F487205

General Info

Members Datasets Scaffolds Average Seq Length
974 340 973 106

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_102379173|Ga0075428_1023791731
Length 121
Sequence MTYQSAATWSALADPTRRAILDRLRDESRTVSTLAAGFDVSRPAISQHLKVLLDAGLVGERKEGRQRYYSLHAQPLRAVDAWLSAYRRFWERNLLGLKEYVEAEERTERRPKRGRKTEQES

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
189 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 13.86
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1044402 3300002073 Unclassified 555
2 Ga0070658_10428860 3300005327 Bacteria 1138
3 Ga0070658_11706863 3300005327 Unclassified 545
4 Ga0070676_10822642 3300005328 Unclassified 687
5 Ga0070683_100090739 3300005329 Bacteria 2869
6 Ga0070683_100101527 3300005329 Bacteria 2709
7 Ga0070683_100112705 3300005329 Bacteria 2567
8 Ga0070677_10282291 3300005333 Bacteria 837
9 Ga0068869_100138974 3300005334 Bacteria 1874
10 Ga0068869_100273229 3300005334 Unclassified 1357
11 Ga0070680_100303111 3300005336 Bacteria 1355
12 Ga0070680_100672675 3300005336 Bacteria 890
13 Ga0070680_100676325 3300005336 Bacteria 888
14 Ga0070682_100006477 3300005337 Bacteria 6583
15 Ga0070682_100518328 3300005337 Unclassified 927
16 Ga0070682_101354596 3300005337 Unclassified 607
17 Ga0068868_100060548 3300005338 Bacteria 2998
18 Ga0070660_100699058 3300005339 Unclassified 850
19 Ga0070689_100056184 3300005340 Bacteria 3052
20 Ga0070689_101964780 3300005340 Unclassified 535
21 Ga0070691_10191415 3300005341 Unclassified 1070
22 Ga0070691_10766322 3300005341 Unclassified 585
23 Ga0070687_100207905 3300005343 Bacteria 1190
24 Ga0070687_101280556 3300005343 Bacteria 544
25 Ga0070661_100244888 3300005344 Bacteria 1382
26 Ga0070668_100276760 3300005347 Bacteria 1400
27 Ga0070669_101302738 3300005353 Bacteria 629
28 Ga0070669_101660046 3300005353 Unclassified 557
29 Ga0070675_100078841 3300005354 Bacteria 2744
30 Ga0070675_100813560 3300005354 Bacteria 854
31 Ga0070675_101293695 3300005354 Bacteria 672
32 Ga0070671_100226357 3300005355 Bacteria 1587
33 Ga0070671_100647197 3300005355 Bacteria 915
34 Ga0070671_100803256 3300005355 Unclassified 819
35 Ga0070671_101389008 3300005355 Bacteria 620
36 Ga0070674_100007039 3300005356 Bacteria 6612
37 Ga0070674_100266072 3300005356 Bacteria 1353
38 Ga0070674_100981507 3300005356 Bacteria 740
39 Ga0070673_100106159 3300005364 Bacteria 2321
40 Ga0070673_100230066 3300005364 Bacteria 1608
41 Ga0070673_100540241 3300005364 Bacteria 1058
42 Ga0070673_102219931 3300005364 Unclassified 522
43 Ga0070688_100154130 3300005365 Bacteria 1573
44 Ga0070659_101255173 3300005366 Bacteria 656
45 Ga0070667_100204324 3300005367 Bacteria 1754
46 Ga0070703_10012614 3300005406 Bacteria 2395
47 Ga0070703_10158829 3300005406 Bacteria 856
48 Ga0070703_10509785 3300005406 Bacteria 543
49 Ga0070709_10010201 3300005434 Bacteria 5193
50 Ga0070709_10013995 3300005434 Unclassified 4527
51 Ga0070709_10078771 3300005434 Bacteria 2145
52 Ga0070709_10200734 3300005434 Unclassified 1412
53 Ga0070709_10735834 3300005434 Bacteria 770
54 Ga0070714_100668974 3300005435 Bacteria 1000
55 Ga0070714_100893277 3300005435 Unclassified 862
56 Ga0070713_100198314 3300005436 Bacteria 1812
57 Ga0070710_10015608 3300005437 Bacteria 3848
58 Ga0070710_10059350 3300005437 Bacteria 2172
59 Ga0070710_10357824 3300005437 Bacteria 968
60 Ga0070710_10650082 3300005437 Unclassified 739
61 Ga0070701_10058379 3300005438 Bacteria 2025
62 Ga0070701_10648310 3300005438 Unclassified 705
63 Ga0070701_11229175 3300005438 Bacteria 533
64 Ga0070711_100053930 3300005439 Bacteria 2773
65 Ga0070711_100066924 3300005439 Bacteria 2519
66 Ga0070711_100105853 3300005439 Bacteria 2055
67 Ga0070711_100216803 3300005439 Bacteria 1485
68 Ga0070711_100241048 3300005439 Bacteria 1414
69 Ga0070711_100848786 3300005439 Bacteria 777
70 Ga0070711_101007174 3300005439 Bacteria 715
71 Ga0070711_101555057 3300005439 Bacteria 578
72 Ga0070705_100055860 3300005440 Bacteria 2322
73 Ga0070705_100086775 3300005440 Bacteria 1938
74 Ga0070705_100773756 3300005440 Bacteria 761
75 Ga0070705_101379031 3300005440 Unclassified 587
76 Ga0070705_101898186 3300005440 Unclassified 507
77 Ga0070700_100032492 3300005441 Bacteria 3136
78 Ga0070700_101776599 3300005441 Unclassified 531
79 Ga0070694_100103932 3300005444 Bacteria 2013
80 Ga0070694_100260569 3300005444 Bacteria 1315
81 Ga0070694_100520672 3300005444 Bacteria 949
82 Ga0070694_101900076 3300005444 Unclassified 508
83 Ga0070708_100023312 3300005445 Bacteria 5262
84 Ga0070708_100096950 3300005445 Bacteria 2695
85 Ga0070708_100114600 3300005445 Bacteria 2480
86 Ga0070708_100129705 3300005445 Bacteria 2332
87 Ga0070708_100252045 3300005445 Bacteria 1658
88 Ga0070708_100321042 3300005445 Bacteria 1459
89 Ga0070708_100966715 3300005445 Bacteria 799
90 Ga0070663_100156331 3300005455 Bacteria 1752
91 Ga0070663_101586453 3300005455 Bacteria 583
92 Ga0070678_100006059 3300005456 Bacteria 7055
93 Ga0070678_100027265 3300005456 Bacteria 3878
94 Ga0070678_100176555 3300005456 Bacteria 1745
95 Ga0070678_100508479 3300005456 Unclassified 1064
96 Ga0070678_101538877 3300005456 Bacteria 623
97 Ga0070662_100153148 3300005457 Bacteria 1797
98 Ga0070662_100353028 3300005457 Unclassified 1205
99 Ga0070662_100950439 3300005457 Bacteria 735
100 Ga0070681_10067874 3300005458 Bacteria 3533
101 Ga0070681_10447922 3300005458 Unclassified 1203
102 Ga0070681_11104320 3300005458 Unclassified 714
103 Ga0068867_100101688 3300005459 Unclassified 2196
104 Ga0070685_10052029 3300005466 Bacteria 2369
105 Ga0070706_100008263 3300005467 Bacteria 9706
106 Ga0070706_100091857 3300005467 Unclassified 2816
107 Ga0070706_100197069 3300005467 Bacteria 1881
108 Ga0070706_100270509 3300005467 Bacteria 1586
109 Ga0070706_100387198 3300005467 Bacteria 1302
110 Ga0070706_101676874 3300005467 Unclassified 579
111 Ga0070707_100009180 3300005468 Bacteria 9173
112 Ga0070707_100093249 3300005468 Bacteria 2915
113 Ga0070707_100207265 3300005468 Unclassified 1911
114 Ga0070707_100525827 3300005468 Bacteria 1145
115 Ga0070707_100605527 3300005468 Bacteria 1058
116 Ga0070707_101103051 3300005468 Bacteria 760
117 Ga0070707_101143436 3300005468 Unclassified 745
118 Ga0070707_101799209 3300005468 Bacteria 580
119 Ga0070698_100004541 3300005471 Bacteria 15252
120 Ga0070698_100178885 3300005471 Bacteria 2059
121 Ga0070698_100209917 3300005471 Unclassified 1882
122 Ga0070698_100230235 3300005471 Bacteria 1786
123 Ga0070698_100282775 3300005471 Bacteria 1590
124 Ga0070699_100018853 3300005518 Bacteria 5929
125 Ga0070699_100055304 3300005518 Bacteria 3437
126 Ga0070684_100022106 3300005535 Bacteria 5302
127 Ga0070684_100032939 3300005535 Bacteria 4421
128 Ga0070684_100915199 3300005535 Unclassified 822
129 Ga0070697_100035973 3300005536 Bacteria 3997
130 Ga0068853_100288972 3300005539 Bacteria 1513
131 Ga0068853_101947688 3300005539 Unclassified 570
132 Ga0070672_100356307 3300005543 Unclassified 1248
133 Ga0070686_100298072 3300005544 Bacteria 1195
134 Ga0070686_100444744 3300005544 Bacteria 995
135 Ga0070686_101388161 3300005544 Bacteria 589
136 Ga0070695_100057596 3300005545 Bacteria 2511
137 Ga0070695_101427571 3300005545 Unclassified 574
138 Ga0070696_100012929 3300005546 Bacteria 5606
139 Ga0070696_100487491 3300005546 Bacteria 978
140 Ga0070696_100892976 3300005546 Unclassified 737
141 Ga0070696_101233520 3300005546 Bacteria 633
142 Ga0070696_101831956 3300005546 Unclassified 525
143 Ga0070693_100314642 3300005547 Bacteria 1060
144 Ga0070693_100369772 3300005547 Bacteria 986
145 Ga0070665_101655678 3300005548 Unclassified 647
146 Ga0070704_100017166 3300005549 Bacteria 4595
147 Ga0070704_100465025 3300005549 Unclassified 1092
148 Ga0070704_101037707 3300005549 Bacteria 743
149 Ga0070704_101055689 3300005549 Bacteria 737
150 Ga0070704_101165879 3300005549 Unclassified 702
151 Ga0070704_101478371 3300005549 Unclassified 624
152 Ga0070704_101492980 3300005549 Unclassified 621
153 Ga0070704_101562379 3300005549 Bacteria 608
154 Ga0070704_101704790 3300005549 Bacteria 582
155 Ga0068855_100093499 3300005563 Bacteria 3467
156 Ga0068855_100212327 3300005563 Bacteria 2174
157 Ga0068855_101705456 3300005563 Bacteria 642
158 Ga0070664_100007855 3300005564 Bacteria 8617
159 Ga0070664_100064930 3300005564 Bacteria 3113
160 Ga0068857_100374381 3300005577 Bacteria 1321
161 Ga0068856_100135612 3300005614 Bacteria 2466
162 Ga0068856_100585088 3300005614 Unclassified 1137
163 Ga0068856_100619683 3300005614 Bacteria 1103
164 Ga0068856_100666651 3300005614 Bacteria 1061
165 Ga0068856_100817040 3300005614 Unclassified 952
166 Ga0070702_100011024 3300005615 Bacteria 4483
167 Ga0070702_100117267 3300005615 Bacteria 1661
168 Ga0068852_100009899 3300005616 Bacteria 7095
169 Ga0068852_101617206 3300005616 Unclassified 670
170 Ga0068859_100486396 3300005617 Bacteria 1330
171 Ga0068864_100036831 3300005618 Bacteria 4172
172 Ga0068866_10051763 3300005718 Unclassified 2092
173 Ga0068866_10108340 3300005718 Unclassified 1545
174 Ga0068866_10629481 3300005718 Bacteria 728
175 Ga0068861_100560910 3300005719 Bacteria 1042
176 Ga0068861_102482496 3300005719 Unclassified 522
177 Ga0068863_100355000 3300005841 Bacteria 1428
178 Ga0068860_100114268 3300005843 Bacteria 2582
179 Ga0068860_101696910 3300005843 Unclassified 654
180 Ga0068862_100676377 3300005844 Bacteria 998
181 Ga0068862_101660491 3300005844 Unclassified 647
182 Ga0081455_10130107 3300005937 Unclassified 1970
183 Ga0081455_10296000 3300005937 Bacteria 1163
184 Ga0081538_10029400 3300005981 Bacteria 3754
185 Ga0081538_10062276 3300005981 Bacteria 2129
186 Ga0081538_10113985 3300005981 Bacteria 1318
187 Ga0081540_1015838 3300005983 Bacteria 4752
188 Ga0081539_10000068 3300005985 Bacteria 240998
189 Ga0081539_10009415 3300005985 Bacteria 8171
190 Ga0081539_10058993 3300005985 Bacteria 2115
191 Ga0081539_10271264 3300005985 Bacteria 743
192 Ga0070717_10097143 3300006028 Bacteria 2496
193 Ga0070717_10203795 3300006028 Bacteria 1734
194 Ga0070717_11180949 3300006028 Bacteria 696
195 Ga0070717_11534822 3300006028 Bacteria 604
196 Ga0075432_10137469 3300006058 Bacteria 930
197 Ga0075432_10318838 3300006058 Bacteria 650
198 Ga0070715_10045288 3300006163 Bacteria 1864
199 Ga0070715_10206287 3300006163 Bacteria 1001
200 Ga0070716_100001084 3300006173 Bacteria 11939
201 Ga0070716_100094734 3300006173 Bacteria 1816
202 Ga0070716_100096573 3300006173 Bacteria 1801
203 Ga0070716_100305481 3300006173 Bacteria 1108
204 Ga0070716_100431575 3300006173 Unclassified 956
205 Ga0070716_100948812 3300006173 Bacteria 677
206 Ga0070716_101167947 3300006173 Bacteria 617
207 Ga0070712_100000007 3300006175 Bacteria 157653
208 Ga0070712_100003758 3300006175 Bacteria 9352
209 Ga0070712_100014605 3300006175 Bacteria 5040
210 Ga0070712_100026426 3300006175 Bacteria 3866
211 Ga0070712_100045974 3300006175 Bacteria 3016
212 Ga0070712_100117206 3300006175 Bacteria 1998
213 Ga0070712_100159601 3300006175 Unclassified 1740
214 Ga0070712_100305032 3300006175 Bacteria 1290
215 Ga0070712_100437586 3300006175 Bacteria 1087
216 Ga0070712_100516687 3300006175 Unclassified 1003
217 Ga0070712_101383421 3300006175 Bacteria 614
218 Ga0075367_10401444 3300006178 Bacteria 867
219 Ga0097621_100194138 3300006237 Bacteria 1760
220 Ga0097621_100312780 3300006237 Bacteria 1390
221 Ga0075370_10553252 3300006353 Bacteria 696
222 Ga0068871_100868497 3300006358 Bacteria 835
223 Ga0068871_101697189 3300006358 Bacteria 599
224 Ga0075428_100121377 3300006844 Bacteria 2846
225 Ga0075428_100166123 3300006844 Bacteria 2394
226 Ga0075428_100388463 3300006844 Bacteria 1496
227 Ga0075428_100729930 3300006844 Unclassified 1054
228 Ga0075428_102379173 3300006844 Bacteria 544
229 Ga0075430_100380167 3300006846 Bacteria 1165
230 Ga0075430_101139996 3300006846 Unclassified 642
231 Ga0075431_100026120 3300006847 Bacteria 5989
232 Ga0075431_100117633 3300006847 Bacteria 2743
233 Ga0075431_100229757 3300006847 Unclassified 1890
234 Ga0075431_101016083 3300006847 Bacteria 796
235 Ga0075431_101415227 3300006847 Unclassified 655
236 Ga0075433_10015003 3300006852 Bacteria 6344
237 Ga0075433_10031218 3300006852 Bacteria 4553
238 Ga0075433_10044990 3300006852 Bacteria 3836
239 Ga0075433_10310276 3300006852 Unclassified 1396
240 Ga0075434_100045749 3300006871 Bacteria 4342
241 Ga0075434_100074186 3300006871 Bacteria 3396
242 Ga0075434_100115672 3300006871 Bacteria 2695
243 Ga0075434_100288829 3300006871 Unclassified 1660
244 Ga0075434_100778090 3300006871 Bacteria 974
245 Ga0075434_100854788 3300006871 Unclassified 925
246 Ga0075434_101583399 3300006871 Bacteria 664
247 Ga0075434_102004576 3300006871 Bacteria 584
248 Ga0075429_100280665 3300006880 Bacteria 1459
249 Ga0075436_100028580 3300006914 Bacteria 3835
250 Ga0075436_100038877 3300006914 Bacteria 3283
251 Ga0075436_100094513 3300006914 Bacteria 2079
252 Ga0075436_100179277 3300006914 Bacteria 1497
253 Ga0075436_100697180 3300006914 Bacteria 752
254 Ga0097620_100486395 3300006931 Bacteria 1330
255 Ga0075435_100000552 3300007076 Bacteria 22973
256 Ga0075435_100030027 3300007076 Bacteria 4271
257 Ga0075435_100114959 3300007076 Bacteria 2240
258 Ga0075435_100335121 3300007076 Bacteria 1296
259 Ga0075435_100485802 3300007076 Bacteria 1067
260 Ga0075435_100495423 3300007076 Bacteria 1056
261 Ga0075435_100598741 3300007076 Unclassified 956
262 Ga0075435_100719933 3300007076 Bacteria 868
263 Ga0075435_100783243 3300007076 Bacteria 830
264 Ga0075435_101512360 3300007076 Unclassified 589
265 Ga0099795_10359624 3300007788 Unclassified 653
266 Ga0105250_10150021 3300009092 Bacteria 970
267 Ga0105240_10906743 3300009093 Bacteria 948
268 Ga0105240_11099973 3300009093 Unclassified 846
269 Ga0105240_11158809 3300009093 Unclassified 820
270 Ga0111539_10028470 3300009094 Bacteria 6815
271 Ga0111539_10046823 3300009094 Bacteria 5172
272 Ga0111539_10046834 3300009094 Bacteria 5171
273 Ga0111539_10276381 3300009094 Bacteria 1954
274 Ga0111539_10434915 3300009094 Bacteria 1528
275 Ga0111539_10900962 3300009094 Bacteria 1029
276 Ga0105245_10011852 3300009098 Bacteria 7585
277 Ga0105245_10130771 3300009098 Bacteria 2354
278 Ga0105245_10344762 3300009098 Bacteria 1474
279 Ga0105245_10505981 3300009098 Bacteria 1225
280 Ga0105245_10899249 3300009098 Bacteria 927
281 Ga0105245_11709099 3300009098 Bacteria 682
282 Ga0105245_12148096 3300009098 Unclassified 612
283 Ga0114129_10000831 3300009147 Bacteria 39916
284 Ga0114129_10007775 3300009147 Bacteria 15253
285 Ga0114129_10097803 3300009147 Bacteria 4063
286 Ga0114129_10108514 3300009147 Bacteria 3832
287 Ga0114129_10166187 3300009147 Bacteria 3011
288 Ga0114129_10206491 3300009147 Archaea 2657
289 Ga0114129_10395042 3300009147 Bacteria 1823
290 Ga0114129_10670901 3300009147 Bacteria 1336
291 Ga0114129_10722376 3300009147 Unclassified 1278
292 Ga0114129_10927154 3300009147 Bacteria 1102
293 Ga0114129_11763949 3300009147 Bacteria 754
294 Ga0105243_10016878 3300009148 Bacteria 5520
295 Ga0105243_10048038 3300009148 Bacteria 3363
296 Ga0105243_10063943 3300009148 Bacteria 2950
297 Ga0105243_10761442 3300009148 Unclassified 950
298 Ga0105243_11205100 3300009148 Bacteria 770
299 Ga0105243_11638713 3300009148 Bacteria 671
300 Ga0105243_13061977 3300009148 Unclassified 507
301 Ga0105241_11772752 3300009174 Unclassified 602
302 Ga0105242_10040981 3300009176 Bacteria 3733
303 Ga0105242_10047642 3300009176 Bacteria 3481
304 Ga0105242_10201013 3300009176 Bacteria 1770
305 Ga0105242_10205333 3300009176 Bacteria 1752
306 Ga0105242_10471047 3300009176 Unclassified 1188
307 Ga0105242_10732396 3300009176 Bacteria 971
308 Ga0105242_11072493 3300009176 Unclassified 818
309 Ga0105242_11177449 3300009176 Bacteria 784
310 Ga0105248_10450454 3300009177 Unclassified 1450
311 Ga0105248_12354264 3300009177 Unclassified 606
312 Ga0105248_12746152 3300009177 Bacteria 562
313 Ga0105237_10928327 3300009545 Unclassified 877
314 Ga0105238_10530372 3300009551 Bacteria 1180
315 Ga0105249_10118902 3300009553 Bacteria 2509
316 Ga0105249_10696486 3300009553 Unclassified 1076
317 Ga0105249_11564040 3300009553 Unclassified 732
318 Ga0105239_10004095 3300010375 Bacteria 17531
319 Ga0105239_10386990 3300010375 Bacteria 1582
320 Ga0105239_10493160 3300010375 Bacteria 1392
321 Ga0105239_11287061 3300010375 Unclassified 843
322 Ga0105239_13061540 3300010375 Unclassified 545
323 Ga0105246_11531884 3300011119 Bacteria 627
324 Ga0157346_1001569 3300012480 Unclassified 1099
325 Ga0157341_1015006 3300012494 Bacteria 708
326 Ga0157342_1019055 3300012507 Bacteria 783
327 Ga0157371_10396243 3300013102 Bacteria 1010
328 Ga0157370_11195751 3300013104 Bacteria 686
329 Ga0157369_10019782 3300013105 Bacteria 7534
330 Ga0157369_10515497 3300013105 Unclassified 1237
331 Ga0157369_11066244 3300013105 Unclassified 826
332 Ga0157369_12533383 3300013105 Bacteria 519
333 Ga0157374_10010688 3300013296 Bacteria 7907
334 Ga0157374_10150805 3300013296 Bacteria 2260
335 Ga0157374_11301669 3300013296 Bacteria 749
336 Ga0157374_11338816 3300013296 Bacteria 738
337 Ga0157378_10693939 3300013297 Bacteria 1037
338 Ga0157378_11209187 3300013297 Bacteria 795
339 Ga0163162_10411859 3300013306 Bacteria 1484
340 Ga0163162_10598976 3300013306 Bacteria 1228
341 Ga0163162_10668087 3300013306 Bacteria 1162
342 Ga0157372_10203064 3300013307 Bacteria 2296
343 Ga0157372_10643391 3300013307 Bacteria 1235
344 Ga0157375_10105603 3300013308 Bacteria 2907
345 Ga0157375_10456694 3300013308 Unclassified 1443
346 Ga0157375_10860870 3300013308 Bacteria 1052
347 Ga0157375_13465122 3300013308 Unclassified 525
348 Ga0163163_10133860 3300014325 Bacteria 2519
349 Ga0157380_10378526 3300014326 Unclassified 1335
350 Ga0157380_10407620 3300014326 Bacteria 1292
351 Ga0157380_10474416 3300014326 Bacteria 1208
352 Ga0157380_10630516 3300014326 Bacteria 1066
353 Ga0157380_11431991 3300014326 Bacteria 742
354 Ga0157377_10001774 3300014745 Bacteria 9412
355 Ga0157377_10035301 3300014745 Bacteria 2742
356 Ga0157377_10479923 3300014745 Unclassified 865
357 Ga0157377_11256145 3300014745 Unclassified 576
358 Ga0157379_10163166 3300014968 Bacteria 2011
359 Ga0157379_10760144 3300014968 Bacteria 913
360 Ga0157376_10410401 3300014969 Bacteria 1312
361 Ga0157376_10887516 3300014969 Bacteria 909
362 Ga0157376_12192216 3300014969 Bacteria 591
363 Ga0163161_10358667 3300017792 Bacteria 1161
364 Ga0206354_10173438 3300020081 Bacteria 1978
365 Ga0206353_10095162 3300020082 Bacteria 1114
366 Ga0206353_10365959 3300020082 Unclassified 509
367 Ga0206353_11480865 3300020082 Bacteria 978
368 Ga0154015_1659241 3300020610 Unclassified 609
369 Ga0213873_10074288 3300021358 Bacteria 942
370 Ga0207653_10005114 3300025885 Bacteria 4098
371 Ga0207653_10226294 3300025885 Bacteria 711
372 Ga0207692_10157458 3300025898 Bacteria 1306
373 Ga0207692_10188351 3300025898 Bacteria 1206
374 Ga0207692_10512071 3300025898 Unclassified 763
375 Ga0207642_10715864 3300025899 Bacteria 632
376 Ga0207710_10590365 3300025900 Unclassified 580
377 Ga0207688_10003516 3300025901 Bacteria 8553
378 Ga0207647_10277656 3300025904 Unclassified 957
379 Ga0207685_10073254 3300025905 Unclassified 1395
380 Ga0207685_10477463 3300025905 Bacteria 653
381 Ga0207699_10004114 3300025906 Bacteria 6970
382 Ga0207699_10006204 3300025906 Bacteria 5767
383 Ga0207699_10066552 3300025906 Unclassified 2188
384 Ga0207699_10090402 3300025906 Bacteria 1921
385 Ga0207705_10671735 3300025909 Unclassified 806
386 Ga0207684_10142609 3300025910 Bacteria 2060
387 Ga0207684_10206944 3300025910 Bacteria 1693
388 Ga0207684_10577071 3300025910 Bacteria 961
389 Ga0207684_11262026 3300025910 Unclassified 610
390 Ga0207707_10075848 3300025912 Bacteria 2934
391 Ga0207707_10103226 3300025912 Bacteria 2492
392 Ga0207695_10817634 3300025913 Unclassified 812
393 Ga0207695_11040720 3300025913 Bacteria 698
394 Ga0207693_10001413 3300025915 Bacteria 21296
395 Ga0207693_10002613 3300025915 Bacteria 15647
396 Ga0207693_10020915 3300025915 Bacteria 5202
397 Ga0207693_10026555 3300025915 Bacteria 4582
398 Ga0207693_10039249 3300025915 Bacteria 3728
399 Ga0207693_10158426 3300025915 Bacteria 1781
400 Ga0207693_10178444 3300025915 Unclassified 1671
401 Ga0207693_10195845 3300025915 Unclassified 1590
402 Ga0207693_10793857 3300025915 Bacteria 730
403 Ga0207663_10095807 3300025916 Bacteria 1981
404 Ga0207663_10182104 3300025916 Bacteria 1501
405 Ga0207663_10216817 3300025916 Bacteria 1390
406 Ga0207663_10344220 3300025916 Bacteria 1127
407 Ga0207663_10409025 3300025916 Bacteria 1039
408 Ga0207663_10546255 3300025916 Bacteria 905
409 Ga0207663_10851447 3300025916 Unclassified 728
410 Ga0207660_10676584 3300025917 Bacteria 842
411 Ga0207662_10007150 3300025918 Bacteria 6071
412 Ga0207657_10196743 3300025919 Unclassified 1624
413 Ga0207652_10646904 3300025921 Bacteria 946
414 Ga0207646_10010563 3300025922 Bacteria 9009
415 Ga0207646_10124888 3300025922 Bacteria 2314
416 Ga0207646_10165062 3300025922 Bacteria 1999
417 Ga0207646_10362136 3300025922 Bacteria 1310
418 Ga0207646_10497647 3300025922 Bacteria 1098
419 Ga0207646_10531440 3300025922 Bacteria 1058
420 Ga0207646_11317405 3300025922 Bacteria 630
421 Ga0207646_11349072 3300025922 Bacteria 622
422 Ga0207681_11408751 3300025923 Unclassified 585
423 Ga0207694_11598584 3300025924 Unclassified 549
424 Ga0207650_11707137 3300025925 Unclassified 534
425 Ga0207659_10168573 3300025926 Unclassified 1726
426 Ga0207687_10086372 3300025927 Bacteria 2278
427 Ga0207687_10216630 3300025927 Bacteria 1505
428 Ga0207687_10643024 3300025927 Unclassified 897
429 Ga0207687_11617396 3300025927 Unclassified 556
430 Ga0207700_10151217 3300025928 Bacteria 1918
431 Ga0207664_10730016 3300025929 Unclassified 891
432 Ga0207664_11285428 3300025929 Bacteria 651
433 Ga0207664_11631287 3300025929 Bacteria 567
434 Ga0207644_10859075 3300025931 Unclassified 760
435 Ga0207706_10087029 3300025933 Bacteria 2747
436 Ga0207706_10115490 3300025933 Bacteria 2361
437 Ga0207706_11063050 3300025933 Unclassified 678
438 Ga0207706_11474656 3300025933 Bacteria 556
439 Ga0207686_10096419 3300025934 Bacteria 1965
440 Ga0207686_10178089 3300025934 Bacteria 1505
441 Ga0207686_10724462 3300025934 Bacteria 792
442 Ga0207686_10772546 3300025934 Unclassified 768
443 Ga0207686_10903130 3300025934 Bacteria 713
444 Ga0207686_10952778 3300025934 Bacteria 695
445 Ga0207686_11026956 3300025934 Bacteria 670
446 Ga0207709_10444225 3300025935 Bacteria 1001
447 Ga0207709_10768462 3300025935 Unclassified 776
448 Ga0207709_11464397 3300025935 Archaea 566
449 Ga0207670_10978563 3300025936 Bacteria 711
450 Ga0207669_10038865 3300025937 Bacteria 2744
451 Ga0207669_10191473 3300025937 Bacteria 1476
452 Ga0207704_10048774 3300025938 Bacteria 2542
453 Ga0207704_10232902 3300025938 Bacteria 1371
454 Ga0207665_10117047 3300025939 Bacteria 1879
455 Ga0207665_10137581 3300025939 Bacteria 1739
456 Ga0207665_10168821 3300025939 Bacteria 1579
457 Ga0207665_10620381 3300025939 Unclassified 846
458 Ga0207665_10726833 3300025939 Bacteria 782
459 Ga0207711_10489186 3300025941 Unclassified 1146
460 Ga0207689_10169712 3300025942 Bacteria 1798
461 Ga0207661_10068368 3300025944 Bacteria 2893
462 Ga0207661_10224017 3300025944 Bacteria 1663
463 Ga0207661_11242159 3300025944 Bacteria 685
464 Ga0207679_10007996 3300025945 Bacteria 6725
465 Ga0207679_10011810 3300025945 Bacteria 5674
466 Ga0207667_10179367 3300025949 Bacteria 2175
467 Ga0207667_10321160 3300025949 Bacteria 1581
468 Ga0207667_11876508 3300025949 Unclassified 562
469 Ga0207651_10574167 3300025960 Unclassified 983
470 Ga0207651_10776683 3300025960 Unclassified 848
471 Ga0207712_11076618 3300025961 Unclassified 715
472 Ga0207712_11223303 3300025961 Unclassified 670
473 Ga0207677_10273426 3300026023 Bacteria 1383
474 Ga0207677_10354586 3300026023 Bacteria 1230
475 Ga0207678_10022172 3300026067 Bacteria 5565
476 Ga0207678_11331757 3300026067 Bacteria 635
477 Ga0207708_10001166 3300026075 Bacteria 19795
478 Ga0207708_10231739 3300026075 Bacteria 1483
479 Ga0207708_11853678 3300026075 Bacteria 529
480 Ga0207702_10028071 3300026078 Bacteria 4676
481 Ga0207702_10286402 3300026078 Unclassified 1559
482 Ga0207702_11051495 3300026078 Unclassified 808
483 Ga0207648_10135205 3300026089 Unclassified 2171
484 Ga0207648_10782486 3300026089 Bacteria 887
485 Ga0207676_10185975 3300026095 Bacteria 1823
486 Ga0207676_10700249 3300026095 Bacteria 981
487 Ga0207674_10450721 3300026116 Bacteria 1244
488 Ga0207675_100042914 3300026118 Bacteria 4223
489 Ga0207675_100125613 3300026118 Bacteria 2430
490 Ga0207675_101079035 3300026118 Bacteria 822
491 Ga0207683_10141485 3300026121 Bacteria 2168
492 Ga0207683_10169808 3300026121 Bacteria 1975
493 Ga0207683_10191462 3300026121 Bacteria 1857
494 Ga0207683_12186531 3300026121 Bacteria 501
495 Ga0207698_10374389 3300026142 Unclassified 1353
496 Ga0207428_10054782 3300027907 Bacteria 3175
497 Ga0207428_10355292 3300027907 Unclassified 1078
498 Ga0207428_10461925 3300027907 Bacteria 925
499 Ga0268265_10849332 3300028380 Bacteria 893
500 Ga0268264_10334425 3300028381 Bacteria 1436
501 Ga0268264_10968706 3300028381 Bacteria 856
502 Ga0268264_11361116 3300028381 Bacteria 720
503 Ga0265338_10236046 3300028800 Bacteria 1357
504 Ga0265338_10509359 3300028800 Unclassified 846
505 Ga0265325_10020382 3300031241 Bacteria 3655
506 Ga0265313_10112784 3300031595 Bacteria 1194
507 Ga0307412_10283823 3300031911 Bacteria 1301
508 Ga0307409_101047970 3300031995 Bacteria 835
509 Ga0307409_101826815 3300031995 Bacteria 637
510 Ga0307416_100018682 3300032002 Bacteria 4893
511 Ga0307416_100113792 3300032002 Bacteria 2392
512 Ga0307416_102605848 3300032002 Unclassified 603
513 Ga0307415_100026813 3300032126 Bacteria 3641
514 Ga0307415_102204028 3300032126 Unclassified 539
515 Ga0373930_0022749 3300034816 Bacteria 1242
516 Ga0373948_0139211 3300034817 Bacteria 599
517 Ga0373950_0052684 3300034818 Bacteria 802
518 Ga0373959_0003544 3300034820 Bacteria 2493
519 Ga0373938_0024714 3300034957 Bacteria 1244
520 Ga0373928_0006763 3300035084 Bacteria 2207
521 Ga0373929_0048132 3300035085 Bacteria 967
522 Ga0373940_0128863 3300035088 Unclassified 791
523 Ga0373949_0011808 3300035090 Unclassified 1927
524 Ga0373949_0130256 3300035090 Unclassified 713
525 Ga0373951_0005669 3300035091 Bacteria 2891
526 Ga0373952_0024073 3300035092 Bacteria 1305
527 Ga0373932_0016907 3300035112 Bacteria 1866
528 Ga0373939_0014328 3300035114 Bacteria 2055
529 Ga0373953_0233728 3300035117 Unclassified 797
530 Ga0373954_0342249 3300035118 Bacteria 739
531 Ga0373957_0112193 3300035120 Bacteria 1099
532 Ga0373960_0004406 3300035121 Bacteria 3222
533 Ga0373943_0014323 3300035170 Bacteria 3588
534 Ga0373943_0118265 3300035170 Bacteria 1406
535 Ga0373955_0128205 3300035172 Bacteria 1479
536 Ga0373955_0743130 3300035172 Bacteria 603
537 Ga0373942_0002766 3300035207 Bacteria 4187
538 Ga0373961_0004810 3300035241 Bacteria 3246
539 Ga0373962_0004999 3300035242 Bacteria 3206
540 Ga0373931_0010433 3300035691 Bacteria 4464
541 Ga0373931_0339276 3300035691 Unclassified 938
542 Ga0373931_1087291 3300035691 Bacteria 544
543 Ga0373935_0128438 3300035692 Unclassified 1701
544 Ga0373935_0181807 3300035692 Bacteria 1444
545 Ga0373927_0072159 3300035695 Bacteria 2234
546 Ga0373933_0997871 3300035724 Bacteria 551
547 Ga0373947_0012053 3300035725 Bacteria 4951
548 Ga0373937_0000976 3300036401 Bacteria 24290
549 Ga0373937_0196750 3300036401 Bacteria 1895
550 Ga0373937_0999052 3300036401 Bacteria 785
551 Ga0373925_0009072 3300037068 Bacteria 7240
552 Ga0395899_0002136 3300037312 Bacteria 16250
553 Ga0395899_0002201 3300037312 Bacteria 15973
554 Ga0395899_0019734 3300037312 Bacteria 5118
555 Ga0395899_0026936 3300037312 Bacteria 4336
556 Ga0395899_0052492 3300037312 Bacteria 3021
557 Ga0395899_0101106 3300037312 Bacteria 2081
558 Ga0395899_0123714 3300037312 Bacteria 1851
559 Ga0395899_0220748 3300037312 Bacteria 1313
560 Ga0395899_0456164 3300037312 Bacteria 836
561 Ga0395899_0556228 3300037312 Bacteria 737
562 Ga0395899_0883041 3300037312 Unclassified 546
563 Ga0395899_0950143 3300037312 Unclassified 521
564 Ga0395900_0001291 3300037418 Bacteria 30553
565 Ga0395900_0001589 3300037418 Bacteria 26870
566 Ga0395900_0003136 3300037418 Bacteria 17929
567 Ga0395900_0004208 3300037418 Bacteria 15271
568 Ga0395900_0019234 3300037418 Bacteria 6964
569 Ga0395900_0032656 3300037418 Bacteria 5353
570 Ga0395900_0033591 3300037418 Bacteria 5279
571 Ga0395900_0059917 3300037418 Unclassified 3918
572 Ga0395900_0137616 3300037418 Bacteria 2502
573 Ga0395900_0158276 3300037418 Bacteria 2312
574 Ga0395900_0220711 3300037418 Bacteria 1911
575 Ga0395900_0238306 3300037418 Bacteria 1826
576 Ga0395900_0307589 3300037418 Bacteria 1569
577 Ga0395900_0448053 3300037418 Bacteria 1247
578 Ga0395900_0481552 3300037418 Unclassified 1193
579 Ga0395900_0899052 3300037418 Archaea 809
580 Ga0395900_1044094 3300037418 Bacteria 736
581 Ga0395900_1404172 3300037418 Unclassified 611
582 Ga0395900_1899646 3300037418 Bacteria 506
583 Ga0395898_0001958 3300037466 Bacteria 26038
584 Ga0395898_0004222 3300037466 Bacteria 15747
585 Ga0395898_0004997 3300037466 Bacteria 14385
586 Ga0395898_0006008 3300037466 Bacteria 13037
587 Ga0395898_0021621 3300037466 Bacteria 6520
588 Ga0395898_0024332 3300037466 Bacteria 6107
589 Ga0395898_0037004 3300037466 Bacteria 4843
590 Ga0395898_0050486 3300037466 Bacteria 4070
591 Ga0395898_0058954 3300037466 Bacteria 3736
592 Ga0395898_0076990 3300037466 Bacteria 3220
593 Ga0395898_0086397 3300037466 Bacteria 3023
594 Ga0395898_0097794 3300037466 Bacteria 2819
595 Ga0395898_0115575 3300037466 Bacteria 2571
596 Ga0395898_0158397 3300037466 Bacteria 2165
597 Ga0395898_0159525 3300037466 Bacteria 2157
598 Ga0395898_0312764 3300037466 Unclassified 1498
599 Ga0395898_0361068 3300037466 Unclassified 1385
600 Ga0395898_0416511 3300037466 Bacteria 1280
601 Ga0395898_1332445 3300037466 Unclassified 647
602 Ga0395898_1458832 3300037466 Bacteria 611
603 Ga0395905_0003055 3300037471 Bacteria 18136
604 Ga0395905_0003667 3300037471 Bacteria 16283
605 Ga0395905_0004895 3300037471 Bacteria 13800
606 Ga0395905_0010536 3300037471 Bacteria 8979
607 Ga0395905_0010934 3300037471 Bacteria 8783
608 Ga0395905_0025905 3300037471 Bacteria 5528
609 Ga0395905_0027603 3300037471 Bacteria 5353
610 Ga0395905_0063518 3300037471 Bacteria 3455
611 Ga0395905_0066386 3300037471 Bacteria 3379
612 Ga0395905_0073735 3300037471 Bacteria 3199
613 Ga0395905_0284173 3300037471 Bacteria 1541
614 Ga0395905_0487257 3300037471 Unclassified 1133
615 Ga0395905_0620099 3300037471 Bacteria 983
616 Ga0395905_0999808 3300037471 Bacteria 739
617 Ga0395905_1018127 3300037471 Unclassified 731
618 Ga0395905_1357009 3300037471 Unclassified 615
619 Ga0395905_1407633 3300037471 Unclassified 601
620 Ga0395905_1668681 3300037471 Unclassified 542
621 Ga0395901_0000365 3300038443 Bacteria 54535
622 Ga0395901_0000733 3300038443 Bacteria 37083
623 Ga0395901_0002616 3300038443 Bacteria 18216
624 Ga0395901_0006872 3300038443 Bacteria 11494
625 Ga0395901_0008831 3300038443 Bacteria 10201
626 Ga0395901_0036919 3300038443 Bacteria 5052
627 Ga0395901_0042881 3300038443 Bacteria 4692
628 Ga0395901_0058533 3300038443 Bacteria 4007
629 Ga0395901_0058930 3300038443 Bacteria 3994
630 Ga0395901_0065057 3300038443 Bacteria 3796
631 Ga0395901_0079355 3300038443 Bacteria 3427
632 Ga0395901_0096099 3300038443 Bacteria 3105
633 Ga0395901_0129195 3300038443 Bacteria 2655
634 Ga0395901_0187425 3300038443 Bacteria 2170
635 Ga0395901_0255021 3300038443 Unclassified 1827
636 Ga0395901_0353599 3300038443 Archaea 1516
637 Ga0395901_0385807 3300038443 Bacteria 1441
638 Ga0395901_0507213 3300038443 Bacteria 1227
639 Ga0395901_0519163 3300038443 Bacteria 1210
640 Ga0395901_0673091 3300038443 Archaea 1035
641 Ga0395901_0786208 3300038443 Bacteria 942
642 Ga0395901_1151156 3300038443 Bacteria 744
643 Ga0395901_1684364 3300038443 Unclassified 586
644 Ga0242420_032685 3300038996 Bacteria 970
645 Ga0242420_109294 3300038996 Bacteria 594
646 Ga0436362_0464294 3300039453 Bacteria 1980
647 Ga0451787_344860 3300041441 Unclassified 675
648 Ga0451789_0290400 3300041443 Bacteria 811
649 Ga0451793_0231132 3300041452 Bacteria 607
650 Ga0451802_1319019 3300041460 Unclassified 557
651 Ga0451802_2160690 3300041460 Bacteria 768
652 Ga0451841_0813533 3300041498 Bacteria 621
653 Ga0451849_1578475 3300041505 Unclassified 575
654 Ga0451853_0299360 3300041512 Bacteria 570
655 Ga0451853_2286262 3300041512 Bacteria 622
656 Ga0439460_0366864 3300042461 Bacteria 509
657 Ga0466964_0471831 3300044706 Unclassified 669
658 Ga0466968_0322805 3300044735 Bacteria 746
659 Ga0466960_0181431 3300044901 Bacteria 1141
660 Ga0466967_0198264 3300045976 Bacteria 1900
661 Ga0495592_0628131 3300046454 Unclassified 653
662 Ga0495603_0006924 3300046455 Bacteria 6802
663 Ga0495603_0044418 3300046455 Bacteria 2652
664 Ga0495629_0076795 3300046459 Bacteria 2332
665 Ga0495582_0010101 3300046473 Bacteria 5199
666 Ga0495582_0320164 3300046473 Bacteria 892
667 Ga0495582_0905186 3300046473 Unclassified 510
668 Ga0495605_0205845 3300046474 Unclassified 856
669 Ga0495605_0351393 3300046474 Bacteria 618
670 Ga0495605_0439002 3300046474 Bacteria 539
671 Ga0495664_0455603 3300046477 Unclassified 766
672 Ga0495664_0525857 3300046477 Bacteria 706
673 Ga0495584_0010520 3300046491 Bacteria 4752
674 Ga0495584_0079643 3300046491 Bacteria 1648
675 Ga0495584_0158833 3300046491 Bacteria 1149
676 Ga0495584_0360143 3300046491 Bacteria 739
677 Ga0495584_0415673 3300046491 Unclassified 684
678 Ga0495585_0175909 3300046492 Bacteria 1103
679 Ga0495585_0227308 3300046492 Bacteria 939
680 Ga0495585_0230594 3300046492 Bacteria 931
681 Ga0495596_0088582 3300046500 Bacteria 1201
682 Ga0495607_0137220 3300046501 Bacteria 1266
683 Ga0495616_0280941 3300046513 Bacteria 708
684 Ga0495620_0187768 3300046515 Bacteria 798
685 Ga0495628_0514476 3300046516 Bacteria 863
686 Ga0495628_0535041 3300046516 Bacteria 843
687 Ga0495628_1260081 3300046516 Bacteria 500
688 Ga0495630_0064570 3300046517 Bacteria 2751
689 Ga0495631_0492997 3300046518 Bacteria 522
690 Ga0495644_0135293 3300046523 Bacteria 940
691 Ga0495644_0176109 3300046523 Unclassified 822
692 Ga0495663_0011178 3300046525 Unclassified 2498
693 Ga0495642_0124065 3300046528 Bacteria 1109
694 Ga0495642_0140690 3300046528 Bacteria 1042
695 Ga0495642_0176899 3300046528 Unclassified 928
696 Ga0495665_0307697 3300046531 Bacteria 810
697 Ga0495640_0858987 3300046533 Unclassified 539
698 Ga0495586_0619210 3300046535 Unclassified 625
699 Ga0495598_0244365 3300046537 Unclassified 663
700 Ga0495609_0215286 3300046538 Unclassified 799
701 Ga0495609_0275249 3300046538 Unclassified 689
702 Ga0495609_0358146 3300046538 Bacteria 588
703 Ga0495621_0178945 3300046539 Bacteria 846
704 Ga0495667_0090543 3300046559 Bacteria 1982
705 Ga0495656_0112466 3300046615 Unclassified 1276
706 Ga0495656_0135648 3300046615 Bacteria 1175
707 Ga0495656_0471304 3300046615 Bacteria 663
708 Ga0495656_0725864 3300046615 Unclassified 535
709 Ga0495668_0117623 3300046616 Bacteria 1454
710 Ga0495668_0615082 3300046616 Unclassified 600
711 Ga0495611_0054373 3300046648 Bacteria 1810
712 Ga0495659_0134886 3300046664 Bacteria 981
713 Ga0495659_0187982 3300046664 Unclassified 843
714 Ga0495661_0230215 3300046665 Bacteria 956
715 Ga0495588_0096038 3300046674 Unclassified 1554
716 Ga0495588_0640988 3300046674 Bacteria 556
717 Ga0495657_0139204 3300046675 Bacteria 1514
718 Ga0495599_0487071 3300046678 Bacteria 727
719 Ga0495599_0816078 3300046678 Bacteria 532
720 Ga0495623_0045784 3300046679 Plasmid 2778
721 Ga0495658_0158978 3300046683 Bacteria 1392
722 Ga0495658_0268439 3300046683 Bacteria 1075
723 Ga0495669_0138377 3300046684 Bacteria 1149
724 Ga0495613_1103274 3300046689 Bacteria 506
725 Ga0495624_0086679 3300046690 Bacteria 1934
726 Ga0495624_0735291 3300046690 Bacteria 585
727 Ga0495624_0761507 3300046690 Bacteria 573
728 Ga0495670_0127320 3300046691 Unclassified 1326
729 Ga0495671_0583572 3300046692 Unclassified 532
730 Ga0495649_0375489 3300046694 Bacteria 716
731 Ga0495589_0110939 3300046794 Bacteria 1324
732 Ga0495589_0141693 3300046794 Unclassified 1151
733 Ga0495589_0314837 3300046794 Bacteria 724
734 Ga0495589_0470033 3300046794 Unclassified 575
735 Ga0495600_0559744 3300046809 Unclassified 698
736 Ga0495660_0193787 3300046810 Unclassified 975
737 Ga0495581_0011147 3300047315 Bacteria 5194
738 Ga0495581_0351626 3300047315 Bacteria 860
739 Ga0495604_0576136 3300047317 Bacteria 724
740 Ga0495674_0390964 3300047319 Bacteria 1124
741 Ga0495674_0564872 3300047319 Unclassified 904
742 Ga0495674_0688361 3300047319 Bacteria 803
743 Ga0495674_1478701 3300047319 Unclassified 504
744 Ga0495676_0022756 3300047321 Bacteria 5448
745 Ga0495676_0718188 3300047321 Unclassified 646
746 Ga0495680_0703744 3300047322 Bacteria 667
747 Ga0495683_0297768 3300047323 Unclassified 694
748 Ga0495677_0051254 3300047445 Bacteria 1520
749 Ga0495685_149552 3300047447 Bacteria 759
750 Ga0495685_165957 3300047447 Bacteria 714
751 Ga0495684_0692846 3300047471 Bacteria 677
752 Ga0495602_0014286 3300048088 Bacteria 8066
753 Ga0495602_1033497 3300048088 Unclassified 541
754 Ga0495615_0288854 3300048090 Unclassified 529
755 Ga0496100_0000160 3300048903 Bacteria 37151
756 Ga0496100_0098791 3300048903 Unclassified 2007
757 Ga0496100_0145724 3300048903 Bacteria 1684
758 Ga0496100_0153968 3300048903 Bacteria 1642
759 Ga0496100_0421503 3300048903 Bacteria 1019
760 Ga0496100_0532293 3300048903 Unclassified 908
761 Ga0496100_0861372 3300048903 Unclassified 711
762 Ga0496101_0042059 3300048904 Bacteria 3261
763 Ga0496101_0062776 3300048904 Bacteria 2702
764 Ga0496101_0235876 3300048904 Bacteria 1423
765 Ga0496101_0502133 3300048904 Unclassified 958
766 Ga0496101_0553002 3300048904 Unclassified 910
767 Ga0496101_0599768 3300048904 Unclassified 871
768 Ga0496101_1552032 3300048904 Unclassified 515
769 Ga0496102_0060285 3300048905 Bacteria 3471
770 Ga0496102_0079208 3300048905 Bacteria 3026
771 Ga0496102_0243704 3300048905 Unclassified 1695
772 Ga0496102_0403143 3300048905 Bacteria 1286
773 Ga0496102_0622550 3300048905 Bacteria 1002
774 Ga0496102_0668385 3300048905 Bacteria 962
775 Ga0496102_1107886 3300048905 Bacteria 711
776 Ga0496102_1837282 3300048905 Bacteria 523
777 Ga0496103_0011370 3300048906 Bacteria 5272
778 Ga0496103_0166424 3300048906 Bacteria 1414
779 Ga0496103_0329040 3300048906 Unclassified 983
780 Ga0496103_0340212 3300048906 Unclassified 965
781 Ga0496103_0742264 3300048906 Unclassified 621
782 Ga0496104_0019682 3300048907 Bacteria 6181
783 Ga0496104_0053765 3300048907 Bacteria 3806
784 Ga0496104_0095470 3300048907 Bacteria 2844
785 Ga0496104_0223839 3300048907 Unclassified 1794
786 Ga0496104_0289082 3300048907 Bacteria 1551
787 Ga0496104_1475110 3300048907 Bacteria 583
788 Ga0496105_0015245 3300048908 Bacteria 6122
789 Ga0496105_0059466 3300048908 Unclassified 3153
790 Ga0496105_0109557 3300048908 Bacteria 2280
791 Ga0496105_0112921 3300048908 Bacteria 2242
792 Ga0496105_0171800 3300048908 Bacteria 1777
793 Ga0496105_0288678 3300048908 Unclassified 1321
794 Ga0496105_0309367 3300048908 Bacteria 1269
795 Ga0496105_0332615 3300048908 Unclassified 1216
796 Ga0496105_0729513 3300048908 Unclassified 758
797 Ga0496106_0060225 3300048909 Bacteria 2877
798 Ga0496106_0073098 3300048909 Bacteria 2622
799 Ga0496106_0243252 3300048909 Unclassified 1438
800 Ga0496106_0387423 3300048909 Bacteria 1123
801 Ga0496106_0975736 3300048909 Bacteria 667
802 Ga0496107_0022492 3300048910 Bacteria 4455
803 Ga0496107_0171803 3300048910 Bacteria 1609
804 Ga0496107_0230240 3300048910 Bacteria 1379
805 Ga0496107_0237460 3300048910 Bacteria 1356
806 Ga0496107_0352326 3300048910 Unclassified 1095
807 Ga0496107_0381662 3300048910 Bacteria 1048
808 Ga0496107_0393204 3300048910 Unclassified 1031
809 Ga0496107_0534137 3300048910 Bacteria 869
810 Ga0496107_0751248 3300048910 Bacteria 716
811 Ga0496107_1124130 3300048910 Bacteria 567
812 Ga0496108_0018657 3300048911 Bacteria 5683
813 Ga0496108_0055611 3300048911 Bacteria 3323
814 Ga0496108_0059331 3300048911 Bacteria 3217
815 Ga0496108_0400372 3300048911 Unclassified 1199
816 Ga0496108_0494554 3300048911 Bacteria 1068
817 Ga0496108_0697428 3300048911 Bacteria 880
818 Ga0496108_1125761 3300048911 Bacteria 666
819 Ga0496109_0005317 3300048912 Bacteria 10762
820 Ga0496109_0006589 3300048912 Bacteria 9777
821 Ga0496109_0019302 3300048912 Bacteria 6007
822 Ga0496109_0021346 3300048912 Bacteria 5725
823 Ga0496109_0102063 3300048912 Bacteria 2662
824 Ga0496109_0139389 3300048912 Bacteria 2267
825 Ga0496109_0146476 3300048912 Bacteria 2210
826 Ga0496109_0211663 3300048912 Unclassified 1823
827 Ga0496109_0297818 3300048912 Bacteria 1521
828 Ga0496109_0368273 3300048912 Bacteria 1357
829 Ga0496109_0442270 3300048912 Bacteria 1228
830 Ga0496109_0549210 3300048912 Unclassified 1090
831 Ga0496109_0951663 3300048912 Bacteria 797
832 Ga0496110_0064072 3300048913 Bacteria 3248
833 Ga0496110_0076941 3300048913 Bacteria 2967
834 Ga0496110_0127898 3300048913 Bacteria 2293
835 Ga0496110_0140161 3300048913 Bacteria 2186
836 Ga0496110_0526254 3300048913 Unclassified 1075
837 Ga0496110_0633411 3300048913 Bacteria 968
838 Ga0496110_0738515 3300048913 Bacteria 887
839 Ga0496110_0818995 3300048913 Bacteria 836
840 Ga0496110_1001407 3300048913 Bacteria 743
841 Ga0496111_0001245 3300048914 Bacteria 14253
842 Ga0496111_0019004 3300048914 Bacteria 4765
843 Ga0496111_0059104 3300048914 Bacteria 2777
844 Ga0496111_0140117 3300048914 Bacteria 1792
845 Ga0496111_0174875 3300048914 Unclassified 1596
846 Ga0496111_0198803 3300048914 Bacteria 1490
847 Ga0496111_0531987 3300048914 Unclassified 864
848 Ga0496111_0728763 3300048914 Unclassified 720
849 Ga0496111_0919263 3300048914 Bacteria 629
850 Ga0496111_1077771 3300048914 Unclassified 573
851 Ga0496111_1193673 3300048914 Unclassified 539
852 Ga0496112_0000125 3300048915 Bacteria 47606
853 Ga0496112_0004570 3300048915 Bacteria 11759
854 Ga0496112_0067916 3300048915 Bacteria 3520
855 Ga0496112_0103688 3300048915 Bacteria 2814
856 Ga0496112_0133753 3300048915 Bacteria 2450
857 Ga0496112_0142160 3300048915 Bacteria 2369
858 Ga0496112_0203903 3300048915 Bacteria 1936
859 Ga0496112_0532932 3300048915 Bacteria 1108
860 Ga0496112_0556332 3300048915 Unclassified 1081
861 Ga0496112_1229362 3300048915 Unclassified 666
862 Ga0496112_1823612 3300048915 Bacteria 520
863 Ga0496113_0004202 3300048916 Bacteria 8802
864 Ga0496113_0010188 3300048916 Bacteria 6205
865 Ga0496113_0051293 3300048916 Bacteria 3079
866 Ga0496113_0054226 3300048916 Bacteria 3000
867 Ga0496113_0079294 3300048916 Bacteria 2513
868 Ga0496113_0149116 3300048916 Bacteria 1844
869 Ga0496113_0369802 3300048916 Unclassified 1151
870 Ga0496113_0576322 3300048916 Bacteria 902
871 Ga0496113_0901771 3300048916 Unclassified 699
872 Ga0496114_0004595 3300048917 Bacteria 10722
873 Ga0496114_0085207 3300048917 Bacteria 2676
874 Ga0496114_0308611 3300048917 Bacteria 1397
875 Ga0496114_0325633 3300048917 Bacteria 1358
876 Ga0496114_0352959 3300048917 Bacteria 1301
877 Ga0496114_0430931 3300048917 Unclassified 1168
878 Ga0496114_0635371 3300048917 Unclassified 940
879 Ga0496114_0798700 3300048917 Unclassified 822
880 Ga0496115_0000719 3300048918 Bacteria 24524
881 Ga0496115_0011137 3300048918 Bacteria 6739
882 Ga0496115_0017246 3300048918 Bacteria 5514
883 Ga0496115_0397844 3300048918 Bacteria 1118
884 Ga0496115_0771008 3300048918 Bacteria 751
885 Ga0501031_0098812 3300049568 Bacteria 1905
886 Ga0501036_0801312 3300049572 Unclassified 776
887 Ga0501040_0336033 3300049576 Bacteria 1081
888 Ga0501041_0297965 3300049577 Bacteria 1016
889 Ga0501046_0119258 3300049580 Bacteria 2009
890 Ga0501067_0315177 3300049583 Bacteria 871
891 Ga0501070_1477973 3300049586 Unclassified 515
892 Ga0501071_0228115 3300049587 Bacteria 1403
893 Ga0501071_0229855 3300049587 Bacteria 1397
894 Ga0501072_0312901 3300049588 Bacteria 1248
895 Ga0501074_0111653 3300049590 Bacteria 1956
896 Ga0501074_0811417 3300049590 Unclassified 659
897 Ga0501075_0355166 3300049591 Bacteria 1117
898 Ga0501075_0426735 3300049591 Bacteria 1011
899 Ga0501075_0708487 3300049591 Bacteria 767
900 Ga0501076_0204927 3300049592 Bacteria 1611
901 Ga0501076_0308750 3300049592 Bacteria 1297
902 Ga0501076_0334975 3300049592 Bacteria 1242
903 Ga0501077_0014651 3300049593 Bacteria 4928
904 Ga0501209_182944 3300049656 Unclassified 640
905 Ga0501079_0523606 3300049741 Unclassified 932
906 Ga0501079_0557632 3300049741 Bacteria 901
907 Ga0501079_0583770 3300049741 Unclassified 879
908 Ga0501080_0834098 3300049742 Unclassified 807
909 Ga0501081_0370331 3300049743 Bacteria 1058
910 Ga0501081_0461031 3300049743 Bacteria 945
911 nmdc:mga06z11_207454_c1 3300050494 Bacteria 1140
912 nmdc:mga05p37_126299_c1 3300050507 Bacteria 3141
913 nmdc:mga05p37_152131_c1 3300050507 Bacteria 2829
914 nmdc:mga05p37_1770313_c1 3300050507 Bacteria 598
915 nmdc:mga05p37_296926_c1 3300050507 Unclassified 1921
916 nmdc:mga05p37_29893_c1 3300050507 Bacteria 6649
917 nmdc:mga05p37_317867_c1 3300050507 Bacteria 1844
918 nmdc:mga05p37_47248_c1 3300050507 Bacteria 5294
919 nmdc:mga09592_1445061_c1 3300050508 Unclassified 561
920 nmdc:mga09592_197574_c1 3300050508 Unclassified 1741
921 nmdc:mga0qj67_353467_c1 3300050509 Bacteria 1188
922 nmdc:mga06r32_270595_c1 3300050510 Bacteria 1686
923 nmdc:mga06r32_444607_c1 3300050510 Unclassified 1276
924 nmdc:mga06r32_486579_c1 3300050510 Bacteria 1212
925 nmdc:mga06r32_626955_c1 3300050510 Bacteria 1045
926 nmdc:mga08y16_207947_c1 3300050511 Bacteria 2027
927 nmdc:mga08y16_27156_c1 3300050511 Bacteria 6032
928 nmdc:mga08y16_33123_c1 3300050511 Bacteria 5427
929 nmdc:mga08y16_448142_c1 3300050511 Unclassified 1316
930 nmdc:mga08y16_601066_c1 3300050511 Bacteria 1109
931 nmdc:mga08y16_86123_c1 3300050511 Bacteria 3275
932 nmdc:mga0n895_112477_c1 3300050512 Bacteria 2740
933 nmdc:mga0n895_138768_c1 3300050512 Bacteria 2459
934 nmdc:mga0n895_1631416_c1 3300050512 Bacteria 609
935 nmdc:mga0n895_2036586_c1 3300050512 Unclassified 531
936 nmdc:mga0n895_31972_c1 3300050512 Bacteria 5046
937 nmdc:mga0n895_367332_c1 3300050512 Bacteria 1457
938 nmdc:mga0n895_67480_c1 3300050512 Bacteria 3542
939 nmdc:mga0n895_951351_c1 3300050512 Unclassified 842
940 nmdc:mga0rr50_1148081_c1 3300050513 Unclassified 660
941 nmdc:mga0rr50_1169198_c1 3300050513 Bacteria 654
942 nmdc:mga0rr50_1638232_c1 3300050513 Unclassified 543
943 nmdc:mga0rr50_2948_c1 3300050513 Bacteria 9731
944 nmdc:mga0rr50_322216_c1 3300050513 Bacteria 1296
945 nmdc:mga0rr50_554494_c1 3300050513 Bacteria 979
946 nmdc:mga0rr50_600007_c1 3300050513 Bacteria 939
947 nmdc:mga0rr50_626028_c1 3300050513 Bacteria 918
948 nmdc:mga08x19_2470_c1 3300050514 Bacteria 11248
949 nmdc:mga08x19_26455_c1 3300050514 Bacteria 3621
950 nmdc:mga08x19_281394_c1 3300050514 Bacteria 1153
951 nmdc:mga08x19_535449_c1 3300050514 Bacteria 828
952 nmdc:mga08x19_8074_c1 3300050514 Bacteria 6254
953 nmdc:mga0a205_1203477_c1 3300050515 Bacteria 605
954 nmdc:mga0a205_1445252_c1 3300050515 Bacteria 536
955 nmdc:mga0a205_16811_c1 3300050515 Bacteria 6852
956 nmdc:mga0a205_220469_c1 3300050515 Bacteria 1782
957 nmdc:mga0a205_249276_c1 3300050515 Bacteria 1656
958 nmdc:mga0a205_332113_c1 3300050515 Bacteria 1390
959 nmdc:mga0a205_618737_c1 3300050515 Bacteria 935
960 nmdc:mga0a205_675279_c1 3300050515 Bacteria 884
961 nmdc:mga0a205_990416_c1 3300050515 Unclassified 688
962 Ga0495601_0671546 3300053077 Bacteria 662
963 Ga0495601_0713872 3300053077 Bacteria 639
964 Ga0495612_0152474 3300053078 Unclassified 1006
965 Ga0495612_0351837 3300053078 Bacteria 665
966 Ga0495655_0162561 3300053083 Unclassified 709
967 Ga0495595_0082358 3300053084 Bacteria 1535
968 Ga0501084_0128769 3300054114 Bacteria 2131
969 Ga0501084_0718648 3300054114 Unclassified 842
970 Ga0587113_021899 3300059625 Unclassified 678
971 Ga0587130_015021 3300059631 Bacteria 795
972 Ga0501082_0141668 3300060353 Bacteria 2087
973 Ga0501082_0388469 3300060353 Bacteria 1218

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10059350 Ga0070710_100593502 90
2 3300009148 Ga0105243_11205100 Ga0105243_112051002 90
3 3300005355 Ga0070671_101389008 Ga0070671_1013890081 91
4 3300005366 Ga0070659_101255173 Ga0070659_1012551732 91
5 3300009177 Ga0105248_12746152 Ga0105248_127461522 91
6 3300025944 Ga0207661_11242159 Ga0207661_112421591 91
7 3300048915 Ga0496112_1823612 Ga0496112_1823612_78_353 91
8 3300038443 Ga0395901_0255021 Ga0395901_0255021_928_1251 93
9 3300037418 Ga0395900_0307589 Ga0395900_0307589_1212_1505 97
10 3300037466 Ga0395898_1458832 Ga0395898_1458832_111_404 97
11 3300037471 Ga0395905_0999808 Ga0395905_0999808_250_543 97
12 3300005536 Ga0070697_100035973 Ga0070697_1000359732 98
13 3300049656 Ga0501209_182944 Ga0501209_182944_92_418 98
14 3300007788 Ga0099795_10359624 Ga0099795_103596241 99
15 3300005985 Ga0081539_10058993 Ga0081539_100589931 100
16 3300005471 Ga0070698_100230235 Ga0070698_1002302352 101
17 3300025922 Ga0207646_10010563 Ga0207646_100105632 101
18 3300048911 Ga0496108_0400372 Ga0496108_0400372_773_1078 101
19 3300005329 Ga0070683_100090739 Ga0070683_1000907394 102
20 3300005467 Ga0070706_101676874 Ga0070706_1016768741 102
21 3300005544 Ga0070686_101388161 Ga0070686_1013881612 102
22 3300005563 Ga0068855_100093499 Ga0068855_1000934995 102
23 3300005614 Ga0068856_100585088 Ga0068856_1005850882 102
24 3300005981 Ga0081538_10062276 Ga0081538_100622762 102
25 3300009093 Ga0105240_11158809 Ga0105240_111588092 102
26 3300020610 Ga0154015_1659241 Ga0154015_16592411 102
27 3300025913 Ga0207695_10817634 Ga0207695_108176342 102
28 3300025949 Ga0207667_10321160 Ga0207667_103211603 102
29 3300026078 Ga0207702_10286402 Ga0207702_102864024 102
30 3300031241 Ga0265325_10020382 Ga0265325_100203822 102
31 3300031595 Ga0265313_10112784 Ga0265313_101127842 102
32 3300048903 Ga0496100_0000160 Ga0496100_0000160_14541_14852 102
33 3300048912 Ga0496109_0005317 Ga0496109_0005317_4458_4769 102
34 3300049591 Ga0501075_0426735 Ga0501075_0426735_565_873 102
35 3300049592 Ga0501076_0204927 Ga0501076_0204927_40_348 102
36 3300049741 Ga0501079_0583770 Ga0501079_0583770_547_855 102
37 3300054114 Ga0501084_0718648 Ga0501084_0718648_489_797 102
38 3300005333 Ga0070677_10282291 Ga0070677_102822912 103
39 3300005336 Ga0070680_100676325 Ga0070680_1006763252 103
40 3300005337 Ga0070682_101354596 Ga0070682_1013545961 103
41 3300005355 Ga0070671_100226357 Ga0070671_1002263571 103
42 3300005364 Ga0070673_100540241 Ga0070673_1005402412 103
43 3300005406 Ga0070703_10012614 Ga0070703_100126142 103
44 3300005436 Ga0070713_100198314 Ga0070713_1001983142 103
45 3300005437 Ga0070710_10015608 Ga0070710_100156082 103
46 3300005439 Ga0070711_100105853 Ga0070711_1001058532 103
47 3300005440 Ga0070705_100055860 Ga0070705_1000558604 103
48 3300005456 Ga0070678_100027265 Ga0070678_1000272655 103
49 3300005545 Ga0070695_101427571 Ga0070695_1014275711 103
50 3300005546 Ga0070696_100012929 Ga0070696_1000129296 103
51 3300005549 Ga0070704_101055689 Ga0070704_1010556892 103
52 3300005844 Ga0068862_101660491 Ga0068862_1016604911 103
53 3300006163 Ga0070715_10206287 Ga0070715_102062872 103
54 3300006175 Ga0070712_100045974 Ga0070712_1000459743 103
55 3300006237 Ga0097621_100194138 Ga0097621_1001941382 103
56 3300006358 Ga0068871_100868497 Ga0068871_1008684971 103
57 3300006852 Ga0075433_10044990 Ga0075433_100449905 103
58 3300006914 Ga0075436_100038877 Ga0075436_1000388774 103
59 3300009147 Ga0114129_10097803 Ga0114129_100978032 103
60 3300009148 Ga0105243_10016878 Ga0105243_100168788 103
61 3300009174 Ga0105241_11772752 Ga0105241_117727522 103
62 3300009176 Ga0105242_10205333 Ga0105242_102053332 103
63 3300010375 Ga0105239_10493160 Ga0105239_104931602 103
64 3300013297 Ga0157378_10693939 Ga0157378_106939392 103
65 3300013308 Ga0157375_10105603 Ga0157375_101056034 103
66 3300014969 Ga0157376_10410401 Ga0157376_104104012 103
67 3300025885 Ga0207653_10005114 Ga0207653_100051144 103
68 3300025898 Ga0207692_10157458 Ga0207692_101574581 103
69 3300025906 Ga0207699_10090402 Ga0207699_100904022 103
70 3300025910 Ga0207684_10577071 Ga0207684_105770711 103
71 3300025915 Ga0207693_10001413 Ga0207693_1000141328 103
72 3300025916 Ga0207663_10546255 Ga0207663_105462551 103
73 3300025931 Ga0207644_10859075 Ga0207644_108590752 103
74 3300025934 Ga0207686_10724462 Ga0207686_107244621 103
75 3300025939 Ga0207665_10137581 Ga0207665_101375813 103
76 3300026121 Ga0207683_10141485 Ga0207683_101414852 103
77 3300034816 Ga0373930_0022749 Ga0373930_0022749_662_973 103
78 3300034817 Ga0373948_0139211 Ga0373948_0139211_249_560 103
79 3300034818 Ga0373950_0052684 Ga0373950_0052684_239_550 103
80 3300034820 Ga0373959_0003544 Ga0373959_0003544_536_847 103
81 3300034957 Ga0373938_0024714 Ga0373938_0024714_386_697 103
82 3300035084 Ga0373928_0006763 Ga0373928_0006763_138_449 103
83 3300035085 Ga0373929_0048132 Ga0373929_0048132_602_913 103
84 3300035088 Ga0373940_0128863 Ga0373940_0128863_442_753 103
85 3300035090 Ga0373949_0011808 Ga0373949_0011808_97_408 103
86 3300035091 Ga0373951_0005669 Ga0373951_0005669_1034_1345 103
87 3300035092 Ga0373952_0024073 Ga0373952_0024073_237_548 103
88 3300035112 Ga0373932_0016907 Ga0373932_0016907_1205_1516 103
89 3300035114 Ga0373939_0014328 Ga0373939_0014328_292_603 103
90 3300035121 Ga0373960_0004406 Ga0373960_0004406_1392_1703 103
91 3300035207 Ga0373942_0002766 Ga0373942_0002766_404_715 103
92 3300035241 Ga0373961_0004810 Ga0373961_0004810_145_456 103
93 3300035242 Ga0373962_0004999 Ga0373962_0004999_18_329 103
94 3300035691 Ga0373931_0010433 Ga0373931_0010433_1388_1699 103
95 3300037418 Ga0395900_0137616 Ga0395900_0137616_1816_2127 103
96 3300037466 Ga0395898_0004222 Ga0395898_0004222_12953_13264 103
97 3300038443 Ga0395901_0036919 Ga0395901_0036919_2156_2467 103
98 3300048903 Ga0496100_0153968 Ga0496100_0153968_122_433 103
99 3300048904 Ga0496101_0042059 Ga0496101_0042059_1252_1563 103
100 3300048905 Ga0496102_1107886 Ga0496102_1107886_209_520 103
101 3300048906 Ga0496103_0011370 Ga0496103_0011370_3290_3601 103
102 3300048907 Ga0496104_0289082 Ga0496104_0289082_12_323 103
103 3300048908 Ga0496105_0112921 Ga0496105_0112921_911_1222 103
104 3300048909 Ga0496106_0073098 Ga0496106_0073098_1007_1318 103
105 3300048910 Ga0496107_0022492 Ga0496107_0022492_3940_4251 103
106 3300048911 Ga0496108_0055611 Ga0496108_0055611_1699_2010 103
107 3300048912 Ga0496109_0139389 Ga0496109_0139389_869_1180 103
108 3300048913 Ga0496110_0633411 Ga0496110_0633411_38_349 103
109 3300048914 Ga0496111_1193673 Ga0496111_1193673_141_452 103
110 3300048915 Ga0496112_0532932 Ga0496112_0532932_464_775 103
111 3300048916 Ga0496113_0079294 Ga0496113_0079294_249_560 103
112 3300048917 Ga0496114_0308611 Ga0496114_0308611_239_550 103
113 3300048918 Ga0496115_0011137 Ga0496115_0011137_3161_3472 103
114 3300050507 nmdc:mga05p37_29893_c1 nmdc:mga05p37_29893_c1_3062_3373 103
115 3300050513 nmdc:mga0rr50_554494_c1 nmdc:mga0rr50_554494_c1_380_691 103
116 3300050514 nmdc:mga08x19_281394_c1 nmdc:mga08x19_281394_c1_557_868 103
117 3300050515 nmdc:mga0a205_990416_c1 nmdc:mga0a205_990416_c1_53_364 103
118 3300005445 Ga0070708_100096950 Ga0070708_1000969504 104
119 3300031911 Ga0307412_10283823 Ga0307412_102838233 104
120 3300031995 Ga0307409_101047970 Ga0307409_1010479702 104
121 3300032002 Ga0307416_100113792 Ga0307416_1001137923 104
122 3300032126 Ga0307415_100026813 Ga0307415_1000268132 104
123 3300038996 Ga0242420_032685 Ga0242420_032685_113_427 104
124 3300045976 Ga0466967_0198264 Ga0466967_0198264_245_559 104
125 3300046678 Ga0495599_0816078 Ga0495599_0816078_129_443 104
126 3300048912 Ga0496109_0146476 Ga0496109_0146476_119_433 104
127 3300048913 Ga0496110_0738515 Ga0496110_0738515_22_336 104
128 3300049583 Ga0501067_0315177 Ga0501067_0315177_515_838 104
129 3300005328 Ga0070676_10822642 Ga0070676_108226422 105
130 3300005329 Ga0070683_100112705 Ga0070683_1001127053 105
131 3300005334 Ga0068869_100273229 Ga0068869_1002732292 105
132 3300005338 Ga0068868_100060548 Ga0068868_1000605484 105
133 3300005339 Ga0070660_100699058 Ga0070660_1006990582 105
134 3300005340 Ga0070689_101964780 Ga0070689_1019647802 105
135 3300005341 Ga0070691_10766322 Ga0070691_107663222 105
136 3300005343 Ga0070687_101280556 Ga0070687_1012805562 105
137 3300005347 Ga0070668_100276760 Ga0070668_1002767602 105
138 3300005353 Ga0070669_101660046 Ga0070669_1016600462 105
139 3300005354 Ga0070675_100078841 Ga0070675_1000788414 105
140 3300005354 Ga0070675_101293695 Ga0070675_1012936952 105
141 3300005356 Ga0070674_100007039 Ga0070674_1000070395 105
142 3300005356 Ga0070674_100981507 Ga0070674_1009815071 105
143 3300005364 Ga0070673_100106159 Ga0070673_1001061593 105
144 3300005367 Ga0070667_100204324 Ga0070667_1002043243 105
145 3300005434 Ga0070709_10078771 Ga0070709_100787712 105
146 3300005437 Ga0070710_10357824 Ga0070710_103578243 105
147 3300005438 Ga0070701_11229175 Ga0070701_112291751 105
148 3300005439 Ga0070711_100066924 Ga0070711_1000669243 105
149 3300005439 Ga0070711_100216803 Ga0070711_1002168033 105
150 3300005440 Ga0070705_100086775 Ga0070705_1000867752 105
151 3300005444 Ga0070694_100103932 Ga0070694_1001039322 105
152 3300005445 Ga0070708_100252045 Ga0070708_1002520453 105
153 3300005456 Ga0070678_100176555 Ga0070678_1001765552 105
154 3300005457 Ga0070662_100153148 Ga0070662_1001531481 105
155 3300005457 Ga0070662_100950439 Ga0070662_1009504391 105
156 3300005459 Ga0068867_100101688 Ga0068867_1001016883 105
157 3300005467 Ga0070706_100197069 Ga0070706_1001970692 105
158 3300005467 Ga0070706_100387198 Ga0070706_1003871982 105
159 3300005468 Ga0070707_100605527 Ga0070707_1006055273 105
160 3300005468 Ga0070707_101143436 Ga0070707_1011434361 105
161 3300005471 Ga0070698_100178885 Ga0070698_1001788853 105
162 3300005535 Ga0070684_100032939 Ga0070684_1000329393 105
163 3300005539 Ga0068853_101947688 Ga0068853_1019476881 105
164 3300005544 Ga0070686_100298072 Ga0070686_1002980721 105
165 3300005545 Ga0070695_100057596 Ga0070695_1000575965 105
166 3300005546 Ga0070696_100487491 Ga0070696_1004874912 105
167 3300005546 Ga0070696_101831956 Ga0070696_1018319561 105
168 3300005547 Ga0070693_100369772 Ga0070693_1003697722 105
169 3300005548 Ga0070665_101655678 Ga0070665_1016556782 105
170 3300005549 Ga0070704_101478371 Ga0070704_1014783712 105
171 3300005549 Ga0070704_101492980 Ga0070704_1014929801 105
172 3300005563 Ga0068855_101705456 Ga0068855_1017054562 105
173 3300005564 Ga0070664_100064930 Ga0070664_1000649304 105
174 3300005577 Ga0068857_100374381 Ga0068857_1003743813 105
175 3300005615 Ga0070702_100117267 Ga0070702_1001172671 105
176 3300005616 Ga0068852_101617206 Ga0068852_1016172061 105
177 3300005718 Ga0068866_10051763 Ga0068866_100517634 105
178 3300005719 Ga0068861_102482496 Ga0068861_1024824961 105
179 3300005843 Ga0068860_100114268 Ga0068860_1001142684 105
180 3300005843 Ga0068860_101696910 Ga0068860_1016969102 105
181 3300005844 Ga0068862_100676377 Ga0068862_1006763772 105
182 3300005937 Ga0081455_10296000 Ga0081455_102960003 105
183 3300006028 Ga0070717_11534822 Ga0070717_115348222 105
184 3300006173 Ga0070716_100305481 Ga0070716_1003054813 105
185 3300006173 Ga0070716_100431575 Ga0070716_1004315753 105
186 3300006173 Ga0070716_100948812 Ga0070716_1009488122 105
187 3300006175 Ga0070712_100117206 Ga0070712_1001172062 105
188 3300006237 Ga0097621_100312780 Ga0097621_1003127802 105
189 3300006358 Ga0068871_101697189 Ga0068871_1016971892 105
190 3300006844 Ga0075428_100388463 Ga0075428_1003884632 105
191 3300006844 Ga0075428_100729930 Ga0075428_1007299303 105
192 3300006847 Ga0075431_100026120 Ga0075431_1000261207 105
193 3300006871 Ga0075434_100778090 Ga0075434_1007780903 105
194 3300006880 Ga0075429_100280665 Ga0075429_1002806653 105
195 3300007076 Ga0075435_100114959 Ga0075435_1001149593 105
196 3300009092 Ga0105250_10150021 Ga0105250_101500212 105
197 3300009094 Ga0111539_10028470 Ga0111539_100284706 105
198 3300009094 Ga0111539_10046834 Ga0111539_100468346 105
199 3300009098 Ga0105245_10130771 Ga0105245_101307712 105
200 3300009098 Ga0105245_11709099 Ga0105245_117090991 105
201 3300009147 Ga0114129_10000831 Ga0114129_1000083117 105
202 3300009147 Ga0114129_10108514 Ga0114129_101085141 105
203 3300009148 Ga0105243_10063943 Ga0105243_100639432 105
204 3300009148 Ga0105243_13061977 Ga0105243_130619772 105
205 3300009176 Ga0105242_10040981 Ga0105242_100409817 105
206 3300009176 Ga0105242_10201013 Ga0105242_102010135 105
207 3300009176 Ga0105242_11072493 Ga0105242_110724932 105
208 3300009177 Ga0105248_10450454 Ga0105248_104504542 105
209 3300009177 Ga0105248_12354264 Ga0105248_123542641 105
210 3300009551 Ga0105238_10530372 Ga0105238_105303722 105
211 3300009553 Ga0105249_10118902 Ga0105249_101189022 105
212 3300009553 Ga0105249_10696486 Ga0105249_106964862 105
213 3300010375 Ga0105239_10386990 Ga0105239_103869902 105
214 3300010375 Ga0105239_11287061 Ga0105239_112870612 105
215 3300011119 Ga0105246_11531884 Ga0105246_115318842 105
216 3300013102 Ga0157371_10396243 Ga0157371_103962432 105
217 3300013105 Ga0157369_11066244 Ga0157369_110662442 105
218 3300013296 Ga0157374_10150805 Ga0157374_101508053 105
219 3300013296 Ga0157374_11301669 Ga0157374_113016692 105
220 3300013306 Ga0163162_10411859 Ga0163162_104118594 105
221 3300013306 Ga0163162_10598976 Ga0163162_105989762 105
222 3300013307 Ga0157372_10643391 Ga0157372_106433912 105
223 3300013308 Ga0157375_10456694 Ga0157375_104566941 105
224 3300013308 Ga0157375_10860870 Ga0157375_108608702 105
225 3300014325 Ga0163163_10133860 Ga0163163_101338604 105
226 3300014326 Ga0157380_10474416 Ga0157380_104744162 105
227 3300014326 Ga0157380_10630516 Ga0157380_106305162 105
228 3300014745 Ga0157377_10035301 Ga0157377_100353014 105
229 3300014745 Ga0157377_10479923 Ga0157377_104799232 105
230 3300014968 Ga0157379_10163166 Ga0157379_101631663 105
231 3300014969 Ga0157376_12192216 Ga0157376_121922162 105
232 3300017792 Ga0163161_10358667 Ga0163161_103586672 105
233 3300020082 Ga0206353_10365959 Ga0206353_103659591 105
234 3300025898 Ga0207692_10188351 Ga0207692_101883513 105
235 3300025900 Ga0207710_10590365 Ga0207710_105903652 105
236 3300025915 Ga0207693_10026555 Ga0207693_100265556 105
237 3300025916 Ga0207663_10216817 Ga0207663_102168172 105
238 3300025916 Ga0207663_10344220 Ga0207663_103442203 105
239 3300025921 Ga0207652_10646904 Ga0207652_106469043 105
240 3300025922 Ga0207646_10165062 Ga0207646_101650621 105
241 3300025922 Ga0207646_10362136 Ga0207646_103621362 105
242 3300025925 Ga0207650_11707137 Ga0207650_117071372 105
243 3300025926 Ga0207659_10168573 Ga0207659_101685734 105
244 3300025927 Ga0207687_10216630 Ga0207687_102166303 105
245 3300025929 Ga0207664_11285428 Ga0207664_112854282 105
246 3300025933 Ga0207706_10115490 Ga0207706_101154904 105
247 3300025933 Ga0207706_11063050 Ga0207706_110630501 105
248 3300025934 Ga0207686_10096419 Ga0207686_100964191 105
249 3300025935 Ga0207709_10768462 Ga0207709_107684622 105
250 3300025937 Ga0207669_10038865 Ga0207669_100388655 105
251 3300025938 Ga0207704_10232902 Ga0207704_102329023 105
252 3300025939 Ga0207665_10168821 Ga0207665_101688213 105
253 3300025939 Ga0207665_10726833 Ga0207665_107268332 105
254 3300025942 Ga0207689_10169712 Ga0207689_101697122 105
255 3300025944 Ga0207661_10068368 Ga0207661_100683682 105
256 3300025945 Ga0207679_10011810 Ga0207679_100118104 105
257 3300025960 Ga0207651_10776683 Ga0207651_107766832 105
258 3300025961 Ga0207712_11223303 Ga0207712_112233031 105
259 3300026023 Ga0207677_10354586 Ga0207677_103545862 105
260 3300026089 Ga0207648_10135205 Ga0207648_101352053 105
261 3300026095 Ga0207676_10700249 Ga0207676_107002492 105
262 3300026118 Ga0207675_100125613 Ga0207675_1001256135 105
263 3300026121 Ga0207683_10169808 Ga0207683_101698082 105
264 3300026142 Ga0207698_10374389 Ga0207698_103743892 105
265 3300027907 Ga0207428_10054782 Ga0207428_100547822 105
266 3300028381 Ga0268264_10334425 Ga0268264_103344252 105
267 3300028381 Ga0268264_10968706 Ga0268264_109687062 105
268 3300031995 Ga0307409_101826815 Ga0307409_1018268151 105
269 3300035118 Ga0373954_0342249 Ga0373954_0342249_134_454 105
270 3300035120 Ga0373957_0112193 Ga0373957_0112193_548_868 105
271 3300035172 Ga0373955_0743130 Ga0373955_0743130_136_456 105
272 3300035724 Ga0373933_0997871 Ga0373933_0997871_85_405 105
273 3300036401 Ga0373937_0999052 Ga0373937_0999052_282_602 105
274 3300037418 Ga0395900_0481552 Ga0395900_0481552_700_1017 105
275 3300037418 Ga0395900_0899052 Ga0395900_0899052_63_380 105
276 3300037466 Ga0395898_0361068 Ga0395898_0361068_327_644 105
277 3300037471 Ga0395905_0073735 Ga0395905_0073735_2064_2381 105
278 3300037471 Ga0395905_0487257 Ga0395905_0487257_609_926 105
279 3300037471 Ga0395905_1668681 Ga0395905_1668681_43_360 105
280 3300038443 Ga0395901_0353599 Ga0395901_0353599_958_1275 105
281 3300038443 Ga0395901_0519163 Ga0395901_0519163_260_577 105
282 3300038443 Ga0395901_0786208 Ga0395901_0786208_468_785 105
283 3300038443 Ga0395901_1684364 Ga0395901_1684364_217_543 105
284 3300041460 Ga0451802_2160690 Ga0451802_2160690_184_501 105
285 3300041505 Ga0451849_1578475 Ga0451849_1578475_219_536 105
286 3300046474 Ga0495605_0439002 Ga0495605_0439002_11_328 105
287 3300046477 Ga0495664_0525857 Ga0495664_0525857_26_346 105
288 3300046491 Ga0495584_0415673 Ga0495584_0415673_224_559 105
289 3300046516 Ga0495628_0514476 Ga0495628_0514476_143_463 105
290 3300046528 Ga0495642_0124065 Ga0495642_0124065_494_811 105
291 3300046559 Ga0495667_0090543 Ga0495667_0090543_10_330 105
292 3300046615 Ga0495656_0471304 Ga0495656_0471304_83_400 105
293 3300046678 Ga0495599_0487071 Ga0495599_0487071_115_435 105
294 3300046794 Ga0495589_0314837 Ga0495589_0314837_391_708 105
295 3300047319 Ga0495674_0390964 Ga0495674_0390964_424_741 105
296 3300047321 Ga0495676_0718188 Ga0495676_0718188_244_561 105
297 3300047447 Ga0495685_165957 Ga0495685_165957_209_526 105
298 3300047471 Ga0495684_0692846 Ga0495684_0692846_203_520 105
299 3300048905 Ga0496102_0243704 Ga0496102_0243704_439_756 105
300 3300048905 Ga0496102_0668385 Ga0496102_0668385_549_872 105
301 3300048905 Ga0496102_1837282 Ga0496102_1837282_82_399 105
302 3300048909 Ga0496106_0975736 Ga0496106_0975736_130_465 105
303 3300048910 Ga0496107_0171803 Ga0496107_0171803_139_462 105
304 3300048910 Ga0496107_0393204 Ga0496107_0393204_582_899 105
305 3300048910 Ga0496107_1124130 Ga0496107_1124130_142_459 105
306 3300048911 Ga0496108_0059331 Ga0496108_0059331_1512_1838 105
307 3300048911 Ga0496108_1125761 Ga0496108_1125761_50_367 105
308 3300048912 Ga0496109_0021346 Ga0496109_0021346_1816_2142 105
309 3300048912 Ga0496109_0297818 Ga0496109_0297818_36_353 105
310 3300048913 Ga0496110_0818995 Ga0496110_0818995_391_708 105
311 3300048914 Ga0496111_0198803 Ga0496111_0198803_301_636 105
312 3300048914 Ga0496111_0728763 Ga0496111_0728763_181_507 105
313 3300048914 Ga0496111_1077771 Ga0496111_1077771_69_386 105
314 3300048915 Ga0496112_0000125 Ga0496112_0000125_44094_44411 105
315 3300048915 Ga0496112_0142160 Ga0496112_0142160_1839_2171 105
316 3300048916 Ga0496113_0576322 Ga0496113_0576322_368_685 105
317 3300048916 Ga0496113_0901771 Ga0496113_0901771_293_619 105
318 3300050507 nmdc:mga05p37_296926_c1 nmdc:mga05p37_296926_c1_790_1107 105
319 3300050507 nmdc:mga05p37_47248_c1 nmdc:mga05p37_47248_c1_3967_4284 105
320 3300050508 nmdc:mga09592_197574_c1 nmdc:mga09592_197574_c1_1159_1476 105
321 3300050511 nmdc:mga08y16_27156_c1 nmdc:mga08y16_27156_c1_1319_1636 105
322 3300050511 nmdc:mga08y16_86123_c1 nmdc:mga08y16_86123_c1_200_517 105
323 3300050512 nmdc:mga0n895_31972_c1 nmdc:mga0n895_31972_c1_1210_1527 105
324 3300050512 nmdc:mga0n895_951351_c1 nmdc:mga0n895_951351_c1_146_463 105
325 3300050514 nmdc:mga08x19_26455_c1 nmdc:mga08x19_26455_c1_156_473 105
326 3300050515 nmdc:mga0a205_1445252_c1 nmdc:mga0a205_1445252_c1_137_454 105
327 3300050515 nmdc:mga0a205_675279_c1 nmdc:mga0a205_675279_c1_383_700 105
328 3300053077 Ga0495601_0671546 Ga0495601_0671546_214_531 105
329 3300053078 Ga0495612_0351837 Ga0495612_0351837_173_493 105
330 3300053084 Ga0495595_0082358 Ga0495595_0082358_740_1060 105
331 3300059625 Ga0587113_021899 Ga0587113_021899_71_388 105
332 3300059631 Ga0587130_015021 Ga0587130_015021_26_343 105
333 3300002073 JGI24745J21846_1044402 JGI24745J21846_10444021 106
334 3300005327 Ga0070658_10428860 Ga0070658_104288601 106
335 3300005327 Ga0070658_11706863 Ga0070658_117068631 106
336 3300005329 Ga0070683_100101527 Ga0070683_1001015272 106
337 3300005334 Ga0068869_100138974 Ga0068869_1001389744 106
338 3300005336 Ga0070680_100303111 Ga0070680_1003031112 106
339 3300005336 Ga0070680_100672675 Ga0070680_1006726752 106
340 3300005337 Ga0070682_100006477 Ga0070682_1000064779 106
341 3300005337 Ga0070682_100518328 Ga0070682_1005183281 106
342 3300005340 Ga0070689_100056184 Ga0070689_1000561842 106
343 3300005341 Ga0070691_10191415 Ga0070691_101914152 106
344 3300005343 Ga0070687_100207905 Ga0070687_1002079052 106
345 3300005344 Ga0070661_100244888 Ga0070661_1002448882 106
346 3300005353 Ga0070669_101302738 Ga0070669_1013027382 106
347 3300005354 Ga0070675_100813560 Ga0070675_1008135601 106
348 3300005355 Ga0070671_100647197 Ga0070671_1006471972 106
349 3300005355 Ga0070671_100803256 Ga0070671_1008032561 106
350 3300005356 Ga0070674_100266072 Ga0070674_1002660722 106
351 3300005364 Ga0070673_100230066 Ga0070673_1002300664 106
352 3300005364 Ga0070673_102219931 Ga0070673_1022199312 106
353 3300005365 Ga0070688_100154130 Ga0070688_1001541302 106
354 3300005406 Ga0070703_10158829 Ga0070703_101588292 106
355 3300005406 Ga0070703_10509785 Ga0070703_105097852 106
356 3300005434 Ga0070709_10010201 Ga0070709_100102014 106
357 3300005434 Ga0070709_10013995 Ga0070709_100139955 106
358 3300005434 Ga0070709_10200734 Ga0070709_102007342 106
359 3300005434 Ga0070709_10735834 Ga0070709_107358342 106
360 3300005435 Ga0070714_100668974 Ga0070714_1006689742 106
361 3300005435 Ga0070714_100893277 Ga0070714_1008932771 106
362 3300005437 Ga0070710_10650082 Ga0070710_106500822 106
363 3300005438 Ga0070701_10058379 Ga0070701_100583792 106
364 3300005438 Ga0070701_10648310 Ga0070701_106483102 106
365 3300005439 Ga0070711_100053930 Ga0070711_1000539304 106
366 3300005439 Ga0070711_100241048 Ga0070711_1002410483 106
367 3300005439 Ga0070711_100848786 Ga0070711_1008487862 106
368 3300005439 Ga0070711_101007174 Ga0070711_1010071742 106
369 3300005439 Ga0070711_101555057 Ga0070711_1015550571 106
370 3300005440 Ga0070705_100773756 Ga0070705_1007737562 106
371 3300005440 Ga0070705_101379031 Ga0070705_1013790311 106
372 3300005440 Ga0070705_101898186 Ga0070705_1018981862 106
373 3300005441 Ga0070700_100032492 Ga0070700_1000324924 106
374 3300005441 Ga0070700_101776599 Ga0070700_1017765992 106
375 3300005444 Ga0070694_100260569 Ga0070694_1002605692 106
376 3300005444 Ga0070694_100520672 Ga0070694_1005206722 106
377 3300005444 Ga0070694_101900076 Ga0070694_1019000761 106
378 3300005445 Ga0070708_100023312 Ga0070708_1000233126 106
379 3300005445 Ga0070708_100114600 Ga0070708_1001146002 106
380 3300005445 Ga0070708_100129705 Ga0070708_1001297054 106
381 3300005445 Ga0070708_100321042 Ga0070708_1003210422 106
382 3300005445 Ga0070708_100966715 Ga0070708_1009667151 106
383 3300005455 Ga0070663_100156331 Ga0070663_1001563314 106
384 3300005455 Ga0070663_101586453 Ga0070663_1015864531 106
385 3300005456 Ga0070678_100006059 Ga0070678_1000060592 106
386 3300005456 Ga0070678_100508479 Ga0070678_1005084792 106
387 3300005456 Ga0070678_101538877 Ga0070678_1015388772 106
388 3300005457 Ga0070662_100353028 Ga0070662_1003530282 106
389 3300005458 Ga0070681_10067874 Ga0070681_100678747 106
390 3300005458 Ga0070681_10447922 Ga0070681_104479222 106
391 3300005458 Ga0070681_11104320 Ga0070681_111043202 106
392 3300005466 Ga0070685_10052029 Ga0070685_100520294 106
393 3300005467 Ga0070706_100008263 Ga0070706_1000082634 106
394 3300005467 Ga0070706_100091857 Ga0070706_1000918572 106
395 3300005467 Ga0070706_100270509 Ga0070706_1002705093 106
396 3300005468 Ga0070707_100009180 Ga0070707_10000918012 106
397 3300005468 Ga0070707_100093249 Ga0070707_1000932493 106
398 3300005468 Ga0070707_100207265 Ga0070707_1002072652 106
399 3300005468 Ga0070707_100525827 Ga0070707_1005258272 106
400 3300005468 Ga0070707_101103051 Ga0070707_1011030512 106
401 3300005468 Ga0070707_101799209 Ga0070707_1017992092 106
402 3300005471 Ga0070698_100004541 Ga0070698_10000454110 106
403 3300005471 Ga0070698_100209917 Ga0070698_1002099172 106
404 3300005471 Ga0070698_100282775 Ga0070698_1002827752 106
405 3300005518 Ga0070699_100018853 Ga0070699_1000188535 106
406 3300005518 Ga0070699_100055304 Ga0070699_1000553042 106
407 3300005535 Ga0070684_100022106 Ga0070684_1000221063 106
408 3300005535 Ga0070684_100915199 Ga0070684_1009151992 106
409 3300005539 Ga0068853_100288972 Ga0068853_1002889723 106
410 3300005543 Ga0070672_100356307 Ga0070672_1003563072 106
411 3300005544 Ga0070686_100444744 Ga0070686_1004447441 106
412 3300005546 Ga0070696_100892976 Ga0070696_1008929761 106
413 3300005546 Ga0070696_101233520 Ga0070696_1012335202 106
414 3300005547 Ga0070693_100314642 Ga0070693_1003146422 106
415 3300005549 Ga0070704_100017166 Ga0070704_1000171662 106
416 3300005549 Ga0070704_100465025 Ga0070704_1004650251 106
417 3300005549 Ga0070704_101037707 Ga0070704_1010377072 106
418 3300005549 Ga0070704_101165879 Ga0070704_1011658792 106
419 3300005549 Ga0070704_101562379 Ga0070704_1015623792 106
420 3300005549 Ga0070704_101704790 Ga0070704_1017047901 106
421 3300005563 Ga0068855_100212327 Ga0068855_1002123272 106
422 3300005564 Ga0070664_100007855 Ga0070664_10000785511 106
423 3300005614 Ga0068856_100135612 Ga0068856_1001356124 106
424 3300005614 Ga0068856_100619683 Ga0068856_1006196833 106
425 3300005614 Ga0068856_100666651 Ga0068856_1006666512 106
426 3300005614 Ga0068856_100817040 Ga0068856_1008170401 106
427 3300005615 Ga0070702_100011024 Ga0070702_1000110242 106
428 3300005616 Ga0068852_100009899 Ga0068852_1000098995 106
429 3300005617 Ga0068859_100486396 Ga0068859_1004863963 106
430 3300005618 Ga0068864_100036831 Ga0068864_1000368317 106
431 3300005718 Ga0068866_10108340 Ga0068866_101083403 106
432 3300005718 Ga0068866_10629481 Ga0068866_106294812 106
433 3300005719 Ga0068861_100560910 Ga0068861_1005609103 106
434 3300005841 Ga0068863_100355000 Ga0068863_1003550001 106
435 3300005937 Ga0081455_10130107 Ga0081455_101301072 106
436 3300005981 Ga0081538_10029400 Ga0081538_100294003 106
437 3300005981 Ga0081538_10113985 Ga0081538_101139852 106
438 3300005983 Ga0081540_1015838 Ga0081540_10158386 106
439 3300005985 Ga0081539_10000068 Ga0081539_10000068117 106
440 3300005985 Ga0081539_10009415 Ga0081539_100094159 106
441 3300005985 Ga0081539_10271264 Ga0081539_102712642 106
442 3300006028 Ga0070717_10097143 Ga0070717_100971433 106
443 3300006028 Ga0070717_10203795 Ga0070717_102037953 106
444 3300006028 Ga0070717_11180949 Ga0070717_111809491 106
445 3300006058 Ga0075432_10137469 Ga0075432_101374692 106
446 3300006058 Ga0075432_10318838 Ga0075432_103188381 106
447 3300006163 Ga0070715_10045288 Ga0070715_100452883 106
448 3300006173 Ga0070716_100001084 Ga0070716_1000010847 106
449 3300006173 Ga0070716_100094734 Ga0070716_1000947343 106
450 3300006173 Ga0070716_100096573 Ga0070716_1000965733 106
451 3300006173 Ga0070716_101167947 Ga0070716_1011679472 106
452 3300006175 Ga0070712_100000007 Ga0070712_10000000750 106
453 3300006175 Ga0070712_100003758 Ga0070712_1000037585 106
454 3300006175 Ga0070712_100014605 Ga0070712_1000146052 106
455 3300006175 Ga0070712_100026426 Ga0070712_1000264263 106
456 3300006175 Ga0070712_100159601 Ga0070712_1001596013 106
457 3300006175 Ga0070712_100305032 Ga0070712_1003050322 106
458 3300006175 Ga0070712_100437586 Ga0070712_1004375862 106
459 3300006175 Ga0070712_100516687 Ga0070712_1005166872 106
460 3300006175 Ga0070712_101383421 Ga0070712_1013834211 106
461 3300006178 Ga0075367_10401444 Ga0075367_104014443 106
462 3300006353 Ga0075370_10553252 Ga0075370_105532522 106
463 3300006844 Ga0075428_100121377 Ga0075428_1001213774 106
464 3300006844 Ga0075428_100166123 Ga0075428_1001661234 106
465 3300006844 Ga0075428_102379173 Ga0075428_1023791731 106
466 3300006846 Ga0075430_100380167 Ga0075430_1003801671 106
467 3300006846 Ga0075430_101139996 Ga0075430_1011399962 106
468 3300006847 Ga0075431_100117633 Ga0075431_1001176334 106
469 3300006847 Ga0075431_100229757 Ga0075431_1002297572 106
470 3300006847 Ga0075431_101016083 Ga0075431_1010160832 106
471 3300006847 Ga0075431_101415227 Ga0075431_1014152272 106
472 3300006852 Ga0075433_10015003 Ga0075433_100150035 106
473 3300006852 Ga0075433_10031218 Ga0075433_100312183 106
474 3300006852 Ga0075433_10310276 Ga0075433_103102762 106
475 3300006871 Ga0075434_100045749 Ga0075434_1000457493 106
476 3300006871 Ga0075434_100074186 Ga0075434_1000741864 106
477 3300006871 Ga0075434_100115672 Ga0075434_1001156724 106
478 3300006871 Ga0075434_100288829 Ga0075434_1002888293 106
479 3300006871 Ga0075434_100854788 Ga0075434_1008547882 106
480 3300006871 Ga0075434_101583399 Ga0075434_1015833991 106
481 3300006871 Ga0075434_102004576 Ga0075434_1020045762 106
482 3300006914 Ga0075436_100028580 Ga0075436_1000285806 106
483 3300006914 Ga0075436_100094513 Ga0075436_1000945132 106
484 3300006914 Ga0075436_100179277 Ga0075436_1001792773 106
485 3300006914 Ga0075436_100697180 Ga0075436_1006971802 106
486 3300006931 Ga0097620_100486395 Ga0097620_1004863953 106
487 3300007076 Ga0075435_100000552 Ga0075435_10000055221 106
488 3300007076 Ga0075435_100030027 Ga0075435_1000300274 106
489 3300007076 Ga0075435_100335121 Ga0075435_1003351211 106
490 3300007076 Ga0075435_100485802 Ga0075435_1004858022 106
491 3300007076 Ga0075435_100495423 Ga0075435_1004954232 106
492 3300007076 Ga0075435_100598741 Ga0075435_1005987412 106
493 3300007076 Ga0075435_100719933 Ga0075435_1007199332 106
494 3300007076 Ga0075435_100783243 Ga0075435_1007832432 106
495 3300007076 Ga0075435_101512360 Ga0075435_1015123601 106
496 3300009093 Ga0105240_10906743 Ga0105240_109067432 106
497 3300009093 Ga0105240_11099973 Ga0105240_110999731 106
498 3300009094 Ga0111539_10046823 Ga0111539_100468238 106
499 3300009094 Ga0111539_10276381 Ga0111539_102763812 106
500 3300009094 Ga0111539_10434915 Ga0111539_104349152 106
501 3300009094 Ga0111539_10900962 Ga0111539_109009622 106
502 3300009098 Ga0105245_10011852 Ga0105245_100118529 106
503 3300009098 Ga0105245_10344762 Ga0105245_103447622 106
504 3300009098 Ga0105245_10505981 Ga0105245_105059812 106
505 3300009098 Ga0105245_10899249 Ga0105245_108992493 106
506 3300009098 Ga0105245_12148096 Ga0105245_121480962 106
507 3300009147 Ga0114129_10007775 Ga0114129_100077756 106
508 3300009147 Ga0114129_10166187 Ga0114129_101661873 106
509 3300009147 Ga0114129_10206491 Ga0114129_102064912 106
510 3300009147 Ga0114129_10395042 Ga0114129_103950423 106
511 3300009147 Ga0114129_10670901 Ga0114129_106709012 106
512 3300009147 Ga0114129_10722376 Ga0114129_107223762 106
513 3300009147 Ga0114129_10927154 Ga0114129_109271542 106
514 3300009147 Ga0114129_11763949 Ga0114129_117639492 106
515 3300009148 Ga0105243_10048038 Ga0105243_100480382 106
516 3300009148 Ga0105243_10761442 Ga0105243_107614422 106
517 3300009148 Ga0105243_11638713 Ga0105243_116387132 106
518 3300009176 Ga0105242_10047642 Ga0105242_100476424 106
519 3300009176 Ga0105242_10471047 Ga0105242_104710472 106
520 3300009176 Ga0105242_10732396 Ga0105242_107323962 106
521 3300009176 Ga0105242_11177449 Ga0105242_111774492 106
522 3300009545 Ga0105237_10928327 Ga0105237_109283272 106
523 3300009553 Ga0105249_11564040 Ga0105249_115640402 106
524 3300010375 Ga0105239_10004095 Ga0105239_100040953 106
525 3300010375 Ga0105239_13061540 Ga0105239_130615402 106
526 3300012480 Ga0157346_1001569 Ga0157346_10015693 106
527 3300012494 Ga0157341_1015006 Ga0157341_10150061 106
528 3300012507 Ga0157342_1019055 Ga0157342_10190552 106
529 3300013104 Ga0157370_11195751 Ga0157370_111957512 106
530 3300013105 Ga0157369_10019782 Ga0157369_100197827 106
531 3300013105 Ga0157369_10515497 Ga0157369_105154971 106
532 3300013105 Ga0157369_12533383 Ga0157369_125333831 106
533 3300013296 Ga0157374_10010688 Ga0157374_100106884 106
534 3300013296 Ga0157374_11338816 Ga0157374_113388162 106
535 3300013297 Ga0157378_11209187 Ga0157378_112091872 106
536 3300013306 Ga0163162_10668087 Ga0163162_106680873 106
537 3300013307 Ga0157372_10203064 Ga0157372_102030645 106
538 3300013308 Ga0157375_13465122 Ga0157375_134651222 106
539 3300014326 Ga0157380_10378526 Ga0157380_103785262 106
540 3300014326 Ga0157380_10407620 Ga0157380_104076203 106
541 3300014326 Ga0157380_11431991 Ga0157380_114319912 106
542 3300014745 Ga0157377_10001774 Ga0157377_100017745 106
543 3300014745 Ga0157377_11256145 Ga0157377_112561451 106
544 3300014968 Ga0157379_10760144 Ga0157379_107601442 106
545 3300014969 Ga0157376_10887516 Ga0157376_108875163 106
546 3300020081 Ga0206354_10173438 Ga0206354_101734384 106
547 3300020082 Ga0206353_10095162 Ga0206353_100951623 106
548 3300020082 Ga0206353_11480865 Ga0206353_114808652 106
549 3300021358 Ga0213873_10074288 Ga0213873_100742882 106
550 3300025885 Ga0207653_10226294 Ga0207653_102262942 106
551 3300025898 Ga0207692_10512071 Ga0207692_105120711 106
552 3300025899 Ga0207642_10715864 Ga0207642_107158642 106
553 3300025901 Ga0207688_10003516 Ga0207688_100035164 106
554 3300025904 Ga0207647_10277656 Ga0207647_102776562 106
555 3300025905 Ga0207685_10073254 Ga0207685_100732543 106
556 3300025905 Ga0207685_10477463 Ga0207685_104774631 106
557 3300025906 Ga0207699_10004114 Ga0207699_100041145 106
558 3300025906 Ga0207699_10006204 Ga0207699_100062043 106
559 3300025906 Ga0207699_10066552 Ga0207699_100665522 106
560 3300025909 Ga0207705_10671735 Ga0207705_106717352 106
561 3300025910 Ga0207684_10142609 Ga0207684_101426094 106
562 3300025910 Ga0207684_10206944 Ga0207684_102069444 106
563 3300025910 Ga0207684_11262026 Ga0207684_112620262 106
564 3300025912 Ga0207707_10075848 Ga0207707_100758482 106
565 3300025912 Ga0207707_10103226 Ga0207707_101032262 106
566 3300025913 Ga0207695_11040720 Ga0207695_110407202 106
567 3300025915 Ga0207693_10002613 Ga0207693_1000261321 106
568 3300025915 Ga0207693_10020915 Ga0207693_100209153 106
569 3300025915 Ga0207693_10039249 Ga0207693_100392496 106
570 3300025915 Ga0207693_10158426 Ga0207693_101584262 106
571 3300025915 Ga0207693_10178444 Ga0207693_101784443 106
572 3300025915 Ga0207693_10195845 Ga0207693_101958453 106
573 3300025915 Ga0207693_10793857 Ga0207693_107938571 106
574 3300025916 Ga0207663_10095807 Ga0207663_100958072 106
575 3300025916 Ga0207663_10182104 Ga0207663_101821043 106
576 3300025916 Ga0207663_10409025 Ga0207663_104090251 106
577 3300025916 Ga0207663_10851447 Ga0207663_108514472 106
578 3300025917 Ga0207660_10676584 Ga0207660_106765842 106
579 3300025918 Ga0207662_10007150 Ga0207662_1000715010 106
580 3300025919 Ga0207657_10196743 Ga0207657_101967433 106
581 3300025922 Ga0207646_10124888 Ga0207646_101248881 106
582 3300025922 Ga0207646_10497647 Ga0207646_104976472 106
583 3300025922 Ga0207646_10531440 Ga0207646_105314402 106
584 3300025922 Ga0207646_11317405 Ga0207646_113174052 106
585 3300025922 Ga0207646_11349072 Ga0207646_113490722 106
586 3300025923 Ga0207681_11408751 Ga0207681_114087511 106
587 3300025924 Ga0207694_11598584 Ga0207694_115985842 106
588 3300025927 Ga0207687_10086372 Ga0207687_100863724 106
589 3300025927 Ga0207687_10643024 Ga0207687_106430242 106
590 3300025927 Ga0207687_11617396 Ga0207687_116173962 106
591 3300025928 Ga0207700_10151217 Ga0207700_101512173 106
592 3300025929 Ga0207664_10730016 Ga0207664_107300162 106
593 3300025929 Ga0207664_11631287 Ga0207664_116312872 106
594 3300025933 Ga0207706_10087029 Ga0207706_100870292 106
595 3300025933 Ga0207706_11474656 Ga0207706_114746562 106
596 3300025934 Ga0207686_10178089 Ga0207686_101780892 106
597 3300025934 Ga0207686_10772546 Ga0207686_107725461 106
598 3300025934 Ga0207686_10903130 Ga0207686_109031301 106
599 3300025934 Ga0207686_10952778 Ga0207686_109527782 106
600 3300025934 Ga0207686_11026956 Ga0207686_110269562 106
601 3300025935 Ga0207709_10444225 Ga0207709_104442252 106
602 3300025935 Ga0207709_11464397 Ga0207709_114643972 106
603 3300025936 Ga0207670_10978563 Ga0207670_109785632 106
604 3300025937 Ga0207669_10191473 Ga0207669_101914733 106
605 3300025938 Ga0207704_10048774 Ga0207704_100487742 106
606 3300025939 Ga0207665_10117047 Ga0207665_101170472 106
607 3300025939 Ga0207665_10620381 Ga0207665_106203812 106
608 3300025941 Ga0207711_10489186 Ga0207711_104891863 106
609 3300025944 Ga0207661_10224017 Ga0207661_102240172 106
610 3300025945 Ga0207679_10007996 Ga0207679_100079969 106
611 3300025949 Ga0207667_10179367 Ga0207667_101793672 106
612 3300025949 Ga0207667_11876508 Ga0207667_118765081 106
613 3300025960 Ga0207651_10574167 Ga0207651_105741672 106
614 3300025961 Ga0207712_11076618 Ga0207712_110766181 106
615 3300026023 Ga0207677_10273426 Ga0207677_102734261 106
616 3300026067 Ga0207678_10022172 Ga0207678_100221728 106
617 3300026067 Ga0207678_11331757 Ga0207678_113317571 106
618 3300026075 Ga0207708_10001166 Ga0207708_1000116614 106
619 3300026075 Ga0207708_10231739 Ga0207708_102317392 106
620 3300026075 Ga0207708_11853678 Ga0207708_118536782 106
621 3300026078 Ga0207702_10028071 Ga0207702_100280716 106
622 3300026078 Ga0207702_11051495 Ga0207702_110514952 106
623 3300026089 Ga0207648_10782486 Ga0207648_107824862 106
624 3300026095 Ga0207676_10185975 Ga0207676_101859751 106
625 3300026116 Ga0207674_10450721 Ga0207674_104507214 106
626 3300026118 Ga0207675_100042914 Ga0207675_1000429146 106
627 3300026118 Ga0207675_101079035 Ga0207675_1010790351 106
628 3300026121 Ga0207683_10191462 Ga0207683_101914624 106
629 3300026121 Ga0207683_12186531 Ga0207683_121865311 106
630 3300027907 Ga0207428_10355292 Ga0207428_103552922 106
631 3300027907 Ga0207428_10461925 Ga0207428_104619252 106
632 3300028380 Ga0268265_10849332 Ga0268265_108493322 106
633 3300028381 Ga0268264_11361116 Ga0268264_113611161 106
634 3300028800 Ga0265338_10236046 Ga0265338_102360463 106
635 3300028800 Ga0265338_10509359 Ga0265338_105093592 106
636 3300032002 Ga0307416_100018682 Ga0307416_1000186824 106
637 3300032002 Ga0307416_102605848 Ga0307416_1026058482 106
638 3300032126 Ga0307415_102204028 Ga0307415_1022040281 106
639 3300035090 Ga0373949_0130256 Ga0373949_0130256_117_437 106
640 3300035117 Ga0373953_0233728 Ga0373953_0233728_425_772 106
641 3300035170 Ga0373943_0014323 Ga0373943_0014323_762_1103 106
642 3300035170 Ga0373943_0118265 Ga0373943_0118265_559_879 106
643 3300035172 Ga0373955_0128205 Ga0373955_0128205_752_1099 106
644 3300035691 Ga0373931_0339276 Ga0373931_0339276_498_818 106
645 3300035691 Ga0373931_1087291 Ga0373931_1087291_81_401 106
646 3300035692 Ga0373935_0128438 Ga0373935_0128438_13_360 106
647 3300035692 Ga0373935_0181807 Ga0373935_0181807_25_366 106
648 3300035695 Ga0373927_0072159 Ga0373927_0072159_704_1045 106
649 3300035725 Ga0373947_0012053 Ga0373947_0012053_1149_1490 106
650 3300036401 Ga0373937_0000976 Ga0373937_0000976_4093_4440 106
651 3300036401 Ga0373937_0196750 Ga0373937_0196750_160_480 106
652 3300037068 Ga0373925_0009072 Ga0373925_0009072_6003_6344 106
653 3300037312 Ga0395899_0002136 Ga0395899_0002136_1046_1366 106
654 3300037312 Ga0395899_0002201 Ga0395899_0002201_9899_10219 106
655 3300037312 Ga0395899_0019734 Ga0395899_0019734_4504_4824 106
656 3300037312 Ga0395899_0026936 Ga0395899_0026936_3596_3916 106
657 3300037312 Ga0395899_0052492 Ga0395899_0052492_1819_2139 106
658 3300037312 Ga0395899_0101106 Ga0395899_0101106_977_1297 106
659 3300037312 Ga0395899_0123714 Ga0395899_0123714_1311_1631 106
660 3300037312 Ga0395899_0220748 Ga0395899_0220748_198_521 106
661 3300037312 Ga0395899_0456164 Ga0395899_0456164_395_715 106
662 3300037312 Ga0395899_0556228 Ga0395899_0556228_301_621 106
663 3300037312 Ga0395899_0883041 Ga0395899_0883041_145_465 106
664 3300037312 Ga0395899_0950143 Ga0395899_0950143_10_330 106
665 3300037418 Ga0395900_0001291 Ga0395900_0001291_16722_17042 106
666 3300037418 Ga0395900_0001589 Ga0395900_0001589_7107_7427 106
667 3300037418 Ga0395900_0003136 Ga0395900_0003136_6872_7192 106
668 3300037418 Ga0395900_0004208 Ga0395900_0004208_2838_3158 106
669 3300037418 Ga0395900_0019234 Ga0395900_0019234_2315_2653 106
670 3300037418 Ga0395900_0032656 Ga0395900_0032656_775_1095 106
671 3300037418 Ga0395900_0033591 Ga0395900_0033591_4195_4518 106
672 3300037418 Ga0395900_0059917 Ga0395900_0059917_1976_2296 106
673 3300037418 Ga0395900_0158276 Ga0395900_0158276_828_1148 106
674 3300037418 Ga0395900_0220711 Ga0395900_0220711_292_612 106
675 3300037418 Ga0395900_0238306 Ga0395900_0238306_882_1202 106
676 3300037418 Ga0395900_0448053 Ga0395900_0448053_282_602 106
677 3300037418 Ga0395900_1044094 Ga0395900_1044094_296_616 106
678 3300037418 Ga0395900_1404172 Ga0395900_1404172_47_367 106
679 3300037418 Ga0395900_1899646 Ga0395900_1899646_155_475 106
680 3300037466 Ga0395898_0001958 Ga0395898_0001958_15628_15948 106
681 3300037466 Ga0395898_0001958 Ga0395898_0001958_8960_9280 106
682 3300037466 Ga0395898_0004997 Ga0395898_0004997_5684_6004 106
683 3300037466 Ga0395898_0006008 Ga0395898_0006008_4690_5010 106
684 3300037466 Ga0395898_0021621 Ga0395898_0021621_1598_1918 106
685 3300037466 Ga0395898_0024332 Ga0395898_0024332_1006_1326 106
686 3300037466 Ga0395898_0037004 Ga0395898_0037004_3357_3680 106
687 3300037466 Ga0395898_0050486 Ga0395898_0050486_433_753 106
688 3300037466 Ga0395898_0058954 Ga0395898_0058954_440_760 106
689 3300037466 Ga0395898_0076990 Ga0395898_0076990_768_1088 106
690 3300037466 Ga0395898_0086397 Ga0395898_0086397_1309_1629 106
691 3300037466 Ga0395898_0097794 Ga0395898_0097794_2008_2328 106
692 3300037466 Ga0395898_0115575 Ga0395898_0115575_1457_1777 106
693 3300037466 Ga0395898_0158397 Ga0395898_0158397_1388_1726 106
694 3300037466 Ga0395898_0159525 Ga0395898_0159525_1593_1913 106
695 3300037466 Ga0395898_0312764 Ga0395898_0312764_191_511 106
696 3300037466 Ga0395898_0416511 Ga0395898_0416511_67_405 106
697 3300037466 Ga0395898_1332445 Ga0395898_1332445_44_364 106
698 3300037471 Ga0395905_0003055 Ga0395905_0003055_8455_8775 106
699 3300037471 Ga0395905_0003667 Ga0395905_0003667_5624_5944 106
700 3300037471 Ga0395905_0004895 Ga0395905_0004895_10105_10425 106
701 3300037471 Ga0395905_0010536 Ga0395905_0010536_1917_2240 106
702 3300037471 Ga0395905_0010934 Ga0395905_0010934_943_1263 106
703 3300037471 Ga0395905_0025905 Ga0395905_0025905_3765_4085 106
704 3300037471 Ga0395905_0027603 Ga0395905_0027603_1644_1964 106
705 3300037471 Ga0395905_0063518 Ga0395905_0063518_2341_2661 106
706 3300037471 Ga0395905_0066386 Ga0395905_0066386_369_689 106
707 3300037471 Ga0395905_0284173 Ga0395905_0284173_444_764 106
708 3300037471 Ga0395905_0620099 Ga0395905_0620099_614_934 106
709 3300037471 Ga0395905_1018127 Ga0395905_1018127_102_422 106
710 3300037471 Ga0395905_1357009 Ga0395905_1357009_102_422 106
711 3300037471 Ga0395905_1407633 Ga0395905_1407633_12_332 106
712 3300038443 Ga0395901_0000365 Ga0395901_0000365_34339_34659 106
713 3300038443 Ga0395901_0000733 Ga0395901_0000733_13228_13548 106
714 3300038443 Ga0395901_0002616 Ga0395901_0002616_7061_7381 106
715 3300038443 Ga0395901_0006872 Ga0395901_0006872_5972_6292 106
716 3300038443 Ga0395901_0008831 Ga0395901_0008831_8245_8565 106
717 3300038443 Ga0395901_0042881 Ga0395901_0042881_1741_2064 106
718 3300038443 Ga0395901_0058533 Ga0395901_0058533_145_465 106
719 3300038443 Ga0395901_0058930 Ga0395901_0058930_2462_2782 106
720 3300038443 Ga0395901_0065057 Ga0395901_0065057_1188_1508 106
721 3300038443 Ga0395901_0079355 Ga0395901_0079355_120_440 106
722 3300038443 Ga0395901_0096099 Ga0395901_0096099_755_1075 106
723 3300038443 Ga0395901_0129195 Ga0395901_0129195_1798_2118 106
724 3300038443 Ga0395901_0187425 Ga0395901_0187425_1836_2156 106
725 3300038443 Ga0395901_0385807 Ga0395901_0385807_689_1009 106
726 3300038443 Ga0395901_0507213 Ga0395901_0507213_245_565 106
727 3300038443 Ga0395901_0673091 Ga0395901_0673091_310_630 106
728 3300038443 Ga0395901_1151156 Ga0395901_1151156_66_386 106
729 3300038996 Ga0242420_109294 Ga0242420_109294_216_536 106
730 3300039453 Ga0436362_0464294 Ga0436362_0464294_1133_1453 106
731 3300041441 Ga0451787_344860 Ga0451787_344860_75_395 106
732 3300041443 Ga0451789_0290400 Ga0451789_0290400_322_642 106
733 3300041452 Ga0451793_0231132 Ga0451793_0231132_124_444 106
734 3300041460 Ga0451802_1319019 Ga0451802_1319019_110_430 106
735 3300041498 Ga0451841_0813533 Ga0451841_0813533_51_371 106
736 3300041512 Ga0451853_0299360 Ga0451853_0299360_178_498 106
737 3300041512 Ga0451853_2286262 Ga0451853_2286262_174_494 106
738 3300042461 Ga0439460_0366864 Ga0439460_0366864_44_364 106
739 3300044706 Ga0466964_0471831 Ga0466964_0471831_290_610 106
740 3300044735 Ga0466968_0322805 Ga0466968_0322805_389_709 106
741 3300044901 Ga0466960_0181431 Ga0466960_0181431_113_433 106
742 3300046454 Ga0495592_0628131 Ga0495592_0628131_215_535 106
743 3300046455 Ga0495603_0006924 Ga0495603_0006924_2576_2896 106
744 3300046455 Ga0495603_0044418 Ga0495603_0044418_1638_1979 106
745 3300046459 Ga0495629_0076795 Ga0495629_0076795_382_702 106
746 3300046473 Ga0495582_0010101 Ga0495582_0010101_4728_5048 106
747 3300046473 Ga0495582_0320164 Ga0495582_0320164_305_625 106
748 3300046473 Ga0495582_0905186 Ga0495582_0905186_74_394 106
749 3300046474 Ga0495605_0205845 Ga0495605_0205845_248_568 106
750 3300046474 Ga0495605_0351393 Ga0495605_0351393_158_478 106
751 3300046477 Ga0495664_0455603 Ga0495664_0455603_297_617 106
752 3300046491 Ga0495584_0010520 Ga0495584_0010520_368_688 106
753 3300046491 Ga0495584_0079643 Ga0495584_0079643_999_1319 106
754 3300046491 Ga0495584_0158833 Ga0495584_0158833_727_1047 106
755 3300046491 Ga0495584_0360143 Ga0495584_0360143_388_708 106
756 3300046492 Ga0495585_0175909 Ga0495585_0175909_23_343 106
757 3300046492 Ga0495585_0227308 Ga0495585_0227308_225_545 106
758 3300046492 Ga0495585_0230594 Ga0495585_0230594_362_682 106
759 3300046500 Ga0495596_0088582 Ga0495596_0088582_487_807 106
760 3300046501 Ga0495607_0137220 Ga0495607_0137220_199_519 106
761 3300046513 Ga0495616_0280941 Ga0495616_0280941_181_501 106
762 3300046515 Ga0495620_0187768 Ga0495620_0187768_21_341 106
763 3300046516 Ga0495628_0535041 Ga0495628_0535041_387_707 106
764 3300046516 Ga0495628_1260081 Ga0495628_1260081_132_452 106
765 3300046517 Ga0495630_0064570 Ga0495630_0064570_2060_2380 106
766 3300046518 Ga0495631_0492997 Ga0495631_0492997_127_447 106
767 3300046523 Ga0495644_0135293 Ga0495644_0135293_403_723 106
768 3300046523 Ga0495644_0176109 Ga0495644_0176109_465_785 106
769 3300046525 Ga0495663_0011178 Ga0495663_0011178_539_859 106
770 3300046528 Ga0495642_0140690 Ga0495642_0140690_132_452 106
771 3300046528 Ga0495642_0176899 Ga0495642_0176899_57_377 106
772 3300046531 Ga0495665_0307697 Ga0495665_0307697_57_377 106
773 3300046533 Ga0495640_0858987 Ga0495640_0858987_62_382 106
774 3300046535 Ga0495586_0619210 Ga0495586_0619210_83_403 106
775 3300046537 Ga0495598_0244365 Ga0495598_0244365_59_379 106
776 3300046538 Ga0495609_0215286 Ga0495609_0215286_35_355 106
777 3300046538 Ga0495609_0275249 Ga0495609_0275249_248_568 106
778 3300046538 Ga0495609_0358146 Ga0495609_0358146_207_527 106
779 3300046539 Ga0495621_0178945 Ga0495621_0178945_200_520 106
780 3300046615 Ga0495656_0112466 Ga0495656_0112466_12_332 106
781 3300046615 Ga0495656_0135648 Ga0495656_0135648_387_707 106
782 3300046615 Ga0495656_0725864 Ga0495656_0725864_144_464 106
783 3300046616 Ga0495668_0117623 Ga0495668_0117623_380_700 106
784 3300046616 Ga0495668_0615082 Ga0495668_0615082_259_579 106
785 3300046648 Ga0495611_0054373 Ga0495611_0054373_178_498 106
786 3300046664 Ga0495659_0134886 Ga0495659_0134886_618_938 106
787 3300046664 Ga0495659_0187982 Ga0495659_0187982_512_832 106
788 3300046665 Ga0495661_0230215 Ga0495661_0230215_606_926 106
789 3300046674 Ga0495588_0096038 Ga0495588_0096038_412_732 106
790 3300046674 Ga0495588_0640988 Ga0495588_0640988_49_369 106
791 3300046675 Ga0495657_0139204 Ga0495657_0139204_362_682 106
792 3300046679 Ga0495623_0045784 Ga0495623_0045784_1677_2024 106
793 3300046683 Ga0495658_0158978 Ga0495658_0158978_329_649 106
794 3300046683 Ga0495658_0268439 Ga0495658_0268439_599_940 106
795 3300046684 Ga0495669_0138377 Ga0495669_0138377_402_722 106
796 3300046689 Ga0495613_1103274 Ga0495613_1103274_47_367 106
797 3300046690 Ga0495624_0086679 Ga0495624_0086679_1510_1830 106
798 3300046690 Ga0495624_0735291 Ga0495624_0735291_170_490 106
799 3300046690 Ga0495624_0761507 Ga0495624_0761507_93_413 106
800 3300046691 Ga0495670_0127320 Ga0495670_0127320_783_1103 106
801 3300046692 Ga0495671_0583572 Ga0495671_0583572_149_469 106
802 3300046694 Ga0495649_0375489 Ga0495649_0375489_317_637 106
803 3300046794 Ga0495589_0110939 Ga0495589_0110939_493_813 106
804 3300046794 Ga0495589_0141693 Ga0495589_0141693_55_375 106
805 3300046794 Ga0495589_0470033 Ga0495589_0470033_29_349 106
806 3300046809 Ga0495600_0559744 Ga0495600_0559744_168_488 106
807 3300046810 Ga0495660_0193787 Ga0495660_0193787_578_898 106
808 3300047315 Ga0495581_0011147 Ga0495581_0011147_1064_1384 106
809 3300047315 Ga0495581_0351626 Ga0495581_0351626_244_564 106
810 3300047317 Ga0495604_0576136 Ga0495604_0576136_358_678 106
811 3300047319 Ga0495674_0564872 Ga0495674_0564872_48_368 106
812 3300047319 Ga0495674_0688361 Ga0495674_0688361_260_580 106
813 3300047319 Ga0495674_1478701 Ga0495674_1478701_122_442 106
814 3300047321 Ga0495676_0022756 Ga0495676_0022756_2890_3210 106
815 3300047322 Ga0495680_0703744 Ga0495680_0703744_123_443 106
816 3300047323 Ga0495683_0297768 Ga0495683_0297768_28_348 106
817 3300047445 Ga0495677_0051254 Ga0495677_0051254_330_650 106
818 3300047447 Ga0495685_149552 Ga0495685_149552_294_614 106
819 3300048088 Ga0495602_0014286 Ga0495602_0014286_4729_5076 106
820 3300048088 Ga0495602_1033497 Ga0495602_1033497_26_346 106
821 3300048090 Ga0495615_0288854 Ga0495615_0288854_77_397 106
822 3300048903 Ga0496100_0098791 Ga0496100_0098791_484_804 106
823 3300048903 Ga0496100_0145724 Ga0496100_0145724_742_1062 106
824 3300048903 Ga0496100_0421503 Ga0496100_0421503_22_342 106
825 3300048903 Ga0496100_0532293 Ga0496100_0532293_92_412 106
826 3300048903 Ga0496100_0861372 Ga0496100_0861372_139_459 106
827 3300048904 Ga0496101_0062776 Ga0496101_0062776_1326_1646 106
828 3300048904 Ga0496101_0235876 Ga0496101_0235876_852_1172 106
829 3300048904 Ga0496101_0502133 Ga0496101_0502133_175_495 106
830 3300048904 Ga0496101_0553002 Ga0496101_0553002_154_474 106
831 3300048904 Ga0496101_0599768 Ga0496101_0599768_208_528 106
832 3300048904 Ga0496101_1552032 Ga0496101_1552032_168_488 106
833 3300048905 Ga0496102_0060285 Ga0496102_0060285_1847_2167 106
834 3300048905 Ga0496102_0079208 Ga0496102_0079208_2261_2581 106
835 3300048905 Ga0496102_0403143 Ga0496102_0403143_690_1010 106
836 3300048905 Ga0496102_0622550 Ga0496102_0622550_547_867 106
837 3300048906 Ga0496103_0166424 Ga0496103_0166424_944_1264 106
838 3300048906 Ga0496103_0329040 Ga0496103_0329040_399_719 106
839 3300048906 Ga0496103_0340212 Ga0496103_0340212_239_559 106
840 3300048906 Ga0496103_0742264 Ga0496103_0742264_274_594 106
841 3300048907 Ga0496104_0019682 Ga0496104_0019682_5377_5697 106
842 3300048907 Ga0496104_0053765 Ga0496104_0053765_1107_1427 106
843 3300048907 Ga0496104_0095470 Ga0496104_0095470_1876_2196 106
844 3300048907 Ga0496104_0223839 Ga0496104_0223839_391_711 106
845 3300048907 Ga0496104_1475110 Ga0496104_1475110_200_520 106
846 3300048908 Ga0496105_0015245 Ga0496105_0015245_4685_5005 106
847 3300048908 Ga0496105_0059466 Ga0496105_0059466_460_780 106
848 3300048908 Ga0496105_0109557 Ga0496105_0109557_1253_1573 106
849 3300048908 Ga0496105_0171800 Ga0496105_0171800_984_1304 106
850 3300048908 Ga0496105_0288678 Ga0496105_0288678_866_1186 106
851 3300048908 Ga0496105_0309367 Ga0496105_0309367_255_581 106
852 3300048908 Ga0496105_0332615 Ga0496105_0332615_294_614 106
853 3300048908 Ga0496105_0729513 Ga0496105_0729513_361_681 106
854 3300048909 Ga0496106_0060225 Ga0496106_0060225_683_1003 106
855 3300048909 Ga0496106_0243252 Ga0496106_0243252_954_1274 106
856 3300048909 Ga0496106_0387423 Ga0496106_0387423_781_1101 106
857 3300048910 Ga0496107_0230240 Ga0496107_0230240_549_869 106
858 3300048910 Ga0496107_0237460 Ga0496107_0237460_407_727 106
859 3300048910 Ga0496107_0352326 Ga0496107_0352326_218_538 106
860 3300048910 Ga0496107_0381662 Ga0496107_0381662_622_942 106
861 3300048910 Ga0496107_0534137 Ga0496107_0534137_455_775 106
862 3300048910 Ga0496107_0751248 Ga0496107_0751248_241_561 106
863 3300048911 Ga0496108_0018657 Ga0496108_0018657_413_733 106
864 3300048911 Ga0496108_0494554 Ga0496108_0494554_645_965 106
865 3300048911 Ga0496108_0697428 Ga0496108_0697428_338_658 106
866 3300048912 Ga0496109_0006589 Ga0496109_0006589_59_379 106
867 3300048912 Ga0496109_0019302 Ga0496109_0019302_3858_4178 106
868 3300048912 Ga0496109_0102063 Ga0496109_0102063_284_604 106
869 3300048912 Ga0496109_0211663 Ga0496109_0211663_1028_1348 106
870 3300048912 Ga0496109_0368273 Ga0496109_0368273_584_904 106
871 3300048912 Ga0496109_0442270 Ga0496109_0442270_580_900 106
872 3300048912 Ga0496109_0549210 Ga0496109_0549210_217_537 106
873 3300048912 Ga0496109_0951663 Ga0496109_0951663_454_774 106
874 3300048913 Ga0496110_0064072 Ga0496110_0064072_2224_2544 106
875 3300048913 Ga0496110_0076941 Ga0496110_0076941_1319_1639 106
876 3300048913 Ga0496110_0127898 Ga0496110_0127898_1475_1795 106
877 3300048913 Ga0496110_0140161 Ga0496110_0140161_1441_1761 106
878 3300048913 Ga0496110_0526254 Ga0496110_0526254_547_867 106
879 3300048913 Ga0496110_1001407 Ga0496110_1001407_284_604 106
880 3300048914 Ga0496111_0001245 Ga0496111_0001245_2468_2788 106
881 3300048914 Ga0496111_0019004 Ga0496111_0019004_3788_4108 106
882 3300048914 Ga0496111_0059104 Ga0496111_0059104_1320_1640 106
883 3300048914 Ga0496111_0140117 Ga0496111_0140117_691_1017 106
884 3300048914 Ga0496111_0174875 Ga0496111_0174875_921_1241 106
885 3300048914 Ga0496111_0531987 Ga0496111_0531987_506_826 106
886 3300048914 Ga0496111_0919263 Ga0496111_0919263_19_339 106
887 3300048915 Ga0496112_0004570 Ga0496112_0004570_3135_3455 106
888 3300048915 Ga0496112_0067916 Ga0496112_0067916_2593_2913 106
889 3300048915 Ga0496112_0103688 Ga0496112_0103688_619_939 106
890 3300048915 Ga0496112_0133753 Ga0496112_0133753_1262_1582 106
891 3300048915 Ga0496112_0203903 Ga0496112_0203903_293_613 106
892 3300048915 Ga0496112_0556332 Ga0496112_0556332_494_814 106
893 3300048915 Ga0496112_1229362 Ga0496112_1229362_186_506 106
894 3300048916 Ga0496113_0004202 Ga0496113_0004202_233_553 106
895 3300048916 Ga0496113_0010188 Ga0496113_0010188_3060_3380 106
896 3300048916 Ga0496113_0051293 Ga0496113_0051293_313_633 106
897 3300048916 Ga0496113_0054226 Ga0496113_0054226_540_866 106
898 3300048916 Ga0496113_0149116 Ga0496113_0149116_941_1261 106
899 3300048916 Ga0496113_0369802 Ga0496113_0369802_812_1132 106
900 3300048917 Ga0496114_0004595 Ga0496114_0004595_432_752 106
901 3300048917 Ga0496114_0085207 Ga0496114_0085207_1144_1464 106
902 3300048917 Ga0496114_0325633 Ga0496114_0325633_818_1138 106
903 3300048917 Ga0496114_0352959 Ga0496114_0352959_707_1027 106
904 3300048917 Ga0496114_0430931 Ga0496114_0430931_171_491 106
905 3300048917 Ga0496114_0635371 Ga0496114_0635371_511_831 106
906 3300048917 Ga0496114_0798700 Ga0496114_0798700_152_472 106
907 3300048918 Ga0496115_0000719 Ga0496115_0000719_13174_13494 106
908 3300048918 Ga0496115_0017246 Ga0496115_0017246_20_340 106
909 3300048918 Ga0496115_0397844 Ga0496115_0397844_539_859 106
910 3300048918 Ga0496115_0771008 Ga0496115_0771008_22_342 106
911 3300049568 Ga0501031_0098812 Ga0501031_0098812_605_925 106
912 3300049572 Ga0501036_0801312 Ga0501036_0801312_82_438 106
913 3300049576 Ga0501040_0336033 Ga0501040_0336033_281_601 106
914 3300049577 Ga0501041_0297965 Ga0501041_0297965_289_609 106
915 3300049580 Ga0501046_0119258 Ga0501046_0119258_178_498 106
916 3300049586 Ga0501070_1477973 Ga0501070_1477973_126_467 106
917 3300049587 Ga0501071_0228115 Ga0501071_0228115_698_1018 106
918 3300049587 Ga0501071_0229855 Ga0501071_0229855_118_459 106
919 3300049588 Ga0501072_0312901 Ga0501072_0312901_836_1156 106
920 3300049590 Ga0501074_0111653 Ga0501074_0111653_671_991 106
921 3300049590 Ga0501074_0811417 Ga0501074_0811417_249_590 106
922 3300049591 Ga0501075_0355166 Ga0501075_0355166_629_949 106
923 3300049591 Ga0501075_0708487 Ga0501075_0708487_144_464 106
924 3300049592 Ga0501076_0308750 Ga0501076_0308750_816_1157 106
925 3300049592 Ga0501076_0334975 Ga0501076_0334975_909_1229 106
926 3300049593 Ga0501077_0014651 Ga0501077_0014651_1787_2107 106
927 3300049741 Ga0501079_0523606 Ga0501079_0523606_279_599 106
928 3300049741 Ga0501079_0557632 Ga0501079_0557632_332_652 106
929 3300049742 Ga0501080_0834098 Ga0501080_0834098_202_543 106
930 3300049743 Ga0501081_0370331 Ga0501081_0370331_705_1025 106
931 3300049743 Ga0501081_0461031 Ga0501081_0461031_95_436 106
932 3300050494 nmdc:mga06z11_207454_c1 nmdc:mga06z11_207454_c1_523_843 106
933 3300050507 nmdc:mga05p37_126299_c1 nmdc:mga05p37_126299_c1_868_1188 106
934 3300050507 nmdc:mga05p37_152131_c1 nmdc:mga05p37_152131_c1_904_1224 106
935 3300050507 nmdc:mga05p37_1770313_c1 nmdc:mga05p37_1770313_c1_209_529 106
936 3300050507 nmdc:mga05p37_317867_c1 nmdc:mga05p37_317867_c1_212_532 106
937 3300050508 nmdc:mga09592_1445061_c1 nmdc:mga09592_1445061_c1_19_339 106
938 3300050509 nmdc:mga0qj67_353467_c1 nmdc:mga0qj67_353467_c1_113_433 106
939 3300050510 nmdc:mga06r32_270595_c1 nmdc:mga06r32_270595_c1_280_600 106
940 3300050510 nmdc:mga06r32_444607_c1 nmdc:mga06r32_444607_c1_535_855 106
941 3300050510 nmdc:mga06r32_486579_c1 nmdc:mga06r32_486579_c1_811_1131 106
942 3300050510 nmdc:mga06r32_626955_c1 nmdc:mga06r32_626955_c1_268_633 106
943 3300050511 nmdc:mga08y16_207947_c1 nmdc:mga08y16_207947_c1_332_652 106
944 3300050511 nmdc:mga08y16_33123_c1 nmdc:mga08y16_33123_c1_590_910 106
945 3300050511 nmdc:mga08y16_448142_c1 nmdc:mga08y16_448142_c1_464_784 106
946 3300050511 nmdc:mga08y16_601066_c1 nmdc:mga08y16_601066_c1_721_1041 106
947 3300050512 nmdc:mga0n895_112477_c1 nmdc:mga0n895_112477_c1_721_1041 106
948 3300050512 nmdc:mga0n895_138768_c1 nmdc:mga0n895_138768_c1_1635_1955 106
949 3300050512 nmdc:mga0n895_1631416_c1 nmdc:mga0n895_1631416_c1_93_413 106
950 3300050512 nmdc:mga0n895_2036586_c1 nmdc:mga0n895_2036586_c1_176_496 106
951 3300050512 nmdc:mga0n895_367332_c1 nmdc:mga0n895_367332_c1_1118_1438 106
952 3300050512 nmdc:mga0n895_67480_c1 nmdc:mga0n895_67480_c1_868_1188 106
953 3300050513 nmdc:mga0rr50_1148081_c1 nmdc:mga0rr50_1148081_c1_231_551 106
954 3300050513 nmdc:mga0rr50_1169198_c1 nmdc:mga0rr50_1169198_c1_91_411 106
955 3300050513 nmdc:mga0rr50_1638232_c1 nmdc:mga0rr50_1638232_c1_117_437 106
956 3300050513 nmdc:mga0rr50_2948_c1 nmdc:mga0rr50_2948_c1_8051_8371 106
957 3300050513 nmdc:mga0rr50_322216_c1 nmdc:mga0rr50_322216_c1_926_1246 106
958 3300050513 nmdc:mga0rr50_600007_c1 nmdc:mga0rr50_600007_c1_285_605 106
959 3300050513 nmdc:mga0rr50_626028_c1 nmdc:mga0rr50_626028_c1_448_768 106
960 3300050514 nmdc:mga08x19_2470_c1 nmdc:mga08x19_2470_c1_504_824 106
961 3300050514 nmdc:mga08x19_535449_c1 nmdc:mga08x19_535449_c1_407_727 106
962 3300050514 nmdc:mga08x19_8074_c1 nmdc:mga08x19_8074_c1_2385_2705 106
963 3300050515 nmdc:mga0a205_1203477_c1 nmdc:mga0a205_1203477_c1_233_553 106
964 3300050515 nmdc:mga0a205_16811_c1 nmdc:mga0a205_16811_c1_1648_1968 106
965 3300050515 nmdc:mga0a205_220469_c1 nmdc:mga0a205_220469_c1_1039_1359 106
966 3300050515 nmdc:mga0a205_249276_c1 nmdc:mga0a205_249276_c1_377_697 106
967 3300050515 nmdc:mga0a205_332113_c1 nmdc:mga0a205_332113_c1_977_1297 106
968 3300050515 nmdc:mga0a205_618737_c1 nmdc:mga0a205_618737_c1_343_663 106
969 3300053077 Ga0495601_0713872 Ga0495601_0713872_245_565 106
970 3300053078 Ga0495612_0152474 Ga0495612_0152474_633_980 106
971 3300053083 Ga0495655_0162561 Ga0495655_0162561_344_664 106
972 3300054114 Ga0501084_0128769 Ga0501084_0128769_472_813 106
973 3300060353 Ga0501082_0141668 Ga0501082_0141668_902_1222 106
974 3300060353 Ga0501082_0388469 Ga0501082_0388469_436_777 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

14

60

0.99

PF12840

HTH_20

Helix-turn-helix domain

12

61

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9529 2 83
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9365 2 84
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9274 23 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9047 5 75
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9031 13 67
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9447 13 65 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9363 2 77 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9361 15 65 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.93 6 66 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9259 7 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S5JG36-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9727 2 81 GO:0003677
GO:0003700
AF-A0A848UBD8-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9683 2 100 GO:0003700
AF-A0A2T6KF80-F1-model_v4 ArsR family transcriptional regulator 0.966 1 80 GO:0003677
GO:0003700
AF-A0A4Q3GMU9-F1-model_v4 deleted 0.9652 2 81
AF-A0A1H2KN53-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9639 1 94 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
90.18 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map