ga0307405_10001184 Ga0307405_100011845 210
117 3300046474 Ga0495605_0063077 Ga0495605_0063077_625_1299 210
118 3300046492 Ga0495585_0069684 Ga0495585_0069684_461_1135 210
119 3300046506 Ga0495583_0008838 Ga0495583_0008838_4857_5531 210
120 3300046507 Ga0495606_0038290 Ga0495606_0038290_733_1407 210
121 3300046518 Ga0495631_0076482 Ga0495631_0076482_597_1271 210
122 3300046558 Ga0495633_0100472 Ga0495633_0100472_46_720 210
123 3300046660 Ga0495625_0174510 Ga0495625_0174510_189_863 210
124 3300046674 Ga0495588_0084686 Ga0495588_0084686_669_1343 210
125 3300048924 Ga0496121_0247956 Ga0496121_0247956_369_1022 210
126 3300059504 Ga0587082_054916 Ga0587082_054916_85_759 210
127 3300059642 Ga0587069_027150 Ga0587069_027150_70_744 210
128 iso_pu_bacteria 3003930520 3003930992 210
129 iso_pu_bacteria 8005658619 8005660828 210
130 3300002987 JGI25159J45721_1021911 JGI25159J45721_10219112 211
131 3300003187 JGI25151J46595_10010459 JGI25151J46595_100104592 211
132 3300003316 rootH1_10034948 rootH1_100349482 211
133 3300003771 Ga0055526_1017612 Ga0055526_10176122 211
134 3300003775 Ga0055524_1011296 Ga0055524_10112962 211
135 3300003790 Ga0055528_1000099 Ga0055528_100009939 211
136 3300005262 Ga0065165_1006272 Ga0065165_10062722 211
137 3300006353 Ga0075370_10176647 Ga0075370_101766472 211
138 3300025258 Ga0209129_1000118 Ga0209129_10001189 211
139 3300025273 Ga0209673_1000033 Ga0209673_1000033225 211
140 3300025284 Ga0209130_1011628 Ga0209130_10116282 211
141 3300025292 Ga0209676_1046264 Ga0209676_10462642 211
142 3300025294 Ga0209025_1002567 Ga0209025_100256719 211
143 3300025295 Ga0209564_1011899 Ga0209564_10118995 211
144 3300025299 Ga0209256_1003350 Ga0209256_100335010 211
145 3300025304 Ga0209257_1071898 Ga0209257_10718981 211
146 3300028794 Ga0307515_10289506 Ga0307515_102895061 211
147 3300048909 Ga0496106_0063105 Ga0496106_0063105_1548_2216 211
148 3300048910 Ga0496107_0184142 Ga0496107_0184142_251_919 211
149 3300048924 Ga0496121_0063751 Ga0496121_0063751_1017_1685 211
150 3300048925 Ga0496122_0056159 Ga0496122_0056159_76_744 211
151 3300048926 Ga0496123_0161416 Ga0496123_0161416_376_1044 211
152 3300048927 Ga0496124_0077454 Ga0496124_0077454_1926_2594 211
153 3300048929 Ga0496126_0150463 Ga0496126_0150463_716_1384 211
154 3300053125 Ga0500618_007819 Ga0500618_007819_1937_2611 211
155 iso_pu_bacteria 2510917028 2511184009 211
156 iso_pu_bacteria 2513237088 2513596839 211
157 iso_pu_bacteria 2513237138 2513867491 211
158 iso_pu_bacteria 2513237146 2513928425 211
159 iso_pu_bacteria 2534681796 2535519035 211
160 iso_pu_bacteria 2558860983 2561467150 211
161 iso_pu_bacteria 2582581867 2585399760 211
162 iso_pu_bacteria 2585427590 2585820847 211
163 iso_pu_bacteria 2599185170 2599420134 211
164 iso_pu_bacteria 2738541317 2738947026 211
165 iso_pu_bacteria 2791355261 2793327294 211
166 iso_pu_bacteria 2838035591 2838040342 211
167 iso_pu_bacteria 2838661181 2838667757 211
168 iso_pu_bacteria 2894652903 2894653805 211
169 iso_pu_bacteria 2913308742 2913312147 211
170 iso_pu_bacteria 2923556063 2923559479 211
171 iso_pu_bacteria 2933016740 2933017658 211
172 iso_pu_bacteria 2996887358 2996890252 211
173 iso_pu_bacteria 8005258706 8005262435 211
174 iso_pu_bacteria 8005321885 8005324779 211
175 iso_pu_bacteria 8005382845 8005387764 211
176 iso_pu_bacteria 8005395548 8005400799 211
177 iso_pu_bacteria 8005542996 8005546684 211
178 3300002773 JGI25152J39213_1002324 JGI25152J39213_10023244 212
179 3300002987 JGI25159J45721_1004034 JGI25159J45721_10040342 212
180 3300003215 JGI25153J46596_10020535 JGI25153J46596_100205352 212
181 3300003354 JGI25160J50197_1001577 JGI25160J50197_10015779 212
182 3300003354 JGI25160J50197_1001979 JGI25160J50197_10019796 212
183 3300003374 JGI25161J50226_1000327 JGI25161J50226_100032728 212
184 3300003374 JGI25161J50226_1006452 JGI25161J50226_10064522 212
185 3300003771 Ga0055526_1005433 Ga0055526_10054332 212
186 3300003771 Ga0055526_1005536 Ga0055526_10055362 212
187 3300003775 Ga0055524_1003673 Ga0055524_10036732 212
188 3300003775 Ga0055524_1005096 Ga0055524_10050966 212
189 3300003790 Ga0055528_1013626 Ga0055528_10136262 212
190 3300003790 Ga0055528_1014903 Ga0055528_10149032 212
191 3300003790 Ga0055528_1021135 Ga0055528_10211352 212
192 3300003790 Ga0055528_1023836 Ga0055528_10238361 212
193 3300003792 Ga0055540_1001518 Ga0055540_10015184 212
194 3300003792 Ga0055540_1025164 Ga0055540_10251641 212
195 3300004625 Ga0055543_1000062 Ga0055543_100006266 212
196 3300004625 Ga0055543_1000683 Ga0055543_100068313 212
197 3300005262 Ga0065165_1009106 Ga0065165_10091063 212
198 3300005262 Ga0065165_1029849 Ga0065165_10298492 212
199 3300005455 Ga0070663_100022278 Ga0070663_1000222782 212
200 3300006048 Ga0075363_100175330 Ga0075363_1001753302 212
201 3300006186 Ga0075369_10002960 Ga0075369_100029609 212
202 3300006195 Ga0075366_10008756 Ga0075366_100087566 212
203 3300006195 Ga0075366_10364364 Ga0075366_103643642 212
204 3300006353 Ga0075370_10218378 Ga0075370_102183782 212
205 3300009765 Ga0123341_1000009 Ga0123341_1000009110 212
206 3300009766 Ga0123342_1014739 Ga0123342_10147395 212
207 3300012490 Ga0157322_1000554 Ga0157322_10005542 212
208 3300012500 Ga0157314_1007373 Ga0157314_10073731 212
209 3300012503 Ga0157313_1001433 Ga0157313_10014332 212
210 3300012513 Ga0157326_1003420 Ga0157326_10034202 212
211 3300025208 Ga0209436_100018 Ga0209436_10001836 212
212 3300025258 Ga0209129_1001394 Ga0209129_10013943 212
213 3300025258 Ga0209129_1002591 Ga0209129_100259113 212
214 3300025258 Ga0209129_1015400 Ga0209129_10154002 212
215 3300025273 Ga0209673_1000052 Ga0209673_1000052164 212
216 3300025273 Ga0209673_1001738 Ga0209673_10017383 212
217 3300025273 Ga0209673_1002049 Ga0209673_10020493 212
218 3300025273 Ga0209673_1012763 Ga0209673_10127632 212
219 3300025284 Ga0209130_1000009 Ga0209130_1000009256 212
220 3300025291 Ga0209675_1036862 Ga0209675_10368622 212
221 3300025292 Ga0209676_1034641 Ga0209676_10346412 212
222 3300025294 Ga0209025_1000335 Ga0209025_100033531 212
223 3300025295 Ga0209564_1001330 Ga0209564_100133010 212
224 3300025295 Ga0209564_1005228 Ga0209564_10052289 212
225 3300025295 Ga0209564_1012761 Ga0209564_10127612 212
226 3300025297 Ga0209758_1000896 Ga0209758_100089611 212
227 3300025297 Ga0209758_1001936 Ga0209758_100193612 212
228 3300025297 Ga0209758_1002583 Ga0209758_100258315 212
229 3300025298 Ga0209050_1010152 Ga0209050_10101522 212
230 3300025299 Ga0209256_1003248 Ga0209256_100324811 212
231 3300025299 Ga0209256_1007011 Ga0209256_10070116 212
232 3300025299 Ga0209256_1010945 Ga0209256_10109452 212
233 3300025302 Ga0207426_1000041 Ga0207426_1000041194 212
234 3300025302 Ga0207426_1000348 Ga0207426_100034868 212
235 3300025303 Ga0209051_1000276 Ga0209051_100027628 212
236 3300025303 Ga0209051_1014339 Ga0209051_10143392 212
237 3300025303 Ga0209051_1019151 Ga0209051_10191513 212
238 3300025304 Ga0209257_1005271 Ga0209257_10052718 212
239 3300026067 Ga0207678_10274835 Ga0207678_102748352 212
240 3300027866 Ga0209813_10034213 Ga0209813_100342132 212
241 3300028794 Ga0307515_10401845 Ga0307515_104018452 212
242 3300041413 Ga0439465_0016593 Ga0439465_0016593_1188_1856 212
243 3300041453 Ga0451797_0377651 Ga0451797_0377651_38_706 212
244 3300041456 Ga0451795_0185263 Ga0451795_0185263_157_825 212
245 3300041491 Ga0451833_1171735 Ga0451833_1171735_219_887 212
246 3300041496 Ga0451839_1307106 Ga0451839_1307106_173_841 212
247 3300041498 Ga0451841_0643035 Ga0451841_0643035_607_1275 212
248 3300041503 Ga0451847_0449155 Ga0451847_0449155_294_962 212
249 3300041505 Ga0451849_0061017 Ga0451849_0061017_262_930 212
250 3300041507 Ga0451851_0052458 Ga0451851_0052458_577_1245 212
251 3300041512 Ga0451853_3609191 Ga0451853_3609191_193_861 212
252 3300042010 Ga0439452_035526 Ga0439452_035526_470_1138 212
253 3300046474 Ga0495605_0064505 Ga0495605_0064505_408_1076 212
254 3300046492 Ga0495585_0052303 Ga0495585_0052303_202_870 212
255 3300046500 Ga0495596_0029987 Ga0495596_0029987_1142_1810 212
256 3300046501 Ga0495607_0093888 Ga0495607_0093888_420_1088 212
257 3300046506 Ga0495583_0027490 Ga0495583_0027490_1442_2110 212
258 3300046507 Ga0495606_0023480 Ga0495606_0023480_3457_4125 212
259 3300046512 Ga0495610_0004675 Ga0495610_0004675_3564_4238 212
260 3300046513 Ga0495616_0049134 Ga0495616_0049134_661_1329 212
261 3300046519 Ga0495632_0012381 Ga0495632_0012381_3671_4339 212
262 3300046522 Ga0495643_0017636 Ga0495643_0017636_505_1173 212
263 3300046524 Ga0495648_0075848 Ga0495648_0075848_323_991 212
264 3300046524 Ga0495648_0096933 Ga0495648_0096933_457_1125 212
265 3300046530 Ga0495654_0139768 Ga0495654_0139768_30_698 212
266 3300046542 Ga0495597_0018375 Ga0495597_0018375_585_1253 212
267 3300046558 Ga0495633_0018967 Ga0495633_0018967_2217_2885 212
268 3300046615 Ga0495656_0060490 Ga0495656_0060490_462_1130 212
269 3300046648 Ga0495611_0076418 Ga0495611_0076418_651_1319 212
270 3300046665 Ga0495661_0062968 Ga0495661_0062968_714_1382 212
271 3300046665 Ga0495661_0304767 Ga0495661_0304767_49_717 212
272 3300046691 Ga0495670_0067595 Ga0495670_0067595_282_950 212
273 3300046692 Ga0495671_0047425 Ga0495671_0047425_555_1223 212
274 3300046694 Ga0495649_0041540 Ga0495649_0041540_1511_2179 212
275 3300046794 Ga0495589_0181131 Ga0495589_0181131_235_903 212
276 3300046810 Ga0495660_0032470 Ga0495660_0032470_1156_1824 212
277 3300047446 Ga0495679_042957 Ga0495679_042957_377_1045 212
278 3300047447 Ga0495685_039926 Ga0495685_039926_381_1049 212
279 3300047469 Ga0495673_0106409 Ga0495673_0106409_26_700 212
280 3300047470 Ga0495681_0115224 Ga0495681_0115224_202_870 212
281 3300047472 Ga0495686_0005368 Ga0495686_0005368_5754_6428 212
282 3300047472 Ga0495686_0052740 Ga0495686_0052740_1697_2365 212
283 3300048909 Ga0496106_0001539 Ga0496106_0001539_4607_5281 212
284 3300048927 Ga0496124_0065069 Ga0496124_0065069_1394_2068 212
285 3300048927 Ga0496124_0133806 Ga0496124_0133806_786_1460 212
286 3300049459 Ga0495678_022752 Ga0495678_022752_1635_2303 212
287 3300049569 Ga0501032_0052710 Ga0501032_0052710_775_1449 212
288 3300049571 Ga0501034_0446120 Ga0501034_0446120_450_1124 212
289 3300049589 Ga0501073_0112082 Ga0501073_0112082_669_1343 212
290 3300049744 Ga0501083_0021315 Ga0501083_0021315_66_740 212
291 3300050490 nmdc:mga03n38_120870_c1 nmdc:mga03n38_120870_c1_399_1067 212
292 3300050492 nmdc:mga0yw44_127892_c1 nmdc:mga0yw44_127892_c1_431_1099 212
293 3300053134 Ga0500658_0000735 Ga0500658_0000735_3798_4466 212
294 3300053134 Ga0500658_0026139 Ga0500658_0026139_1230_1904 212
295 3300053139 Ga0500568_0007940 Ga0500568_0007940_3453_4127 212
296 3300053151 Ga0500604_0014189 Ga0500604_0014189_867_1541 212
297 3300053153 Ga0500616_0021142 Ga0500616_0021142_2698_3366 212
298 3300053156 Ga0500622_0029751 Ga0500622_0029751_1484_2152 212
299 3300053158 Ga0500627_0124400 Ga0500627_0124400_56_724 212
300 3300053160 Ga0500633_0023461 Ga0500633_0023461_496_1170 212
301 3300053161 Ga0500634_0020365 Ga0500634_0020365_2389_3072 212
302 3300059503 Ga0587080_018640 Ga0587080_018640_398_1066 212
303 3300059511 Ga0587091_041448 Ga0587091_041448_194_862 212
304 3300060353 Ga0501082_0122222 Ga0501082_0122222_731_1405 212
305 iso_pu_bacteria 2509276021 2509389396 212
306 iso_pu_bacteria 2509276033 2509446203 212
307 iso_pu_bacteria 2510065019 2510135255 212
308 iso_pu_bacteria 2510461076 2510896710 212
309 iso_pu_bacteria 2513237084 2513571638 212
310 iso_pu_bacteria 2513237085 2513578673 212
311 iso_pu_bacteria 2513237093 2513630143 212
312 iso_pu_bacteria 2513237103 2513711359 212
313 iso_pu_bacteria 2513237162 2514019411 212
314 iso_pu_bacteria 2515075009 2515114413 212
315 iso_pu_bacteria 2515154113 2515635417 212
316 iso_pu_bacteria 2515154114 2515643175 212
317 iso_pu_bacteria 2515154116 2515657639 212
318 iso_pu_bacteria 2515154134 2515741598 212
319 iso_pu_bacteria 2516653077 2517038065 212
320 iso_pu_bacteria 2516653085 2517078328 212
321 iso_pu_bacteria 2517093000 2517097087 212
322 iso_pu_bacteria 2517287029 2517408528 212
323 iso_pu_bacteria 2519899620 2520376412 212
324 iso_pu_bacteria 2529292951 2530647340 212
325 iso_pu_bacteria 2582581298 2585223932 212
326 iso_pu_bacteria 2582581304 2585257349 212
327 iso_pu_bacteria 2585427526 2585526034 212
328 iso_pu_bacteria 2585427528 2585540789 212
329 iso_pu_bacteria 2585427529 2585549155 212
330 iso_pu_bacteria 2585427593 2585839059 212
331 iso_pu_bacteria 2585427594 2585844910 212
332 iso_pu_bacteria 2599185156 2599335057 212
333 iso_pu_bacteria 2615840624 2616296306 212
334 iso_pu_bacteria 2643221555 2643795631 212
335 iso_pu_bacteria 2643221599 2644002483 212
336 iso_pu_bacteria 2643221634 2644194810 212
337 iso_pu_bacteria 2643221643 2644240492 212
338 iso_pu_bacteria 2643221689 2644499257 212
339 iso_pu_bacteria 2718217882 2719182972 212
340 iso_pu_bacteria 2718217927 2719387687 212
341 iso_pu_bacteria 2718217997 2719667317 212
342 iso_pu_bacteria 2718218009 2719733689 212
343 iso_pu_bacteria 2718218199 2720493737 212
344 iso_pu_bacteria 2718218232 2720615193 212
345 iso_pu_bacteria 2718218233 2720621986 212
346 iso_pu_bacteria 2718218235 2720633336 212
347 iso_pu_bacteria 2718218269 2720777034 212
348 iso_pu_bacteria 2718218363 2721149084 212
349 iso_pu_bacteria 2718218365 2721160482 212
350 iso_pu_bacteria 2718218366 2721165897 212
351 iso_pu_bacteria 2718218423 2721401321 212
352 iso_pu_bacteria 2721755514 2722842067 212
353 iso_pu_bacteria 2721755556 2723028632 212
354 iso_pu_bacteria 2721755684 2723562236 212
355 iso_pu_bacteria 2721755685 2723568939 212
356 iso_pu_bacteria 2721755809 2724040135 212
357 iso_pu_bacteria 2721755810 2724046445 212
358 iso_pu_bacteria 2721755819 2724091641 212
359 iso_pu_bacteria 2721755822 2724106204 212
360 iso_pu_bacteria 2721755823 2724112010 212
361 iso_pu_bacteria 2724679232 2725947547 212
362 iso_pu_bacteria 2728369352 2730109568 212
363 iso_pu_bacteria 2728369365 2730166207 212
364 iso_pu_bacteria 2728369397 2730300114 212
365 iso_pu_bacteria 2738541293 2738801176 212
366 iso_pu_bacteria 2738541333 2739037285 212
367 iso_pu_bacteria 2765235942 2766064258 212
368 iso_pu_bacteria 2791355256 2793295618 212
369 iso_pu_bacteria 2791355259 2793313367 212
370 iso_pu_bacteria 2791355260 2793320730 212
371 iso_pu_bacteria 2791355262 2793332247 212
372 iso_pu_bacteria 2791355263 2793338824 212
373 iso_pu_bacteria 2791355264 2793346609 212
374 iso_pu_bacteria 2791355265 2793353852 212
375 iso_pu_bacteria 2791355266 2793359386 212
376 iso_pu_bacteria 2791355267 2793365914 212
377 iso_pu_bacteria 2802429605 2805926224 212
378 iso_pu_bacteria 2802429606 2805933950 212
379 iso_pu_bacteria 2802429633 2806047377 212
380 iso_pu_bacteria 2802429634 2806054232 212
381 iso_pu_bacteria 2802429635 2806060184 212
382 iso_pu_bacteria 2802429636 2806068795 212
383 iso_pu_bacteria 2802429637 2806076401 212
384 iso_pu_bacteria 2838016132 2838018323 212
385 iso_pu_bacteria 2838022645 2838024004 212
386 iso_pu_bacteria 2838042994 2838047851 212
387 iso_pu_bacteria 2838048938 2838050816 212
388 iso_pu_bacteria 2838061910 2838062584 212
389 iso_pu_bacteria 2838068647 2838072133 212
390 iso_pu_bacteria 2838668709 2838672173 212
391 iso_pu_bacteria 2838680041 2838683869 212
392 iso_pu_bacteria 2838686498 2838690292 212
393 iso_pu_bacteria 2838694306 2838698397 212
394 iso_pu_bacteria 2838701080 2838704957 212
395 iso_pu_bacteria 2838707686 2838711512 212
396 iso_pu_bacteria 2838729681 2838732067 212
397 iso_pu_bacteria 2838742623 2838744963 212
398 iso_pu_bacteria 2840764183 2840766320 212
399 iso_pu_bacteria 2841851746 2841856021 212
400 iso_pu_bacteria 2841864319 2841867748 212
401 iso_pu_bacteria 2842077413 2842081313 212
402 iso_pu_bacteria 2842110456 2842116845 212
403 iso_pu_bacteria 2842118031 2842121910 212
404 iso_pu_bacteria 2842146304 2842148807 212
405 iso_pu_bacteria 2842156927 2842161190 212
406 iso_pu_bacteria 2842163707 2842166702 212
407 iso_pu_bacteria 2842180545 2842184807 212
408 iso_pu_bacteria 2842192696 2842194873 212
409 iso_pu_bacteria 2842198810 2842201597 212
410 iso_pu_bacteria 2842205361 2842207429 212
411 iso_pu_bacteria 2842217011 2842221790 212
412 iso_pu_bacteria 2842229732 2842232389 212
413 iso_pu_bacteria 2842237096 2842240924 212
414 iso_pu_bacteria 2842243621 2842246805 212
415 iso_pu_bacteria 2842250916 2842254638 212
416 iso_pu_bacteria 2842257432 2842261094 212
417 iso_pu_bacteria 2842264693 2842269648 212
418 iso_pu_bacteria 2842271015 2842274312 212
419 iso_pu_bacteria 2842278818 2842280860 212
420 iso_pu_bacteria 2842285085 2842288528 212
421 iso_pu_bacteria 2842291075 2842294970 212
422 iso_pu_bacteria 2842304105 2842305846 212
423 iso_pu_bacteria 2842311132 2842311422 212
424 iso_pu_bacteria 2842317721 2842321120 212
425 iso_pu_bacteria 2842341865 2842346571 212
426 iso_pu_bacteria 2842363717 2842366261 212
427 iso_pu_bacteria 2842370503 2842375012 212
428 iso_pu_bacteria 2842377471 2842381369 212
429 iso_pu_bacteria 2842384541 2842388439 212
430 iso_pu_bacteria 2842395702 2842395934 212
431 iso_pu_bacteria 2842402390 2842406126 212
432 iso_pu_bacteria 2842409023 2842412711 212
433 iso_pu_bacteria 2842415677 2842419410 212
434 iso_pu_bacteria 2842422224 2842425765 212
435 iso_pu_bacteria 2842428310 2842433590 212
436 iso_pu_bacteria 2842434925 2842439918 212
437 iso_pu_bacteria 2842441272 2842446547 212
438 iso_pu_bacteria 2842447887 2842448769 212
439 iso_pu_bacteria 2842462802 2842467944 212
440 iso_pu_bacteria 2842469257 2842474527 212
441 iso_pu_bacteria 2842489311 2842491173 212
442 iso_pu_bacteria 2842495871 2842498510 212
443 iso_pu_bacteria 2842922631 2842926246 212
444 iso_pu_bacteria 2844454524 2844457009 212
445 iso_pu_bacteria 2857516855 2857519583 212
446 iso_pu_bacteria 2919100787 2919105396 212
447 iso_pu_bacteria 2933570622 2933572351 212
448 iso_pu_bacteria 2933586486 2933593150 212
449 iso_pu_bacteria 2933599457 2933603014 212
450 iso_pu_bacteria 2935894831 2935897952 212
451 iso_pu_bacteria 2935901341 2935903626 212
452 iso_pu_bacteria 2936367885 2936369897 212
453 iso_pu_bacteria 2936375103 2936379082 212
454 iso_pu_bacteria 2936381700 2936381941 212
455 iso_pu_bacteria 2989771324 2989771560 212
456 iso_pu_bacteria 2996893221 2996897005 212
457 iso_pu_bacteria 3005445848 3005449668 212
458 iso_pu_bacteria 3005452660 3005455959 212
459 iso_pu_bacteria 639633055 639650439 212
460 iso_pu_bacteria 8005275841 8005282442 212
461 iso_pu_bacteria 8005282627 8005286740 212
462 iso_pu_bacteria 8005289223 8005295091 212
463 iso_pu_bacteria 8005301065 8005305970 212
464 iso_pu_bacteria 8005307578 8005313707 212
465 iso_pu_bacteria 8005376324 8005381560 212
466 iso_pu_bacteria 8005430974 8005431114 212
467 iso_pu_bacteria 8005460587 8005465105 212
468 iso_pu_bacteria 8005497431 8005497683 212
469 iso_pu_bacteria 8005556819 8005561181 212
470 iso_pu_bacteria 8005563573 8005565805 212
471 iso_pu_bacteria 8005570704 8005571853 212
472 iso_pu_bacteria 8005619151 8005623415 212
473 iso_pu_bacteria 8005626139 8005631004 212
474 iso_pu_bacteria 8005668836 8005669088 212
475 iso_pu_bacteria 8005688590 8005694331 212
476 iso_pu_bacteria 8005695170 8005695744 212
477 iso_pu_bacteria 8018127388 8018128918 212
478 iso_pu_bacteria 8018163183 8018165080 212
479 iso_pu_bacteria 8018176218 8018177160 212
480 iso_pu_bacteria 8023680758 8023686547 212
481 iso_pu_bacteria 8024479707 8024484378 212
482 iso_pu_bacteria 8024501048 8024502018 212
483 iso_pu_bacteria 8056375014 8056380424 212
484 iso_pu_bacteria 8056382006 8056385253 212
485 iso_pu_bacteria 8057874678 8057879297 212
486 3300013100 Ga0157373_10023861 Ga0157373_100238612 213
487 3300037471 Ga0395905_0012935 Ga0395905_0012935_1022_1687 213
488 3300037471 Ga0395905_0045508 Ga0395905_0045508_2951_3622 213
489 3300046507 Ga0495606_0004841 Ga0495606_0004841_9184_9858 213
490 3300048924 Ga0496121_0029870 Ga0496121_0029870_2680_3354 213
491 3300053136 Ga0500559_0048346 Ga0500559_0048346_722_1390 213
492 iso_pu_bacteria 2643221653 2644299787 213
493 iso_pu_bacteria 2643221719 2644658014 213
494 iso_pu_bacteria 2775506902 2776269618 213
495 iso_pu_bacteria 2775506904 2776282549 213
496 iso_pu_bacteria 2818991272 2819244571 213
497 iso_pu_bacteria 2989776772 2989780171 213
498 iso_pu_bacteria 8005246636 8005249315 213
499 3300003187 JGI25151J46595_10059924 JGI25151J46595_100599242 214
500 3300003578 Ga0006562J51391_1022330 Ga0006562J51391_10223302 214
501 3300003856 Ga0058692_1003573 Ga0058692_10035732 214
502 3300005289 Ga0065704_10227534 Ga0065704_102275341 214
503 3300005347 Ga0070668_100459624 Ga0070668_1004596241 214
504 3300005353 Ga0070669_100322310 Ga0070669_1003223101 214
505 3300005548 Ga0070665_100006674 Ga0070665_1000066748 214
506 3300006042 Ga0075368_10070007 Ga0075368_100700072 214
507 3300006177 Ga0075362_10010559 Ga0075362_100105594 214
508 3300006178 Ga0075367_10081119 Ga0075367_100811192 214
509 3300006186 Ga0075369_10002996 Ga0075369_100029964 214
510 3300006186 Ga0075369_10071463 Ga0075369_100714632 214
511 3300006948 Ga0099826_10001615 Ga0099826_100016156 214
512 3300009148 Ga0105243_10243624 Ga0105243_102436242 214
513 3300011119 Ga0105246_10024870 Ga0105246_100248702 214
514 3300013100 Ga0157373_10107542 Ga0157373_101075422 214
515 3300013102 Ga0157371_10000071 Ga0157371_1000007122 214
516 3300013104 Ga0157370_10000469 Ga0157370_1000046916 214
517 3300025294 Ga0209025_1001416 Ga0209025_10014163 214
518 3300025923 Ga0207681_10205936 Ga0207681_102059362 214
519 3300025972 Ga0207668_10371521 Ga0207668_103715212 214
520 3300027312 Ga0209371_1000037 Ga0209371_1000037200 214
521 3300027312 Ga0209371_1005695 Ga0209371_10056953 214
522 3300027666 Ga0209282_1001575 Ga0209282_10015758 214
523 3300028379 Ga0268266_10005017 Ga0268266_100050173 214
524 3300030500 Ga0268256_1000039 Ga0268256_1000039108 214
525 3300030500 Ga0268256_1005626 Ga0268256_10056263 214
526 3300030500 Ga0268256_1027137 Ga0268256_10271372 214
527 3300031911 Ga0307412_10662089 Ga0307412_106620891 214
528 3300031995 Ga0307409_100121494 Ga0307409_1001214941 214
529 3300035692 Ga0373935_0182831 Ga0373935_0182831_338_1003 214
530 3300035725 Ga0373947_0375044 Ga0373947_0375044_16_744 214
531 3300037068 Ga0373925_0001135 Ga0373925_0001135_19068_19796 214
532 3300046460 Ga0495638_0046858 Ga0495638_0046858_21_686 214
533 3300046558 Ga0495633_0094714 Ga0495633_0094714_69_794 214
534 3300046692 Ga0495671_0095584 Ga0495671_0095584_197_922 214
535 3300047470 Ga0495681_0013535 Ga0495681_0013535_733_1458 214
536 3300048916 Ga0496113_0055444 Ga0496113_0055444_652_1359 214
537 3300048919 Ga0496116_0107877 Ga0496116_0107877_772_1479 214
538 3300048920 Ga0496117_0000031 Ga0496117_0000031_244622_245329 214
539 3300048921 Ga0496118_0003281 Ga0496118_0003281_9114_9821 214
540 3300048922 Ga0496119_0047363 Ga0496119_0047363_1958_2665 214
541 3300048923 Ga0496120_0001350 Ga0496120_0001350_9114_9821 214
542 3300048925 Ga0496122_0000023 Ga0496122_0000023_244610_245317 214
543 3300048926 Ga0496123_0000027 Ga0496123_0000027_135719_136426 214
544 3300048927 Ga0496124_0001510 Ga0496124_0001510_5984_6691 214
545 3300048928 Ga0496125_0065387 Ga0496125_0065387_1189_1896 214
546 3300048929 Ga0496126_0130745 Ga0496126_0130745_894_1601 214
547 3300050490 nmdc:mga03n38_300735_c1 nmdc:mga03n38_300735_c1_37_744 214
548 3300050491 nmdc:mga00v17_243645_c1 nmdc:mga00v17_243645_c1_101_826 214
549 3300050491 nmdc:mga00v17_545_c1 nmdc:mga00v17_545_c1_6744_7451 214
550 3300050492 nmdc:mga0yw44_88586_c1 nmdc:mga0yw44_88586_c1_401_1108 214
551 3300050494 nmdc:mga06z11_171671_c1 nmdc:mga06z11_171671_c1_440_1147 214
552 3300050494 nmdc:mga06z11_88095_c1 nmdc:mga06z11_88095_c1_818_1492 214
553 3300050516 nmdc:mga0sz30_551_c1 nmdc:mga0sz30_551_c1_6542_7249 214
554 3300050516 nmdc:mga0sz30_9548_c1 nmdc:mga0sz30_9548_c1_49_774 214
555 3300053137 Ga0500561_0000030 Ga0500561_0000030_17761_18468 214
556 3300059508 Ga0587088_032581 Ga0587088_032581_146_871 214
557 3300059604 Ga0587098_015505 Ga0587098_015505_98_823 214
558 3300059641 Ga0587068_017695 Ga0587068_017695_333_1058 214
559 iso_pu_bacteria 2512047086 2512534588 214
560 iso_pu_bacteria 2537561587 2537873620 214
561 iso_pu_bacteria 2554235003 2554248921 214
562 iso_pu_bacteria 2558860242 2559296009 214
563 iso_pu_bacteria 2599185210 2599603198 214
564 iso_pu_bacteria 2600255279 2601610897 214
565 iso_pu_bacteria 2600255308 2601747671 214
566 iso_pu_bacteria 2643221582 2643921533 214
567 iso_pu_bacteria 2643221693 2644521587 214
568 iso_pu_bacteria 2765235802 2765465673 214
569 iso_pu_bacteria 2775507049 2776915579 214
570 iso_pu_bacteria 2808606387 2808988165 214
571 iso_pu_bacteria 2818991439 2819561019 214
572 iso_pu_bacteria 2838675328 2838678612 214
573 iso_pu_bacteria 2838714209 2838718300 214
574 iso_pu_bacteria 2838719591 2838722908 214
575 iso_pu_bacteria 2838724970 2838728366 214
576 iso_pu_bacteria 2841846520 2841850464 214
577 iso_pu_bacteria 2841859092 2841863283 214
578 iso_pu_bacteria 2842124991 2842129026 214
579 iso_pu_bacteria 2842130223 2842133505 214
580 iso_pu_bacteria 2842152218 2842155584 214
581 iso_pu_bacteria 2842170452 2842174458 214
582 iso_pu_bacteria 2842175837 2842179119 214
583 iso_pu_bacteria 2842187318 2842190724 214
584 iso_pu_bacteria 2842211629 2842214952 214
585 iso_pu_bacteria 2842224351 2842227673 214
586 iso_pu_bacteria 2842515876 2842519980 214
587 iso_pu_bacteria 2899792073 2899795380 214
588 iso_pu_bacteria 2899845264 2899849359 214
589 iso_pu_bacteria 2916028427 2916031303 214
590 iso_pu_bacteria 2919114240 2919118443 214
591 iso_pu_bacteria 2924214083 2924219899 214
592 iso_pu_bacteria 2924221636 2924225890 214
593 iso_pu_bacteria 2926754445 2926754972 214
594 iso_pu_bacteria 2926760298 2926762136 214
595 iso_pu_bacteria 2933006813 2933010568 214
596 iso_pu_bacteria 2933011516 2933015760 214
597 iso_pu_bacteria 2933594066 2933597502 214
598 iso_pu_bacteria 2979089926 2979092594 214
599 iso_pu_bacteria 2979095461 2979100015 214
600 iso_pu_bacteria 2979100975 2979104566 214
601 iso_pu_bacteria 2984509177 2984513638 214
602 iso_pu_bacteria 2984518228 2984522782 214
603 iso_pu_bacteria 2984537506 2984542088 214
604 iso_pu_bacteria 2984601300 2984601518 214
605 iso_pu_bacteria 650716007 650741225 214
606 iso_pu_bacteria 8003570095 8003573714 214
607 3300005548 Ga0070665_100006303 Ga0070665_10000630310 215
608 3300028379 Ga0268266_10045610 Ga0268266_100456104 215
609 3300046459 Ga0495629_0021063 Ga0495629_0021063_3315_3989 215
610 3300046462 Ga0495651_0263144 Ga0495651_0263144_384_1058 215
611 3300046476 Ga0495662_0002196 Ga0495662_0002196_533_1207 215
612 3300046477 Ga0495664_0075784 Ga0495664_0075784_34_708 215
613 3300046516 Ga0495628_0323437 Ga0495628_0323437_157_831 215
614 3300046517 Ga0495630_0493610 Ga0495630_0493610_222_896 215
615 3300046642 Ga0495634_0147610 Ga0495634_0147610_234_908 215
616 3300046663 Ga0495635_0076020 Ga0495635_0076020_424_1098 215
617 3300046675 Ga0495657_0055172 Ga0495657_0055172_298_972 215
618 3300046690 Ga0495624_0048415 Ga0495624_0048415_138_812 215
619 3300046809 Ga0495600_0012554 Ga0495600_0012554_1755_2429 215
620 3300047317 Ga0495604_0008757 Ga0495604_0008757_2620_3294 215
621 3300047319 Ga0495674_0259817 Ga0495674_0259817_174_848 215
622 3300049551 Ga0501335_004751 Ga0501335_004751_363_1031 215
623 3300049776 Ga0501280_001610 Ga0501280_001610_2397_3065 215
624 3300053077 Ga0495601_0088286 Ga0495601_0088286_84_758 215
625 3300053085 Ga0495619_0175564 Ga0495619_0175564_684_1358 215
626 3300053148 Ga0500590_011317 Ga0500590_011317_462_1136 215
627 3300053177 Ga0500636_0000040 Ga0500636_0000040_36347_37060 215
628 iso_pu_bacteria 2508501122 2509109558 215
629 iso_pu_bacteria 2509276019 2509378119 215
630 iso_pu_bacteria 2510065057 2510305433 215
631 iso_pu_bacteria 2511231052 2511498443 215
632 iso_pu_bacteria 2512875026 2512973598 215
633 iso_pu_bacteria 2513237086 2513583606 215
634 iso_pu_bacteria 2513237089 2513601884 215
635 iso_pu_bacteria 2513237091 2513615680 215
636 iso_pu_bacteria 2513237140 2513885018 215
637 iso_pu_bacteria 2513237143 2513905227 215
638 iso_pu_bacteria 2513237156 2513987177 215
639 iso_pu_bacteria 2513237160 2514003516 215
640 iso_pu_bacteria 2515154107 2515611026 215
641 iso_pu_bacteria 2516143018 2516205617 215
642 iso_pu_bacteria 2516653046 2516894721 215
643 iso_pu_bacteria 2517487022 2517571398 215
644 iso_pu_bacteria 2524023207 2524450456 215
645 iso_pu_bacteria 2551306084 2551676578 215
646 iso_pu_bacteria 2551306084 2551680202 215
647 iso_pu_bacteria 2551306085 2551685033 215
648 iso_pu_bacteria 2551306086 2551692779 215
649 iso_pu_bacteria 2551306087 2551703413 215
650 iso_pu_bacteria 2551306089 2551711328 215
651 iso_pu_bacteria 2551306090 2551723775 215
652 iso_pu_bacteria 2551306091 2551729752 215
653 iso_pu_bacteria 2551306092 2551733635 215
654 iso_pu_bacteria 2551306093 2551744537 215
655 iso_pu_bacteria 2558860100 2558867381 215
656 iso_pu_bacteria 2643221688 2644493064 215
657 iso_pu_bacteria 2657244999 2657682492 215
658 iso_pu_bacteria 2690316117 2692320223 215
659 iso_pu_bacteria 2751185821 2753462480 215
660 iso_pu_bacteria 2791355082 2792582158 215
661 iso_pu_bacteria 2791355091 2792621938 215
662 iso_pu_bacteria 2791355092 2792628805 215
663 iso_pu_bacteria 2791355094 2792640008 215
664 iso_pu_bacteria 2791355253 2793281045 215
665 iso_pu_bacteria 2802428858 2802717234 215
666 iso_pu_bacteria 2802428859 2802724777 215
667 iso_pu_bacteria 2802428860 2802729528 215
668 iso_pu_bacteria 2802428861 2802736874 215
669 iso_pu_bacteria 2802428862 2802743279 215
670 iso_pu_bacteria 2802428863 2802749595 215
671 iso_pu_bacteria 2802429268 2804753617 215
672 iso_pu_bacteria 2838074704 2838078201 215
673 iso_pu_bacteria 2847417321 2847420737 215
674 iso_pu_bacteria 2848992105 2848995569 215
675 iso_pu_bacteria 2850079185 2850082618 215
676 iso_pu_bacteria 2855825444 2855827361 215
677 iso_pu_bacteria 2855839649 2855842729 215
678 iso_pu_bacteria 2855872281 2855878095 215
679 iso_pu_bacteria 2858800743 2858802069 215
680 iso_pu_bacteria 2891373044 2891373903 215
681 iso_pu_bacteria 2896384573 2896390230 215
682 iso_pu_bacteria 2904578770 2904580030 215
683 iso_pu_bacteria 2913295892 2913300097 215
684 iso_pu_bacteria 2915980308 2915982447 215
685 iso_pu_bacteria 2915986958 2915989668 215
686 iso_pu_bacteria 2915993759 2915996497 215
687 iso_pu_bacteria 2916000859 2916005918 215
688 iso_pu_bacteria 2916007675 2916010559 215
689 iso_pu_bacteria 2916014648 2916018325 215
690 iso_pu_bacteria 2916021584 2916024334 215
691 iso_pu_bacteria 2916035215 2916037727 215
692 iso_pu_bacteria 2916041962 2916045940 215
693 iso_pu_bacteria 2916048683 2916054336 215
694 iso_pu_bacteria 2916055098 2916058493 215
695 iso_pu_bacteria 2916061851 2916065034 215
696 iso_pu_bacteria 2916068649 2916073364 215
697 iso_pu_bacteria 2916076590 2916077701 215
698 iso_pu_bacteria 2919119836 2919120297 215
699 iso_pu_bacteria 2921201388 2921204618 215
700 iso_pu_bacteria 2921208531 2921208975 215
701 iso_pu_bacteria 2921237296 2921239852 215
702 iso_pu_bacteria 2921244191 2921245839 215
703 iso_pu_bacteria 2921250672 2921252957 215
704 iso_pu_bacteria 2921257292 2921259040 215
705 iso_pu_bacteria 2921263974 2921267085 215
706 iso_pu_bacteria 2921282425 2921285642 215
707 iso_pu_bacteria 2921289301 2921296664 215
708 iso_pu_bacteria 2921296804 2921303335 215
709 iso_pu_bacteria 2924144063 2924146652 215
710 iso_pu_bacteria 2924150972 2924157753 215
711 iso_pu_bacteria 2924158325 2924161611 215
712 iso_pu_bacteria 2924165586 2924169709 215
713 iso_pu_bacteria 2924172951 2924177304 215
714 iso_pu_bacteria 2924179722 2924185094 215
715 iso_pu_bacteria 2924186466 2924186890 215
716 iso_pu_bacteria 2924193448 2924193628 215
717 iso_pu_bacteria 2924200457 2924201812 215
718 iso_pu_bacteria 2924207177 2924210271 215
719 iso_pu_bacteria 2924228884 2924231697 215
720 iso_pu_bacteria 2936996657 2936998988 215
721 iso_pu_bacteria 2937002841 2937006755 215
722 iso_pu_bacteria 2937009748 2937014654 215
723 iso_pu_bacteria 2937016420 2937019044 215
724 iso_pu_bacteria 2937023124 2937025995 215
725 iso_pu_bacteria 2937029754 2937031877 215
726 iso_pu_bacteria 2937036028 2937036192 215
727 iso_pu_bacteria 2937042894 2937045737 215
728 iso_pu_bacteria 2937049772 2937053444 215
729 iso_pu_bacteria 2937056579 2937060101 215
730 iso_pu_bacteria 2937063883 2937067740 215
731 iso_pu_bacteria 2937071275 2937072758 215
732 iso_pu_bacteria 2937078374 2937082028 215
733 iso_pu_bacteria 2937084907 2937089966 215
734 iso_pu_bacteria 2937091812 2937097312 215
735 iso_pu_bacteria 2937098957 2937101235 215
736 iso_pu_bacteria 2937106411 2937109168 215
737 iso_pu_bacteria 2937113482 2937116029 215
738 iso_pu_bacteria 2937119839 2937123223 215
739 iso_pu_bacteria 2937126314 2937127775 215
740 iso_pu_bacteria 2957375807 2957381848 215
741 iso_pu_bacteria 2957382221 2957384659 215
742 iso_pu_bacteria 2957388812 2957391429 215
743 iso_pu_bacteria 2957395598 2957400761 215
744 iso_pu_bacteria 2957402308 2957404399 215
745 iso_pu_bacteria 2957408893 2957411855 215
746 iso_pu_bacteria 2957415311 2957416680 215
747 iso_pu_bacteria 2957422303 2957427202 215
748 iso_pu_bacteria 2957430029 2957432058 215
749 iso_pu_bacteria 2957437181 2957442106 215
750 iso_pu_bacteria 2957443900 2957450260 215
751 iso_pu_bacteria 2957450854 2957456869 215
752 iso_pu_bacteria 2957457609 2957461252 215
753 iso_pu_bacteria 2957464669 2957470889 215
754 iso_pu_bacteria 2957471148 2957474199 215
755 iso_pu_bacteria 2957478035 2957481712 215
756 iso_pu_bacteria 2957484790 2957489814 215
757 iso_pu_bacteria 2957491536 2957494578 215
758 iso_pu_bacteria 2957498199 2957503996 215
759 iso_pu_bacteria 2957505466 2957512178 215
760 iso_pu_bacteria 2960584000 2960590344 215
761 iso_pu_bacteria 2960591022 2960592216 215
762 iso_pu_bacteria 2960597568 2960599225 215
763 iso_pu_bacteria 2960603979 2960609735 215
764 iso_pu_bacteria 2960610863 2960613248 215
765 iso_pu_bacteria 2960617483 2960618271 215
766 iso_pu_bacteria 2960624210 2960628448 215
767 iso_pu_bacteria 2960631154 2960633421 215
768 iso_pu_bacteria 2960637947 2960645080 215
769 iso_pu_bacteria 2960645483 2960651355 215
770 iso_pu_bacteria 2960652885 2960660047 215
771 iso_pu_bacteria 2960660292 2960666798 215
772 iso_pu_bacteria 2960667422 2960673970 215
773 iso_pu_bacteria 2960674078 2960674651 215
774 iso_pu_bacteria 2960680706 2960682323 215
775 iso_pu_bacteria 2960687367 2960691555 215
776 iso_pu_bacteria 2960693952 2960698251 215
777 iso_pu_bacteria 2964607997 2964613175 215
778 iso_pu_bacteria 2964615318 2964619335 215
779 iso_pu_bacteria 2964621998 2964624783 215
780 iso_pu_bacteria 2964628898 2964635078 215
781 iso_pu_bacteria 2964636051 2964639813 215
782 iso_pu_bacteria 2964643177 2964645896 215
783 iso_pu_bacteria 2964649959 2964654864 215
784 iso_pu_bacteria 2964656573 2964657100 215
785 iso_pu_bacteria 2964663802 2964668972 215
786 iso_pu_bacteria 2964670856 2964672334 215
787 iso_pu_bacteria 2964678106 2964681215 215
788 iso_pu_bacteria 2964685014 2964690951 215
789 iso_pu_bacteria 2964691889 2964694555 215
790 iso_pu_bacteria 2964698721 2964701355 215
791 iso_pu_bacteria 2964705432 2964707971 215
792 iso_pu_bacteria 2964712639 2964712803 215
793 iso_pu_bacteria 2964719344 2964722211 215
794 iso_pu_bacteria 2967664464 2967667737 215
795 iso_pu_bacteria 2967671571 2967676950 215
796 iso_pu_bacteria 2967678726 2967681680 215
797 iso_pu_bacteria 2967686174 2967690267 215
798 iso_pu_bacteria 2967693043 2967695437 215
799 iso_pu_bacteria 2967699805 2967704852 215
800 iso_pu_bacteria 2967706974 2967712499 215
801 iso_pu_bacteria 2967714385 2967719524 215
802 iso_pu_bacteria 2967721400 2967726892 215
803 iso_pu_bacteria 2967728569 2967732059 215
804 iso_pu_bacteria 2967735183 2967738321 215
805 iso_pu_bacteria 2967742019 2967748168 215
806 iso_pu_bacteria 2967748971 2967752554 215
807 iso_pu_bacteria 2967755722 2967762278 215
808 iso_pu_bacteria 2967762386 2967766436 215
809 iso_pu_bacteria 2967769361 2967772871 215
810 iso_pu_bacteria 2967775926 2967781638 215
811 iso_pu_bacteria 2970019648 2970020003 215
812 iso_pu_bacteria 2970026789 2970029517 215
813 iso_pu_bacteria 2970033650 2970035187 215
814 iso_pu_bacteria 2970047711 2970052405 215
815 iso_pu_bacteria 2970054988 2970060370 215
816 iso_pu_bacteria 2970061556 2970068213 215
817 iso_pu_bacteria 2970068827 2970075220 215
818 iso_pu_bacteria 2970076120 2970076924 215
819 iso_pu_bacteria 2970082768 2970086306 215
820 iso_pu_bacteria 2970088815 2970092886 215
821 iso_pu_bacteria 2970095765 2970101291 215
822 iso_pu_bacteria 2970102677 2970105335 215
823 iso_pu_bacteria 2970109326 2970112942 215
824 iso_pu_bacteria 2970116247 2970116796 215
825 iso_pu_bacteria 2970122695 2970123955 215
826 iso_pu_bacteria 2970129317 2970133664 215
827 iso_pu_bacteria 2970136068 2970141000 215
828 iso_pu_bacteria 2970143518 2970143621 215
829 iso_pu_bacteria 2970149975 2970152885 215
830 iso_pu_bacteria 2970156795 2970163303 215
831 iso_pu_bacteria 2970164137 2970167276 215
832 iso_pu_bacteria 2970170962 2970174770 215
833 iso_pu_bacteria 2970177841 2970178162 215
834 iso_pu_bacteria 2970184632 2970190760 215
835 iso_pu_bacteria 2970191845 2970198057 215
836 iso_pu_bacteria 2977516862 2977520081 215
837 iso_pu_bacteria 2977523885 2977525505 215
838 iso_pu_bacteria 2977530762 2977535101 215
839 iso_pu_bacteria 2977537788 2977540341 215
840 iso_pu_bacteria 2977544691 2977550646 215
841 iso_pu_bacteria 2977551784 2977553232 215
842 iso_pu_bacteria 2977558990 2977562127 215
843 iso_pu_bacteria 2977565890 2977571050 215
844 iso_pu_bacteria 2977572785 2977578638 215
845 iso_pu_bacteria 2977579622 2977585578 215
846 iso_pu_bacteria 2989349275 2989354931 215
847 iso_pu_bacteria 643692032 643827335 215
848 iso_pu_bacteria 648276728 648737169 215
849 iso_pu_bacteria 8003992118 8003995311 215
850 iso_pu_bacteria 8003999396 8004003060 215
851 iso_pu_bacteria 8024486573 8024490862 215
852 iso_pu_bacteria 8049293176 8049296187 215
853 3300025294 Ga0209025_1000042 Ga0209025_1000042292 216
854 3300031901 Ga0307406_10018127 Ga0307406_100181272 216
855 3300048919 Ga0496116_0000057 Ga0496116_0000057_127822_128547 216
856 3300048920 Ga0496117_0005347 Ga0496117_0005347_4712_5386 216
857 3300048920 Ga0496117_0147223 Ga0496117_0147223_472_1197 216
858 3300048923 Ga0496120_0070276 Ga0496120_0070276_1038_1712 216
859 3300048925 Ga0496122_0000984 Ga0496122_0000984_47379_48053 216
860 3300048926 Ga0496123_0000290 Ga0496123_0000290_17950_18624 216
861 3300048927 Ga0496124_0007783 Ga0496124_0007783_7602_8276 216
862 3300048928 Ga0496125_0007081 Ga0496125_0007081_8482_9156 216
863 3300048929 Ga0496126_0000115 Ga0496126_0000115_127797_128522 216
864 3300048929 Ga0496126_0001347 Ga0496126_0001347_12357_13031 216
865 3300048929 Ga0496126_0030825 Ga0496126_0030825_617_1285 216
866 3300049570 Ga0501033_0036210 Ga0501033_0036210_615_1364 216
867 3300049574 Ga0501038_0187833 Ga0501038_0187833_118_867 216
868 3300049579 Ga0501043_0029008 Ga0501043_0029008_2955_3704 216
869 3300049580 Ga0501046_0123027 Ga0501046_0123027_236_931 216
870 3300049586 Ga0501070_0083601 Ga0501070_0083601_348_1037 216
871 3300049822 Ga0501035_0229477 Ga0501035_0229477_130_879 216
872 3300050492 nmdc:mga0yw44_334496_c1 nmdc:mga0yw44_334496_c1_18_698 216
873 3300059510 Ga0587090_048732 Ga0587090_048732_58_723 216
874 iso_pu_bacteria 2599185352 2600193385 216
875 iso_pu_bacteria 2643221557 2643808083 216
876 iso_pu_bacteria 2643221568 2643854867 216
877 iso_pu_bacteria 2643221610 2644068728 216
878 iso_pu_bacteria 2643221618 2644110132 216
879 iso_pu_bacteria 2643221626 2644150408 216
880 iso_pu_bacteria 2643221655 2644313012 216
881 iso_pu_bacteria 2643221659 2644336560 216
882 iso_pu_bacteria 2643221668 2644379517 216
883 iso_pu_bacteria 2643221675 2644419798 216
884 iso_pu_bacteria 2643221680 2644453155 216
885 iso_pu_bacteria 2643221698 2644546206 216
886 iso_pu_bacteria 2643221712 2644618742 216
887 iso_pu_bacteria 2643221723 2644677111 216
888 iso_pu_bacteria 2643221726 2644688817 216
889 iso_pu_bacteria 2844163670 2844164337 216
890 iso_pu_bacteria 2919166419 2919170504 216
891 iso_pu_bacteria 2920760137 2920760356 216
892 iso_pu_bacteria 2920822456 2920825914 216
893 iso_pu_bacteria 2941499720 2941501332 216
894 iso_pu_bacteria 2978969890 2978972699 216
895 iso_pu_bacteria 2984587000 2984590951 216
896 3300031548 Ga0307408_100082644 Ga0307408_1000826442 217
897 3300031911 Ga0307412_10604306 Ga0307412_106043061 217
898 3300041404 Ga0439436_0021820 Ga0439436_0021820_714_1394 217
899 3300041411 Ga0439466_0024036 Ga0439466_0024036_412_1092 217
900 3300041413 Ga0439465_0008121 Ga0439465_0008121_1161_1841 217
901 3300041999 Ga0439433_0029146 Ga0439433_0029146_531_1211 217
902 3300042004 Ga0439445_0023871 Ga0439445_0023871_492_1172 217
903 3300042007 Ga0439449_0070391 Ga0439449_0070391_546_1226 217
904 3300042122 Ga0450920_018296 Ga0450920_018296_588_1268 217
905 3300042145 Ga0450906_001942 Ga0450906_001942_3457_4137 217
906 3300042531 Ga0450918_002052 Ga0450918_002052_2618_3298 217
907 iso_pu_bacteria 2513237159 2513998503 217
908 iso_pu_bacteria 2842521101 2842524468 217
909 iso_pu_bacteria 2899803654 2899808027 217
910 iso_pu_bacteria 2996336353 2996339677 217
911 3300028794 Ga0307515_10016477 Ga0307515_1001647712 218
912 3300046558 Ga0495633_0122295 Ga0495633_0122295_196_891 218
913 3300046660 Ga0495625_0284719 Ga0495625_0284719_171_944 218
914 3300053156 Ga0500622_0000541 Ga0500622_0000541_31068_31799 218
915 iso_pu_bacteria 2582581865 2585387962 218
916 iso_pu_bacteria 2582581866 2585396057 218
917 iso_pu_bacteria 8054558443 8054560992 218
918 3300006946 Ga0079104_1003980 Ga0079104_10039802 219
919 3300006946 Ga0079104_1011776 Ga0079104_10117762 219
920 3300021320 Ga0214544_1000024 Ga0214544_100002425 219
921 3300021321 Ga0214542_1000008 Ga0214542_1000008167 219
922 3300021321 Ga0214542_1013885 Ga0214542_10138855 219
923 3300021327 Ga0214543_1000015 Ga0214543_100001561 219
924 3300021327 Ga0214543_1000031 Ga0214543_100003198 219
925 3300022739 Ga0228711_1000004 Ga0228711_100000484 219
926 3300022740 Ga0228710_1000002 Ga0228710_100000232 219
927 3300027111 Ga0209281_1000030 Ga0209281_1000030228 219
928 3300027111 Ga0209281_1000955 Ga0209281_100095512 219
929 3300027666 Ga0209282_1000004 Ga0209282_1000004228 219
930 3300028794 Ga0307515_10004852 Ga0307515_1000485214 219
931 3300031901 Ga0307406_10175534 Ga0307406_101755342 219
932 3300031967 Ga0315914_1000001 Ga0315914_1000001156 219
933 3300031995 Ga0307409_100400516 Ga0307409_1004005161 219
934 3300032002 Ga0307416_100841465 Ga0307416_1008414652 219
935 3300033430 Ga0315913_1000004 Ga0315913_1000004145 219
936 3300033464 Ga0315915_1000002 Ga0315915_1000002229 219
937 3300041404 Ga0439436_0024821 Ga0439436_0024821_650_1327 219
938 3300041404 Ga0439436_0040189 Ga0439436_0040189_38_718 219
939 3300042007 Ga0439449_0027762 Ga0439449_0027762_671_1348 219
940 3300042007 Ga0439449_0042768 Ga0439449_0042768_39_719 219
941 3300049532 Ga0501316_020356 Ga0501316_020356_33_710 219
942 3300053151 Ga0500604_0054772 Ga0500604_0054772_36_734 219
943 iso_pu_bacteria 2582581283 2585166740 219
944 iso_pu_bacteria 2643221607 2644052026 219
945 iso_pu_bacteria 2643221636 2644201417 219
946 iso_pu_bacteria 2643221686 2644484478 219
947 3300002739 JGI25158J39367_1002834 JGI25158J39367_10028341 220
948 3300002987 JGI25159J45721_1000017 JGI25159J45721_1000017118 220
949 3300003187 JGI25151J46595_10007018 JGI25151J46595_100070182 220
950 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002767 220
951 3300003374 JGI25161J50226_1000531 JGI25161J50226_10005316 220
952 3300003771 Ga0055526_1000643 Ga0055526_100064325 220
953 3300003775 Ga0055524_1002302 Ga0055524_10023022 220
954 3300003775 Ga0055524_1048603 Ga0055524_10486031 220
955 3300003791 Ga0055530_10016995 Ga0055530_100169952 220
956 3300003792 Ga0055540_1011023 Ga0055540_10110232 220
957 3300003794 Ga0055531_10004886 Ga0055531_100048862 220
958 3300004625 Ga0055543_1000030 Ga0055543_100003075 220
959 3300005262 Ga0065165_1000122 Ga0065165_1000122118 220
960 3300013249 Ga0171463_1004 Ga0171463_1004178 220
961 3300015684 Ga0183365_10029 Ga0183365_100292 220
962 3300015690 Ga0183363_1019 Ga0183363_101955 220
963 3300025208 Ga0209436_100540 Ga0209436_10054015 220
964 3300025284 Ga0209130_1000027 Ga0209130_1000027202 220
965 3300025292 Ga0209676_1000406 Ga0209676_100040637 220
966 3300025294 Ga0209025_1000241 Ga0209025_100024135 220
967 3300025295 Ga0209564_1000111 Ga0209564_1000111183 220
968 3300025298 Ga0209050_1003192 Ga0209050_10031929 220
969 3300025299 Ga0209256_1000773 Ga0209256_100077318 220
970 3300025299 Ga0209256_1030564 Ga0209256_10305642 220
971 3300025302 Ga0207426_1000072 Ga0207426_1000072113 220
972 3300025303 Ga0209051_1002411 Ga0209051_10024118 220
973 3300025304 Ga0209257_1002672 Ga0209257_100267217 220
974 3300041498 Ga0451841_0234680 Ga0451841_0234680_209_982 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

90

245

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8veh-assembly4.cif.gz_D crystal structure of outer membrane lipoprotein carrier protein (lola) from rickettsia bellii 0.8517 44 215
1ua8-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.8059 43 209
2w7q-assembly1.cif.gz_A structure of pseudomonas aeruginosa lola 0.7997 45 209
8v1k-assembly2.cif.gz_B crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis 0.7986 46 207
3ksn-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.7979 45 214
ID Description Score Start End Superfamily
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7785 43 209 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7694 45 210 2.50.20.10
3r6kA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Positive stranded ssRNA viruses 0.7632 57 81 2.40.30.120
af_Q2FYX8_1_83_2.170.210.20 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain 0.753 140 179 2.170.210.20
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7244 43 209 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A523FM76-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9461 50 209
AF-A0A383BQ27-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9355 45 156
AF-A0A5C7UHI7-F1-model_v4 deleted 0.9345 50 211
AF-A0A526ZY58-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9279 103 219
AF-A0A435AFI0-F1-model_v4 deleted 0.9271 44 213

Feature Viewer

pLDDT pTM Quality
78.24 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map