F487205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 974 | 340 | 973 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_102379173|Ga0075428_1023791731 |
| Length | 121 |
| Sequence | MTYQSAATWSALADPTRRAILDRLRDESRTVSTLAAGFDVSRPAISQHLKVLLDAGLVGERKEGRQRYYSLHAQPLRAVDAWLSAYRRFWERNLLGLKEYVEAEERTERRPKRGRKTEQES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 228 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 13.86 |
| Rhizosphere | 85.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1044402 | 3300002073 | Unclassified | 555 |
| 2 | Ga0070658_10428860 | 3300005327 | Bacteria | 1138 |
| 3 | Ga0070658_11706863 | 3300005327 | Unclassified | 545 |
| 4 | Ga0070676_10822642 | 3300005328 | Unclassified | 687 |
| 5 | Ga0070683_100090739 | 3300005329 | Bacteria | 2869 |
| 6 | Ga0070683_100101527 | 3300005329 | Bacteria | 2709 |
| 7 | Ga0070683_100112705 | 3300005329 | Bacteria | 2567 |
| 8 | Ga0070677_10282291 | 3300005333 | Bacteria | 837 |
| 9 | Ga0068869_100138974 | 3300005334 | Bacteria | 1874 |
| 10 | Ga0068869_100273229 | 3300005334 | Unclassified | 1357 |
| 11 | Ga0070680_100303111 | 3300005336 | Bacteria | 1355 |
| 12 | Ga0070680_100672675 | 3300005336 | Bacteria | 890 |
| 13 | Ga0070680_100676325 | 3300005336 | Bacteria | 888 |
| 14 | Ga0070682_100006477 | 3300005337 | Bacteria | 6583 |
| 15 | Ga0070682_100518328 | 3300005337 | Unclassified | 927 |
| 16 | Ga0070682_101354596 | 3300005337 | Unclassified | 607 |
| 17 | Ga0068868_100060548 | 3300005338 | Bacteria | 2998 |
| 18 | Ga0070660_100699058 | 3300005339 | Unclassified | 850 |
| 19 | Ga0070689_100056184 | 3300005340 | Bacteria | 3052 |
| 20 | Ga0070689_101964780 | 3300005340 | Unclassified | 535 |
| 21 | Ga0070691_10191415 | 3300005341 | Unclassified | 1070 |
| 22 | Ga0070691_10766322 | 3300005341 | Unclassified | 585 |
| 23 | Ga0070687_100207905 | 3300005343 | Bacteria | 1190 |
| 24 | Ga0070687_101280556 | 3300005343 | Bacteria | 544 |
| 25 | Ga0070661_100244888 | 3300005344 | Bacteria | 1382 |
| 26 | Ga0070668_100276760 | 3300005347 | Bacteria | 1400 |
| 27 | Ga0070669_101302738 | 3300005353 | Bacteria | 629 |
| 28 | Ga0070669_101660046 | 3300005353 | Unclassified | 557 |
| 29 | Ga0070675_100078841 | 3300005354 | Bacteria | 2744 |
| 30 | Ga0070675_100813560 | 3300005354 | Bacteria | 854 |
| 31 | Ga0070675_101293695 | 3300005354 | Bacteria | 672 |
| 32 | Ga0070671_100226357 | 3300005355 | Bacteria | 1587 |
| 33 | Ga0070671_100647197 | 3300005355 | Bacteria | 915 |
| 34 | Ga0070671_100803256 | 3300005355 | Unclassified | 819 |
| 35 | Ga0070671_101389008 | 3300005355 | Bacteria | 620 |
| 36 | Ga0070674_100007039 | 3300005356 | Bacteria | 6612 |
| 37 | Ga0070674_100266072 | 3300005356 | Bacteria | 1353 |
| 38 | Ga0070674_100981507 | 3300005356 | Bacteria | 740 |
| 39 | Ga0070673_100106159 | 3300005364 | Bacteria | 2321 |
| 40 | Ga0070673_100230066 | 3300005364 | Bacteria | 1608 |
| 41 | Ga0070673_100540241 | 3300005364 | Bacteria | 1058 |
| 42 | Ga0070673_102219931 | 3300005364 | Unclassified | 522 |
| 43 | Ga0070688_100154130 | 3300005365 | Bacteria | 1573 |
| 44 | Ga0070659_101255173 | 3300005366 | Bacteria | 656 |
| 45 | Ga0070667_100204324 | 3300005367 | Bacteria | 1754 |
| 46 | Ga0070703_10012614 | 3300005406 | Bacteria | 2395 |
| 47 | Ga0070703_10158829 | 3300005406 | Bacteria | 856 |
| 48 | Ga0070703_10509785 | 3300005406 | Bacteria | 543 |
| 49 | Ga0070709_10010201 | 3300005434 | Bacteria | 5193 |
| 50 | Ga0070709_10013995 | 3300005434 | Unclassified | 4527 |
| 51 | Ga0070709_10078771 | 3300005434 | Bacteria | 2145 |
| 52 | Ga0070709_10200734 | 3300005434 | Unclassified | 1412 |
| 53 | Ga0070709_10735834 | 3300005434 | Bacteria | 770 |
| 54 | Ga0070714_100668974 | 3300005435 | Bacteria | 1000 |
| 55 | Ga0070714_100893277 | 3300005435 | Unclassified | 862 |
| 56 | Ga0070713_100198314 | 3300005436 | Bacteria | 1812 |
| 57 | Ga0070710_10015608 | 3300005437 | Bacteria | 3848 |
| 58 | Ga0070710_10059350 | 3300005437 | Bacteria | 2172 |
| 59 | Ga0070710_10357824 | 3300005437 | Bacteria | 968 |
| 60 | Ga0070710_10650082 | 3300005437 | Unclassified | 739 |
| 61 | Ga0070701_10058379 | 3300005438 | Bacteria | 2025 |
| 62 | Ga0070701_10648310 | 3300005438 | Unclassified | 705 |
| 63 | Ga0070701_11229175 | 3300005438 | Bacteria | 533 |
| 64 | Ga0070711_100053930 | 3300005439 | Bacteria | 2773 |
| 65 | Ga0070711_100066924 | 3300005439 | Bacteria | 2519 |
| 66 | Ga0070711_100105853 | 3300005439 | Bacteria | 2055 |
| 67 | Ga0070711_100216803 | 3300005439 | Bacteria | 1485 |
| 68 | Ga0070711_100241048 | 3300005439 | Bacteria | 1414 |
| 69 | Ga0070711_100848786 | 3300005439 | Bacteria | 777 |
| 70 | Ga0070711_101007174 | 3300005439 | Bacteria | 715 |
| 71 | Ga0070711_101555057 | 3300005439 | Bacteria | 578 |
| 72 | Ga0070705_100055860 | 3300005440 | Bacteria | 2322 |
| 73 | Ga0070705_100086775 | 3300005440 | Bacteria | 1938 |
| 74 | Ga0070705_100773756 | 3300005440 | Bacteria | 761 |
| 75 | Ga0070705_101379031 | 3300005440 | Unclassified | 587 |
| 76 | Ga0070705_101898186 | 3300005440 | Unclassified | 507 |
| 77 | Ga0070700_100032492 | 3300005441 | Bacteria | 3136 |
| 78 | Ga0070700_101776599 | 3300005441 | Unclassified | 531 |
| 79 | Ga0070694_100103932 | 3300005444 | Bacteria | 2013 |
| 80 | Ga0070694_100260569 | 3300005444 | Bacteria | 1315 |
| 81 | Ga0070694_100520672 | 3300005444 | Bacteria | 949 |
| 82 | Ga0070694_101900076 | 3300005444 | Unclassified | 508 |
| 83 | Ga0070708_100023312 | 3300005445 | Bacteria | 5262 |
| 84 | Ga0070708_100096950 | 3300005445 | Bacteria | 2695 |
| 85 | Ga0070708_100114600 | 3300005445 | Bacteria | 2480 |
| 86 | Ga0070708_100129705 | 3300005445 | Bacteria | 2332 |
| 87 | Ga0070708_100252045 | 3300005445 | Bacteria | 1658 |
| 88 | Ga0070708_100321042 | 3300005445 | Bacteria | 1459 |
| 89 | Ga0070708_100966715 | 3300005445 | Bacteria | 799 |
| 90 | Ga0070663_100156331 | 3300005455 | Bacteria | 1752 |
| 91 | Ga0070663_101586453 | 3300005455 | Bacteria | 583 |
| 92 | Ga0070678_100006059 | 3300005456 | Bacteria | 7055 |
| 93 | Ga0070678_100027265 | 3300005456 | Bacteria | 3878 |
| 94 | Ga0070678_100176555 | 3300005456 | Bacteria | 1745 |
| 95 | Ga0070678_100508479 | 3300005456 | Unclassified | 1064 |
| 96 | Ga0070678_101538877 | 3300005456 | Bacteria | 623 |
| 97 | Ga0070662_100153148 | 3300005457 | Bacteria | 1797 |
| 98 | Ga0070662_100353028 | 3300005457 | Unclassified | 1205 |
| 99 | Ga0070662_100950439 | 3300005457 | Bacteria | 735 |
| 100 | Ga0070681_10067874 | 3300005458 | Bacteria | 3533 |
| 101 | Ga0070681_10447922 | 3300005458 | Unclassified | 1203 |
| 102 | Ga0070681_11104320 | 3300005458 | Unclassified | 714 |
| 103 | Ga0068867_100101688 | 3300005459 | Unclassified | 2196 |
| 104 | Ga0070685_10052029 | 3300005466 | Bacteria | 2369 |
| 105 | Ga0070706_100008263 | 3300005467 | Bacteria | 9706 |
| 106 | Ga0070706_100091857 | 3300005467 | Unclassified | 2816 |
| 107 | Ga0070706_100197069 | 3300005467 | Bacteria | 1881 |
| 108 | Ga0070706_100270509 | 3300005467 | Bacteria | 1586 |
| 109 | Ga0070706_100387198 | 3300005467 | Bacteria | 1302 |
| 110 | Ga0070706_101676874 | 3300005467 | Unclassified | 579 |
| 111 | Ga0070707_100009180 | 3300005468 | Bacteria | 9173 |
| 112 | Ga0070707_100093249 | 3300005468 | Bacteria | 2915 |
| 113 | Ga0070707_100207265 | 3300005468 | Unclassified | 1911 |
| 114 | Ga0070707_100525827 | 3300005468 | Bacteria | 1145 |
| 115 | Ga0070707_100605527 | 3300005468 | Bacteria | 1058 |
| 116 | Ga0070707_101103051 | 3300005468 | Bacteria | 760 |
| 117 | Ga0070707_101143436 | 3300005468 | Unclassified | 745 |
| 118 | Ga0070707_101799209 | 3300005468 | Bacteria | 580 |
| 119 | Ga0070698_100004541 | 3300005471 | Bacteria | 15252 |
| 120 | Ga0070698_100178885 | 3300005471 | Bacteria | 2059 |
| 121 | Ga0070698_100209917 | 3300005471 | Unclassified | 1882 |
| 122 | Ga0070698_100230235 | 3300005471 | Bacteria | 1786 |
| 123 | Ga0070698_100282775 | 3300005471 | Bacteria | 1590 |
| 124 | Ga0070699_100018853 | 3300005518 | Bacteria | 5929 |
| 125 | Ga0070699_100055304 | 3300005518 | Bacteria | 3437 |
| 126 | Ga0070684_100022106 | 3300005535 | Bacteria | 5302 |
| 127 | Ga0070684_100032939 | 3300005535 | Bacteria | 4421 |
| 128 | Ga0070684_100915199 | 3300005535 | Unclassified | 822 |
| 129 | Ga0070697_100035973 | 3300005536 | Bacteria | 3997 |
| 130 | Ga0068853_100288972 | 3300005539 | Bacteria | 1513 |
| 131 | Ga0068853_101947688 | 3300005539 | Unclassified | 570 |
| 132 | Ga0070672_100356307 | 3300005543 | Unclassified | 1248 |
| 133 | Ga0070686_100298072 | 3300005544 | Bacteria | 1195 |
| 134 | Ga0070686_100444744 | 3300005544 | Bacteria | 995 |
| 135 | Ga0070686_101388161 | 3300005544 | Bacteria | 589 |
| 136 | Ga0070695_100057596 | 3300005545 | Bacteria | 2511 |
| 137 | Ga0070695_101427571 | 3300005545 | Unclassified | 574 |
| 138 | Ga0070696_100012929 | 3300005546 | Bacteria | 5606 |
| 139 | Ga0070696_100487491 | 3300005546 | Bacteria | 978 |
| 140 | Ga0070696_100892976 | 3300005546 | Unclassified | 737 |
| 141 | Ga0070696_101233520 | 3300005546 | Bacteria | 633 |
| 142 | Ga0070696_101831956 | 3300005546 | Unclassified | 525 |
| 143 | Ga0070693_100314642 | 3300005547 | Bacteria | 1060 |
| 144 | Ga0070693_100369772 | 3300005547 | Bacteria | 986 |
| 145 | Ga0070665_101655678 | 3300005548 | Unclassified | 647 |
| 146 | Ga0070704_100017166 | 3300005549 | Bacteria | 4595 |
| 147 | Ga0070704_100465025 | 3300005549 | Unclassified | 1092 |
| 148 | Ga0070704_101037707 | 3300005549 | Bacteria | 743 |
| 149 | Ga0070704_101055689 | 3300005549 | Bacteria | 737 |
| 150 | Ga0070704_101165879 | 3300005549 | Unclassified | 702 |
| 151 | Ga0070704_101478371 | 3300005549 | Unclassified | 624 |
| 152 | Ga0070704_101492980 | 3300005549 | Unclassified | 621 |
| 153 | Ga0070704_101562379 | 3300005549 | Bacteria | 608 |
| 154 | Ga0070704_101704790 | 3300005549 | Bacteria | 582 |
| 155 | Ga0068855_100093499 | 3300005563 | Bacteria | 3467 |
| 156 | Ga0068855_100212327 | 3300005563 | Bacteria | 2174 |
| 157 | Ga0068855_101705456 | 3300005563 | Bacteria | 642 |
| 158 | Ga0070664_100007855 | 3300005564 | Bacteria | 8617 |
| 159 | Ga0070664_100064930 | 3300005564 | Bacteria | 3113 |
| 160 | Ga0068857_100374381 | 3300005577 | Bacteria | 1321 |
| 161 | Ga0068856_100135612 | 3300005614 | Bacteria | 2466 |
| 162 | Ga0068856_100585088 | 3300005614 | Unclassified | 1137 |
| 163 | Ga0068856_100619683 | 3300005614 | Bacteria | 1103 |
| 164 | Ga0068856_100666651 | 3300005614 | Bacteria | 1061 |
| 165 | Ga0068856_100817040 | 3300005614 | Unclassified | 952 |
| 166 | Ga0070702_100011024 | 3300005615 | Bacteria | 4483 |
| 167 | Ga0070702_100117267 | 3300005615 | Bacteria | 1661 |
| 168 | Ga0068852_100009899 | 3300005616 | Bacteria | 7095 |
| 169 | Ga0068852_101617206 | 3300005616 | Unclassified | 670 |
| 170 | Ga0068859_100486396 | 3300005617 | Bacteria | 1330 |
| 171 | Ga0068864_100036831 | 3300005618 | Bacteria | 4172 |
| 172 | Ga0068866_10051763 | 3300005718 | Unclassified | 2092 |
| 173 | Ga0068866_10108340 | 3300005718 | Unclassified | 1545 |
| 174 | Ga0068866_10629481 | 3300005718 | Bacteria | 728 |
| 175 | Ga0068861_100560910 | 3300005719 | Bacteria | 1042 |
| 176 | Ga0068861_102482496 | 3300005719 | Unclassified | 522 |
| 177 | Ga0068863_100355000 | 3300005841 | Bacteria | 1428 |
| 178 | Ga0068860_100114268 | 3300005843 | Bacteria | 2582 |
| 179 | Ga0068860_101696910 | 3300005843 | Unclassified | 654 |
| 180 | Ga0068862_100676377 | 3300005844 | Bacteria | 998 |
| 181 | Ga0068862_101660491 | 3300005844 | Unclassified | 647 |
| 182 | Ga0081455_10130107 | 3300005937 | Unclassified | 1970 |
| 183 | Ga0081455_10296000 | 3300005937 | Bacteria | 1163 |
| 184 | Ga0081538_10029400 | 3300005981 | Bacteria | 3754 |
| 185 | Ga0081538_10062276 | 3300005981 | Bacteria | 2129 |
| 186 | Ga0081538_10113985 | 3300005981 | Bacteria | 1318 |
| 187 | Ga0081540_1015838 | 3300005983 | Bacteria | 4752 |
| 188 | Ga0081539_10000068 | 3300005985 | Bacteria | 240998 |
| 189 | Ga0081539_10009415 | 3300005985 | Bacteria | 8171 |
| 190 | Ga0081539_10058993 | 3300005985 | Bacteria | 2115 |
| 191 | Ga0081539_10271264 | 3300005985 | Bacteria | 743 |
| 192 | Ga0070717_10097143 | 3300006028 | Bacteria | 2496 |
| 193 | Ga0070717_10203795 | 3300006028 | Bacteria | 1734 |
| 194 | Ga0070717_11180949 | 3300006028 | Bacteria | 696 |
| 195 | Ga0070717_11534822 | 3300006028 | Bacteria | 604 |
| 196 | Ga0075432_10137469 | 3300006058 | Bacteria | 930 |
| 197 | Ga0075432_10318838 | 3300006058 | Bacteria | 650 |
| 198 | Ga0070715_10045288 | 3300006163 | Bacteria | 1864 |
| 199 | Ga0070715_10206287 | 3300006163 | Bacteria | 1001 |
| 200 | Ga0070716_100001084 | 3300006173 | Bacteria | 11939 |
| 201 | Ga0070716_100094734 | 3300006173 | Bacteria | 1816 |
| 202 | Ga0070716_100096573 | 3300006173 | Bacteria | 1801 |
| 203 | Ga0070716_100305481 | 3300006173 | Bacteria | 1108 |
| 204 | Ga0070716_100431575 | 3300006173 | Unclassified | 956 |
| 205 | Ga0070716_100948812 | 3300006173 | Bacteria | 677 |
| 206 | Ga0070716_101167947 | 3300006173 | Bacteria | 617 |
| 207 | Ga0070712_100000007 | 3300006175 | Bacteria | 157653 |
| 208 | Ga0070712_100003758 | 3300006175 | Bacteria | 9352 |
| 209 | Ga0070712_100014605 | 3300006175 | Bacteria | 5040 |
| 210 | Ga0070712_100026426 | 3300006175 | Bacteria | 3866 |
| 211 | Ga0070712_100045974 | 3300006175 | Bacteria | 3016 |
| 212 | Ga0070712_100117206 | 3300006175 | Bacteria | 1998 |
| 213 | Ga0070712_100159601 | 3300006175 | Unclassified | 1740 |
| 214 | Ga0070712_100305032 | 3300006175 | Bacteria | 1290 |
| 215 | Ga0070712_100437586 | 3300006175 | Bacteria | 1087 |
| 216 | Ga0070712_100516687 | 3300006175 | Unclassified | 1003 |
| 217 | Ga0070712_101383421 | 3300006175 | Bacteria | 614 |
| 218 | Ga0075367_10401444 | 3300006178 | Bacteria | 867 |
| 219 | Ga0097621_100194138 | 3300006237 | Bacteria | 1760 |
| 220 | Ga0097621_100312780 | 3300006237 | Bacteria | 1390 |
| 221 | Ga0075370_10553252 | 3300006353 | Bacteria | 696 |
| 222 | Ga0068871_100868497 | 3300006358 | Bacteria | 835 |
| 223 | Ga0068871_101697189 | 3300006358 | Bacteria | 599 |
| 224 | Ga0075428_100121377 | 3300006844 | Bacteria | 2846 |
| 225 | Ga0075428_100166123 | 3300006844 | Bacteria | 2394 |
| 226 | Ga0075428_100388463 | 3300006844 | Bacteria | 1496 |
| 227 | Ga0075428_100729930 | 3300006844 | Unclassified | 1054 |
| 228 | Ga0075428_102379173 | 3300006844 | Bacteria | 544 |
| 229 | Ga0075430_100380167 | 3300006846 | Bacteria | 1165 |
| 230 | Ga0075430_101139996 | 3300006846 | Unclassified | 642 |
| 231 | Ga0075431_100026120 | 3300006847 | Bacteria | 5989 |
| 232 | Ga0075431_100117633 | 3300006847 | Bacteria | 2743 |
| 233 | Ga0075431_100229757 | 3300006847 | Unclassified | 1890 |
| 234 | Ga0075431_101016083 | 3300006847 | Bacteria | 796 |
| 235 | Ga0075431_101415227 | 3300006847 | Unclassified | 655 |
| 236 | Ga0075433_10015003 | 3300006852 | Bacteria | 6344 |
| 237 | Ga0075433_10031218 | 3300006852 | Bacteria | 4553 |
| 238 | Ga0075433_10044990 | 3300006852 | Bacteria | 3836 |
| 239 | Ga0075433_10310276 | 3300006852 | Unclassified | 1396 |
| 240 | Ga0075434_100045749 | 3300006871 | Bacteria | 4342 |
| 241 | Ga0075434_100074186 | 3300006871 | Bacteria | 3396 |
| 242 | Ga0075434_100115672 | 3300006871 | Bacteria | 2695 |
| 243 | Ga0075434_100288829 | 3300006871 | Unclassified | 1660 |
| 244 | Ga0075434_100778090 | 3300006871 | Bacteria | 974 |
| 245 | Ga0075434_100854788 | 3300006871 | Unclassified | 925 |
| 246 | Ga0075434_101583399 | 3300006871 | Bacteria | 664 |
| 247 | Ga0075434_102004576 | 3300006871 | Bacteria | 584 |
| 248 | Ga0075429_100280665 | 3300006880 | Bacteria | 1459 |
| 249 | Ga0075436_100028580 | 3300006914 | Bacteria | 3835 |
| 250 | Ga0075436_100038877 | 3300006914 | Bacteria | 3283 |
| 251 | Ga0075436_100094513 | 3300006914 | Bacteria | 2079 |
| 252 | Ga0075436_100179277 | 3300006914 | Bacteria | 1497 |
| 253 | Ga0075436_100697180 | 3300006914 | Bacteria | 752 |
| 254 | Ga0097620_100486395 | 3300006931 | Bacteria | 1330 |
| 255 | Ga0075435_100000552 | 3300007076 | Bacteria | 22973 |
| 256 | Ga0075435_100030027 | 3300007076 | Bacteria | 4271 |
| 257 | Ga0075435_100114959 | 3300007076 | Bacteria | 2240 |
| 258 | Ga0075435_100335121 | 3300007076 | Bacteria | 1296 |
| 259 | Ga0075435_100485802 | 3300007076 | Bacteria | 1067 |
| 260 | Ga0075435_100495423 | 3300007076 | Bacteria | 1056 |
| 261 | Ga0075435_100598741 | 3300007076 | Unclassified | 956 |
| 262 | Ga0075435_100719933 | 3300007076 | Bacteria | 868 |
| 263 | Ga0075435_100783243 | 3300007076 | Bacteria | 830 |
| 264 | Ga0075435_101512360 | 3300007076 | Unclassified | 589 |
| 265 | Ga0099795_10359624 | 3300007788 | Unclassified | 653 |
| 266 | Ga0105250_10150021 | 3300009092 | Bacteria | 970 |
| 267 | Ga0105240_10906743 | 3300009093 | Bacteria | 948 |
| 268 | Ga0105240_11099973 | 3300009093 | Unclassified | 846 |
| 269 | Ga0105240_11158809 | 3300009093 | Unclassified | 820 |
| 270 | Ga0111539_10028470 | 3300009094 | Bacteria | 6815 |
| 271 | Ga0111539_10046823 | 3300009094 | Bacteria | 5172 |
| 272 | Ga0111539_10046834 | 3300009094 | Bacteria | 5171 |
| 273 | Ga0111539_10276381 | 3300009094 | Bacteria | 1954 |
| 274 | Ga0111539_10434915 | 3300009094 | Bacteria | 1528 |
| 275 | Ga0111539_10900962 | 3300009094 | Bacteria | 1029 |
| 276 | Ga0105245_10011852 | 3300009098 | Bacteria | 7585 |
| 277 | Ga0105245_10130771 | 3300009098 | Bacteria | 2354 |
| 278 | Ga0105245_10344762 | 3300009098 | Bacteria | 1474 |
| 279 | Ga0105245_10505981 | 3300009098 | Bacteria | 1225 |
| 280 | Ga0105245_10899249 | 3300009098 | Bacteria | 927 |
| 281 | Ga0105245_11709099 | 3300009098 | Bacteria | 682 |
| 282 | Ga0105245_12148096 | 3300009098 | Unclassified | 612 |
| 283 | Ga0114129_10000831 | 3300009147 | Bacteria | 39916 |
| 284 | Ga0114129_10007775 | 3300009147 | Bacteria | 15253 |
| 285 | Ga0114129_10097803 | 3300009147 | Bacteria | 4063 |
| 286 | Ga0114129_10108514 | 3300009147 | Bacteria | 3832 |
| 287 | Ga0114129_10166187 | 3300009147 | Bacteria | 3011 |
| 288 | Ga0114129_10206491 | 3300009147 | Archaea | 2657 |
| 289 | Ga0114129_10395042 | 3300009147 | Bacteria | 1823 |
| 290 | Ga0114129_10670901 | 3300009147 | Bacteria | 1336 |
| 291 | Ga0114129_10722376 | 3300009147 | Unclassified | 1278 |
| 292 | Ga0114129_10927154 | 3300009147 | Bacteria | 1102 |
| 293 | Ga0114129_11763949 | 3300009147 | Bacteria | 754 |
| 294 | Ga0105243_10016878 | 3300009148 | Bacteria | 5520 |
| 295 | Ga0105243_10048038 | 3300009148 | Bacteria | 3363 |
| 296 | Ga0105243_10063943 | 3300009148 | Bacteria | 2950 |
| 297 | Ga0105243_10761442 | 3300009148 | Unclassified | 950 |
| 298 | Ga0105243_11205100 | 3300009148 | Bacteria | 770 |
| 299 | Ga0105243_11638713 | 3300009148 | Bacteria | 671 |
| 300 | Ga0105243_13061977 | 3300009148 | Unclassified | 507 |
| 301 | Ga0105241_11772752 | 3300009174 | Unclassified | 602 |
| 302 | Ga0105242_10040981 | 3300009176 | Bacteria | 3733 |
| 303 | Ga0105242_10047642 | 3300009176 | Bacteria | 3481 |
| 304 | Ga0105242_10201013 | 3300009176 | Bacteria | 1770 |
| 305 | Ga0105242_10205333 | 3300009176 | Bacteria | 1752 |
| 306 | Ga0105242_10471047 | 3300009176 | Unclassified | 1188 |
| 307 | Ga0105242_10732396 | 3300009176 | Bacteria | 971 |
| 308 | Ga0105242_11072493 | 3300009176 | Unclassified | 818 |
| 309 | Ga0105242_11177449 | 3300009176 | Bacteria | 784 |
| 310 | Ga0105248_10450454 | 3300009177 | Unclassified | 1450 |
| 311 | Ga0105248_12354264 | 3300009177 | Unclassified | 606 |
| 312 | Ga0105248_12746152 | 3300009177 | Bacteria | 562 |
| 313 | Ga0105237_10928327 | 3300009545 | Unclassified | 877 |
| 314 | Ga0105238_10530372 | 3300009551 | Bacteria | 1180 |
| 315 | Ga0105249_10118902 | 3300009553 | Bacteria | 2509 |
| 316 | Ga0105249_10696486 | 3300009553 | Unclassified | 1076 |
| 317 | Ga0105249_11564040 | 3300009553 | Unclassified | 732 |
| 318 | Ga0105239_10004095 | 3300010375 | Bacteria | 17531 |
| 319 | Ga0105239_10386990 | 3300010375 | Bacteria | 1582 |
| 320 | Ga0105239_10493160 | 3300010375 | Bacteria | 1392 |
| 321 | Ga0105239_11287061 | 3300010375 | Unclassified | 843 |
| 322 | Ga0105239_13061540 | 3300010375 | Unclassified | 545 |
| 323 | Ga0105246_11531884 | 3300011119 | Bacteria | 627 |
| 324 | Ga0157346_1001569 | 3300012480 | Unclassified | 1099 |
| 325 | Ga0157341_1015006 | 3300012494 | Bacteria | 708 |
| 326 | Ga0157342_1019055 | 3300012507 | Bacteria | 783 |
| 327 | Ga0157371_10396243 | 3300013102 | Bacteria | 1010 |
| 328 | Ga0157370_11195751 | 3300013104 | Bacteria | 686 |
| 329 | Ga0157369_10019782 | 3300013105 | Bacteria | 7534 |
| 330 | Ga0157369_10515497 | 3300013105 | Unclassified | 1237 |
| 331 | Ga0157369_11066244 | 3300013105 | Unclassified | 826 |
| 332 | Ga0157369_12533383 | 3300013105 | Bacteria | 519 |
| 333 | Ga0157374_10010688 | 3300013296 | Bacteria | 7907 |
| 334 | Ga0157374_10150805 | 3300013296 | Bacteria | 2260 |
| 335 | Ga0157374_11301669 | 3300013296 | Bacteria | 749 |
| 336 | Ga0157374_11338816 | 3300013296 | Bacteria | 738 |
| 337 | Ga0157378_10693939 | 3300013297 | Bacteria | 1037 |
| 338 | Ga0157378_11209187 | 3300013297 | Bacteria | 795 |
| 339 | Ga0163162_10411859 | 3300013306 | Bacteria | 1484 |
| 340 | Ga0163162_10598976 | 3300013306 | Bacteria | 1228 |
| 341 | Ga0163162_10668087 | 3300013306 | Bacteria | 1162 |
| 342 | Ga0157372_10203064 | 3300013307 | Bacteria | 2296 |
| 343 | Ga0157372_10643391 | 3300013307 | Bacteria | 1235 |
| 344 | Ga0157375_10105603 | 3300013308 | Bacteria | 2907 |
| 345 | Ga0157375_10456694 | 3300013308 | Unclassified | 1443 |
| 346 | Ga0157375_10860870 | 3300013308 | Bacteria | 1052 |
| 347 | Ga0157375_13465122 | 3300013308 | Unclassified | 525 |
| 348 | Ga0163163_10133860 | 3300014325 | Bacteria | 2519 |
| 349 | Ga0157380_10378526 | 3300014326 | Unclassified | 1335 |
| 350 | Ga0157380_10407620 | 3300014326 | Bacteria | 1292 |
| 351 | Ga0157380_10474416 | 3300014326 | Bacteria | 1208 |
| 352 | Ga0157380_10630516 | 3300014326 | Bacteria | 1066 |
| 353 | Ga0157380_11431991 | 3300014326 | Bacteria | 742 |
| 354 | Ga0157377_10001774 | 3300014745 | Bacteria | 9412 |
| 355 | Ga0157377_10035301 | 3300014745 | Bacteria | 2742 |
| 356 | Ga0157377_10479923 | 3300014745 | Unclassified | 865 |
| 357 | Ga0157377_11256145 | 3300014745 | Unclassified | 576 |
| 358 | Ga0157379_10163166 | 3300014968 | Bacteria | 2011 |
| 359 | Ga0157379_10760144 | 3300014968 | Bacteria | 913 |
| 360 | Ga0157376_10410401 | 3300014969 | Bacteria | 1312 |
| 361 | Ga0157376_10887516 | 3300014969 | Bacteria | 909 |
| 362 | Ga0157376_12192216 | 3300014969 | Bacteria | 591 |
| 363 | Ga0163161_10358667 | 3300017792 | Bacteria | 1161 |
| 364 | Ga0206354_10173438 | 3300020081 | Bacteria | 1978 |
| 365 | Ga0206353_10095162 | 3300020082 | Bacteria | 1114 |
| 366 | Ga0206353_10365959 | 3300020082 | Unclassified | 509 |
| 367 | Ga0206353_11480865 | 3300020082 | Bacteria | 978 |
| 368 | Ga0154015_1659241 | 3300020610 | Unclassified | 609 |
| 369 | Ga0213873_10074288 | 3300021358 | Bacteria | 942 |
| 370 | Ga0207653_10005114 | 3300025885 | Bacteria | 4098 |
| 371 | Ga0207653_10226294 | 3300025885 | Bacteria | 711 |
| 372 | Ga0207692_10157458 | 3300025898 | Bacteria | 1306 |
| 373 | Ga0207692_10188351 | 3300025898 | Bacteria | 1206 |
| 374 | Ga0207692_10512071 | 3300025898 | Unclassified | 763 |
| 375 | Ga0207642_10715864 | 3300025899 | Bacteria | 632 |
| 376 | Ga0207710_10590365 | 3300025900 | Unclassified | 580 |
| 377 | Ga0207688_10003516 | 3300025901 | Bacteria | 8553 |
| 378 | Ga0207647_10277656 | 3300025904 | Unclassified | 957 |
| 379 | Ga0207685_10073254 | 3300025905 | Unclassified | 1395 |
| 380 | Ga0207685_10477463 | 3300025905 | Bacteria | 653 |
| 381 | Ga0207699_10004114 | 3300025906 | Bacteria | 6970 |
| 382 | Ga0207699_10006204 | 3300025906 | Bacteria | 5767 |
| 383 | Ga0207699_10066552 | 3300025906 | Unclassified | 2188 |
| 384 | Ga0207699_10090402 | 3300025906 | Bacteria | 1921 |
| 385 | Ga0207705_10671735 | 3300025909 | Unclassified | 806 |
| 386 | Ga0207684_10142609 | 3300025910 | Bacteria | 2060 |
| 387 | Ga0207684_10206944 | 3300025910 | Bacteria | 1693 |
| 388 | Ga0207684_10577071 | 3300025910 | Bacteria | 961 |
| 389 | Ga0207684_11262026 | 3300025910 | Unclassified | 610 |
| 390 | Ga0207707_10075848 | 3300025912 | Bacteria | 2934 |
| 391 | Ga0207707_10103226 | 3300025912 | Bacteria | 2492 |
| 392 | Ga0207695_10817634 | 3300025913 | Unclassified | 812 |
| 393 | Ga0207695_11040720 | 3300025913 | Bacteria | 698 |
| 394 | Ga0207693_10001413 | 3300025915 | Bacteria | 21296 |
| 395 | Ga0207693_10002613 | 3300025915 | Bacteria | 15647 |
| 396 | Ga0207693_10020915 | 3300025915 | Bacteria | 5202 |
| 397 | Ga0207693_10026555 | 3300025915 | Bacteria | 4582 |
| 398 | Ga0207693_10039249 | 3300025915 | Bacteria | 3728 |
| 399 | Ga0207693_10158426 | 3300025915 | Bacteria | 1781 |
| 400 | Ga0207693_10178444 | 3300025915 | Unclassified | 1671 |
| 401 | Ga0207693_10195845 | 3300025915 | Unclassified | 1590 |
| 402 | Ga0207693_10793857 | 3300025915 | Bacteria | 730 |
| 403 | Ga0207663_10095807 | 3300025916 | Bacteria | 1981 |
| 404 | Ga0207663_10182104 | 3300025916 | Bacteria | 1501 |
| 405 | Ga0207663_10216817 | 3300025916 | Bacteria | 1390 |
| 406 | Ga0207663_10344220 | 3300025916 | Bacteria | 1127 |
| 407 | Ga0207663_10409025 | 3300025916 | Bacteria | 1039 |
| 408 | Ga0207663_10546255 | 3300025916 | Bacteria | 905 |
| 409 | Ga0207663_10851447 | 3300025916 | Unclassified | 728 |
| 410 | Ga0207660_10676584 | 3300025917 | Bacteria | 842 |
| 411 | Ga0207662_10007150 | 3300025918 | Bacteria | 6071 |
| 412 | Ga0207657_10196743 | 3300025919 | Unclassified | 1624 |
| 413 | Ga0207652_10646904 | 3300025921 | Bacteria | 946 |
| 414 | Ga0207646_10010563 | 3300025922 | Bacteria | 9009 |
| 415 | Ga0207646_10124888 | 3300025922 | Bacteria | 2314 |
| 416 | Ga0207646_10165062 | 3300025922 | Bacteria | 1999 |
| 417 | Ga0207646_10362136 | 3300025922 | Bacteria | 1310 |
| 418 | Ga0207646_10497647 | 3300025922 | Bacteria | 1098 |
| 419 | Ga0207646_10531440 | 3300025922 | Bacteria | 1058 |
| 420 | Ga0207646_11317405 | 3300025922 | Bacteria | 630 |
| 421 | Ga0207646_11349072 | 3300025922 | Bacteria | 622 |
| 422 | Ga0207681_11408751 | 3300025923 | Unclassified | 585 |
| 423 | Ga0207694_11598584 | 3300025924 | Unclassified | 549 |
| 424 | Ga0207650_11707137 | 3300025925 | Unclassified | 534 |
| 425 | Ga0207659_10168573 | 3300025926 | Unclassified | 1726 |
| 426 | Ga0207687_10086372 | 3300025927 | Bacteria | 2278 |
| 427 | Ga0207687_10216630 | 3300025927 | Bacteria | 1505 |
| 428 | Ga0207687_10643024 | 3300025927 | Unclassified | 897 |
| 429 | Ga0207687_11617396 | 3300025927 | Unclassified | 556 |
| 430 | Ga0207700_10151217 | 3300025928 | Bacteria | 1918 |
| 431 | Ga0207664_10730016 | 3300025929 | Unclassified | 891 |
| 432 | Ga0207664_11285428 | 3300025929 | Bacteria | 651 |
| 433 | Ga0207664_11631287 | 3300025929 | Bacteria | 567 |
| 434 | Ga0207644_10859075 | 3300025931 | Unclassified | 760 |
| 435 | Ga0207706_10087029 | 3300025933 | Bacteria | 2747 |
| 436 | Ga0207706_10115490 | 3300025933 | Bacteria | 2361 |
| 437 | Ga0207706_11063050 | 3300025933 | Unclassified | 678 |
| 438 | Ga0207706_11474656 | 3300025933 | Bacteria | 556 |
| 439 | Ga0207686_10096419 | 3300025934 | Bacteria | 1965 |
| 440 | Ga0207686_10178089 | 3300025934 | Bacteria | 1505 |
| 441 | Ga0207686_10724462 | 3300025934 | Bacteria | 792 |
| 442 | Ga0207686_10772546 | 3300025934 | Unclassified | 768 |
| 443 | Ga0207686_10903130 | 3300025934 | Bacteria | 713 |
| 444 | Ga0207686_10952778 | 3300025934 | Bacteria | 695 |
| 445 | Ga0207686_11026956 | 3300025934 | Bacteria | 670 |
| 446 | Ga0207709_10444225 | 3300025935 | Bacteria | 1001 |
| 447 | Ga0207709_10768462 | 3300025935 | Unclassified | 776 |
| 448 | Ga0207709_11464397 | 3300025935 | Archaea | 566 |
| 449 | Ga0207670_10978563 | 3300025936 | Bacteria | 711 |
| 450 | Ga0207669_10038865 | 3300025937 | Bacteria | 2744 |
| 451 | Ga0207669_10191473 | 3300025937 | Bacteria | 1476 |
| 452 | Ga0207704_10048774 | 3300025938 | Bacteria | 2542 |
| 453 | Ga0207704_10232902 | 3300025938 | Bacteria | 1371 |
| 454 | Ga0207665_10117047 | 3300025939 | Bacteria | 1879 |
| 455 | Ga0207665_10137581 | 3300025939 | Bacteria | 1739 |
| 456 | Ga0207665_10168821 | 3300025939 | Bacteria | 1579 |
| 457 | Ga0207665_10620381 | 3300025939 | Unclassified | 846 |
| 458 | Ga0207665_10726833 | 3300025939 | Bacteria | 782 |
| 459 | Ga0207711_10489186 | 3300025941 | Unclassified | 1146 |
| 460 | Ga0207689_10169712 | 3300025942 | Bacteria | 1798 |
| 461 | Ga0207661_10068368 | 3300025944 | Bacteria | 2893 |
| 462 | Ga0207661_10224017 | 3300025944 | Bacteria | 1663 |
| 463 | Ga0207661_11242159 | 3300025944 | Bacteria | 685 |
| 464 | Ga0207679_10007996 | 3300025945 | Bacteria | 6725 |
| 465 | Ga0207679_10011810 | 3300025945 | Bacteria | 5674 |
| 466 | Ga0207667_10179367 | 3300025949 | Bacteria | 2175 |
| 467 | Ga0207667_10321160 | 3300025949 | Bacteria | 1581 |
| 468 | Ga0207667_11876508 | 3300025949 | Unclassified | 562 |
| 469 | Ga0207651_10574167 | 3300025960 | Unclassified | 983 |
| 470 | Ga0207651_10776683 | 3300025960 | Unclassified | 848 |
| 471 | Ga0207712_11076618 | 3300025961 | Unclassified | 715 |
| 472 | Ga0207712_11223303 | 3300025961 | Unclassified | 670 |
| 473 | Ga0207677_10273426 | 3300026023 | Bacteria | 1383 |
| 474 | Ga0207677_10354586 | 3300026023 | Bacteria | 1230 |
| 475 | Ga0207678_10022172 | 3300026067 | Bacteria | 5565 |
| 476 | Ga0207678_11331757 | 3300026067 | Bacteria | 635 |
| 477 | Ga0207708_10001166 | 3300026075 | Bacteria | 19795 |
| 478 | Ga0207708_10231739 | 3300026075 | Bacteria | 1483 |
| 479 | Ga0207708_11853678 | 3300026075 | Bacteria | 529 |
| 480 | Ga0207702_10028071 | 3300026078 | Bacteria | 4676 |
| 481 | Ga0207702_10286402 | 3300026078 | Unclassified | 1559 |
| 482 | Ga0207702_11051495 | 3300026078 | Unclassified | 808 |
| 483 | Ga0207648_10135205 | 3300026089 | Unclassified | 2171 |
| 484 | Ga0207648_10782486 | 3300026089 | Bacteria | 887 |
| 485 | Ga0207676_10185975 | 3300026095 | Bacteria | 1823 |
| 486 | Ga0207676_10700249 | 3300026095 | Bacteria | 981 |
| 487 | Ga0207674_10450721 | 3300026116 | Bacteria | 1244 |
| 488 | Ga0207675_100042914 | 3300026118 | Bacteria | 4223 |
| 489 | Ga0207675_100125613 | 3300026118 | Bacteria | 2430 |
| 490 | Ga0207675_101079035 | 3300026118 | Bacteria | 822 |
| 491 | Ga0207683_10141485 | 3300026121 | Bacteria | 2168 |
| 492 | Ga0207683_10169808 | 3300026121 | Bacteria | 1975 |
| 493 | Ga0207683_10191462 | 3300026121 | Bacteria | 1857 |
| 494 | Ga0207683_12186531 | 3300026121 | Bacteria | 501 |
| 495 | Ga0207698_10374389 | 3300026142 | Unclassified | 1353 |
| 496 | Ga0207428_10054782 | 3300027907 | Bacteria | 3175 |
| 497 | Ga0207428_10355292 | 3300027907 | Unclassified | 1078 |
| 498 | Ga0207428_10461925 | 3300027907 | Bacteria | 925 |
| 499 | Ga0268265_10849332 | 3300028380 | Bacteria | 893 |
| 500 | Ga0268264_10334425 | 3300028381 | Bacteria | 1436 |
| 501 | Ga0268264_10968706 | 3300028381 | Bacteria | 856 |
| 502 | Ga0268264_11361116 | 3300028381 | Bacteria | 720 |
| 503 | Ga0265338_10236046 | 3300028800 | Bacteria | 1357 |
| 504 | Ga0265338_10509359 | 3300028800 | Unclassified | 846 |
| 505 | Ga0265325_10020382 | 3300031241 | Bacteria | 3655 |
| 506 | Ga0265313_10112784 | 3300031595 | Bacteria | 1194 |
| 507 | Ga0307412_10283823 | 3300031911 | Bacteria | 1301 |
| 508 | Ga0307409_101047970 | 3300031995 | Bacteria | 835 |
| 509 | Ga0307409_101826815 | 3300031995 | Bacteria | 637 |
| 510 | Ga0307416_100018682 | 3300032002 | Bacteria | 4893 |
| 511 | Ga0307416_100113792 | 3300032002 | Bacteria | 2392 |
| 512 | Ga0307416_102605848 | 3300032002 | Unclassified | 603 |
| 513 | Ga0307415_100026813 | 3300032126 | Bacteria | 3641 |
| 514 | Ga0307415_102204028 | 3300032126 | Unclassified | 539 |
| 515 | Ga0373930_0022749 | 3300034816 | Bacteria | 1242 |
| 516 | Ga0373948_0139211 | 3300034817 | Bacteria | 599 |
| 517 | Ga0373950_0052684 | 3300034818 | Bacteria | 802 |
| 518 | Ga0373959_0003544 | 3300034820 | Bacteria | 2493 |
| 519 | Ga0373938_0024714 | 3300034957 | Bacteria | 1244 |
| 520 | Ga0373928_0006763 | 3300035084 | Bacteria | 2207 |
| 521 | Ga0373929_0048132 | 3300035085 | Bacteria | 967 |
| 522 | Ga0373940_0128863 | 3300035088 | Unclassified | 791 |
| 523 | Ga0373949_0011808 | 3300035090 | Unclassified | 1927 |
| 524 | Ga0373949_0130256 | 3300035090 | Unclassified | 713 |
| 525 | Ga0373951_0005669 | 3300035091 | Bacteria | 2891 |
| 526 | Ga0373952_0024073 | 3300035092 | Bacteria | 1305 |
| 527 | Ga0373932_0016907 | 3300035112 | Bacteria | 1866 |
| 528 | Ga0373939_0014328 | 3300035114 | Bacteria | 2055 |
| 529 | Ga0373953_0233728 | 3300035117 | Unclassified | 797 |
| 530 | Ga0373954_0342249 | 3300035118 | Bacteria | 739 |
| 531 | Ga0373957_0112193 | 3300035120 | Bacteria | 1099 |
| 532 | Ga0373960_0004406 | 3300035121 | Bacteria | 3222 |
| 533 | Ga0373943_0014323 | 3300035170 | Bacteria | 3588 |
| 534 | Ga0373943_0118265 | 3300035170 | Bacteria | 1406 |
| 535 | Ga0373955_0128205 | 3300035172 | Bacteria | 1479 |
| 536 | Ga0373955_0743130 | 3300035172 | Bacteria | 603 |
| 537 | Ga0373942_0002766 | 3300035207 | Bacteria | 4187 |
| 538 | Ga0373961_0004810 | 3300035241 | Bacteria | 3246 |
| 539 | Ga0373962_0004999 | 3300035242 | Bacteria | 3206 |
| 540 | Ga0373931_0010433 | 3300035691 | Bacteria | 4464 |
| 541 | Ga0373931_0339276 | 3300035691 | Unclassified | 938 |
| 542 | Ga0373931_1087291 | 3300035691 | Bacteria | 544 |
| 543 | Ga0373935_0128438 | 3300035692 | Unclassified | 1701 |
| 544 | Ga0373935_0181807 | 3300035692 | Bacteria | 1444 |
| 545 | Ga0373927_0072159 | 3300035695 | Bacteria | 2234 |
| 546 | Ga0373933_0997871 | 3300035724 | Bacteria | 551 |
| 547 | Ga0373947_0012053 | 3300035725 | Bacteria | 4951 |
| 548 | Ga0373937_0000976 | 3300036401 | Bacteria | 24290 |
| 549 | Ga0373937_0196750 | 3300036401 | Bacteria | 1895 |
| 550 | Ga0373937_0999052 | 3300036401 | Bacteria | 785 |
| 551 | Ga0373925_0009072 | 3300037068 | Bacteria | 7240 |
| 552 | Ga0395899_0002136 | 3300037312 | Bacteria | 16250 |
| 553 | Ga0395899_0002201 | 3300037312 | Bacteria | 15973 |
| 554 | Ga0395899_0019734 | 3300037312 | Bacteria | 5118 |
| 555 | Ga0395899_0026936 | 3300037312 | Bacteria | 4336 |
| 556 | Ga0395899_0052492 | 3300037312 | Bacteria | 3021 |
| 557 | Ga0395899_0101106 | 3300037312 | Bacteria | 2081 |
| 558 | Ga0395899_0123714 | 3300037312 | Bacteria | 1851 |
| 559 | Ga0395899_0220748 | 3300037312 | Bacteria | 1313 |
| 560 | Ga0395899_0456164 | 3300037312 | Bacteria | 836 |
| 561 | Ga0395899_0556228 | 3300037312 | Bacteria | 737 |
| 562 | Ga0395899_0883041 | 3300037312 | Unclassified | 546 |
| 563 | Ga0395899_0950143 | 3300037312 | Unclassified | 521 |
| 564 | Ga0395900_0001291 | 3300037418 | Bacteria | 30553 |
| 565 | Ga0395900_0001589 | 3300037418 | Bacteria | 26870 |
| 566 | Ga0395900_0003136 | 3300037418 | Bacteria | 17929 |
| 567 | Ga0395900_0004208 | 3300037418 | Bacteria | 15271 |
| 568 | Ga0395900_0019234 | 3300037418 | Bacteria | 6964 |
| 569 | Ga0395900_0032656 | 3300037418 | Bacteria | 5353 |
| 570 | Ga0395900_0033591 | 3300037418 | Bacteria | 5279 |
| 571 | Ga0395900_0059917 | 3300037418 | Unclassified | 3918 |
| 572 | Ga0395900_0137616 | 3300037418 | Bacteria | 2502 |
| 573 | Ga0395900_0158276 | 3300037418 | Bacteria | 2312 |
| 574 | Ga0395900_0220711 | 3300037418 | Bacteria | 1911 |
| 575 | Ga0395900_0238306 | 3300037418 | Bacteria | 1826 |
| 576 | Ga0395900_0307589 | 3300037418 | Bacteria | 1569 |
| 577 | Ga0395900_0448053 | 3300037418 | Bacteria | 1247 |
| 578 | Ga0395900_0481552 | 3300037418 | Unclassified | 1193 |
| 579 | Ga0395900_0899052 | 3300037418 | Archaea | 809 |
| 580 | Ga0395900_1044094 | 3300037418 | Bacteria | 736 |
| 581 | Ga0395900_1404172 | 3300037418 | Unclassified | 611 |
| 582 | Ga0395900_1899646 | 3300037418 | Bacteria | 506 |
| 583 | Ga0395898_0001958 | 3300037466 | Bacteria | 26038 |
| 584 | Ga0395898_0004222 | 3300037466 | Bacteria | 15747 |
| 585 | Ga0395898_0004997 | 3300037466 | Bacteria | 14385 |
| 586 | Ga0395898_0006008 | 3300037466 | Bacteria | 13037 |
| 587 | Ga0395898_0021621 | 3300037466 | Bacteria | 6520 |
| 588 | Ga0395898_0024332 | 3300037466 | Bacteria | 6107 |
| 589 | Ga0395898_0037004 | 3300037466 | Bacteria | 4843 |
| 590 | Ga0395898_0050486 | 3300037466 | Bacteria | 4070 |
| 591 | Ga0395898_0058954 | 3300037466 | Bacteria | 3736 |
| 592 | Ga0395898_0076990 | 3300037466 | Bacteria | 3220 |
| 593 | Ga0395898_0086397 | 3300037466 | Bacteria | 3023 |
| 594 | Ga0395898_0097794 | 3300037466 | Bacteria | 2819 |
| 595 | Ga0395898_0115575 | 3300037466 | Bacteria | 2571 |
| 596 | Ga0395898_0158397 | 3300037466 | Bacteria | 2165 |
| 597 | Ga0395898_0159525 | 3300037466 | Bacteria | 2157 |
| 598 | Ga0395898_0312764 | 3300037466 | Unclassified | 1498 |
| 599 | Ga0395898_0361068 | 3300037466 | Unclassified | 1385 |
| 600 | Ga0395898_0416511 | 3300037466 | Bacteria | 1280 |
| 601 | Ga0395898_1332445 | 3300037466 | Unclassified | 647 |
| 602 | Ga0395898_1458832 | 3300037466 | Bacteria | 611 |
| 603 | Ga0395905_0003055 | 3300037471 | Bacteria | 18136 |
| 604 | Ga0395905_0003667 | 3300037471 | Bacteria | 16283 |
| 605 | Ga0395905_0004895 | 3300037471 | Bacteria | 13800 |
| 606 | Ga0395905_0010536 | 3300037471 | Bacteria | 8979 |
| 607 | Ga0395905_0010934 | 3300037471 | Bacteria | 8783 |
| 608 | Ga0395905_0025905 | 3300037471 | Bacteria | 5528 |
| 609 | Ga0395905_0027603 | 3300037471 | Bacteria | 5353 |
| 610 | Ga0395905_0063518 | 3300037471 | Bacteria | 3455 |
| 611 | Ga0395905_0066386 | 3300037471 | Bacteria | 3379 |
| 612 | Ga0395905_0073735 | 3300037471 | Bacteria | 3199 |
| 613 | Ga0395905_0284173 | 3300037471 | Bacteria | 1541 |
| 614 | Ga0395905_0487257 | 3300037471 | Unclassified | 1133 |
| 615 | Ga0395905_0620099 | 3300037471 | Bacteria | 983 |
| 616 | Ga0395905_0999808 | 3300037471 | Bacteria | 739 |
| 617 | Ga0395905_1018127 | 3300037471 | Unclassified | 731 |
| 618 | Ga0395905_1357009 | 3300037471 | Unclassified | 615 |
| 619 | Ga0395905_1407633 | 3300037471 | Unclassified | 601 |
| 620 | Ga0395905_1668681 | 3300037471 | Unclassified | 542 |
| 621 | Ga0395901_0000365 | 3300038443 | Bacteria | 54535 |
| 622 | Ga0395901_0000733 | 3300038443 | Bacteria | 37083 |
| 623 | Ga0395901_0002616 | 3300038443 | Bacteria | 18216 |
| 624 | Ga0395901_0006872 | 3300038443 | Bacteria | 11494 |
| 625 | Ga0395901_0008831 | 3300038443 | Bacteria | 10201 |
| 626 | Ga0395901_0036919 | 3300038443 | Bacteria | 5052 |
| 627 | Ga0395901_0042881 | 3300038443 | Bacteria | 4692 |
| 628 | Ga0395901_0058533 | 3300038443 | Bacteria | 4007 |
| 629 | Ga0395901_0058930 | 3300038443 | Bacteria | 3994 |
| 630 | Ga0395901_0065057 | 3300038443 | Bacteria | 3796 |
| 631 | Ga0395901_0079355 | 3300038443 | Bacteria | 3427 |
| 632 | Ga0395901_0096099 | 3300038443 | Bacteria | 3105 |
| 633 | Ga0395901_0129195 | 3300038443 | Bacteria | 2655 |
| 634 | Ga0395901_0187425 | 3300038443 | Bacteria | 2170 |
| 635 | Ga0395901_0255021 | 3300038443 | Unclassified | 1827 |
| 636 | Ga0395901_0353599 | 3300038443 | Archaea | 1516 |
| 637 | Ga0395901_0385807 | 3300038443 | Bacteria | 1441 |
| 638 | Ga0395901_0507213 | 3300038443 | Bacteria | 1227 |
| 639 | Ga0395901_0519163 | 3300038443 | Bacteria | 1210 |
| 640 | Ga0395901_0673091 | 3300038443 | Archaea | 1035 |
| 641 | Ga0395901_0786208 | 3300038443 | Bacteria | 942 |
| 642 | Ga0395901_1151156 | 3300038443 | Bacteria | 744 |
| 643 | Ga0395901_1684364 | 3300038443 | Unclassified | 586 |
| 644 | Ga0242420_032685 | 3300038996 | Bacteria | 970 |
| 645 | Ga0242420_109294 | 3300038996 | Bacteria | 594 |
| 646 | Ga0436362_0464294 | 3300039453 | Bacteria | 1980 |
| 647 | Ga0451787_344860 | 3300041441 | Unclassified | 675 |
| 648 | Ga0451789_0290400 | 3300041443 | Bacteria | 811 |
| 649 | Ga0451793_0231132 | 3300041452 | Bacteria | 607 |
| 650 | Ga0451802_1319019 | 3300041460 | Unclassified | 557 |
| 651 | Ga0451802_2160690 | 3300041460 | Bacteria | 768 |
| 652 | Ga0451841_0813533 | 3300041498 | Bacteria | 621 |
| 653 | Ga0451849_1578475 | 3300041505 | Unclassified | 575 |
| 654 | Ga0451853_0299360 | 3300041512 | Bacteria | 570 |
| 655 | Ga0451853_2286262 | 3300041512 | Bacteria | 622 |
| 656 | Ga0439460_0366864 | 3300042461 | Bacteria | 509 |
| 657 | Ga0466964_0471831 | 3300044706 | Unclassified | 669 |
| 658 | Ga0466968_0322805 | 3300044735 | Bacteria | 746 |
| 659 | Ga0466960_0181431 | 3300044901 | Bacteria | 1141 |
| 660 | Ga0466967_0198264 | 3300045976 | Bacteria | 1900 |
| 661 | Ga0495592_0628131 | 3300046454 | Unclassified | 653 |
| 662 | Ga0495603_0006924 | 3300046455 | Bacteria | 6802 |
| 663 | Ga0495603_0044418 | 3300046455 | Bacteria | 2652 |
| 664 | Ga0495629_0076795 | 3300046459 | Bacteria | 2332 |
| 665 | Ga0495582_0010101 | 3300046473 | Bacteria | 5199 |
| 666 | Ga0495582_0320164 | 3300046473 | Bacteria | 892 |
| 667 | Ga0495582_0905186 | 3300046473 | Unclassified | 510 |
| 668 | Ga0495605_0205845 | 3300046474 | Unclassified | 856 |
| 669 | Ga0495605_0351393 | 3300046474 | Bacteria | 618 |
| 670 | Ga0495605_0439002 | 3300046474 | Bacteria | 539 |
| 671 | Ga0495664_0455603 | 3300046477 | Unclassified | 766 |
| 672 | Ga0495664_0525857 | 3300046477 | Bacteria | 706 |
| 673 | Ga0495584_0010520 | 3300046491 | Bacteria | 4752 |
| 674 | Ga0495584_0079643 | 3300046491 | Bacteria | 1648 |
| 675 | Ga0495584_0158833 | 3300046491 | Bacteria | 1149 |
| 676 | Ga0495584_0360143 | 3300046491 | Bacteria | 739 |
| 677 | Ga0495584_0415673 | 3300046491 | Unclassified | 684 |
| 678 | Ga0495585_0175909 | 3300046492 | Bacteria | 1103 |
| 679 | Ga0495585_0227308 | 3300046492 | Bacteria | 939 |
| 680 | Ga0495585_0230594 | 3300046492 | Bacteria | 931 |
| 681 | Ga0495596_0088582 | 3300046500 | Bacteria | 1201 |
| 682 | Ga0495607_0137220 | 3300046501 | Bacteria | 1266 |
| 683 | Ga0495616_0280941 | 3300046513 | Bacteria | 708 |
| 684 | Ga0495620_0187768 | 3300046515 | Bacteria | 798 |
| 685 | Ga0495628_0514476 | 3300046516 | Bacteria | 863 |
| 686 | Ga0495628_0535041 | 3300046516 | Bacteria | 843 |
| 687 | Ga0495628_1260081 | 3300046516 | Bacteria | 500 |
| 688 | Ga0495630_0064570 | 3300046517 | Bacteria | 2751 |
| 689 | Ga0495631_0492997 | 3300046518 | Bacteria | 522 |
| 690 | Ga0495644_0135293 | 3300046523 | Bacteria | 940 |
| 691 | Ga0495644_0176109 | 3300046523 | Unclassified | 822 |
| 692 | Ga0495663_0011178 | 3300046525 | Unclassified | 2498 |
| 693 | Ga0495642_0124065 | 3300046528 | Bacteria | 1109 |
| 694 | Ga0495642_0140690 | 3300046528 | Bacteria | 1042 |
| 695 | Ga0495642_0176899 | 3300046528 | Unclassified | 928 |
| 696 | Ga0495665_0307697 | 3300046531 | Bacteria | 810 |
| 697 | Ga0495640_0858987 | 3300046533 | Unclassified | 539 |
| 698 | Ga0495586_0619210 | 3300046535 | Unclassified | 625 |
| 699 | Ga0495598_0244365 | 3300046537 | Unclassified | 663 |
| 700 | Ga0495609_0215286 | 3300046538 | Unclassified | 799 |
| 701 | Ga0495609_0275249 | 3300046538 | Unclassified | 689 |
| 702 | Ga0495609_0358146 | 3300046538 | Bacteria | 588 |
| 703 | Ga0495621_0178945 | 3300046539 | Bacteria | 846 |
| 704 | Ga0495667_0090543 | 3300046559 | Bacteria | 1982 |
| 705 | Ga0495656_0112466 | 3300046615 | Unclassified | 1276 |
| 706 | Ga0495656_0135648 | 3300046615 | Bacteria | 1175 |
| 707 | Ga0495656_0471304 | 3300046615 | Bacteria | 663 |
| 708 | Ga0495656_0725864 | 3300046615 | Unclassified | 535 |
| 709 | Ga0495668_0117623 | 3300046616 | Bacteria | 1454 |
| 710 | Ga0495668_0615082 | 3300046616 | Unclassified | 600 |
| 711 | Ga0495611_0054373 | 3300046648 | Bacteria | 1810 |
| 712 | Ga0495659_0134886 | 3300046664 | Bacteria | 981 |
| 713 | Ga0495659_0187982 | 3300046664 | Unclassified | 843 |
| 714 | Ga0495661_0230215 | 3300046665 | Bacteria | 956 |
| 715 | Ga0495588_0096038 | 3300046674 | Unclassified | 1554 |
| 716 | Ga0495588_0640988 | 3300046674 | Bacteria | 556 |
| 717 | Ga0495657_0139204 | 3300046675 | Bacteria | 1514 |
| 718 | Ga0495599_0487071 | 3300046678 | Bacteria | 727 |
| 719 | Ga0495599_0816078 | 3300046678 | Bacteria | 532 |
| 720 | Ga0495623_0045784 | 3300046679 | Plasmid | 2778 |
| 721 | Ga0495658_0158978 | 3300046683 | Bacteria | 1392 |
| 722 | Ga0495658_0268439 | 3300046683 | Bacteria | 1075 |
| 723 | Ga0495669_0138377 | 3300046684 | Bacteria | 1149 |
| 724 | Ga0495613_1103274 | 3300046689 | Bacteria | 506 |
| 725 | Ga0495624_0086679 | 3300046690 | Bacteria | 1934 |
| 726 | Ga0495624_0735291 | 3300046690 | Bacteria | 585 |
| 727 | Ga0495624_0761507 | 3300046690 | Bacteria | 573 |
| 728 | Ga0495670_0127320 | 3300046691 | Unclassified | 1326 |
| 729 | Ga0495671_0583572 | 3300046692 | Unclassified | 532 |
| 730 | Ga0495649_0375489 | 3300046694 | Bacteria | 716 |
| 731 | Ga0495589_0110939 | 3300046794 | Bacteria | 1324 |
| 732 | Ga0495589_0141693 | 3300046794 | Unclassified | 1151 |
| 733 | Ga0495589_0314837 | 3300046794 | Bacteria | 724 |
| 734 | Ga0495589_0470033 | 3300046794 | Unclassified | 575 |
| 735 | Ga0495600_0559744 | 3300046809 | Unclassified | 698 |
| 736 | Ga0495660_0193787 | 3300046810 | Unclassified | 975 |
| 737 | Ga0495581_0011147 | 3300047315 | Bacteria | 5194 |
| 738 | Ga0495581_0351626 | 3300047315 | Bacteria | 860 |
| 739 | Ga0495604_0576136 | 3300047317 | Bacteria | 724 |
| 740 | Ga0495674_0390964 | 3300047319 | Bacteria | 1124 |
| 741 | Ga0495674_0564872 | 3300047319 | Unclassified | 904 |
| 742 | Ga0495674_0688361 | 3300047319 | Bacteria | 803 |
| 743 | Ga0495674_1478701 | 3300047319 | Unclassified | 504 |
| 744 | Ga0495676_0022756 | 3300047321 | Bacteria | 5448 |
| 745 | Ga0495676_0718188 | 3300047321 | Unclassified | 646 |
| 746 | Ga0495680_0703744 | 3300047322 | Bacteria | 667 |
| 747 | Ga0495683_0297768 | 3300047323 | Unclassified | 694 |
| 748 | Ga0495677_0051254 | 3300047445 | Bacteria | 1520 |
| 749 | Ga0495685_149552 | 3300047447 | Bacteria | 759 |
| 750 | Ga0495685_165957 | 3300047447 | Bacteria | 714 |
| 751 | Ga0495684_0692846 | 3300047471 | Bacteria | 677 |
| 752 | Ga0495602_0014286 | 3300048088 | Bacteria | 8066 |
| 753 | Ga0495602_1033497 | 3300048088 | Unclassified | 541 |
| 754 | Ga0495615_0288854 | 3300048090 | Unclassified | 529 |
| 755 | Ga0496100_0000160 | 3300048903 | Bacteria | 37151 |
| 756 | Ga0496100_0098791 | 3300048903 | Unclassified | 2007 |
| 757 | Ga0496100_0145724 | 3300048903 | Bacteria | 1684 |
| 758 | Ga0496100_0153968 | 3300048903 | Bacteria | 1642 |
| 759 | Ga0496100_0421503 | 3300048903 | Bacteria | 1019 |
| 760 | Ga0496100_0532293 | 3300048903 | Unclassified | 908 |
| 761 | Ga0496100_0861372 | 3300048903 | Unclassified | 711 |
| 762 | Ga0496101_0042059 | 3300048904 | Bacteria | 3261 |
| 763 | Ga0496101_0062776 | 3300048904 | Bacteria | 2702 |
| 764 | Ga0496101_0235876 | 3300048904 | Bacteria | 1423 |
| 765 | Ga0496101_0502133 | 3300048904 | Unclassified | 958 |
| 766 | Ga0496101_0553002 | 3300048904 | Unclassified | 910 |
| 767 | Ga0496101_0599768 | 3300048904 | Unclassified | 871 |
| 768 | Ga0496101_1552032 | 3300048904 | Unclassified | 515 |
| 769 | Ga0496102_0060285 | 3300048905 | Bacteria | 3471 |
| 770 | Ga0496102_0079208 | 3300048905 | Bacteria | 3026 |
| 771 | Ga0496102_0243704 | 3300048905 | Unclassified | 1695 |
| 772 | Ga0496102_0403143 | 3300048905 | Bacteria | 1286 |
| 773 | Ga0496102_0622550 | 3300048905 | Bacteria | 1002 |
| 774 | Ga0496102_0668385 | 3300048905 | Bacteria | 962 |
| 775 | Ga0496102_1107886 | 3300048905 | Bacteria | 711 |
| 776 | Ga0496102_1837282 | 3300048905 | Bacteria | 523 |
| 777 | Ga0496103_0011370 | 3300048906 | Bacteria | 5272 |
| 778 | Ga0496103_0166424 | 3300048906 | Bacteria | 1414 |
| 779 | Ga0496103_0329040 | 3300048906 | Unclassified | 983 |
| 780 | Ga0496103_0340212 | 3300048906 | Unclassified | 965 |
| 781 | Ga0496103_0742264 | 3300048906 | Unclassified | 621 |
| 782 | Ga0496104_0019682 | 3300048907 | Bacteria | 6181 |
| 783 | Ga0496104_0053765 | 3300048907 | Bacteria | 3806 |
| 784 | Ga0496104_0095470 | 3300048907 | Bacteria | 2844 |
| 785 | Ga0496104_0223839 | 3300048907 | Unclassified | 1794 |
| 786 | Ga0496104_0289082 | 3300048907 | Bacteria | 1551 |
| 787 | Ga0496104_1475110 | 3300048907 | Bacteria | 583 |
| 788 | Ga0496105_0015245 | 3300048908 | Bacteria | 6122 |
| 789 | Ga0496105_0059466 | 3300048908 | Unclassified | 3153 |
| 790 | Ga0496105_0109557 | 3300048908 | Bacteria | 2280 |
| 791 | Ga0496105_0112921 | 3300048908 | Bacteria | 2242 |
| 792 | Ga0496105_0171800 | 3300048908 | Bacteria | 1777 |
| 793 | Ga0496105_0288678 | 3300048908 | Unclassified | 1321 |
| 794 | Ga0496105_0309367 | 3300048908 | Bacteria | 1269 |
| 795 | Ga0496105_0332615 | 3300048908 | Unclassified | 1216 |
| 796 | Ga0496105_0729513 | 3300048908 | Unclassified | 758 |
| 797 | Ga0496106_0060225 | 3300048909 | Bacteria | 2877 |
| 798 | Ga0496106_0073098 | 3300048909 | Bacteria | 2622 |
| 799 | Ga0496106_0243252 | 3300048909 | Unclassified | 1438 |
| 800 | Ga0496106_0387423 | 3300048909 | Bacteria | 1123 |
| 801 | Ga0496106_0975736 | 3300048909 | Bacteria | 667 |
| 802 | Ga0496107_0022492 | 3300048910 | Bacteria | 4455 |
| 803 | Ga0496107_0171803 | 3300048910 | Bacteria | 1609 |
| 804 | Ga0496107_0230240 | 3300048910 | Bacteria | 1379 |
| 805 | Ga0496107_0237460 | 3300048910 | Bacteria | 1356 |
| 806 | Ga0496107_0352326 | 3300048910 | Unclassified | 1095 |
| 807 | Ga0496107_0381662 | 3300048910 | Bacteria | 1048 |
| 808 | Ga0496107_0393204 | 3300048910 | Unclassified | 1031 |
| 809 | Ga0496107_0534137 | 3300048910 | Bacteria | 869 |
| 810 | Ga0496107_0751248 | 3300048910 | Bacteria | 716 |
| 811 | Ga0496107_1124130 | 3300048910 | Bacteria | 567 |
| 812 | Ga0496108_0018657 | 3300048911 | Bacteria | 5683 |
| 813 | Ga0496108_0055611 | 3300048911 | Bacteria | 3323 |
| 814 | Ga0496108_0059331 | 3300048911 | Bacteria | 3217 |
| 815 | Ga0496108_0400372 | 3300048911 | Unclassified | 1199 |
| 816 | Ga0496108_0494554 | 3300048911 | Bacteria | 1068 |
| 817 | Ga0496108_0697428 | 3300048911 | Bacteria | 880 |
| 818 | Ga0496108_1125761 | 3300048911 | Bacteria | 666 |
| 819 | Ga0496109_0005317 | 3300048912 | Bacteria | 10762 |
| 820 | Ga0496109_0006589 | 3300048912 | Bacteria | 9777 |
| 821 | Ga0496109_0019302 | 3300048912 | Bacteria | 6007 |
| 822 | Ga0496109_0021346 | 3300048912 | Bacteria | 5725 |
| 823 | Ga0496109_0102063 | 3300048912 | Bacteria | 2662 |
| 824 | Ga0496109_0139389 | 3300048912 | Bacteria | 2267 |
| 825 | Ga0496109_0146476 | 3300048912 | Bacteria | 2210 |
| 826 | Ga0496109_0211663 | 3300048912 | Unclassified | 1823 |
| 827 | Ga0496109_0297818 | 3300048912 | Bacteria | 1521 |
| 828 | Ga0496109_0368273 | 3300048912 | Bacteria | 1357 |
| 829 | Ga0496109_0442270 | 3300048912 | Bacteria | 1228 |
| 830 | Ga0496109_0549210 | 3300048912 | Unclassified | 1090 |
| 831 | Ga0496109_0951663 | 3300048912 | Bacteria | 797 |
| 832 | Ga0496110_0064072 | 3300048913 | Bacteria | 3248 |
| 833 | Ga0496110_0076941 | 3300048913 | Bacteria | 2967 |
| 834 | Ga0496110_0127898 | 3300048913 | Bacteria | 2293 |
| 835 | Ga0496110_0140161 | 3300048913 | Bacteria | 2186 |
| 836 | Ga0496110_0526254 | 3300048913 | Unclassified | 1075 |
| 837 | Ga0496110_0633411 | 3300048913 | Bacteria | 968 |
| 838 | Ga0496110_0738515 | 3300048913 | Bacteria | 887 |
| 839 | Ga0496110_0818995 | 3300048913 | Bacteria | 836 |
| 840 | Ga0496110_1001407 | 3300048913 | Bacteria | 743 |
| 841 | Ga0496111_0001245 | 3300048914 | Bacteria | 14253 |
| 842 | Ga0496111_0019004 | 3300048914 | Bacteria | 4765 |
| 843 | Ga0496111_0059104 | 3300048914 | Bacteria | 2777 |
| 844 | Ga0496111_0140117 | 3300048914 | Bacteria | 1792 |
| 845 | Ga0496111_0174875 | 3300048914 | Unclassified | 1596 |
| 846 | Ga0496111_0198803 | 3300048914 | Bacteria | 1490 |
| 847 | Ga0496111_0531987 | 3300048914 | Unclassified | 864 |
| 848 | Ga0496111_0728763 | 3300048914 | Unclassified | 720 |
| 849 | Ga0496111_0919263 | 3300048914 | Bacteria | 629 |
| 850 | Ga0496111_1077771 | 3300048914 | Unclassified | 573 |
| 851 | Ga0496111_1193673 | 3300048914 | Unclassified | 539 |
| 852 | Ga0496112_0000125 | 3300048915 | Bacteria | 47606 |
| 853 | Ga0496112_0004570 | 3300048915 | Bacteria | 11759 |
| 854 | Ga0496112_0067916 | 3300048915 | Bacteria | 3520 |
| 855 | Ga0496112_0103688 | 3300048915 | Bacteria | 2814 |
| 856 | Ga0496112_0133753 | 3300048915 | Bacteria | 2450 |
| 857 | Ga0496112_0142160 | 3300048915 | Bacteria | 2369 |
| 858 | Ga0496112_0203903 | 3300048915 | Bacteria | 1936 |
| 859 | Ga0496112_0532932 | 3300048915 | Bacteria | 1108 |
| 860 | Ga0496112_0556332 | 3300048915 | Unclassified | 1081 |
| 861 | Ga0496112_1229362 | 3300048915 | Unclassified | 666 |
| 862 | Ga0496112_1823612 | 3300048915 | Bacteria | 520 |
| 863 | Ga0496113_0004202 | 3300048916 | Bacteria | 8802 |
| 864 | Ga0496113_0010188 | 3300048916 | Bacteria | 6205 |
| 865 | Ga0496113_0051293 | 3300048916 | Bacteria | 3079 |
| 866 | Ga0496113_0054226 | 3300048916 | Bacteria | 3000 |
| 867 | Ga0496113_0079294 | 3300048916 | Bacteria | 2513 |
| 868 | Ga0496113_0149116 | 3300048916 | Bacteria | 1844 |
| 869 | Ga0496113_0369802 | 3300048916 | Unclassified | 1151 |
| 870 | Ga0496113_0576322 | 3300048916 | Bacteria | 902 |
| 871 | Ga0496113_0901771 | 3300048916 | Unclassified | 699 |
| 872 | Ga0496114_0004595 | 3300048917 | Bacteria | 10722 |
| 873 | Ga0496114_0085207 | 3300048917 | Bacteria | 2676 |
| 874 | Ga0496114_0308611 | 3300048917 | Bacteria | 1397 |
| 875 | Ga0496114_0325633 | 3300048917 | Bacteria | 1358 |
| 876 | Ga0496114_0352959 | 3300048917 | Bacteria | 1301 |
| 877 | Ga0496114_0430931 | 3300048917 | Unclassified | 1168 |
| 878 | Ga0496114_0635371 | 3300048917 | Unclassified | 940 |
| 879 | Ga0496114_0798700 | 3300048917 | Unclassified | 822 |
| 880 | Ga0496115_0000719 | 3300048918 | Bacteria | 24524 |
| 881 | Ga0496115_0011137 | 3300048918 | Bacteria | 6739 |
| 882 | Ga0496115_0017246 | 3300048918 | Bacteria | 5514 |
| 883 | Ga0496115_0397844 | 3300048918 | Bacteria | 1118 |
| 884 | Ga0496115_0771008 | 3300048918 | Bacteria | 751 |
| 885 | Ga0501031_0098812 | 3300049568 | Bacteria | 1905 |
| 886 | Ga0501036_0801312 | 3300049572 | Unclassified | 776 |
| 887 | Ga0501040_0336033 | 3300049576 | Bacteria | 1081 |
| 888 | Ga0501041_0297965 | 3300049577 | Bacteria | 1016 |
| 889 | Ga0501046_0119258 | 3300049580 | Bacteria | 2009 |
| 890 | Ga0501067_0315177 | 3300049583 | Bacteria | 871 |
| 891 | Ga0501070_1477973 | 3300049586 | Unclassified | 515 |
| 892 | Ga0501071_0228115 | 3300049587 | Bacteria | 1403 |
| 893 | Ga0501071_0229855 | 3300049587 | Bacteria | 1397 |
| 894 | Ga0501072_0312901 | 3300049588 | Bacteria | 1248 |
| 895 | Ga0501074_0111653 | 3300049590 | Bacteria | 1956 |
| 896 | Ga0501074_0811417 | 3300049590 | Unclassified | 659 |
| 897 | Ga0501075_0355166 | 3300049591 | Bacteria | 1117 |
| 898 | Ga0501075_0426735 | 3300049591 | Bacteria | 1011 |
| 899 | Ga0501075_0708487 | 3300049591 | Bacteria | 767 |
| 900 | Ga0501076_0204927 | 3300049592 | Bacteria | 1611 |
| 901 | Ga0501076_0308750 | 3300049592 | Bacteria | 1297 |
| 902 | Ga0501076_0334975 | 3300049592 | Bacteria | 1242 |
| 903 | Ga0501077_0014651 | 3300049593 | Bacteria | 4928 |
| 904 | Ga0501209_182944 | 3300049656 | Unclassified | 640 |
| 905 | Ga0501079_0523606 | 3300049741 | Unclassified | 932 |
| 906 | Ga0501079_0557632 | 3300049741 | Bacteria | 901 |
| 907 | Ga0501079_0583770 | 3300049741 | Unclassified | 879 |
| 908 | Ga0501080_0834098 | 3300049742 | Unclassified | 807 |
| 909 | Ga0501081_0370331 | 3300049743 | Bacteria | 1058 |
| 910 | Ga0501081_0461031 | 3300049743 | Bacteria | 945 |
| 911 | nmdc:mga06z11_207454_c1 | 3300050494 | Bacteria | 1140 |
| 912 | nmdc:mga05p37_126299_c1 | 3300050507 | Bacteria | 3141 |
| 913 | nmdc:mga05p37_152131_c1 | 3300050507 | Bacteria | 2829 |
| 914 | nmdc:mga05p37_1770313_c1 | 3300050507 | Bacteria | 598 |
| 915 | nmdc:mga05p37_296926_c1 | 3300050507 | Unclassified | 1921 |
| 916 | nmdc:mga05p37_29893_c1 | 3300050507 | Bacteria | 6649 |
| 917 | nmdc:mga05p37_317867_c1 | 3300050507 | Bacteria | 1844 |
| 918 | nmdc:mga05p37_47248_c1 | 3300050507 | Bacteria | 5294 |
| 919 | nmdc:mga09592_1445061_c1 | 3300050508 | Unclassified | 561 |
| 920 | nmdc:mga09592_197574_c1 | 3300050508 | Unclassified | 1741 |
| 921 | nmdc:mga0qj67_353467_c1 | 3300050509 | Bacteria | 1188 |
| 922 | nmdc:mga06r32_270595_c1 | 3300050510 | Bacteria | 1686 |
| 923 | nmdc:mga06r32_444607_c1 | 3300050510 | Unclassified | 1276 |
| 924 | nmdc:mga06r32_486579_c1 | 3300050510 | Bacteria | 1212 |
| 925 | nmdc:mga06r32_626955_c1 | 3300050510 | Bacteria | 1045 |
| 926 | nmdc:mga08y16_207947_c1 | 3300050511 | Bacteria | 2027 |
| 927 | nmdc:mga08y16_27156_c1 | 3300050511 | Bacteria | 6032 |
| 928 | nmdc:mga08y16_33123_c1 | 3300050511 | Bacteria | 5427 |
| 929 | nmdc:mga08y16_448142_c1 | 3300050511 | Unclassified | 1316 |
| 930 | nmdc:mga08y16_601066_c1 | 3300050511 | Bacteria | 1109 |
| 931 | nmdc:mga08y16_86123_c1 | 3300050511 | Bacteria | 3275 |
| 932 | nmdc:mga0n895_112477_c1 | 3300050512 | Bacteria | 2740 |
| 933 | nmdc:mga0n895_138768_c1 | 3300050512 | Bacteria | 2459 |
| 934 | nmdc:mga0n895_1631416_c1 | 3300050512 | Bacteria | 609 |
| 935 | nmdc:mga0n895_2036586_c1 | 3300050512 | Unclassified | 531 |
| 936 | nmdc:mga0n895_31972_c1 | 3300050512 | Bacteria | 5046 |
| 937 | nmdc:mga0n895_367332_c1 | 3300050512 | Bacteria | 1457 |
| 938 | nmdc:mga0n895_67480_c1 | 3300050512 | Bacteria | 3542 |
| 939 | nmdc:mga0n895_951351_c1 | 3300050512 | Unclassified | 842 |
| 940 | nmdc:mga0rr50_1148081_c1 | 3300050513 | Unclassified | 660 |
| 941 | nmdc:mga0rr50_1169198_c1 | 3300050513 | Bacteria | 654 |
| 942 | nmdc:mga0rr50_1638232_c1 | 3300050513 | Unclassified | 543 |
| 943 | nmdc:mga0rr50_2948_c1 | 3300050513 | Bacteria | 9731 |
| 944 | nmdc:mga0rr50_322216_c1 | 3300050513 | Bacteria | 1296 |
| 945 | nmdc:mga0rr50_554494_c1 | 3300050513 | Bacteria | 979 |
| 946 | nmdc:mga0rr50_600007_c1 | 3300050513 | Bacteria | 939 |
| 947 | nmdc:mga0rr50_626028_c1 | 3300050513 | Bacteria | 918 |
| 948 | nmdc:mga08x19_2470_c1 | 3300050514 | Bacteria | 11248 |
| 949 | nmdc:mga08x19_26455_c1 | 3300050514 | Bacteria | 3621 |
| 950 | nmdc:mga08x19_281394_c1 | 3300050514 | Bacteria | 1153 |
| 951 | nmdc:mga08x19_535449_c1 | 3300050514 | Bacteria | 828 |
| 952 | nmdc:mga08x19_8074_c1 | 3300050514 | Bacteria | 6254 |
| 953 | nmdc:mga0a205_1203477_c1 | 3300050515 | Bacteria | 605 |
| 954 | nmdc:mga0a205_1445252_c1 | 3300050515 | Bacteria | 536 |
| 955 | nmdc:mga0a205_16811_c1 | 3300050515 | Bacteria | 6852 |
| 956 | nmdc:mga0a205_220469_c1 | 3300050515 | Bacteria | 1782 |
| 957 | nmdc:mga0a205_249276_c1 | 3300050515 | Bacteria | 1656 |
| 958 | nmdc:mga0a205_332113_c1 | 3300050515 | Bacteria | 1390 |
| 959 | nmdc:mga0a205_618737_c1 | 3300050515 | Bacteria | 935 |
| 960 | nmdc:mga0a205_675279_c1 | 3300050515 | Bacteria | 884 |
| 961 | nmdc:mga0a205_990416_c1 | 3300050515 | Unclassified | 688 |
| 962 | Ga0495601_0671546 | 3300053077 | Bacteria | 662 |
| 963 | Ga0495601_0713872 | 3300053077 | Bacteria | 639 |
| 964 | Ga0495612_0152474 | 3300053078 | Unclassified | 1006 |
| 965 | Ga0495612_0351837 | 3300053078 | Bacteria | 665 |
| 966 | Ga0495655_0162561 | 3300053083 | Unclassified | 709 |
| 967 | Ga0495595_0082358 | 3300053084 | Bacteria | 1535 |
| 968 | Ga0501084_0128769 | 3300054114 | Bacteria | 2131 |
| 969 | Ga0501084_0718648 | 3300054114 | Unclassified | 842 |
| 970 | Ga0587113_021899 | 3300059625 | Unclassified | 678 |
| 971 | Ga0587130_015021 | 3300059631 | Bacteria | 795 |
| 972 | Ga0501082_0141668 | 3300060353 | Bacteria | 2087 |
| 973 | Ga0501082_0388469 | 3300060353 | Bacteria | 1218 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10059350 | Ga0070710_100593502 | 90 |
| 2 | 3300009148 | Ga0105243_11205100 | Ga0105243_112051002 | 90 |
| 3 | 3300005355 | Ga0070671_101389008 | Ga0070671_1013890081 | 91 |
| 4 | 3300005366 | Ga0070659_101255173 | Ga0070659_1012551732 | 91 |
| 5 | 3300009177 | Ga0105248_12746152 | Ga0105248_127461522 | 91 |
| 6 | 3300025944 | Ga0207661_11242159 | Ga0207661_112421591 | 91 |
| 7 | 3300048915 | Ga0496112_1823612 | Ga0496112_1823612_78_353 | 91 |
| 8 | 3300038443 | Ga0395901_0255021 | Ga0395901_0255021_928_1251 | 93 |
| 9 | 3300037418 | Ga0395900_0307589 | Ga0395900_0307589_1212_1505 | 97 |
| 10 | 3300037466 | Ga0395898_1458832 | Ga0395898_1458832_111_404 | 97 |
| 11 | 3300037471 | Ga0395905_0999808 | Ga0395905_0999808_250_543 | 97 |
| 12 | 3300005536 | Ga0070697_100035973 | Ga0070697_1000359732 | 98 |
| 13 | 3300049656 | Ga0501209_182944 | Ga0501209_182944_92_418 | 98 |
| 14 | 3300007788 | Ga0099795_10359624 | Ga0099795_103596241 | 99 |
| 15 | 3300005985 | Ga0081539_10058993 | Ga0081539_100589931 | 100 |
| 16 | 3300005471 | Ga0070698_100230235 | Ga0070698_1002302352 | 101 |
| 17 | 3300025922 | Ga0207646_10010563 | Ga0207646_100105632 | 101 |
| 18 | 3300048911 | Ga0496108_0400372 | Ga0496108_0400372_773_1078 | 101 |
| 19 | 3300005329 | Ga0070683_100090739 | Ga0070683_1000907394 | 102 |
| 20 | 3300005467 | Ga0070706_101676874 | Ga0070706_1016768741 | 102 |
| 21 | 3300005544 | Ga0070686_101388161 | Ga0070686_1013881612 | 102 |
| 22 | 3300005563 | Ga0068855_100093499 | Ga0068855_1000934995 | 102 |
| 23 | 3300005614 | Ga0068856_100585088 | Ga0068856_1005850882 | 102 |
| 24 | 3300005981 | Ga0081538_10062276 | Ga0081538_100622762 | 102 |
| 25 | 3300009093 | Ga0105240_11158809 | Ga0105240_111588092 | 102 |
| 26 | 3300020610 | Ga0154015_1659241 | Ga0154015_16592411 | 102 |
| 27 | 3300025913 | Ga0207695_10817634 | Ga0207695_108176342 | 102 |
| 28 | 3300025949 | Ga0207667_10321160 | Ga0207667_103211603 | 102 |
| 29 | 3300026078 | Ga0207702_10286402 | Ga0207702_102864024 | 102 |
| 30 | 3300031241 | Ga0265325_10020382 | Ga0265325_100203822 | 102 |
| 31 | 3300031595 | Ga0265313_10112784 | Ga0265313_101127842 | 102 |
| 32 | 3300048903 | Ga0496100_0000160 | Ga0496100_0000160_14541_14852 | 102 |
| 33 | 3300048912 | Ga0496109_0005317 | Ga0496109_0005317_4458_4769 | 102 |
| 34 | 3300049591 | Ga0501075_0426735 | Ga0501075_0426735_565_873 | 102 |
| 35 | 3300049592 | Ga0501076_0204927 | Ga0501076_0204927_40_348 | 102 |
| 36 | 3300049741 | Ga0501079_0583770 | Ga0501079_0583770_547_855 | 102 |
| 37 | 3300054114 | Ga0501084_0718648 | Ga0501084_0718648_489_797 | 102 |
| 38 | 3300005333 | Ga0070677_10282291 | Ga0070677_102822912 | 103 |
| 39 | 3300005336 | Ga0070680_100676325 | Ga0070680_1006763252 | 103 |
| 40 | 3300005337 | Ga0070682_101354596 | Ga0070682_1013545961 | 103 |
| 41 | 3300005355 | Ga0070671_100226357 | Ga0070671_1002263571 | 103 |
| 42 | 3300005364 | Ga0070673_100540241 | Ga0070673_1005402412 | 103 |
| 43 | 3300005406 | Ga0070703_10012614 | Ga0070703_100126142 | 103 |
| 44 | 3300005436 | Ga0070713_100198314 | Ga0070713_1001983142 | 103 |
| 45 | 3300005437 | Ga0070710_10015608 | Ga0070710_100156082 | 103 |
| 46 | 3300005439 | Ga0070711_100105853 | Ga0070711_1001058532 | 103 |
| 47 | 3300005440 | Ga0070705_100055860 | Ga0070705_1000558604 | 103 |
| 48 | 3300005456 | Ga0070678_100027265 | Ga0070678_1000272655 | 103 |
| 49 | 3300005545 | Ga0070695_101427571 | Ga0070695_1014275711 | 103 |
| 50 | 3300005546 | Ga0070696_100012929 | Ga0070696_1000129296 | 103 |
| 51 | 3300005549 | Ga0070704_101055689 | Ga0070704_1010556892 | 103 |
| 52 | 3300005844 | Ga0068862_101660491 | Ga0068862_1016604911 | 103 |
| 53 | 3300006163 | Ga0070715_10206287 | Ga0070715_102062872 | 103 |
| 54 | 3300006175 | Ga0070712_100045974 | Ga0070712_1000459743 | 103 |
| 55 | 3300006237 | Ga0097621_100194138 | Ga0097621_1001941382 | 103 |
| 56 | 3300006358 | Ga0068871_100868497 | Ga0068871_1008684971 | 103 |
| 57 | 3300006852 | Ga0075433_10044990 | Ga0075433_100449905 | 103 |
| 58 | 3300006914 | Ga0075436_100038877 | Ga0075436_1000388774 | 103 |
| 59 | 3300009147 | Ga0114129_10097803 | Ga0114129_100978032 | 103 |
| 60 | 3300009148 | Ga0105243_10016878 | Ga0105243_100168788 | 103 |
| 61 | 3300009174 | Ga0105241_11772752 | Ga0105241_117727522 | 103 |
| 62 | 3300009176 | Ga0105242_10205333 | Ga0105242_102053332 | 103 |
| 63 | 3300010375 | Ga0105239_10493160 | Ga0105239_104931602 | 103 |
| 64 | 3300013297 | Ga0157378_10693939 | Ga0157378_106939392 | 103 |
| 65 | 3300013308 | Ga0157375_10105603 | Ga0157375_101056034 | 103 |
| 66 | 3300014969 | Ga0157376_10410401 | Ga0157376_104104012 | 103 |
| 67 | 3300025885 | Ga0207653_10005114 | Ga0207653_100051144 | 103 |
| 68 | 3300025898 | Ga0207692_10157458 | Ga0207692_101574581 | 103 |
| 69 | 3300025906 | Ga0207699_10090402 | Ga0207699_100904022 | 103 |
| 70 | 3300025910 | Ga0207684_10577071 | Ga0207684_105770711 | 103 |
| 71 | 3300025915 | Ga0207693_10001413 | Ga0207693_1000141328 | 103 |
| 72 | 3300025916 | Ga0207663_10546255 | Ga0207663_105462551 | 103 |
| 73 | 3300025931 | Ga0207644_10859075 | Ga0207644_108590752 | 103 |
| 74 | 3300025934 | Ga0207686_10724462 | Ga0207686_107244621 | 103 |
| 75 | 3300025939 | Ga0207665_10137581 | Ga0207665_101375813 | 103 |
| 76 | 3300026121 | Ga0207683_10141485 | Ga0207683_101414852 | 103 |
| 77 | 3300034816 | Ga0373930_0022749 | Ga0373930_0022749_662_973 | 103 |
| 78 | 3300034817 | Ga0373948_0139211 | Ga0373948_0139211_249_560 | 103 |
| 79 | 3300034818 | Ga0373950_0052684 | Ga0373950_0052684_239_550 | 103 |
| 80 | 3300034820 | Ga0373959_0003544 | Ga0373959_0003544_536_847 | 103 |
| 81 | 3300034957 | Ga0373938_0024714 | Ga0373938_0024714_386_697 | 103 |
| 82 | 3300035084 | Ga0373928_0006763 | Ga0373928_0006763_138_449 | 103 |
| 83 | 3300035085 | Ga0373929_0048132 | Ga0373929_0048132_602_913 | 103 |
| 84 | 3300035088 | Ga0373940_0128863 | Ga0373940_0128863_442_753 | 103 |
| 85 | 3300035090 | Ga0373949_0011808 | Ga0373949_0011808_97_408 | 103 |
| 86 | 3300035091 | Ga0373951_0005669 | Ga0373951_0005669_1034_1345 | 103 |
| 87 | 3300035092 | Ga0373952_0024073 | Ga0373952_0024073_237_548 | 103 |
| 88 | 3300035112 | Ga0373932_0016907 | Ga0373932_0016907_1205_1516 | 103 |
| 89 | 3300035114 | Ga0373939_0014328 | Ga0373939_0014328_292_603 | 103 |
| 90 | 3300035121 | Ga0373960_0004406 | Ga0373960_0004406_1392_1703 | 103 |
| 91 | 3300035207 | Ga0373942_0002766 | Ga0373942_0002766_404_715 | 103 |
| 92 | 3300035241 | Ga0373961_0004810 | Ga0373961_0004810_145_456 | 103 |
| 93 | 3300035242 | Ga0373962_0004999 | Ga0373962_0004999_18_329 | 103 |
| 94 | 3300035691 | Ga0373931_0010433 | Ga0373931_0010433_1388_1699 | 103 |
| 95 | 3300037418 | Ga0395900_0137616 | Ga0395900_0137616_1816_2127 | 103 |
| 96 | 3300037466 | Ga0395898_0004222 | Ga0395898_0004222_12953_13264 | 103 |
| 97 | 3300038443 | Ga0395901_0036919 | Ga0395901_0036919_2156_2467 | 103 |
| 98 | 3300048903 | Ga0496100_0153968 | Ga0496100_0153968_122_433 | 103 |
| 99 | 3300048904 | Ga0496101_0042059 | Ga0496101_0042059_1252_1563 | 103 |
| 100 | 3300048905 | Ga0496102_1107886 | Ga0496102_1107886_209_520 | 103 |
| 101 | 3300048906 | Ga0496103_0011370 | Ga0496103_0011370_3290_3601 | 103 |
| 102 | 3300048907 | Ga0496104_0289082 | Ga0496104_0289082_12_323 | 103 |
| 103 | 3300048908 | Ga0496105_0112921 | Ga0496105_0112921_911_1222 | 103 |
| 104 | 3300048909 | Ga0496106_0073098 | Ga0496106_0073098_1007_1318 | 103 |
| 105 | 3300048910 | Ga0496107_0022492 | Ga0496107_0022492_3940_4251 | 103 |
| 106 | 3300048911 | Ga0496108_0055611 | Ga0496108_0055611_1699_2010 | 103 |
| 107 | 3300048912 | Ga0496109_0139389 | Ga0496109_0139389_869_1180 | 103 |
| 108 | 3300048913 | Ga0496110_0633411 | Ga0496110_0633411_38_349 | 103 |
| 109 | 3300048914 | Ga0496111_1193673 | Ga0496111_1193673_141_452 | 103 |
| 110 | 3300048915 | Ga0496112_0532932 | Ga0496112_0532932_464_775 | 103 |
| 111 | 3300048916 | Ga0496113_0079294 | Ga0496113_0079294_249_560 | 103 |
| 112 | 3300048917 | Ga0496114_0308611 | Ga0496114_0308611_239_550 | 103 |
| 113 | 3300048918 | Ga0496115_0011137 | Ga0496115_0011137_3161_3472 | 103 |
| 114 | 3300050507 | nmdc:mga05p37_29893_c1 | nmdc:mga05p37_29893_c1_3062_3373 | 103 |
| 115 | 3300050513 | nmdc:mga0rr50_554494_c1 | nmdc:mga0rr50_554494_c1_380_691 | 103 |
| 116 | 3300050514 | nmdc:mga08x19_281394_c1 | nmdc:mga08x19_281394_c1_557_868 | 103 |
| 117 | 3300050515 | nmdc:mga0a205_990416_c1 | nmdc:mga0a205_990416_c1_53_364 | 103 |
| 118 | 3300005445 | Ga0070708_100096950 | Ga0070708_1000969504 | 104 |
| 119 | 3300031911 | Ga0307412_10283823 | Ga0307412_102838233 | 104 |
| 120 | 3300031995 | Ga0307409_101047970 | Ga0307409_1010479702 | 104 |
| 121 | 3300032002 | Ga0307416_100113792 | Ga0307416_1001137923 | 104 |
| 122 | 3300032126 | Ga0307415_100026813 | Ga0307415_1000268132 | 104 |
| 123 | 3300038996 | Ga0242420_032685 | Ga0242420_032685_113_427 | 104 |
| 124 | 3300045976 | Ga0466967_0198264 | Ga0466967_0198264_245_559 | 104 |
| 125 | 3300046678 | Ga0495599_0816078 | Ga0495599_0816078_129_443 | 104 |
| 126 | 3300048912 | Ga0496109_0146476 | Ga0496109_0146476_119_433 | 104 |
| 127 | 3300048913 | Ga0496110_0738515 | Ga0496110_0738515_22_336 | 104 |
| 128 | 3300049583 | Ga0501067_0315177 | Ga0501067_0315177_515_838 | 104 |
| 129 | 3300005328 | Ga0070676_10822642 | Ga0070676_108226422 | 105 |
| 130 | 3300005329 | Ga0070683_100112705 | Ga0070683_1001127053 | 105 |
| 131 | 3300005334 | Ga0068869_100273229 | Ga0068869_1002732292 | 105 |
| 132 | 3300005338 | Ga0068868_100060548 | Ga0068868_1000605484 | 105 |
| 133 | 3300005339 | Ga0070660_100699058 | Ga0070660_1006990582 | 105 |
| 134 | 3300005340 | Ga0070689_101964780 | Ga0070689_1019647802 | 105 |
| 135 | 3300005341 | Ga0070691_10766322 | Ga0070691_107663222 | 105 |
| 136 | 3300005343 | Ga0070687_101280556 | Ga0070687_1012805562 | 105 |
| 137 | 3300005347 | Ga0070668_100276760 | Ga0070668_1002767602 | 105 |
| 138 | 3300005353 | Ga0070669_101660046 | Ga0070669_1016600462 | 105 |
| 139 | 3300005354 | Ga0070675_100078841 | Ga0070675_1000788414 | 105 |
| 140 | 3300005354 | Ga0070675_101293695 | Ga0070675_1012936952 | 105 |
| 141 | 3300005356 | Ga0070674_100007039 | Ga0070674_1000070395 | 105 |
| 142 | 3300005356 | Ga0070674_100981507 | Ga0070674_1009815071 | 105 |
| 143 | 3300005364 | Ga0070673_100106159 | Ga0070673_1001061593 | 105 |
| 144 | 3300005367 | Ga0070667_100204324 | Ga0070667_1002043243 | 105 |
| 145 | 3300005434 | Ga0070709_10078771 | Ga0070709_100787712 | 105 |
| 146 | 3300005437 | Ga0070710_10357824 | Ga0070710_103578243 | 105 |
| 147 | 3300005438 | Ga0070701_11229175 | Ga0070701_112291751 | 105 |
| 148 | 3300005439 | Ga0070711_100066924 | Ga0070711_1000669243 | 105 |
| 149 | 3300005439 | Ga0070711_100216803 | Ga0070711_1002168033 | 105 |
| 150 | 3300005440 | Ga0070705_100086775 | Ga0070705_1000867752 | 105 |
| 151 | 3300005444 | Ga0070694_100103932 | Ga0070694_1001039322 | 105 |
| 152 | 3300005445 | Ga0070708_100252045 | Ga0070708_1002520453 | 105 |
| 153 | 3300005456 | Ga0070678_100176555 | Ga0070678_1001765552 | 105 |
| 154 | 3300005457 | Ga0070662_100153148 | Ga0070662_1001531481 | 105 |
| 155 | 3300005457 | Ga0070662_100950439 | Ga0070662_1009504391 | 105 |
| 156 | 3300005459 | Ga0068867_100101688 | Ga0068867_1001016883 | 105 |
| 157 | 3300005467 | Ga0070706_100197069 | Ga0070706_1001970692 | 105 |
| 158 | 3300005467 | Ga0070706_100387198 | Ga0070706_1003871982 | 105 |
| 159 | 3300005468 | Ga0070707_100605527 | Ga0070707_1006055273 | 105 |
| 160 | 3300005468 | Ga0070707_101143436 | Ga0070707_1011434361 | 105 |
| 161 | 3300005471 | Ga0070698_100178885 | Ga0070698_1001788853 | 105 |
| 162 | 3300005535 | Ga0070684_100032939 | Ga0070684_1000329393 | 105 |
| 163 | 3300005539 | Ga0068853_101947688 | Ga0068853_1019476881 | 105 |
| 164 | 3300005544 | Ga0070686_100298072 | Ga0070686_1002980721 | 105 |
| 165 | 3300005545 | Ga0070695_100057596 | Ga0070695_1000575965 | 105 |
| 166 | 3300005546 | Ga0070696_100487491 | Ga0070696_1004874912 | 105 |
| 167 | 3300005546 | Ga0070696_101831956 | Ga0070696_1018319561 | 105 |
| 168 | 3300005547 | Ga0070693_100369772 | Ga0070693_1003697722 | 105 |
| 169 | 3300005548 | Ga0070665_101655678 | Ga0070665_1016556782 | 105 |
| 170 | 3300005549 | Ga0070704_101478371 | Ga0070704_1014783712 | 105 |
| 171 | 3300005549 | Ga0070704_101492980 | Ga0070704_1014929801 | 105 |
| 172 | 3300005563 | Ga0068855_101705456 | Ga0068855_1017054562 | 105 |
| 173 | 3300005564 | Ga0070664_100064930 | Ga0070664_1000649304 | 105 |
| 174 | 3300005577 | Ga0068857_100374381 | Ga0068857_1003743813 | 105 |
| 175 | 3300005615 | Ga0070702_100117267 | Ga0070702_1001172671 | 105 |
| 176 | 3300005616 | Ga0068852_101617206 | Ga0068852_1016172061 | 105 |
| 177 | 3300005718 | Ga0068866_10051763 | Ga0068866_100517634 | 105 |
| 178 | 3300005719 | Ga0068861_102482496 | Ga0068861_1024824961 | 105 |
| 179 | 3300005843 | Ga0068860_100114268 | Ga0068860_1001142684 | 105 |
| 180 | 3300005843 | Ga0068860_101696910 | Ga0068860_1016969102 | 105 |
| 181 | 3300005844 | Ga0068862_100676377 | Ga0068862_1006763772 | 105 |
| 182 | 3300005937 | Ga0081455_10296000 | Ga0081455_102960003 | 105 |
| 183 | 3300006028 | Ga0070717_11534822 | Ga0070717_115348222 | 105 |
| 184 | 3300006173 | Ga0070716_100305481 | Ga0070716_1003054813 | 105 |
| 185 | 3300006173 | Ga0070716_100431575 | Ga0070716_1004315753 | 105 |
| 186 | 3300006173 | Ga0070716_100948812 | Ga0070716_1009488122 | 105 |
| 187 | 3300006175 | Ga0070712_100117206 | Ga0070712_1001172062 | 105 |
| 188 | 3300006237 | Ga0097621_100312780 | Ga0097621_1003127802 | 105 |
| 189 | 3300006358 | Ga0068871_101697189 | Ga0068871_1016971892 | 105 |
| 190 | 3300006844 | Ga0075428_100388463 | Ga0075428_1003884632 | 105 |
| 191 | 3300006844 | Ga0075428_100729930 | Ga0075428_1007299303 | 105 |
| 192 | 3300006847 | Ga0075431_100026120 | Ga0075431_1000261207 | 105 |
| 193 | 3300006871 | Ga0075434_100778090 | Ga0075434_1007780903 | 105 |
| 194 | 3300006880 | Ga0075429_100280665 | Ga0075429_1002806653 | 105 |
| 195 | 3300007076 | Ga0075435_100114959 | Ga0075435_1001149593 | 105 |
| 196 | 3300009092 | Ga0105250_10150021 | Ga0105250_101500212 | 105 |
| 197 | 3300009094 | Ga0111539_10028470 | Ga0111539_100284706 | 105 |
| 198 | 3300009094 | Ga0111539_10046834 | Ga0111539_100468346 | 105 |
| 199 | 3300009098 | Ga0105245_10130771 | Ga0105245_101307712 | 105 |
| 200 | 3300009098 | Ga0105245_11709099 | Ga0105245_117090991 | 105 |
| 201 | 3300009147 | Ga0114129_10000831 | Ga0114129_1000083117 | 105 |
| 202 | 3300009147 | Ga0114129_10108514 | Ga0114129_101085141 | 105 |
| 203 | 3300009148 | Ga0105243_10063943 | Ga0105243_100639432 | 105 |
| 204 | 3300009148 | Ga0105243_13061977 | Ga0105243_130619772 | 105 |
| 205 | 3300009176 | Ga0105242_10040981 | Ga0105242_100409817 | 105 |
| 206 | 3300009176 | Ga0105242_10201013 | Ga0105242_102010135 | 105 |
| 207 | 3300009176 | Ga0105242_11072493 | Ga0105242_110724932 | 105 |
| 208 | 3300009177 | Ga0105248_10450454 | Ga0105248_104504542 | 105 |
| 209 | 3300009177 | Ga0105248_12354264 | Ga0105248_123542641 | 105 |
| 210 | 3300009551 | Ga0105238_10530372 | Ga0105238_105303722 | 105 |
| 211 | 3300009553 | Ga0105249_10118902 | Ga0105249_101189022 | 105 |
| 212 | 3300009553 | Ga0105249_10696486 | Ga0105249_106964862 | 105 |
| 213 | 3300010375 | Ga0105239_10386990 | Ga0105239_103869902 | 105 |
| 214 | 3300010375 | Ga0105239_11287061 | Ga0105239_112870612 | 105 |
| 215 | 3300011119 | Ga0105246_11531884 | Ga0105246_115318842 | 105 |
| 216 | 3300013102 | Ga0157371_10396243 | Ga0157371_103962432 | 105 |
| 217 | 3300013105 | Ga0157369_11066244 | Ga0157369_110662442 | 105 |
| 218 | 3300013296 | Ga0157374_10150805 | Ga0157374_101508053 | 105 |
| 219 | 3300013296 | Ga0157374_11301669 | Ga0157374_113016692 | 105 |
| 220 | 3300013306 | Ga0163162_10411859 | Ga0163162_104118594 | 105 |
| 221 | 3300013306 | Ga0163162_10598976 | Ga0163162_105989762 | 105 |
| 222 | 3300013307 | Ga0157372_10643391 | Ga0157372_106433912 | 105 |
| 223 | 3300013308 | Ga0157375_10456694 | Ga0157375_104566941 | 105 |
| 224 | 3300013308 | Ga0157375_10860870 | Ga0157375_108608702 | 105 |
| 225 | 3300014325 | Ga0163163_10133860 | Ga0163163_101338604 | 105 |
| 226 | 3300014326 | Ga0157380_10474416 | Ga0157380_104744162 | 105 |
| 227 | 3300014326 | Ga0157380_10630516 | Ga0157380_106305162 | 105 |
| 228 | 3300014745 | Ga0157377_10035301 | Ga0157377_100353014 | 105 |
| 229 | 3300014745 | Ga0157377_10479923 | Ga0157377_104799232 | 105 |
| 230 | 3300014968 | Ga0157379_10163166 | Ga0157379_101631663 | 105 |
| 231 | 3300014969 | Ga0157376_12192216 | Ga0157376_121922162 | 105 |
| 232 | 3300017792 | Ga0163161_10358667 | Ga0163161_103586672 | 105 |
| 233 | 3300020082 | Ga0206353_10365959 | Ga0206353_103659591 | 105 |
| 234 | 3300025898 | Ga0207692_10188351 | Ga0207692_101883513 | 105 |
| 235 | 3300025900 | Ga0207710_10590365 | Ga0207710_105903652 | 105 |
| 236 | 3300025915 | Ga0207693_10026555 | Ga0207693_100265556 | 105 |
| 237 | 3300025916 | Ga0207663_10216817 | Ga0207663_102168172 | 105 |
| 238 | 3300025916 | Ga0207663_10344220 | Ga0207663_103442203 | 105 |
| 239 | 3300025921 | Ga0207652_10646904 | Ga0207652_106469043 | 105 |
| 240 | 3300025922 | Ga0207646_10165062 | Ga0207646_101650621 | 105 |
| 241 | 3300025922 | Ga0207646_10362136 | Ga0207646_103621362 | 105 |
| 242 | 3300025925 | Ga0207650_11707137 | Ga0207650_117071372 | 105 |
| 243 | 3300025926 | Ga0207659_10168573 | Ga0207659_101685734 | 105 |
| 244 | 3300025927 | Ga0207687_10216630 | Ga0207687_102166303 | 105 |
| 245 | 3300025929 | Ga0207664_11285428 | Ga0207664_112854282 | 105 |
| 246 | 3300025933 | Ga0207706_10115490 | Ga0207706_101154904 | 105 |
| 247 | 3300025933 | Ga0207706_11063050 | Ga0207706_110630501 | 105 |
| 248 | 3300025934 | Ga0207686_10096419 | Ga0207686_100964191 | 105 |
| 249 | 3300025935 | Ga0207709_10768462 | Ga0207709_107684622 | 105 |
| 250 | 3300025937 | Ga0207669_10038865 | Ga0207669_100388655 | 105 |
| 251 | 3300025938 | Ga0207704_10232902 | Ga0207704_102329023 | 105 |
| 252 | 3300025939 | Ga0207665_10168821 | Ga0207665_101688213 | 105 |
| 253 | 3300025939 | Ga0207665_10726833 | Ga0207665_107268332 | 105 |
| 254 | 3300025942 | Ga0207689_10169712 | Ga0207689_101697122 | 105 |
| 255 | 3300025944 | Ga0207661_10068368 | Ga0207661_100683682 | 105 |
| 256 | 3300025945 | Ga0207679_10011810 | Ga0207679_100118104 | 105 |
| 257 | 3300025960 | Ga0207651_10776683 | Ga0207651_107766832 | 105 |
| 258 | 3300025961 | Ga0207712_11223303 | Ga0207712_112233031 | 105 |
| 259 | 3300026023 | Ga0207677_10354586 | Ga0207677_103545862 | 105 |
| 260 | 3300026089 | Ga0207648_10135205 | Ga0207648_101352053 | 105 |
| 261 | 3300026095 | Ga0207676_10700249 | Ga0207676_107002492 | 105 |
| 262 | 3300026118 | Ga0207675_100125613 | Ga0207675_1001256135 | 105 |
| 263 | 3300026121 | Ga0207683_10169808 | Ga0207683_101698082 | 105 |
| 264 | 3300026142 | Ga0207698_10374389 | Ga0207698_103743892 | 105 |
| 265 | 3300027907 | Ga0207428_10054782 | Ga0207428_100547822 | 105 |
| 266 | 3300028381 | Ga0268264_10334425 | Ga0268264_103344252 | 105 |
| 267 | 3300028381 | Ga0268264_10968706 | Ga0268264_109687062 | 105 |
| 268 | 3300031995 | Ga0307409_101826815 | Ga0307409_1018268151 | 105 |
| 269 | 3300035118 | Ga0373954_0342249 | Ga0373954_0342249_134_454 | 105 |
| 270 | 3300035120 | Ga0373957_0112193 | Ga0373957_0112193_548_868 | 105 |
| 271 | 3300035172 | Ga0373955_0743130 | Ga0373955_0743130_136_456 | 105 |
| 272 | 3300035724 | Ga0373933_0997871 | Ga0373933_0997871_85_405 | 105 |
| 273 | 3300036401 | Ga0373937_0999052 | Ga0373937_0999052_282_602 | 105 |
| 274 | 3300037418 | Ga0395900_0481552 | Ga0395900_0481552_700_1017 | 105 |
| 275 | 3300037418 | Ga0395900_0899052 | Ga0395900_0899052_63_380 | 105 |
| 276 | 3300037466 | Ga0395898_0361068 | Ga0395898_0361068_327_644 | 105 |
| 277 | 3300037471 | Ga0395905_0073735 | Ga0395905_0073735_2064_2381 | 105 |
| 278 | 3300037471 | Ga0395905_0487257 | Ga0395905_0487257_609_926 | 105 |
| 279 | 3300037471 | Ga0395905_1668681 | Ga0395905_1668681_43_360 | 105 |
| 280 | 3300038443 | Ga0395901_0353599 | Ga0395901_0353599_958_1275 | 105 |
| 281 | 3300038443 | Ga0395901_0519163 | Ga0395901_0519163_260_577 | 105 |
| 282 | 3300038443 | Ga0395901_0786208 | Ga0395901_0786208_468_785 | 105 |
| 283 | 3300038443 | Ga0395901_1684364 | Ga0395901_1684364_217_543 | 105 |
| 284 | 3300041460 | Ga0451802_2160690 | Ga0451802_2160690_184_501 | 105 |
| 285 | 3300041505 | Ga0451849_1578475 | Ga0451849_1578475_219_536 | 105 |
| 286 | 3300046474 | Ga0495605_0439002 | Ga0495605_0439002_11_328 | 105 |
| 287 | 3300046477 | Ga0495664_0525857 | Ga0495664_0525857_26_346 | 105 |
| 288 | 3300046491 | Ga0495584_0415673 | Ga0495584_0415673_224_559 | 105 |
| 289 | 3300046516 | Ga0495628_0514476 | Ga0495628_0514476_143_463 | 105 |
| 290 | 3300046528 | Ga0495642_0124065 | Ga0495642_0124065_494_811 | 105 |
| 291 | 3300046559 | Ga0495667_0090543 | Ga0495667_0090543_10_330 | 105 |
| 292 | 3300046615 | Ga0495656_0471304 | Ga0495656_0471304_83_400 | 105 |
| 293 | 3300046678 | Ga0495599_0487071 | Ga0495599_0487071_115_435 | 105 |
| 294 | 3300046794 | Ga0495589_0314837 | Ga0495589_0314837_391_708 | 105 |
| 295 | 3300047319 | Ga0495674_0390964 | Ga0495674_0390964_424_741 | 105 |
| 296 | 3300047321 | Ga0495676_0718188 | Ga0495676_0718188_244_561 | 105 |
| 297 | 3300047447 | Ga0495685_165957 | Ga0495685_165957_209_526 | 105 |
| 298 | 3300047471 | Ga0495684_0692846 | Ga0495684_0692846_203_520 | 105 |
| 299 | 3300048905 | Ga0496102_0243704 | Ga0496102_0243704_439_756 | 105 |
| 300 | 3300048905 | Ga0496102_0668385 | Ga0496102_0668385_549_872 | 105 |
| 301 | 3300048905 | Ga0496102_1837282 | Ga0496102_1837282_82_399 | 105 |
| 302 | 3300048909 | Ga0496106_0975736 | Ga0496106_0975736_130_465 | 105 |
| 303 | 3300048910 | Ga0496107_0171803 | Ga0496107_0171803_139_462 | 105 |
| 304 | 3300048910 | Ga0496107_0393204 | Ga0496107_0393204_582_899 | 105 |
| 305 | 3300048910 | Ga0496107_1124130 | Ga0496107_1124130_142_459 | 105 |
| 306 | 3300048911 | Ga0496108_0059331 | Ga0496108_0059331_1512_1838 | 105 |
| 307 | 3300048911 | Ga0496108_1125761 | Ga0496108_1125761_50_367 | 105 |
| 308 | 3300048912 | Ga0496109_0021346 | Ga0496109_0021346_1816_2142 | 105 |
| 309 | 3300048912 | Ga0496109_0297818 | Ga0496109_0297818_36_353 | 105 |
| 310 | 3300048913 | Ga0496110_0818995 | Ga0496110_0818995_391_708 | 105 |
| 311 | 3300048914 | Ga0496111_0198803 | Ga0496111_0198803_301_636 | 105 |
| 312 | 3300048914 | Ga0496111_0728763 | Ga0496111_0728763_181_507 | 105 |
| 313 | 3300048914 | Ga0496111_1077771 | Ga0496111_1077771_69_386 | 105 |
| 314 | 3300048915 | Ga0496112_0000125 | Ga0496112_0000125_44094_44411 | 105 |
| 315 | 3300048915 | Ga0496112_0142160 | Ga0496112_0142160_1839_2171 | 105 |
| 316 | 3300048916 | Ga0496113_0576322 | Ga0496113_0576322_368_685 | 105 |
| 317 | 3300048916 | Ga0496113_0901771 | Ga0496113_0901771_293_619 | 105 |
| 318 | 3300050507 | nmdc:mga05p37_296926_c1 | nmdc:mga05p37_296926_c1_790_1107 | 105 |
| 319 | 3300050507 | nmdc:mga05p37_47248_c1 | nmdc:mga05p37_47248_c1_3967_4284 | 105 |
| 320 | 3300050508 | nmdc:mga09592_197574_c1 | nmdc:mga09592_197574_c1_1159_1476 | 105 |
| 321 | 3300050511 | nmdc:mga08y16_27156_c1 | nmdc:mga08y16_27156_c1_1319_1636 | 105 |
| 322 | 3300050511 | nmdc:mga08y16_86123_c1 | nmdc:mga08y16_86123_c1_200_517 | 105 |
| 323 | 3300050512 | nmdc:mga0n895_31972_c1 | nmdc:mga0n895_31972_c1_1210_1527 | 105 |
| 324 | 3300050512 | nmdc:mga0n895_951351_c1 | nmdc:mga0n895_951351_c1_146_463 | 105 |
| 325 | 3300050514 | nmdc:mga08x19_26455_c1 | nmdc:mga08x19_26455_c1_156_473 | 105 |
| 326 | 3300050515 | nmdc:mga0a205_1445252_c1 | nmdc:mga0a205_1445252_c1_137_454 | 105 |
| 327 | 3300050515 | nmdc:mga0a205_675279_c1 | nmdc:mga0a205_675279_c1_383_700 | 105 |
| 328 | 3300053077 | Ga0495601_0671546 | Ga0495601_0671546_214_531 | 105 |
| 329 | 3300053078 | Ga0495612_0351837 | Ga0495612_0351837_173_493 | 105 |
| 330 | 3300053084 | Ga0495595_0082358 | Ga0495595_0082358_740_1060 | 105 |
| 331 | 3300059625 | Ga0587113_021899 | Ga0587113_021899_71_388 | 105 |
| 332 | 3300059631 | Ga0587130_015021 | Ga0587130_015021_26_343 | 105 |
| 333 | 3300002073 | JGI24745J21846_1044402 | JGI24745J21846_10444021 | 106 |
| 334 | 3300005327 | Ga0070658_10428860 | Ga0070658_104288601 | 106 |
| 335 | 3300005327 | Ga0070658_11706863 | Ga0070658_117068631 | 106 |
| 336 | 3300005329 | Ga0070683_100101527 | Ga0070683_1001015272 | 106 |
| 337 | 3300005334 | Ga0068869_100138974 | Ga0068869_1001389744 | 106 |
| 338 | 3300005336 | Ga0070680_100303111 | Ga0070680_1003031112 | 106 |
| 339 | 3300005336 | Ga0070680_100672675 | Ga0070680_1006726752 | 106 |
| 340 | 3300005337 | Ga0070682_100006477 | Ga0070682_1000064779 | 106 |
| 341 | 3300005337 | Ga0070682_100518328 | Ga0070682_1005183281 | 106 |
| 342 | 3300005340 | Ga0070689_100056184 | Ga0070689_1000561842 | 106 |
| 343 | 3300005341 | Ga0070691_10191415 | Ga0070691_101914152 | 106 |
| 344 | 3300005343 | Ga0070687_100207905 | Ga0070687_1002079052 | 106 |
| 345 | 3300005344 | Ga0070661_100244888 | Ga0070661_1002448882 | 106 |
| 346 | 3300005353 | Ga0070669_101302738 | Ga0070669_1013027382 | 106 |
| 347 | 3300005354 | Ga0070675_100813560 | Ga0070675_1008135601 | 106 |
| 348 | 3300005355 | Ga0070671_100647197 | Ga0070671_1006471972 | 106 |
| 349 | 3300005355 | Ga0070671_100803256 | Ga0070671_1008032561 | 106 |
| 350 | 3300005356 | Ga0070674_100266072 | Ga0070674_1002660722 | 106 |
| 351 | 3300005364 | Ga0070673_100230066 | Ga0070673_1002300664 | 106 |
| 352 | 3300005364 | Ga0070673_102219931 | Ga0070673_1022199312 | 106 |
| 353 | 3300005365 | Ga0070688_100154130 | Ga0070688_1001541302 | 106 |
| 354 | 3300005406 | Ga0070703_10158829 | Ga0070703_101588292 | 106 |
| 355 | 3300005406 | Ga0070703_10509785 | Ga0070703_105097852 | 106 |
| 356 | 3300005434 | Ga0070709_10010201 | Ga0070709_100102014 | 106 |
| 357 | 3300005434 | Ga0070709_10013995 | Ga0070709_100139955 | 106 |
| 358 | 3300005434 | Ga0070709_10200734 | Ga0070709_102007342 | 106 |
| 359 | 3300005434 | Ga0070709_10735834 | Ga0070709_107358342 | 106 |
| 360 | 3300005435 | Ga0070714_100668974 | Ga0070714_1006689742 | 106 |
| 361 | 3300005435 | Ga0070714_100893277 | Ga0070714_1008932771 | 106 |
| 362 | 3300005437 | Ga0070710_10650082 | Ga0070710_106500822 | 106 |
| 363 | 3300005438 | Ga0070701_10058379 | Ga0070701_100583792 | 106 |
| 364 | 3300005438 | Ga0070701_10648310 | Ga0070701_106483102 | 106 |
| 365 | 3300005439 | Ga0070711_100053930 | Ga0070711_1000539304 | 106 |
| 366 | 3300005439 | Ga0070711_100241048 | Ga0070711_1002410483 | 106 |
| 367 | 3300005439 | Ga0070711_100848786 | Ga0070711_1008487862 | 106 |
| 368 | 3300005439 | Ga0070711_101007174 | Ga0070711_1010071742 | 106 |
| 369 | 3300005439 | Ga0070711_101555057 | Ga0070711_1015550571 | 106 |
| 370 | 3300005440 | Ga0070705_100773756 | Ga0070705_1007737562 | 106 |
| 371 | 3300005440 | Ga0070705_101379031 | Ga0070705_1013790311 | 106 |
| 372 | 3300005440 | Ga0070705_101898186 | Ga0070705_1018981862 | 106 |
| 373 | 3300005441 | Ga0070700_100032492 | Ga0070700_1000324924 | 106 |
| 374 | 3300005441 | Ga0070700_101776599 | Ga0070700_1017765992 | 106 |
| 375 | 3300005444 | Ga0070694_100260569 | Ga0070694_1002605692 | 106 |
| 376 | 3300005444 | Ga0070694_100520672 | Ga0070694_1005206722 | 106 |
| 377 | 3300005444 | Ga0070694_101900076 | Ga0070694_1019000761 | 106 |
| 378 | 3300005445 | Ga0070708_100023312 | Ga0070708_1000233126 | 106 |
| 379 | 3300005445 | Ga0070708_100114600 | Ga0070708_1001146002 | 106 |
| 380 | 3300005445 | Ga0070708_100129705 | Ga0070708_1001297054 | 106 |
| 381 | 3300005445 | Ga0070708_100321042 | Ga0070708_1003210422 | 106 |
| 382 | 3300005445 | Ga0070708_100966715 | Ga0070708_1009667151 | 106 |
| 383 | 3300005455 | Ga0070663_100156331 | Ga0070663_1001563314 | 106 |
| 384 | 3300005455 | Ga0070663_101586453 | Ga0070663_1015864531 | 106 |
| 385 | 3300005456 | Ga0070678_100006059 | Ga0070678_1000060592 | 106 |
| 386 | 3300005456 | Ga0070678_100508479 | Ga0070678_1005084792 | 106 |
| 387 | 3300005456 | Ga0070678_101538877 | Ga0070678_1015388772 | 106 |
| 388 | 3300005457 | Ga0070662_100353028 | Ga0070662_1003530282 | 106 |
| 389 | 3300005458 | Ga0070681_10067874 | Ga0070681_100678747 | 106 |
| 390 | 3300005458 | Ga0070681_10447922 | Ga0070681_104479222 | 106 |
| 391 | 3300005458 | Ga0070681_11104320 | Ga0070681_111043202 | 106 |
| 392 | 3300005466 | Ga0070685_10052029 | Ga0070685_100520294 | 106 |
| 393 | 3300005467 | Ga0070706_100008263 | Ga0070706_1000082634 | 106 |
| 394 | 3300005467 | Ga0070706_100091857 | Ga0070706_1000918572 | 106 |
| 395 | 3300005467 | Ga0070706_100270509 | Ga0070706_1002705093 | 106 |
| 396 | 3300005468 | Ga0070707_100009180 | Ga0070707_10000918012 | 106 |
| 397 | 3300005468 | Ga0070707_100093249 | Ga0070707_1000932493 | 106 |
| 398 | 3300005468 | Ga0070707_100207265 | Ga0070707_1002072652 | 106 |
| 399 | 3300005468 | Ga0070707_100525827 | Ga0070707_1005258272 | 106 |
| 400 | 3300005468 | Ga0070707_101103051 | Ga0070707_1011030512 | 106 |
| 401 | 3300005468 | Ga0070707_101799209 | Ga0070707_1017992092 | 106 |
| 402 | 3300005471 | Ga0070698_100004541 | Ga0070698_10000454110 | 106 |
| 403 | 3300005471 | Ga0070698_100209917 | Ga0070698_1002099172 | 106 |
| 404 | 3300005471 | Ga0070698_100282775 | Ga0070698_1002827752 | 106 |
| 405 | 3300005518 | Ga0070699_100018853 | Ga0070699_1000188535 | 106 |
| 406 | 3300005518 | Ga0070699_100055304 | Ga0070699_1000553042 | 106 |
| 407 | 3300005535 | Ga0070684_100022106 | Ga0070684_1000221063 | 106 |
| 408 | 3300005535 | Ga0070684_100915199 | Ga0070684_1009151992 | 106 |
| 409 | 3300005539 | Ga0068853_100288972 | Ga0068853_1002889723 | 106 |
| 410 | 3300005543 | Ga0070672_100356307 | Ga0070672_1003563072 | 106 |
| 411 | 3300005544 | Ga0070686_100444744 | Ga0070686_1004447441 | 106 |
| 412 | 3300005546 | Ga0070696_100892976 | Ga0070696_1008929761 | 106 |
| 413 | 3300005546 | Ga0070696_101233520 | Ga0070696_1012335202 | 106 |
| 414 | 3300005547 | Ga0070693_100314642 | Ga0070693_1003146422 | 106 |
| 415 | 3300005549 | Ga0070704_100017166 | Ga0070704_1000171662 | 106 |
| 416 | 3300005549 | Ga0070704_100465025 | Ga0070704_1004650251 | 106 |
| 417 | 3300005549 | Ga0070704_101037707 | Ga0070704_1010377072 | 106 |
| 418 | 3300005549 | Ga0070704_101165879 | Ga0070704_1011658792 | 106 |
| 419 | 3300005549 | Ga0070704_101562379 | Ga0070704_1015623792 | 106 |
| 420 | 3300005549 | Ga0070704_101704790 | Ga0070704_1017047901 | 106 |
| 421 | 3300005563 | Ga0068855_100212327 | Ga0068855_1002123272 | 106 |
| 422 | 3300005564 | Ga0070664_100007855 | Ga0070664_10000785511 | 106 |
| 423 | 3300005614 | Ga0068856_100135612 | Ga0068856_1001356124 | 106 |
| 424 | 3300005614 | Ga0068856_100619683 | Ga0068856_1006196833 | 106 |
| 425 | 3300005614 | Ga0068856_100666651 | Ga0068856_1006666512 | 106 |
| 426 | 3300005614 | Ga0068856_100817040 | Ga0068856_1008170401 | 106 |
| 427 | 3300005615 | Ga0070702_100011024 | Ga0070702_1000110242 | 106 |
| 428 | 3300005616 | Ga0068852_100009899 | Ga0068852_1000098995 | 106 |
| 429 | 3300005617 | Ga0068859_100486396 | Ga0068859_1004863963 | 106 |
| 430 | 3300005618 | Ga0068864_100036831 | Ga0068864_1000368317 | 106 |
| 431 | 3300005718 | Ga0068866_10108340 | Ga0068866_101083403 | 106 |
| 432 | 3300005718 | Ga0068866_10629481 | Ga0068866_106294812 | 106 |
| 433 | 3300005719 | Ga0068861_100560910 | Ga0068861_1005609103 | 106 |
| 434 | 3300005841 | Ga0068863_100355000 | Ga0068863_1003550001 | 106 |
| 435 | 3300005937 | Ga0081455_10130107 | Ga0081455_101301072 | 106 |
| 436 | 3300005981 | Ga0081538_10029400 | Ga0081538_100294003 | 106 |
| 437 | 3300005981 | Ga0081538_10113985 | Ga0081538_101139852 | 106 |
| 438 | 3300005983 | Ga0081540_1015838 | Ga0081540_10158386 | 106 |
| 439 | 3300005985 | Ga0081539_10000068 | Ga0081539_10000068117 | 106 |
| 440 | 3300005985 | Ga0081539_10009415 | Ga0081539_100094159 | 106 |
| 441 | 3300005985 | Ga0081539_10271264 | Ga0081539_102712642 | 106 |
| 442 | 3300006028 | Ga0070717_10097143 | Ga0070717_100971433 | 106 |
| 443 | 3300006028 | Ga0070717_10203795 | Ga0070717_102037953 | 106 |
| 444 | 3300006028 | Ga0070717_11180949 | Ga0070717_111809491 | 106 |
| 445 | 3300006058 | Ga0075432_10137469 | Ga0075432_101374692 | 106 |
| 446 | 3300006058 | Ga0075432_10318838 | Ga0075432_103188381 | 106 |
| 447 | 3300006163 | Ga0070715_10045288 | Ga0070715_100452883 | 106 |
| 448 | 3300006173 | Ga0070716_100001084 | Ga0070716_1000010847 | 106 |
| 449 | 3300006173 | Ga0070716_100094734 | Ga0070716_1000947343 | 106 |
| 450 | 3300006173 | Ga0070716_100096573 | Ga0070716_1000965733 | 106 |
| 451 | 3300006173 | Ga0070716_101167947 | Ga0070716_1011679472 | 106 |
| 452 | 3300006175 | Ga0070712_100000007 | Ga0070712_10000000750 | 106 |
| 453 | 3300006175 | Ga0070712_100003758 | Ga0070712_1000037585 | 106 |
| 454 | 3300006175 | Ga0070712_100014605 | Ga0070712_1000146052 | 106 |
| 455 | 3300006175 | Ga0070712_100026426 | Ga0070712_1000264263 | 106 |
| 456 | 3300006175 | Ga0070712_100159601 | Ga0070712_1001596013 | 106 |
| 457 | 3300006175 | Ga0070712_100305032 | Ga0070712_1003050322 | 106 |
| 458 | 3300006175 | Ga0070712_100437586 | Ga0070712_1004375862 | 106 |
| 459 | 3300006175 | Ga0070712_100516687 | Ga0070712_1005166872 | 106 |
| 460 | 3300006175 | Ga0070712_101383421 | Ga0070712_1013834211 | 106 |
| 461 | 3300006178 | Ga0075367_10401444 | Ga0075367_104014443 | 106 |
| 462 | 3300006353 | Ga0075370_10553252 | Ga0075370_105532522 | 106 |
| 463 | 3300006844 | Ga0075428_100121377 | Ga0075428_1001213774 | 106 |
| 464 | 3300006844 | Ga0075428_100166123 | Ga0075428_1001661234 | 106 |
| 465 | 3300006844 | Ga0075428_102379173 | Ga0075428_1023791731 | 106 |
| 466 | 3300006846 | Ga0075430_100380167 | Ga0075430_1003801671 | 106 |
| 467 | 3300006846 | Ga0075430_101139996 | Ga0075430_1011399962 | 106 |
| 468 | 3300006847 | Ga0075431_100117633 | Ga0075431_1001176334 | 106 |
| 469 | 3300006847 | Ga0075431_100229757 | Ga0075431_1002297572 | 106 |
| 470 | 3300006847 | Ga0075431_101016083 | Ga0075431_1010160832 | 106 |
| 471 | 3300006847 | Ga0075431_101415227 | Ga0075431_1014152272 | 106 |
| 472 | 3300006852 | Ga0075433_10015003 | Ga0075433_100150035 | 106 |
| 473 | 3300006852 | Ga0075433_10031218 | Ga0075433_100312183 | 106 |
| 474 | 3300006852 | Ga0075433_10310276 | Ga0075433_103102762 | 106 |
| 475 | 3300006871 | Ga0075434_100045749 | Ga0075434_1000457493 | 106 |
| 476 | 3300006871 | Ga0075434_100074186 | Ga0075434_1000741864 | 106 |
| 477 | 3300006871 | Ga0075434_100115672 | Ga0075434_1001156724 | 106 |
| 478 | 3300006871 | Ga0075434_100288829 | Ga0075434_1002888293 | 106 |
| 479 | 3300006871 | Ga0075434_100854788 | Ga0075434_1008547882 | 106 |
| 480 | 3300006871 | Ga0075434_101583399 | Ga0075434_1015833991 | 106 |
| 481 | 3300006871 | Ga0075434_102004576 | Ga0075434_1020045762 | 106 |
| 482 | 3300006914 | Ga0075436_100028580 | Ga0075436_1000285806 | 106 |
| 483 | 3300006914 | Ga0075436_100094513 | Ga0075436_1000945132 | 106 |
| 484 | 3300006914 | Ga0075436_100179277 | Ga0075436_1001792773 | 106 |
| 485 | 3300006914 | Ga0075436_100697180 | Ga0075436_1006971802 | 106 |
| 486 | 3300006931 | Ga0097620_100486395 | Ga0097620_1004863953 | 106 |
| 487 | 3300007076 | Ga0075435_100000552 | Ga0075435_10000055221 | 106 |
| 488 | 3300007076 | Ga0075435_100030027 | Ga0075435_1000300274 | 106 |
| 489 | 3300007076 | Ga0075435_100335121 | Ga0075435_1003351211 | 106 |
| 490 | 3300007076 | Ga0075435_100485802 | Ga0075435_1004858022 | 106 |
| 491 | 3300007076 | Ga0075435_100495423 | Ga0075435_1004954232 | 106 |
| 492 | 3300007076 | Ga0075435_100598741 | Ga0075435_1005987412 | 106 |
| 493 | 3300007076 | Ga0075435_100719933 | Ga0075435_1007199332 | 106 |
| 494 | 3300007076 | Ga0075435_100783243 | Ga0075435_1007832432 | 106 |
| 495 | 3300007076 | Ga0075435_101512360 | Ga0075435_1015123601 | 106 |
| 496 | 3300009093 | Ga0105240_10906743 | Ga0105240_109067432 | 106 |
| 497 | 3300009093 | Ga0105240_11099973 | Ga0105240_110999731 | 106 |
| 498 | 3300009094 | Ga0111539_10046823 | Ga0111539_100468238 | 106 |
| 499 | 3300009094 | Ga0111539_10276381 | Ga0111539_102763812 | 106 |
| 500 | 3300009094 | Ga0111539_10434915 | Ga0111539_104349152 | 106 |
| 501 | 3300009094 | Ga0111539_10900962 | Ga0111539_109009622 | 106 |
| 502 | 3300009098 | Ga0105245_10011852 | Ga0105245_100118529 | 106 |
| 503 | 3300009098 | Ga0105245_10344762 | Ga0105245_103447622 | 106 |
| 504 | 3300009098 | Ga0105245_10505981 | Ga0105245_105059812 | 106 |
| 505 | 3300009098 | Ga0105245_10899249 | Ga0105245_108992493 | 106 |
| 506 | 3300009098 | Ga0105245_12148096 | Ga0105245_121480962 | 106 |
| 507 | 3300009147 | Ga0114129_10007775 | Ga0114129_100077756 | 106 |
| 508 | 3300009147 | Ga0114129_10166187 | Ga0114129_101661873 | 106 |
| 509 | 3300009147 | Ga0114129_10206491 | Ga0114129_102064912 | 106 |
| 510 | 3300009147 | Ga0114129_10395042 | Ga0114129_103950423 | 106 |
| 511 | 3300009147 | Ga0114129_10670901 | Ga0114129_106709012 | 106 |
| 512 | 3300009147 | Ga0114129_10722376 | Ga0114129_107223762 | 106 |
| 513 | 3300009147 | Ga0114129_10927154 | Ga0114129_109271542 | 106 |
| 514 | 3300009147 | Ga0114129_11763949 | Ga0114129_117639492 | 106 |
| 515 | 3300009148 | Ga0105243_10048038 | Ga0105243_100480382 | 106 |
| 516 | 3300009148 | Ga0105243_10761442 | Ga0105243_107614422 | 106 |
| 517 | 3300009148 | Ga0105243_11638713 | Ga0105243_116387132 | 106 |
| 518 | 3300009176 | Ga0105242_10047642 | Ga0105242_100476424 | 106 |
| 519 | 3300009176 | Ga0105242_10471047 | Ga0105242_104710472 | 106 |
| 520 | 3300009176 | Ga0105242_10732396 | Ga0105242_107323962 | 106 |
| 521 | 3300009176 | Ga0105242_11177449 | Ga0105242_111774492 | 106 |
| 522 | 3300009545 | Ga0105237_10928327 | Ga0105237_109283272 | 106 |
| 523 | 3300009553 | Ga0105249_11564040 | Ga0105249_115640402 | 106 |
| 524 | 3300010375 | Ga0105239_10004095 | Ga0105239_100040953 | 106 |
| 525 | 3300010375 | Ga0105239_13061540 | Ga0105239_130615402 | 106 |
| 526 | 3300012480 | Ga0157346_1001569 | Ga0157346_10015693 | 106 |
| 527 | 3300012494 | Ga0157341_1015006 | Ga0157341_10150061 | 106 |
| 528 | 3300012507 | Ga0157342_1019055 | Ga0157342_10190552 | 106 |
| 529 | 3300013104 | Ga0157370_11195751 | Ga0157370_111957512 | 106 |
| 530 | 3300013105 | Ga0157369_10019782 | Ga0157369_100197827 | 106 |
| 531 | 3300013105 | Ga0157369_10515497 | Ga0157369_105154971 | 106 |
| 532 | 3300013105 | Ga0157369_12533383 | Ga0157369_125333831 | 106 |
| 533 | 3300013296 | Ga0157374_10010688 | Ga0157374_100106884 | 106 |
| 534 | 3300013296 | Ga0157374_11338816 | Ga0157374_113388162 | 106 |
| 535 | 3300013297 | Ga0157378_11209187 | Ga0157378_112091872 | 106 |
| 536 | 3300013306 | Ga0163162_10668087 | Ga0163162_106680873 | 106 |
| 537 | 3300013307 | Ga0157372_10203064 | Ga0157372_102030645 | 106 |
| 538 | 3300013308 | Ga0157375_13465122 | Ga0157375_134651222 | 106 |
| 539 | 3300014326 | Ga0157380_10378526 | Ga0157380_103785262 | 106 |
| 540 | 3300014326 | Ga0157380_10407620 | Ga0157380_104076203 | 106 |
| 541 | 3300014326 | Ga0157380_11431991 | Ga0157380_114319912 | 106 |
| 542 | 3300014745 | Ga0157377_10001774 | Ga0157377_100017745 | 106 |
| 543 | 3300014745 | Ga0157377_11256145 | Ga0157377_112561451 | 106 |
| 544 | 3300014968 | Ga0157379_10760144 | Ga0157379_107601442 | 106 |
| 545 | 3300014969 | Ga0157376_10887516 | Ga0157376_108875163 | 106 |
| 546 | 3300020081 | Ga0206354_10173438 | Ga0206354_101734384 | 106 |
| 547 | 3300020082 | Ga0206353_10095162 | Ga0206353_100951623 | 106 |
| 548 | 3300020082 | Ga0206353_11480865 | Ga0206353_114808652 | 106 |
| 549 | 3300021358 | Ga0213873_10074288 | Ga0213873_100742882 | 106 |
| 550 | 3300025885 | Ga0207653_10226294 | Ga0207653_102262942 | 106 |
| 551 | 3300025898 | Ga0207692_10512071 | Ga0207692_105120711 | 106 |
| 552 | 3300025899 | Ga0207642_10715864 | Ga0207642_107158642 | 106 |
| 553 | 3300025901 | Ga0207688_10003516 | Ga0207688_100035164 | 106 |
| 554 | 3300025904 | Ga0207647_10277656 | Ga0207647_102776562 | 106 |
| 555 | 3300025905 | Ga0207685_10073254 | Ga0207685_100732543 | 106 |
| 556 | 3300025905 | Ga0207685_10477463 | Ga0207685_104774631 | 106 |
| 557 | 3300025906 | Ga0207699_10004114 | Ga0207699_100041145 | 106 |
| 558 | 3300025906 | Ga0207699_10006204 | Ga0207699_100062043 | 106 |
| 559 | 3300025906 | Ga0207699_10066552 | Ga0207699_100665522 | 106 |
| 560 | 3300025909 | Ga0207705_10671735 | Ga0207705_106717352 | 106 |
| 561 | 3300025910 | Ga0207684_10142609 | Ga0207684_101426094 | 106 |
| 562 | 3300025910 | Ga0207684_10206944 | Ga0207684_102069444 | 106 |
| 563 | 3300025910 | Ga0207684_11262026 | Ga0207684_112620262 | 106 |
| 564 | 3300025912 | Ga0207707_10075848 | Ga0207707_100758482 | 106 |
| 565 | 3300025912 | Ga0207707_10103226 | Ga0207707_101032262 | 106 |
| 566 | 3300025913 | Ga0207695_11040720 | Ga0207695_110407202 | 106 |
| 567 | 3300025915 | Ga0207693_10002613 | Ga0207693_1000261321 | 106 |
| 568 | 3300025915 | Ga0207693_10020915 | Ga0207693_100209153 | 106 |
| 569 | 3300025915 | Ga0207693_10039249 | Ga0207693_100392496 | 106 |
| 570 | 3300025915 | Ga0207693_10158426 | Ga0207693_101584262 | 106 |
| 571 | 3300025915 | Ga0207693_10178444 | Ga0207693_101784443 | 106 |
| 572 | 3300025915 | Ga0207693_10195845 | Ga0207693_101958453 | 106 |
| 573 | 3300025915 | Ga0207693_10793857 | Ga0207693_107938571 | 106 |
| 574 | 3300025916 | Ga0207663_10095807 | Ga0207663_100958072 | 106 |
| 575 | 3300025916 | Ga0207663_10182104 | Ga0207663_101821043 | 106 |
| 576 | 3300025916 | Ga0207663_10409025 | Ga0207663_104090251 | 106 |
| 577 | 3300025916 | Ga0207663_10851447 | Ga0207663_108514472 | 106 |
| 578 | 3300025917 | Ga0207660_10676584 | Ga0207660_106765842 | 106 |
| 579 | 3300025918 | Ga0207662_10007150 | Ga0207662_1000715010 | 106 |
| 580 | 3300025919 | Ga0207657_10196743 | Ga0207657_101967433 | 106 |
| 581 | 3300025922 | Ga0207646_10124888 | Ga0207646_101248881 | 106 |
| 582 | 3300025922 | Ga0207646_10497647 | Ga0207646_104976472 | 106 |
| 583 | 3300025922 | Ga0207646_10531440 | Ga0207646_105314402 | 106 |
| 584 | 3300025922 | Ga0207646_11317405 | Ga0207646_113174052 | 106 |
| 585 | 3300025922 | Ga0207646_11349072 | Ga0207646_113490722 | 106 |
| 586 | 3300025923 | Ga0207681_11408751 | Ga0207681_114087511 | 106 |
| 587 | 3300025924 | Ga0207694_11598584 | Ga0207694_115985842 | 106 |
| 588 | 3300025927 | Ga0207687_10086372 | Ga0207687_100863724 | 106 |
| 589 | 3300025927 | Ga0207687_10643024 | Ga0207687_106430242 | 106 |
| 590 | 3300025927 | Ga0207687_11617396 | Ga0207687_116173962 | 106 |
| 591 | 3300025928 | Ga0207700_10151217 | Ga0207700_101512173 | 106 |
| 592 | 3300025929 | Ga0207664_10730016 | Ga0207664_107300162 | 106 |
| 593 | 3300025929 | Ga0207664_11631287 | Ga0207664_116312872 | 106 |
| 594 | 3300025933 | Ga0207706_10087029 | Ga0207706_100870292 | 106 |
| 595 | 3300025933 | Ga0207706_11474656 | Ga0207706_114746562 | 106 |
| 596 | 3300025934 | Ga0207686_10178089 | Ga0207686_101780892 | 106 |
| 597 | 3300025934 | Ga0207686_10772546 | Ga0207686_107725461 | 106 |
| 598 | 3300025934 | Ga0207686_10903130 | Ga0207686_109031301 | 106 |
| 599 | 3300025934 | Ga0207686_10952778 | Ga0207686_109527782 | 106 |
| 600 | 3300025934 | Ga0207686_11026956 | Ga0207686_110269562 | 106 |
| 601 | 3300025935 | Ga0207709_10444225 | Ga0207709_104442252 | 106 |
| 602 | 3300025935 | Ga0207709_11464397 | Ga0207709_114643972 | 106 |
| 603 | 3300025936 | Ga0207670_10978563 | Ga0207670_109785632 | 106 |
| 604 | 3300025937 | Ga0207669_10191473 | Ga0207669_101914733 | 106 |
| 605 | 3300025938 | Ga0207704_10048774 | Ga0207704_100487742 | 106 |
| 606 | 3300025939 | Ga0207665_10117047 | Ga0207665_101170472 | 106 |
| 607 | 3300025939 | Ga0207665_10620381 | Ga0207665_106203812 | 106 |
| 608 | 3300025941 | Ga0207711_10489186 | Ga0207711_104891863 | 106 |
| 609 | 3300025944 | Ga0207661_10224017 | Ga0207661_102240172 | 106 |
| 610 | 3300025945 | Ga0207679_10007996 | Ga0207679_100079969 | 106 |
| 611 | 3300025949 | Ga0207667_10179367 | Ga0207667_101793672 | 106 |
| 612 | 3300025949 | Ga0207667_11876508 | Ga0207667_118765081 | 106 |
| 613 | 3300025960 | Ga0207651_10574167 | Ga0207651_105741672 | 106 |
| 614 | 3300025961 | Ga0207712_11076618 | Ga0207712_110766181 | 106 |
| 615 | 3300026023 | Ga0207677_10273426 | Ga0207677_102734261 | 106 |
| 616 | 3300026067 | Ga0207678_10022172 | Ga0207678_100221728 | 106 |
| 617 | 3300026067 | Ga0207678_11331757 | Ga0207678_113317571 | 106 |
| 618 | 3300026075 | Ga0207708_10001166 | Ga0207708_1000116614 | 106 |
| 619 | 3300026075 | Ga0207708_10231739 | Ga0207708_102317392 | 106 |
| 620 | 3300026075 | Ga0207708_11853678 | Ga0207708_118536782 | 106 |
| 621 | 3300026078 | Ga0207702_10028071 | Ga0207702_100280716 | 106 |
| 622 | 3300026078 | Ga0207702_11051495 | Ga0207702_110514952 | 106 |
| 623 | 3300026089 | Ga0207648_10782486 | Ga0207648_107824862 | 106 |
| 624 | 3300026095 | Ga0207676_10185975 | Ga0207676_101859751 | 106 |
| 625 | 3300026116 | Ga0207674_10450721 | Ga0207674_104507214 | 106 |
| 626 | 3300026118 | Ga0207675_100042914 | Ga0207675_1000429146 | 106 |
| 627 | 3300026118 | Ga0207675_101079035 | Ga0207675_1010790351 | 106 |
| 628 | 3300026121 | Ga0207683_10191462 | Ga0207683_101914624 | 106 |
| 629 | 3300026121 | Ga0207683_12186531 | Ga0207683_121865311 | 106 |
| 630 | 3300027907 | Ga0207428_10355292 | Ga0207428_103552922 | 106 |
| 631 | 3300027907 | Ga0207428_10461925 | Ga0207428_104619252 | 106 |
| 632 | 3300028380 | Ga0268265_10849332 | Ga0268265_108493322 | 106 |
| 633 | 3300028381 | Ga0268264_11361116 | Ga0268264_113611161 | 106 |
| 634 | 3300028800 | Ga0265338_10236046 | Ga0265338_102360463 | 106 |
| 635 | 3300028800 | Ga0265338_10509359 | Ga0265338_105093592 | 106 |
| 636 | 3300032002 | Ga0307416_100018682 | Ga0307416_1000186824 | 106 |
| 637 | 3300032002 | Ga0307416_102605848 | Ga0307416_1026058482 | 106 |
| 638 | 3300032126 | Ga0307415_102204028 | Ga0307415_1022040281 | 106 |
| 639 | 3300035090 | Ga0373949_0130256 | Ga0373949_0130256_117_437 | 106 |
| 640 | 3300035117 | Ga0373953_0233728 | Ga0373953_0233728_425_772 | 106 |
| 641 | 3300035170 | Ga0373943_0014323 | Ga0373943_0014323_762_1103 | 106 |
| 642 | 3300035170 | Ga0373943_0118265 | Ga0373943_0118265_559_879 | 106 |
| 643 | 3300035172 | Ga0373955_0128205 | Ga0373955_0128205_752_1099 | 106 |
| 644 | 3300035691 | Ga0373931_0339276 | Ga0373931_0339276_498_818 | 106 |
| 645 | 3300035691 | Ga0373931_1087291 | Ga0373931_1087291_81_401 | 106 |
| 646 | 3300035692 | Ga0373935_0128438 | Ga0373935_0128438_13_360 | 106 |
| 647 | 3300035692 | Ga0373935_0181807 | Ga0373935_0181807_25_366 | 106 |
| 648 | 3300035695 | Ga0373927_0072159 | Ga0373927_0072159_704_1045 | 106 |
| 649 | 3300035725 | Ga0373947_0012053 | Ga0373947_0012053_1149_1490 | 106 |
| 650 | 3300036401 | Ga0373937_0000976 | Ga0373937_0000976_4093_4440 | 106 |
| 651 | 3300036401 | Ga0373937_0196750 | Ga0373937_0196750_160_480 | 106 |
| 652 | 3300037068 | Ga0373925_0009072 | Ga0373925_0009072_6003_6344 | 106 |
| 653 | 3300037312 | Ga0395899_0002136 | Ga0395899_0002136_1046_1366 | 106 |
| 654 | 3300037312 | Ga0395899_0002201 | Ga0395899_0002201_9899_10219 | 106 |
| 655 | 3300037312 | Ga0395899_0019734 | Ga0395899_0019734_4504_4824 | 106 |
| 656 | 3300037312 | Ga0395899_0026936 | Ga0395899_0026936_3596_3916 | 106 |
| 657 | 3300037312 | Ga0395899_0052492 | Ga0395899_0052492_1819_2139 | 106 |
| 658 | 3300037312 | Ga0395899_0101106 | Ga0395899_0101106_977_1297 | 106 |
| 659 | 3300037312 | Ga0395899_0123714 | Ga0395899_0123714_1311_1631 | 106 |
| 660 | 3300037312 | Ga0395899_0220748 | Ga0395899_0220748_198_521 | 106 |
| 661 | 3300037312 | Ga0395899_0456164 | Ga0395899_0456164_395_715 | 106 |
| 662 | 3300037312 | Ga0395899_0556228 | Ga0395899_0556228_301_621 | 106 |
| 663 | 3300037312 | Ga0395899_0883041 | Ga0395899_0883041_145_465 | 106 |
| 664 | 3300037312 | Ga0395899_0950143 | Ga0395899_0950143_10_330 | 106 |
| 665 | 3300037418 | Ga0395900_0001291 | Ga0395900_0001291_16722_17042 | 106 |
| 666 | 3300037418 | Ga0395900_0001589 | Ga0395900_0001589_7107_7427 | 106 |
| 667 | 3300037418 | Ga0395900_0003136 | Ga0395900_0003136_6872_7192 | 106 |
| 668 | 3300037418 | Ga0395900_0004208 | Ga0395900_0004208_2838_3158 | 106 |
| 669 | 3300037418 | Ga0395900_0019234 | Ga0395900_0019234_2315_2653 | 106 |
| 670 | 3300037418 | Ga0395900_0032656 | Ga0395900_0032656_775_1095 | 106 |
| 671 | 3300037418 | Ga0395900_0033591 | Ga0395900_0033591_4195_4518 | 106 |
| 672 | 3300037418 | Ga0395900_0059917 | Ga0395900_0059917_1976_2296 | 106 |
| 673 | 3300037418 | Ga0395900_0158276 | Ga0395900_0158276_828_1148 | 106 |
| 674 | 3300037418 | Ga0395900_0220711 | Ga0395900_0220711_292_612 | 106 |
| 675 | 3300037418 | Ga0395900_0238306 | Ga0395900_0238306_882_1202 | 106 |
| 676 | 3300037418 | Ga0395900_0448053 | Ga0395900_0448053_282_602 | 106 |
| 677 | 3300037418 | Ga0395900_1044094 | Ga0395900_1044094_296_616 | 106 |
| 678 | 3300037418 | Ga0395900_1404172 | Ga0395900_1404172_47_367 | 106 |
| 679 | 3300037418 | Ga0395900_1899646 | Ga0395900_1899646_155_475 | 106 |
| 680 | 3300037466 | Ga0395898_0001958 | Ga0395898_0001958_15628_15948 | 106 |
| 681 | 3300037466 | Ga0395898_0001958 | Ga0395898_0001958_8960_9280 | 106 |
| 682 | 3300037466 | Ga0395898_0004997 | Ga0395898_0004997_5684_6004 | 106 |
| 683 | 3300037466 | Ga0395898_0006008 | Ga0395898_0006008_4690_5010 | 106 |
| 684 | 3300037466 | Ga0395898_0021621 | Ga0395898_0021621_1598_1918 | 106 |
| 685 | 3300037466 | Ga0395898_0024332 | Ga0395898_0024332_1006_1326 | 106 |
| 686 | 3300037466 | Ga0395898_0037004 | Ga0395898_0037004_3357_3680 | 106 |
| 687 | 3300037466 | Ga0395898_0050486 | Ga0395898_0050486_433_753 | 106 |
| 688 | 3300037466 | Ga0395898_0058954 | Ga0395898_0058954_440_760 | 106 |
| 689 | 3300037466 | Ga0395898_0076990 | Ga0395898_0076990_768_1088 | 106 |
| 690 | 3300037466 | Ga0395898_0086397 | Ga0395898_0086397_1309_1629 | 106 |
| 691 | 3300037466 | Ga0395898_0097794 | Ga0395898_0097794_2008_2328 | 106 |
| 692 | 3300037466 | Ga0395898_0115575 | Ga0395898_0115575_1457_1777 | 106 |
| 693 | 3300037466 | Ga0395898_0158397 | Ga0395898_0158397_1388_1726 | 106 |
| 694 | 3300037466 | Ga0395898_0159525 | Ga0395898_0159525_1593_1913 | 106 |
| 695 | 3300037466 | Ga0395898_0312764 | Ga0395898_0312764_191_511 | 106 |
| 696 | 3300037466 | Ga0395898_0416511 | Ga0395898_0416511_67_405 | 106 |
| 697 | 3300037466 | Ga0395898_1332445 | Ga0395898_1332445_44_364 | 106 |
| 698 | 3300037471 | Ga0395905_0003055 | Ga0395905_0003055_8455_8775 | 106 |
| 699 | 3300037471 | Ga0395905_0003667 | Ga0395905_0003667_5624_5944 | 106 |
| 700 | 3300037471 | Ga0395905_0004895 | Ga0395905_0004895_10105_10425 | 106 |
| 701 | 3300037471 | Ga0395905_0010536 | Ga0395905_0010536_1917_2240 | 106 |
| 702 | 3300037471 | Ga0395905_0010934 | Ga0395905_0010934_943_1263 | 106 |
| 703 | 3300037471 | Ga0395905_0025905 | Ga0395905_0025905_3765_4085 | 106 |
| 704 | 3300037471 | Ga0395905_0027603 | Ga0395905_0027603_1644_1964 | 106 |
| 705 | 3300037471 | Ga0395905_0063518 | Ga0395905_0063518_2341_2661 | 106 |
| 706 | 3300037471 | Ga0395905_0066386 | Ga0395905_0066386_369_689 | 106 |
| 707 | 3300037471 | Ga0395905_0284173 | Ga0395905_0284173_444_764 | 106 |
| 708 | 3300037471 | Ga0395905_0620099 | Ga0395905_0620099_614_934 | 106 |
| 709 | 3300037471 | Ga0395905_1018127 | Ga0395905_1018127_102_422 | 106 |
| 710 | 3300037471 | Ga0395905_1357009 | Ga0395905_1357009_102_422 | 106 |
| 711 | 3300037471 | Ga0395905_1407633 | Ga0395905_1407633_12_332 | 106 |
| 712 | 3300038443 | Ga0395901_0000365 | Ga0395901_0000365_34339_34659 | 106 |
| 713 | 3300038443 | Ga0395901_0000733 | Ga0395901_0000733_13228_13548 | 106 |
| 714 | 3300038443 | Ga0395901_0002616 | Ga0395901_0002616_7061_7381 | 106 |
| 715 | 3300038443 | Ga0395901_0006872 | Ga0395901_0006872_5972_6292 | 106 |
| 716 | 3300038443 | Ga0395901_0008831 | Ga0395901_0008831_8245_8565 | 106 |
| 717 | 3300038443 | Ga0395901_0042881 | Ga0395901_0042881_1741_2064 | 106 |
| 718 | 3300038443 | Ga0395901_0058533 | Ga0395901_0058533_145_465 | 106 |
| 719 | 3300038443 | Ga0395901_0058930 | Ga0395901_0058930_2462_2782 | 106 |
| 720 | 3300038443 | Ga0395901_0065057 | Ga0395901_0065057_1188_1508 | 106 |
| 721 | 3300038443 | Ga0395901_0079355 | Ga0395901_0079355_120_440 | 106 |
| 722 | 3300038443 | Ga0395901_0096099 | Ga0395901_0096099_755_1075 | 106 |
| 723 | 3300038443 | Ga0395901_0129195 | Ga0395901_0129195_1798_2118 | 106 |
| 724 | 3300038443 | Ga0395901_0187425 | Ga0395901_0187425_1836_2156 | 106 |
| 725 | 3300038443 | Ga0395901_0385807 | Ga0395901_0385807_689_1009 | 106 |
| 726 | 3300038443 | Ga0395901_0507213 | Ga0395901_0507213_245_565 | 106 |
| 727 | 3300038443 | Ga0395901_0673091 | Ga0395901_0673091_310_630 | 106 |
| 728 | 3300038443 | Ga0395901_1151156 | Ga0395901_1151156_66_386 | 106 |
| 729 | 3300038996 | Ga0242420_109294 | Ga0242420_109294_216_536 | 106 |
| 730 | 3300039453 | Ga0436362_0464294 | Ga0436362_0464294_1133_1453 | 106 |
| 731 | 3300041441 | Ga0451787_344860 | Ga0451787_344860_75_395 | 106 |
| 732 | 3300041443 | Ga0451789_0290400 | Ga0451789_0290400_322_642 | 106 |
| 733 | 3300041452 | Ga0451793_0231132 | Ga0451793_0231132_124_444 | 106 |
| 734 | 3300041460 | Ga0451802_1319019 | Ga0451802_1319019_110_430 | 106 |
| 735 | 3300041498 | Ga0451841_0813533 | Ga0451841_0813533_51_371 | 106 |
| 736 | 3300041512 | Ga0451853_0299360 | Ga0451853_0299360_178_498 | 106 |
| 737 | 3300041512 | Ga0451853_2286262 | Ga0451853_2286262_174_494 | 106 |
| 738 | 3300042461 | Ga0439460_0366864 | Ga0439460_0366864_44_364 | 106 |
| 739 | 3300044706 | Ga0466964_0471831 | Ga0466964_0471831_290_610 | 106 |
| 740 | 3300044735 | Ga0466968_0322805 | Ga0466968_0322805_389_709 | 106 |
| 741 | 3300044901 | Ga0466960_0181431 | Ga0466960_0181431_113_433 | 106 |
| 742 | 3300046454 | Ga0495592_0628131 | Ga0495592_0628131_215_535 | 106 |
| 743 | 3300046455 | Ga0495603_0006924 | Ga0495603_0006924_2576_2896 | 106 |
| 744 | 3300046455 | Ga0495603_0044418 | Ga0495603_0044418_1638_1979 | 106 |
| 745 | 3300046459 | Ga0495629_0076795 | Ga0495629_0076795_382_702 | 106 |
| 746 | 3300046473 | Ga0495582_0010101 | Ga0495582_0010101_4728_5048 | 106 |
| 747 | 3300046473 | Ga0495582_0320164 | Ga0495582_0320164_305_625 | 106 |
| 748 | 3300046473 | Ga0495582_0905186 | Ga0495582_0905186_74_394 | 106 |
| 749 | 3300046474 | Ga0495605_0205845 | Ga0495605_0205845_248_568 | 106 |
| 750 | 3300046474 | Ga0495605_0351393 | Ga0495605_0351393_158_478 | 106 |
| 751 | 3300046477 | Ga0495664_0455603 | Ga0495664_0455603_297_617 | 106 |
| 752 | 3300046491 | Ga0495584_0010520 | Ga0495584_0010520_368_688 | 106 |
| 753 | 3300046491 | Ga0495584_0079643 | Ga0495584_0079643_999_1319 | 106 |
| 754 | 3300046491 | Ga0495584_0158833 | Ga0495584_0158833_727_1047 | 106 |
| 755 | 3300046491 | Ga0495584_0360143 | Ga0495584_0360143_388_708 | 106 |
| 756 | 3300046492 | Ga0495585_0175909 | Ga0495585_0175909_23_343 | 106 |
| 757 | 3300046492 | Ga0495585_0227308 | Ga0495585_0227308_225_545 | 106 |
| 758 | 3300046492 | Ga0495585_0230594 | Ga0495585_0230594_362_682 | 106 |
| 759 | 3300046500 | Ga0495596_0088582 | Ga0495596_0088582_487_807 | 106 |
| 760 | 3300046501 | Ga0495607_0137220 | Ga0495607_0137220_199_519 | 106 |
| 761 | 3300046513 | Ga0495616_0280941 | Ga0495616_0280941_181_501 | 106 |
| 762 | 3300046515 | Ga0495620_0187768 | Ga0495620_0187768_21_341 | 106 |
| 763 | 3300046516 | Ga0495628_0535041 | Ga0495628_0535041_387_707 | 106 |
| 764 | 3300046516 | Ga0495628_1260081 | Ga0495628_1260081_132_452 | 106 |
| 765 | 3300046517 | Ga0495630_0064570 | Ga0495630_0064570_2060_2380 | 106 |
| 766 | 3300046518 | Ga0495631_0492997 | Ga0495631_0492997_127_447 | 106 |
| 767 | 3300046523 | Ga0495644_0135293 | Ga0495644_0135293_403_723 | 106 |
| 768 | 3300046523 | Ga0495644_0176109 | Ga0495644_0176109_465_785 | 106 |
| 769 | 3300046525 | Ga0495663_0011178 | Ga0495663_0011178_539_859 | 106 |
| 770 | 3300046528 | Ga0495642_0140690 | Ga0495642_0140690_132_452 | 106 |
| 771 | 3300046528 | Ga0495642_0176899 | Ga0495642_0176899_57_377 | 106 |
| 772 | 3300046531 | Ga0495665_0307697 | Ga0495665_0307697_57_377 | 106 |
| 773 | 3300046533 | Ga0495640_0858987 | Ga0495640_0858987_62_382 | 106 |
| 774 | 3300046535 | Ga0495586_0619210 | Ga0495586_0619210_83_403 | 106 |
| 775 | 3300046537 | Ga0495598_0244365 | Ga0495598_0244365_59_379 | 106 |
| 776 | 3300046538 | Ga0495609_0215286 | Ga0495609_0215286_35_355 | 106 |
| 777 | 3300046538 | Ga0495609_0275249 | Ga0495609_0275249_248_568 | 106 |
| 778 | 3300046538 | Ga0495609_0358146 | Ga0495609_0358146_207_527 | 106 |
| 779 | 3300046539 | Ga0495621_0178945 | Ga0495621_0178945_200_520 | 106 |
| 780 | 3300046615 | Ga0495656_0112466 | Ga0495656_0112466_12_332 | 106 |
| 781 | 3300046615 | Ga0495656_0135648 | Ga0495656_0135648_387_707 | 106 |
| 782 | 3300046615 | Ga0495656_0725864 | Ga0495656_0725864_144_464 | 106 |
| 783 | 3300046616 | Ga0495668_0117623 | Ga0495668_0117623_380_700 | 106 |
| 784 | 3300046616 | Ga0495668_0615082 | Ga0495668_0615082_259_579 | 106 |
| 785 | 3300046648 | Ga0495611_0054373 | Ga0495611_0054373_178_498 | 106 |
| 786 | 3300046664 | Ga0495659_0134886 | Ga0495659_0134886_618_938 | 106 |
| 787 | 3300046664 | Ga0495659_0187982 | Ga0495659_0187982_512_832 | 106 |
| 788 | 3300046665 | Ga0495661_0230215 | Ga0495661_0230215_606_926 | 106 |
| 789 | 3300046674 | Ga0495588_0096038 | Ga0495588_0096038_412_732 | 106 |
| 790 | 3300046674 | Ga0495588_0640988 | Ga0495588_0640988_49_369 | 106 |
| 791 | 3300046675 | Ga0495657_0139204 | Ga0495657_0139204_362_682 | 106 |
| 792 | 3300046679 | Ga0495623_0045784 | Ga0495623_0045784_1677_2024 | 106 |
| 793 | 3300046683 | Ga0495658_0158978 | Ga0495658_0158978_329_649 | 106 |
| 794 | 3300046683 | Ga0495658_0268439 | Ga0495658_0268439_599_940 | 106 |
| 795 | 3300046684 | Ga0495669_0138377 | Ga0495669_0138377_402_722 | 106 |
| 796 | 3300046689 | Ga0495613_1103274 | Ga0495613_1103274_47_367 | 106 |
| 797 | 3300046690 | Ga0495624_0086679 | Ga0495624_0086679_1510_1830 | 106 |
| 798 | 3300046690 | Ga0495624_0735291 | Ga0495624_0735291_170_490 | 106 |
| 799 | 3300046690 | Ga0495624_0761507 | Ga0495624_0761507_93_413 | 106 |
| 800 | 3300046691 | Ga0495670_0127320 | Ga0495670_0127320_783_1103 | 106 |
| 801 | 3300046692 | Ga0495671_0583572 | Ga0495671_0583572_149_469 | 106 |
| 802 | 3300046694 | Ga0495649_0375489 | Ga0495649_0375489_317_637 | 106 |
| 803 | 3300046794 | Ga0495589_0110939 | Ga0495589_0110939_493_813 | 106 |
| 804 | 3300046794 | Ga0495589_0141693 | Ga0495589_0141693_55_375 | 106 |
| 805 | 3300046794 | Ga0495589_0470033 | Ga0495589_0470033_29_349 | 106 |
| 806 | 3300046809 | Ga0495600_0559744 | Ga0495600_0559744_168_488 | 106 |
| 807 | 3300046810 | Ga0495660_0193787 | Ga0495660_0193787_578_898 | 106 |
| 808 | 3300047315 | Ga0495581_0011147 | Ga0495581_0011147_1064_1384 | 106 |
| 809 | 3300047315 | Ga0495581_0351626 | Ga0495581_0351626_244_564 | 106 |
| 810 | 3300047317 | Ga0495604_0576136 | Ga0495604_0576136_358_678 | 106 |
| 811 | 3300047319 | Ga0495674_0564872 | Ga0495674_0564872_48_368 | 106 |
| 812 | 3300047319 | Ga0495674_0688361 | Ga0495674_0688361_260_580 | 106 |
| 813 | 3300047319 | Ga0495674_1478701 | Ga0495674_1478701_122_442 | 106 |
| 814 | 3300047321 | Ga0495676_0022756 | Ga0495676_0022756_2890_3210 | 106 |
| 815 | 3300047322 | Ga0495680_0703744 | Ga0495680_0703744_123_443 | 106 |
| 816 | 3300047323 | Ga0495683_0297768 | Ga0495683_0297768_28_348 | 106 |
| 817 | 3300047445 | Ga0495677_0051254 | Ga0495677_0051254_330_650 | 106 |
| 818 | 3300047447 | Ga0495685_149552 | Ga0495685_149552_294_614 | 106 |
| 819 | 3300048088 | Ga0495602_0014286 | Ga0495602_0014286_4729_5076 | 106 |
| 820 | 3300048088 | Ga0495602_1033497 | Ga0495602_1033497_26_346 | 106 |
| 821 | 3300048090 | Ga0495615_0288854 | Ga0495615_0288854_77_397 | 106 |
| 822 | 3300048903 | Ga0496100_0098791 | Ga0496100_0098791_484_804 | 106 |
| 823 | 3300048903 | Ga0496100_0145724 | Ga0496100_0145724_742_1062 | 106 |
| 824 | 3300048903 | Ga0496100_0421503 | Ga0496100_0421503_22_342 | 106 |
| 825 | 3300048903 | Ga0496100_0532293 | Ga0496100_0532293_92_412 | 106 |
| 826 | 3300048903 | Ga0496100_0861372 | Ga0496100_0861372_139_459 | 106 |
| 827 | 3300048904 | Ga0496101_0062776 | Ga0496101_0062776_1326_1646 | 106 |
| 828 | 3300048904 | Ga0496101_0235876 | Ga0496101_0235876_852_1172 | 106 |
| 829 | 3300048904 | Ga0496101_0502133 | Ga0496101_0502133_175_495 | 106 |
| 830 | 3300048904 | Ga0496101_0553002 | Ga0496101_0553002_154_474 | 106 |
| 831 | 3300048904 | Ga0496101_0599768 | Ga0496101_0599768_208_528 | 106 |
| 832 | 3300048904 | Ga0496101_1552032 | Ga0496101_1552032_168_488 | 106 |
| 833 | 3300048905 | Ga0496102_0060285 | Ga0496102_0060285_1847_2167 | 106 |
| 834 | 3300048905 | Ga0496102_0079208 | Ga0496102_0079208_2261_2581 | 106 |
| 835 | 3300048905 | Ga0496102_0403143 | Ga0496102_0403143_690_1010 | 106 |
| 836 | 3300048905 | Ga0496102_0622550 | Ga0496102_0622550_547_867 | 106 |
| 837 | 3300048906 | Ga0496103_0166424 | Ga0496103_0166424_944_1264 | 106 |
| 838 | 3300048906 | Ga0496103_0329040 | Ga0496103_0329040_399_719 | 106 |
| 839 | 3300048906 | Ga0496103_0340212 | Ga0496103_0340212_239_559 | 106 |
| 840 | 3300048906 | Ga0496103_0742264 | Ga0496103_0742264_274_594 | 106 |
| 841 | 3300048907 | Ga0496104_0019682 | Ga0496104_0019682_5377_5697 | 106 |
| 842 | 3300048907 | Ga0496104_0053765 | Ga0496104_0053765_1107_1427 | 106 |
| 843 | 3300048907 | Ga0496104_0095470 | Ga0496104_0095470_1876_2196 | 106 |
| 844 | 3300048907 | Ga0496104_0223839 | Ga0496104_0223839_391_711 | 106 |
| 845 | 3300048907 | Ga0496104_1475110 | Ga0496104_1475110_200_520 | 106 |
| 846 | 3300048908 | Ga0496105_0015245 | Ga0496105_0015245_4685_5005 | 106 |
| 847 | 3300048908 | Ga0496105_0059466 | Ga0496105_0059466_460_780 | 106 |
| 848 | 3300048908 | Ga0496105_0109557 | Ga0496105_0109557_1253_1573 | 106 |
| 849 | 3300048908 | Ga0496105_0171800 | Ga0496105_0171800_984_1304 | 106 |
| 850 | 3300048908 | Ga0496105_0288678 | Ga0496105_0288678_866_1186 | 106 |
| 851 | 3300048908 | Ga0496105_0309367 | Ga0496105_0309367_255_581 | 106 |
| 852 | 3300048908 | Ga0496105_0332615 | Ga0496105_0332615_294_614 | 106 |
| 853 | 3300048908 | Ga0496105_0729513 | Ga0496105_0729513_361_681 | 106 |
| 854 | 3300048909 | Ga0496106_0060225 | Ga0496106_0060225_683_1003 | 106 |
| 855 | 3300048909 | Ga0496106_0243252 | Ga0496106_0243252_954_1274 | 106 |
| 856 | 3300048909 | Ga0496106_0387423 | Ga0496106_0387423_781_1101 | 106 |
| 857 | 3300048910 | Ga0496107_0230240 | Ga0496107_0230240_549_869 | 106 |
| 858 | 3300048910 | Ga0496107_0237460 | Ga0496107_0237460_407_727 | 106 |
| 859 | 3300048910 | Ga0496107_0352326 | Ga0496107_0352326_218_538 | 106 |
| 860 | 3300048910 | Ga0496107_0381662 | Ga0496107_0381662_622_942 | 106 |
| 861 | 3300048910 | Ga0496107_0534137 | Ga0496107_0534137_455_775 | 106 |
| 862 | 3300048910 | Ga0496107_0751248 | Ga0496107_0751248_241_561 | 106 |
| 863 | 3300048911 | Ga0496108_0018657 | Ga0496108_0018657_413_733 | 106 |
| 864 | 3300048911 | Ga0496108_0494554 | Ga0496108_0494554_645_965 | 106 |
| 865 | 3300048911 | Ga0496108_0697428 | Ga0496108_0697428_338_658 | 106 |
| 866 | 3300048912 | Ga0496109_0006589 | Ga0496109_0006589_59_379 | 106 |
| 867 | 3300048912 | Ga0496109_0019302 | Ga0496109_0019302_3858_4178 | 106 |
| 868 | 3300048912 | Ga0496109_0102063 | Ga0496109_0102063_284_604 | 106 |
| 869 | 3300048912 | Ga0496109_0211663 | Ga0496109_0211663_1028_1348 | 106 |
| 870 | 3300048912 | Ga0496109_0368273 | Ga0496109_0368273_584_904 | 106 |
| 871 | 3300048912 | Ga0496109_0442270 | Ga0496109_0442270_580_900 | 106 |
| 872 | 3300048912 | Ga0496109_0549210 | Ga0496109_0549210_217_537 | 106 |
| 873 | 3300048912 | Ga0496109_0951663 | Ga0496109_0951663_454_774 | 106 |
| 874 | 3300048913 | Ga0496110_0064072 | Ga0496110_0064072_2224_2544 | 106 |
| 875 | 3300048913 | Ga0496110_0076941 | Ga0496110_0076941_1319_1639 | 106 |
| 876 | 3300048913 | Ga0496110_0127898 | Ga0496110_0127898_1475_1795 | 106 |
| 877 | 3300048913 | Ga0496110_0140161 | Ga0496110_0140161_1441_1761 | 106 |
| 878 | 3300048913 | Ga0496110_0526254 | Ga0496110_0526254_547_867 | 106 |
| 879 | 3300048913 | Ga0496110_1001407 | Ga0496110_1001407_284_604 | 106 |
| 880 | 3300048914 | Ga0496111_0001245 | Ga0496111_0001245_2468_2788 | 106 |
| 881 | 3300048914 | Ga0496111_0019004 | Ga0496111_0019004_3788_4108 | 106 |
| 882 | 3300048914 | Ga0496111_0059104 | Ga0496111_0059104_1320_1640 | 106 |
| 883 | 3300048914 | Ga0496111_0140117 | Ga0496111_0140117_691_1017 | 106 |
| 884 | 3300048914 | Ga0496111_0174875 | Ga0496111_0174875_921_1241 | 106 |
| 885 | 3300048914 | Ga0496111_0531987 | Ga0496111_0531987_506_826 | 106 |
| 886 | 3300048914 | Ga0496111_0919263 | Ga0496111_0919263_19_339 | 106 |
| 887 | 3300048915 | Ga0496112_0004570 | Ga0496112_0004570_3135_3455 | 106 |
| 888 | 3300048915 | Ga0496112_0067916 | Ga0496112_0067916_2593_2913 | 106 |
| 889 | 3300048915 | Ga0496112_0103688 | Ga0496112_0103688_619_939 | 106 |
| 890 | 3300048915 | Ga0496112_0133753 | Ga0496112_0133753_1262_1582 | 106 |
| 891 | 3300048915 | Ga0496112_0203903 | Ga0496112_0203903_293_613 | 106 |
| 892 | 3300048915 | Ga0496112_0556332 | Ga0496112_0556332_494_814 | 106 |
| 893 | 3300048915 | Ga0496112_1229362 | Ga0496112_1229362_186_506 | 106 |
| 894 | 3300048916 | Ga0496113_0004202 | Ga0496113_0004202_233_553 | 106 |
| 895 | 3300048916 | Ga0496113_0010188 | Ga0496113_0010188_3060_3380 | 106 |
| 896 | 3300048916 | Ga0496113_0051293 | Ga0496113_0051293_313_633 | 106 |
| 897 | 3300048916 | Ga0496113_0054226 | Ga0496113_0054226_540_866 | 106 |
| 898 | 3300048916 | Ga0496113_0149116 | Ga0496113_0149116_941_1261 | 106 |
| 899 | 3300048916 | Ga0496113_0369802 | Ga0496113_0369802_812_1132 | 106 |
| 900 | 3300048917 | Ga0496114_0004595 | Ga0496114_0004595_432_752 | 106 |
| 901 | 3300048917 | Ga0496114_0085207 | Ga0496114_0085207_1144_1464 | 106 |
| 902 | 3300048917 | Ga0496114_0325633 | Ga0496114_0325633_818_1138 | 106 |
| 903 | 3300048917 | Ga0496114_0352959 | Ga0496114_0352959_707_1027 | 106 |
| 904 | 3300048917 | Ga0496114_0430931 | Ga0496114_0430931_171_491 | 106 |
| 905 | 3300048917 | Ga0496114_0635371 | Ga0496114_0635371_511_831 | 106 |
| 906 | 3300048917 | Ga0496114_0798700 | Ga0496114_0798700_152_472 | 106 |
| 907 | 3300048918 | Ga0496115_0000719 | Ga0496115_0000719_13174_13494 | 106 |
| 908 | 3300048918 | Ga0496115_0017246 | Ga0496115_0017246_20_340 | 106 |
| 909 | 3300048918 | Ga0496115_0397844 | Ga0496115_0397844_539_859 | 106 |
| 910 | 3300048918 | Ga0496115_0771008 | Ga0496115_0771008_22_342 | 106 |
| 911 | 3300049568 | Ga0501031_0098812 | Ga0501031_0098812_605_925 | 106 |
| 912 | 3300049572 | Ga0501036_0801312 | Ga0501036_0801312_82_438 | 106 |
| 913 | 3300049576 | Ga0501040_0336033 | Ga0501040_0336033_281_601 | 106 |
| 914 | 3300049577 | Ga0501041_0297965 | Ga0501041_0297965_289_609 | 106 |
| 915 | 3300049580 | Ga0501046_0119258 | Ga0501046_0119258_178_498 | 106 |
| 916 | 3300049586 | Ga0501070_1477973 | Ga0501070_1477973_126_467 | 106 |
| 917 | 3300049587 | Ga0501071_0228115 | Ga0501071_0228115_698_1018 | 106 |
| 918 | 3300049587 | Ga0501071_0229855 | Ga0501071_0229855_118_459 | 106 |
| 919 | 3300049588 | Ga0501072_0312901 | Ga0501072_0312901_836_1156 | 106 |
| 920 | 3300049590 | Ga0501074_0111653 | Ga0501074_0111653_671_991 | 106 |
| 921 | 3300049590 | Ga0501074_0811417 | Ga0501074_0811417_249_590 | 106 |
| 922 | 3300049591 | Ga0501075_0355166 | Ga0501075_0355166_629_949 | 106 |
| 923 | 3300049591 | Ga0501075_0708487 | Ga0501075_0708487_144_464 | 106 |
| 924 | 3300049592 | Ga0501076_0308750 | Ga0501076_0308750_816_1157 | 106 |
| 925 | 3300049592 | Ga0501076_0334975 | Ga0501076_0334975_909_1229 | 106 |
| 926 | 3300049593 | Ga0501077_0014651 | Ga0501077_0014651_1787_2107 | 106 |
| 927 | 3300049741 | Ga0501079_0523606 | Ga0501079_0523606_279_599 | 106 |
| 928 | 3300049741 | Ga0501079_0557632 | Ga0501079_0557632_332_652 | 106 |
| 929 | 3300049742 | Ga0501080_0834098 | Ga0501080_0834098_202_543 | 106 |
| 930 | 3300049743 | Ga0501081_0370331 | Ga0501081_0370331_705_1025 | 106 |
| 931 | 3300049743 | Ga0501081_0461031 | Ga0501081_0461031_95_436 | 106 |
| 932 | 3300050494 | nmdc:mga06z11_207454_c1 | nmdc:mga06z11_207454_c1_523_843 | 106 |
| 933 | 3300050507 | nmdc:mga05p37_126299_c1 | nmdc:mga05p37_126299_c1_868_1188 | 106 |
| 934 | 3300050507 | nmdc:mga05p37_152131_c1 | nmdc:mga05p37_152131_c1_904_1224 | 106 |
| 935 | 3300050507 | nmdc:mga05p37_1770313_c1 | nmdc:mga05p37_1770313_c1_209_529 | 106 |
| 936 | 3300050507 | nmdc:mga05p37_317867_c1 | nmdc:mga05p37_317867_c1_212_532 | 106 |
| 937 | 3300050508 | nmdc:mga09592_1445061_c1 | nmdc:mga09592_1445061_c1_19_339 | 106 |
| 938 | 3300050509 | nmdc:mga0qj67_353467_c1 | nmdc:mga0qj67_353467_c1_113_433 | 106 |
| 939 | 3300050510 | nmdc:mga06r32_270595_c1 | nmdc:mga06r32_270595_c1_280_600 | 106 |
| 940 | 3300050510 | nmdc:mga06r32_444607_c1 | nmdc:mga06r32_444607_c1_535_855 | 106 |
| 941 | 3300050510 | nmdc:mga06r32_486579_c1 | nmdc:mga06r32_486579_c1_811_1131 | 106 |
| 942 | 3300050510 | nmdc:mga06r32_626955_c1 | nmdc:mga06r32_626955_c1_268_633 | 106 |
| 943 | 3300050511 | nmdc:mga08y16_207947_c1 | nmdc:mga08y16_207947_c1_332_652 | 106 |
| 944 | 3300050511 | nmdc:mga08y16_33123_c1 | nmdc:mga08y16_33123_c1_590_910 | 106 |
| 945 | 3300050511 | nmdc:mga08y16_448142_c1 | nmdc:mga08y16_448142_c1_464_784 | 106 |
| 946 | 3300050511 | nmdc:mga08y16_601066_c1 | nmdc:mga08y16_601066_c1_721_1041 | 106 |
| 947 | 3300050512 | nmdc:mga0n895_112477_c1 | nmdc:mga0n895_112477_c1_721_1041 | 106 |
| 948 | 3300050512 | nmdc:mga0n895_138768_c1 | nmdc:mga0n895_138768_c1_1635_1955 | 106 |
| 949 | 3300050512 | nmdc:mga0n895_1631416_c1 | nmdc:mga0n895_1631416_c1_93_413 | 106 |
| 950 | 3300050512 | nmdc:mga0n895_2036586_c1 | nmdc:mga0n895_2036586_c1_176_496 | 106 |
| 951 | 3300050512 | nmdc:mga0n895_367332_c1 | nmdc:mga0n895_367332_c1_1118_1438 | 106 |
| 952 | 3300050512 | nmdc:mga0n895_67480_c1 | nmdc:mga0n895_67480_c1_868_1188 | 106 |
| 953 | 3300050513 | nmdc:mga0rr50_1148081_c1 | nmdc:mga0rr50_1148081_c1_231_551 | 106 |
| 954 | 3300050513 | nmdc:mga0rr50_1169198_c1 | nmdc:mga0rr50_1169198_c1_91_411 | 106 |
| 955 | 3300050513 | nmdc:mga0rr50_1638232_c1 | nmdc:mga0rr50_1638232_c1_117_437 | 106 |
| 956 | 3300050513 | nmdc:mga0rr50_2948_c1 | nmdc:mga0rr50_2948_c1_8051_8371 | 106 |
| 957 | 3300050513 | nmdc:mga0rr50_322216_c1 | nmdc:mga0rr50_322216_c1_926_1246 | 106 |
| 958 | 3300050513 | nmdc:mga0rr50_600007_c1 | nmdc:mga0rr50_600007_c1_285_605 | 106 |
| 959 | 3300050513 | nmdc:mga0rr50_626028_c1 | nmdc:mga0rr50_626028_c1_448_768 | 106 |
| 960 | 3300050514 | nmdc:mga08x19_2470_c1 | nmdc:mga08x19_2470_c1_504_824 | 106 |
| 961 | 3300050514 | nmdc:mga08x19_535449_c1 | nmdc:mga08x19_535449_c1_407_727 | 106 |
| 962 | 3300050514 | nmdc:mga08x19_8074_c1 | nmdc:mga08x19_8074_c1_2385_2705 | 106 |
| 963 | 3300050515 | nmdc:mga0a205_1203477_c1 | nmdc:mga0a205_1203477_c1_233_553 | 106 |
| 964 | 3300050515 | nmdc:mga0a205_16811_c1 | nmdc:mga0a205_16811_c1_1648_1968 | 106 |
| 965 | 3300050515 | nmdc:mga0a205_220469_c1 | nmdc:mga0a205_220469_c1_1039_1359 | 106 |
| 966 | 3300050515 | nmdc:mga0a205_249276_c1 | nmdc:mga0a205_249276_c1_377_697 | 106 |
| 967 | 3300050515 | nmdc:mga0a205_332113_c1 | nmdc:mga0a205_332113_c1_977_1297 | 106 |
| 968 | 3300050515 | nmdc:mga0a205_618737_c1 | nmdc:mga0a205_618737_c1_343_663 | 106 |
| 969 | 3300053077 | Ga0495601_0713872 | Ga0495601_0713872_245_565 | 106 |
| 970 | 3300053078 | Ga0495612_0152474 | Ga0495612_0152474_633_980 | 106 |
| 971 | 3300053083 | Ga0495655_0162561 | Ga0495655_0162561_344_664 | 106 |
| 972 | 3300054114 | Ga0501084_0128769 | Ga0501084_0128769_472_813 | 106 |
| 973 | 3300060353 | Ga0501082_0141668 | Ga0501082_0141668_902_1222 | 106 |
| 974 | 3300060353 | Ga0501082_0388469 | Ga0501082_0388469_436_777 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9529 | 2 | 83 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9365 | 2 | 84 |
| 4a6d-assembly1.cif.gz_A | crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam | 0.9274 | 23 | 68 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9047 | 5 | 75 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9031 | 13 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9447 | 13 | 65 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9363 | 2 | 77 | 1.10.10.10 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9361 | 15 | 65 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.93 | 6 | 66 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9259 | 7 | 67 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5JG36-F1-model_v4 | DNA-binding transcriptional ArsR family regulator | 0.9727 | 2 | 81 |
GO:0003677
GO:0003700 |
| AF-A0A848UBD8-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9683 | 2 | 100 |
GO:0003700
|
| AF-A0A2T6KF80-F1-model_v4 | ArsR family transcriptional regulator | 0.966 | 1 | 80 |
GO:0003677
GO:0003700 |
| AF-A0A4Q3GMU9-F1-model_v4 | deleted | 0.9652 | 2 | 81 |
|
| AF-A0A1H2KN53-F1-model_v4 | DNA-binding transcriptional regulator, ArsR family | 0.9639 | 1 | 94 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar