F487147

General Info

Members Datasets Scaffolds Average Seq Length
972 780 488 294

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10057721|Ga0075433_100577216
Length 288
Sequence MATTIEGTVPFRGYRTWYQVVGGLPATGGQLPLLVVHGGPGLPHDYLEDLAGLADGERAVVFYDQLGCGKSDHPDDPALWVMDTFAGELATVREVLGLDRIHLLGHSWGGWLALEYALGRPTGLASLVLASTCASLPAFAAQTRRLKESLPPEVQQVIDWHESAGTTGDPTYVQAAMAYRTRWVCRLDPFPVHLVRSICNLSQDVYQTMQGPEWNVTGNLRLDLPVLVTSGRHDEMTPALVRPLVDGIRGAEWVVFEESAHMAMVEEPDRYRQVLQSWLSRVVEAAPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
26 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
27 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
30 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
33 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
34 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
35 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
39 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
42 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
43 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
44 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
45 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
46 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
47 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
51 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
52 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
53 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
54 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
55 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
56 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
57 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
58 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
59 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
60 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
61 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
62 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
63 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
64 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
65 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
66 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
67 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
68 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
69 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
70 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
71 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
72 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
73 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
74 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
75 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
76 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
77 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
78 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
79 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
80 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
81 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
82 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
83 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
84 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
85 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
86 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
87 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
88 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
89 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
90 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
91 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
92 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
93 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
94 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
95 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
96 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
97 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
98 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
99 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
100 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
101 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
102 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
103 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
104 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
105 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
106 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
107 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
108 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
109 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
110 2643221568 Rhizobium sp. Root564 Isolate Unclassified
111 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
112 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
113 2643221688 Rhizobium sp. Root482 Isolate Unclassified
114 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
115 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
118 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
119 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
120 2718217927 Rhizobium sp. N324 Isolate Nodule
121 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
122 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
123 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
124 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
125 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
126 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
127 2718218423 Rhizobium sp. N941 Isolate Nodule
128 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
129 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
130 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
131 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
132 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
133 2721755809 Rhizobium sp. N541 Isolate Nodule
134 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
135 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
136 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
137 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
138 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
139 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
140 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
141 2738541293 Rhizobium sp. GV031 Isolate Unclassified
142 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
143 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
144 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
147 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
148 2751185800 Brucella pituitosa AA2 Isolate Unclassified
149 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
150 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
151 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
152 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
153 2791355256 Rhizobium sp. M10 Isolate Nodule
154 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
155 2791355260 Rhizobium sp. L9 Isolate Nodule
156 2791355261 Rhizobium sp. J15 Isolate Nodule
157 2791355262 Rhizobium sp. M1 Isolate Nodule
158 2791355263 Rhizobium chutanense C5 Isolate Nodule
159 2791355265 Rhizobium sp. H4 Isolate Nodule
160 2791355266 Rhizobium sp. L43 Isolate Nodule
161 2791355267 Rhizobium sp. L18 Isolate Nodule
162 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
163 2802429633 Rhizobium anhuiense J3 Isolate Nodule
164 2802429634 Rhizobium anhuiense S10 Isolate Nodule
165 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
166 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
167 2802429637 Rhizobium anhuiense C15 Isolate Nodule
168 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
169 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
170 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
171 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
172 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
173 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
174 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
175 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
176 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
177 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
178 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
179 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
180 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
181 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
182 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
183 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
184 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
185 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
186 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
187 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
188 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
189 2838048938 Rhizobium pisi 27/80 Isolate Nodule
190 2838061910 Rhizobium phaseoli L15 Isolate Nodule
191 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
192 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
193 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
194 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
195 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
196 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
197 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
198 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
199 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
200 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
201 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
202 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
203 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
204 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
205 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
206 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
207 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
208 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
209 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
210 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
211 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
212 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
213 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
214 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
215 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
216 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
217 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
218 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
219 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
220 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
221 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
222 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
223 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
224 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
225 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
226 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
227 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
228 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
229 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
230 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
231 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
232 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
233 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
234 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
235 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
236 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
237 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
238 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
239 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
240 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
241 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
242 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
243 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
244 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
245 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
246 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
247 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
248 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
249 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
250 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
251 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
252 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
253 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
254 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
255 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
256 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
257 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
258 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
259 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
260 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
261 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
262 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
263 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
264 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
265 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
266 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
267 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
268 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
269 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
270 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
271 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
272 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
273 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
274 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
275 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
276 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
277 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
278 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
279 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
280 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
281 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
282 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
283 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
284 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
285 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
286 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
287 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
288 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
289 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
290 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
291 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
292 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
293 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
294 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
295 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
296 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
297 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
298 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
299 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
300 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
301 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
302 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
303 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
304 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
305 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
306 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
307 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
308 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
309 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
310 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
311 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
312 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
313 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
314 2933599457 Rhizobium phaseoli M3 Isolate Nodule
315 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
316 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
317 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
318 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
319 2936381700 Rhizobium chutanense C16 Isolate Unclassified
320 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
321 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
322 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
323 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
324 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
325 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
326 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
327 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
328 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
329 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
330 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
331 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
332 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
333 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
334 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
335 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
336 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
337 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
338 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
339 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
340 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
341 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
342 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
343 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
344 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
345 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
346 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
347 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
348 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
349 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
350 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
351 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
352 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
353 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
354 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
355 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
356 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
357 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
358 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
359 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
360 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
361 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
362 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
363 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
364 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
365 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
366 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
367 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
368 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
369 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
370 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
371 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
372 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
373 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
374 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
375 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
376 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
377 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
378 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
379 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
380 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
381 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
382 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
383 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
384 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
385 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
386 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
387 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
388 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
389 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
390 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
391 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
392 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
393 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
394 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
395 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
396 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
397 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
398 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
399 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
400 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
401 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
402 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
403 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
404 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
405 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
406 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
407 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
408 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
409 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
410 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
411 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
412 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
413 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
414 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
415 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
416 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
417 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
418 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
419 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
420 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
421 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
422 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
423 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
424 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
425 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
426 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
427 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
428 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
429 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
430 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
431 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
432 2996893221 Rhizobium sp. R635 Isolate Nodule
433 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
434 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
435 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
436 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
437 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
438 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
439 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
440 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
441 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
442 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
443 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
444 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
445 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
446 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
447 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
448 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
449 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
450 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
451 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
452 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
453 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
454 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
455 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
456 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
457 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
458 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
459 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
460 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
461 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
462 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
463 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
464 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
465 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
466 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
467 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
468 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
469 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
470 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
471 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
472 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
473 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
474 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
475 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
476 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
477 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
478 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
479 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
480 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
481 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
482 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
483 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
484 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
485 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
486 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
487 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
488 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
489 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
490 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
491 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
492 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
493 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
494 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
495 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
496 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
497 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
498 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
499 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
500 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
501 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
502 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
503 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
504 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
505 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
506 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
507 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
508 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
509 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
510 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
511 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
512 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
513 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
514 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
515 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
516 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
517 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
518 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
519 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
520 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
521 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
522 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
523 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
524 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
525 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
526 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
527 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
528 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
529 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
530 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
531 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
532 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
533 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
535 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
536 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
537 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
539 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
540 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
541 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
542 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
543 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
544 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
545 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
546 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
570 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
571 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
572 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
573 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
574 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
575 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
576 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
577 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
578 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
579 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
580 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
581 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
582 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
583 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
584 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
585 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
586 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
587 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
588 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
589 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
590 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
591 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
592 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
593 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
594 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
595 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
596 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
597 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
598 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
599 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
600 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
601 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
602 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
603 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
604 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
605 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
606 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
607 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
608 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
609 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
610 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
611 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
612 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
613 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
614 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
615 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
616 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
617 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
618 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
619 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
620 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
621 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
622 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
623 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
624 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
625 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
626 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
627 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
628 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
629 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
630 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
631 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
632 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
633 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
634 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
635 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
636 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
637 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
638 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
639 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
640 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
641 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
642 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
643 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
644 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
645 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
646 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
647 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
648 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
649 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
650 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
651 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
652 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
653 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
654 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
655 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
656 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
657 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
658 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
659 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
660 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
661 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
662 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
663 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
664 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
665 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
666 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
667 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
668 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
669 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
670 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
671 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
672 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
673 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
674 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
675 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
676 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
677 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
678 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
679 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
680 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
681 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
682 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
683 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
684 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
685 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
686 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
687 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
690 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
691 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
692 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
693 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
694 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
695 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
696 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
697 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
698 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
699 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
700 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
701 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
702 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
703 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
704 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
705 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
706 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
707 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
708 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
709 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
710 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
711 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
712 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
713 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
714 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
715 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
716 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
717 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
718 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
719 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
720 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
721 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
722 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
723 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
724 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
725 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
726 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
727 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
728 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
729 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
730 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
731 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
732 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
733 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
734 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
735 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
736 8005275841 Rhizobium sp. N4311 Isolate Nodule
737 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
738 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
739 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
740 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
741 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
742 8005395548 Rhizobium sp. R339 Isolate Nodule
743 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
744 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
745 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
746 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
747 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
748 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
749 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
750 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
751 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
752 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
753 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
754 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
755 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
756 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
757 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
758 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
759 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
760 8018176218 Rhizobium sp. N122 Isolate Nodule
761 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
762 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
763 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
764 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
765 8024501048 Rhizobium sp. H4 Isolate Nodule
766 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
767 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
768 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
769 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
770 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
771 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
772 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
773 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
774 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
775 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
776 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
777 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
778 8056382006 Rhizobium croatiense 13T Isolate Nodule
779 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.21
Metatranscriptomes 0
Isolates 49.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 34.05
Rhizoplane 4.32
Rhizosphere 35.08
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3754702 2162886007 Bacteria 11743
2 MRS1b_contig_6409452 2162886011 Bacteria 1143
3 JGI25162J39368_1000144 3300002737 Bacteria 77232
4 JGI25152J39213_1000087 3300002773 Bacteria 64368
5 JGI25150J39212_1000017 3300002774 Bacteria 150316
6 JGI25150J39212_1000093 3300002774 Bacteria 51048
7 JGI25159J45721_1001687 3300002987 Bacteria 8945
8 JGI25159J45721_1017590 3300002987 Bacteria 1471
9 JGI25151J46595_10000007 3300003187 Bacteria 411751
10 JGI25151J46595_10000525 3300003187 Bacteria 35775
11 JGI25151J46595_10001176 3300003187 Bacteria 18833
12 JGI25151J46595_10003084 3300003187 Bacteria 9396
13 JGI25165J46597_1000075 3300003214 Bacteria 181212
14 JGI25153J46596_10000604 3300003215 Bacteria 21962
15 JGI25153J46596_10001294 3300003215 Bacteria 14977
16 JGI25153J46596_10006139 3300003215 Bacteria 6159
17 JGI25153J46596_10008110 3300003215 Bacteria 5064
18 rootH2_10003773 3300003320 Bacteria 14955
19 rootL2_10003291 3300003322 Bacteria 28178
20 rootH1_10031216 3300003323 Bacteria 8906
21 rootH1_10066597 3300003323 Bacteria 5366
22 JGI25160J50197_1005886 3300003354 Bacteria 5041
23 JGI25160J50197_1017236 3300003354 Bacteria 2296
24 JGI25161J50226_1000450 3300003374 Bacteria 19075
25 JGI25161J50226_1000813 3300003374 Bacteria 11738
26 Ga0055539_1000151 3300003752 Bacteria 68013
27 Ga0055533_1000154 3300003756 Bacteria 68013
28 Ga0055532_1000165 3300003758 Bacteria 57621
29 Ga0055525_1000204 3300003759 Bacteria 68013
30 Ga0055535_1008953 3300003761 Bacteria 1760
31 Ga0055526_1004776 3300003771 Bacteria 8026
32 Ga0055526_1004873 3300003771 Bacteria 7910
33 Ga0055524_1002154 3300003775 Bacteria 10359
34 Ga0055524_1005381 3300003775 Bacteria 5723
35 Ga0055524_1012830 3300003775 Bacteria 3195
36 Ga0055528_1000501 3300003790 Bacteria 30837
37 Ga0055528_1001700 3300003790 Bacteria 12825
38 Ga0055528_1005030 3300003790 Bacteria 6244
39 Ga0055530_10000229 3300003791 Bacteria 50063
40 Ga0055540_1000240 3300003792 Bacteria 50063
41 Ga0055540_1000487 3300003792 Bacteria 30399
42 Ga0055540_1015377 3300003792 Bacteria 2231
43 Ga0055531_10036425 3300003794 Bacteria 1518
44 Ga0055541_1000101 3300003841 Bacteria 68013
45 Ga0055543_1000045 3300004625 Bacteria 115098
46 Ga0055543_1000739 3300004625 Bacteria 16547
47 Ga0065165_1002947 3300005262 Bacteria 12963
48 Ga0065165_1005055 3300005262 Bacteria 7684
49 Ga0065714_10003857 3300005288 Bacteria 9063
50 Ga0065704_10000520 3300005289 Bacteria 26272
51 Ga0065704_10004936 3300005289 Bacteria 3721
52 Ga0065704_10015702 3300005289 Bacteria 2102
53 Ga0065712_10001701 3300005290 Bacteria 5943
54 Ga0070670_100000162 3300005331 Bacteria 60681
55 Ga0070670_100004443 3300005331 Bacteria 11745
56 Ga0070670_100008174 3300005331 Bacteria 8910
57 Ga0070682_100389043 3300005337 Bacteria 1051
58 Ga0070661_100000132 3300005344 Bacteria 62286
59 Ga0070668_100210793 3300005347 Bacteria 1598
60 Ga0070669_100019731 3300005353 Bacteria 4816
61 Ga0070669_100229201 3300005353 Bacteria 1472
62 Ga0070674_100201654 3300005356 Bacteria 1537
63 Ga0070662_100001797 3300005457 Bacteria 13177
64 Ga0070706_100031215 3300005467 Bacteria 4914
65 Ga0070707_100186096 3300005468 Bacteria 2025
66 Ga0068853_100071926 3300005539 Bacteria 3013
67 Ga0068853_100109016 3300005539 Bacteria 2457
68 Ga0070696_100036258 3300005546 Bacteria 3400
69 Ga0070696_100053595 3300005546 Bacteria 2808
70 Ga0070696_100137841 3300005546 Bacteria 1780
71 Ga0070665_100095006 3300005548 Bacteria 2986
72 Ga0070664_100009020 3300005564 Bacteria 8091
73 Ga0070664_100335867 3300005564 Bacteria 1372
74 Ga0068854_100009040 3300005578 Bacteria 6420
75 Ga0068854_100066566 3300005578 Bacteria 2622
76 Ga0068856_100134285 3300005614 Bacteria 2480
77 Ga0068861_100083876 3300005719 Bacteria 2500
78 Ga0068851_10000084 3300005834 Bacteria 52007
79 Ga0081455_10279752 3300005937 Bacteria 1206
80 Ga0081538_10005439 3300005981 Bacteria 11437
81 Ga0075365_10001089 3300006038 Bacteria 11800
82 Ga0075365_10045794 3300006038 Bacteria 2871
83 Ga0075365_10295899 3300006038 Bacteria 1139
84 Ga0075363_100005396 3300006048 Bacteria 5682
85 Ga0075364_10020258 3300006051 Bacteria 4183
86 Ga0075367_10024535 3300006178 Bacteria 3402
87 Ga0075369_10003675 3300006186 Bacteria 5604
88 Ga0075369_10091069 3300006186 Bacteria 1361
89 Ga0075366_10000314 3300006195 Bacteria 21983
90 Ga0075366_10265207 3300006195 Bacteria 1049
91 Ga0075370_10015973 3300006353 Bacteria 4031
92 Ga0075431_100020334 3300006847 Bacteria 6782
93 Ga0075433_10057721 3300006852 Bacteria 3393
94 Ga0075434_100006245 3300006871 Bacteria 10916
95 Ga0075434_100346899 3300006871 Bacteria 1506
96 Ga0075436_100208470 3300006914 Bacteria 1385
97 Ga0075435_100122555 3300007076 Bacteria 2170
98 Ga0105251_10000973 3300009011 Bacteria 25439
99 Ga0105251_10004202 3300009011 Bacteria 9962
100 Ga0105251_10007395 3300009011 Bacteria 6773
101 Ga0105244_10002541 3300009036 Bacteria 13709
102 Ga0105244_10005299 3300009036 Bacteria 8586
103 Ga0105244_10039061 3300009036 Bacteria 2472
104 Ga0105250_10000565 3300009092 Bacteria 24705
105 Ga0105250_10033184 3300009092 Bacteria 2072
106 Ga0105240_10000097 3300009093 Bacteria 179135
107 Ga0111539_10000857 3300009094 Bacteria 39667
108 Ga0111539_10605933 3300009094 Bacteria 1275
109 Ga0114129_10037407 3300009147 Bacteria 6852
110 Ga0114129_10280815 3300009147 Bacteria 2225
111 Ga0114129_10886160 3300009147 Bacteria 1132
112 Ga0105243_10024955 3300009148 Bacteria 4564
113 Ga0105243_10113683 3300009148 Bacteria 2270
114 Ga0105242_10000440 3300009176 Bacteria 33103
115 Ga0105237_10005732 3300009545 Bacteria 13950
116 Ga0105237_10006053 3300009545 Bacteria 13528
117 Ga0105238_10015173 3300009551 Bacteria 7800
118 Ga0123341_1000003 3300009765 Bacteria 172237
119 Ga0123342_1008736 3300009766 Bacteria 12555
120 Ga0123342_1039304 3300009766 Bacteria 1804
121 Ga0105239_10006934 3300010375 Bacteria 13069
122 Ga0105246_10000194 3300011119 Bacteria 30373
123 Ga0105246_10003325 3300011119 Bacteria 9733
124 Ga0157373_10020543 3300013100 Bacteria 4799
125 Ga0157371_10000948 3300013102 Bacteria 32403
126 Ga0157370_10073945 3300013104 Bacteria 3215
127 Ga0157370_10142609 3300013104 Bacteria 2232
128 Ga0157369_10017826 3300013105 Bacteria 7970
129 Ga0157369_10091512 3300013105 Bacteria 3247
130 Ga0157375_10025179 3300013308 Bacteria 5522
131 Ga0157375_10385648 3300013308 Bacteria 1568
132 Ga0182008_10007784 3300014497 Bacteria 5893
133 Ga0182008_10125801 3300014497 Bacteria 1276
134 Ga0182006_1001262 3300015261 Bacteria 15629
135 Ga0182007_10001007 3300015262 Bacteria 15441
136 Ga0182007_10006537 3300015262 Bacteria 4998
137 Ga0182005_1013218 3300015265 Bacteria 2322
138 Ga0163161_10165629 3300017792 Bacteria 1687
139 Ga0163161_10244627 3300017792 Bacteria 1396
140 Ga0209436_100004 3300025208 Bacteria 196698
141 Ga0209784_100138 3300025224 Bacteria 68249
142 Ga0209566_100179 3300025225 Bacteria 68249
143 Ga0209674_100186 3300025226 Bacteria 68249
144 Ga0209147_100195 3300025229 Bacteria 68796
145 Ga0209563_100148 3300025230 Bacteria 68249
146 Ga0209437_100131 3300025233 Bacteria 181264
147 Ga0209258_100339 3300025242 Bacteria 69328
148 Ga0207425_1000018 3300025245 Bacteria 411841
149 Ga0207425_1001189 3300025245 Bacteria 11601
150 Ga0207425_1009736 3300025245 Bacteria 2376
151 Ga0209646_1000516 3300025246 Bacteria 17290
152 Ga0209677_100137 3300025253 Bacteria 68249
153 Ga0209677_102216 3300025253 Bacteria 7544
154 Ga0209759_1007623 3300025256 Bacteria 3462
155 Ga0209129_1000026 3300025258 Bacteria 411839
156 Ga0209129_1001031 3300025258 Bacteria 16562
157 Ga0209233_1000132 3300025261 Bacteria 203971
158 Ga0209233_1000162 3300025261 Bacteria 156508
159 Ga0209455_1010914 3300025272 Bacteria 2273
160 Ga0209673_1000182 3300025273 Bacteria 127522
161 Ga0209673_1002211 3300025273 Bacteria 14191
162 Ga0209673_1003064 3300025273 Bacteria 10290
163 Ga0209673_1007133 3300025273 Bacteria 5229
164 Ga0209130_1000001 3300025284 Bacteria 831557
165 Ga0209130_1000300 3300025284 Bacteria 60286
166 Ga0209130_1014902 3300025284 Bacteria 1935
167 Ga0209675_1013505 3300025291 Bacteria 2547
168 Ga0209676_1002489 3300025292 Bacteria 12923
169 Ga0209676_1044808 3300025292 Bacteria 1209
170 Ga0209025_1000035 3300025294 Bacteria 411841
171 Ga0209025_1000082 3300025294 Bacteria 265613
172 Ga0209025_1000084 3300025294 Bacteria 263812
173 Ga0209025_1003836 3300025294 Bacteria 13686
174 Ga0209025_1016317 3300025294 Bacteria 4397
175 Ga0209564_1001848 3300025295 Bacteria 19273
176 Ga0209758_1000040 3300025297 Bacteria 411841
177 Ga0209758_1000543 3300025297 Bacteria 59880
178 Ga0209758_1001081 3300025297 Bacteria 35442
179 Ga0209758_1001082 3300025297 Bacteria 35430
180 Ga0209758_1005768 3300025297 Bacteria 9295
181 Ga0209758_1006633 3300025297 Bacteria 8194
182 Ga0209758_1016173 3300025297 Bacteria 3804
183 Ga0209758_1048406 3300025297 Bacteria 1512
184 Ga0209050_1000287 3300025298 Bacteria 106507
185 Ga0209256_1001307 3300025299 Bacteria 26756
186 Ga0209256_1002707 3300025299 Bacteria 13821
187 Ga0209256_1009033 3300025299 Bacteria 4461
188 Ga0209256_1010314 3300025299 Bacteria 3935
189 Ga0207426_1000005 3300025302 Bacteria 1037188
190 Ga0207426_1000035 3300025302 Bacteria 448327
191 Ga0207426_1000311 3300025302 Bacteria 95578
192 Ga0209051_1000070 3300025303 Bacteria 215616
193 Ga0209051_1000199 3300025303 Bacteria 106517
194 Ga0209051_1001994 3300025303 Bacteria 15623
195 Ga0209051_1009545 3300025303 Bacteria 4991
196 Ga0209257_1003511 3300025304 Bacteria 13342
197 Ga0209257_1006081 3300025304 Bacteria 8020
198 Ga0209257_1023979 3300025304 Bacteria 2126
199 Ga0207656_10000034 3300025321 Bacteria 66750
200 Ga0207696_1000063 3300025711 Bacteria 239123
201 Ga0207655_1000006 3300025728 Bacteria 861092
202 Ga0207655_1001435 3300025728 Bacteria 22098
203 Ga0207655_1003383 3300025728 Bacteria 11914
204 Ga0207713_1000872 3300025735 Bacteria 27580
205 Ga0207713_1002294 3300025735 Bacteria 14082
206 Ga0207713_1019275 3300025735 Bacteria 3344
207 Ga0207707_10117418 3300025912 Bacteria 2326
208 Ga0207695_10000187 3300025913 Bacteria 179183
209 Ga0207671_10000079 3300025914 Bacteria 149692
210 Ga0207671_10000784 3300025914 Bacteria 40283
211 Ga0207649_10000002 3300025920 Bacteria 498633
212 Ga0207646_10179258 3300025922 Bacteria 1913
213 Ga0207681_10002018 3300025923 Bacteria 13042
214 Ga0207681_10006063 3300025923 Bacteria 7414
215 Ga0207681_10068387 3300025923 Bacteria 2467
216 Ga0207694_10191747 3300025924 Bacteria 1660
217 Ga0207650_10000154 3300025925 Bacteria 82912
218 Ga0207650_10000684 3300025925 Bacteria 26647
219 Ga0207650_10007516 3300025925 Bacteria 7432
220 Ga0207706_10001646 3300025933 Bacteria 22112
221 Ga0207686_10009678 3300025934 Bacteria 5236
222 Ga0207709_10067715 3300025935 Bacteria 2254
223 Ga0207709_10122294 3300025935 Bacteria 1759
224 Ga0207704_10176369 3300025938 Bacteria 1539
225 Ga0207679_10000006 3300025945 Bacteria 498868
226 Ga0207679_10202605 3300025945 Bacteria 1659
227 Ga0207640_10034496 3300025981 Bacteria 3158
228 Ga0207640_10043175 3300025981 Bacteria 2880
229 Ga0207640_10430796 3300025981 Bacteria 1082
230 Ga0207658_10115183 3300025986 Bacteria 2133
231 Ga0207639_10041124 3300026041 Bacteria 3456
232 Ga0207639_10088029 3300026041 Bacteria 2477
233 Ga0207639_10490792 3300026041 Bacteria 1121
234 Ga0207678_10214030 3300026067 Bacteria 1649
235 Ga0207702_10373845 3300026078 Bacteria 1369
236 Ga0207702_10410343 3300026078 Bacteria 1308
237 Ga0207675_100003793 3300026118 Bacteria 14722
238 Ga0209281_1000141 3300027111 Bacteria 175634
239 Ga0209371_1006037 3300027312 Bacteria 4617
240 Ga0207428_10000053 3300027907 Bacteria 175238
241 Ga0268265_10053530 3300028380 Bacteria 3058
242 Ga0307515_10000029 3300028794 Bacteria 365410
243 Ga0307515_10003876 3300028794 Bacteria 31241
244 Ga0307515_10011732 3300028794 Bacteria 16582
245 Ga0268256_1006018 3300030500 Bacteria 4617
246 Ga0316181_1107564 3300030744 Bacteria 5999
247 Ga0307513_10000259 3300031456 Bacteria 76155
248 Ga0307513_10098659 3300031456 Bacteria 2952
249 Ga0307513_10190115 3300031456 Bacteria 1905
250 Ga0307408_100020630 3300031548 Bacteria 4451
251 Ga0307516_10314623 3300031730 Bacteria 1238
252 Ga0307405_10000428 3300031731 Bacteria 15741
253 Ga0307413_10024282 3300031824 Bacteria 3302
254 Ga0307410_10166628 3300031852 Bacteria 1656
255 Ga0307407_10085576 3300031903 Bacteria 1918
256 Ga0307412_10001421 3300031911 Bacteria 13339
257 Ga0307409_100036664 3300031995 Bacteria 3607
258 Ga0307416_100105827 3300032002 Bacteria 2464
259 Ga0307416_100353257 3300032002 Bacteria 1489
260 Ga0307416_100493515 3300032002 Bacteria 1287
261 Ga0307411_10055812 3300032005 Bacteria 2600
262 Ga0307415_100010381 3300032126 Bacteria 5273
263 Ga0316584_0366820 3300036712 Bacteria 1031
264 Ga0395898_0067790 3300037466 Bacteria 3454
265 Ga0395905_0034039 3300037471 Bacteria 4784
266 Ga0395901_0005143 3300038443 Bacteria 13206
267 Ga0400483_140709 3300039062 Bacteria 14444
268 Ga0400483_274668 3300039062 Bacteria 6397
269 Ga0439436_0003510 3300041404 Bacteria 4767
270 Ga0439438_000804 3300041405 Bacteria 14024
271 Ga0439447_006388 3300041407 Bacteria 3833
272 Ga0439466_0001830 3300041411 Bacteria 8338
273 Ga0439465_0004127 3300041413 Bacteria 4727
274 Ga0439465_0009269 3300041413 Bacteria 3102
275 Ga0439465_0054017 3300041413 Bacteria 1321
276 Ga0451798_0208875 3300041458 Bacteria 1301
277 Ga0451833_1093313 3300041491 Bacteria 2988
278 Ga0451837_0109501 3300041494 Bacteria 3578
279 Ga0451839_1218978 3300041496 Bacteria 3446
280 Ga0451841_0040778 3300041498 Bacteria 1653
281 Ga0451845_0462619 3300041501 Bacteria 1076
282 Ga0451849_0485518 3300041505 Bacteria 1356
283 Ga0451851_0421752 3300041507 Bacteria 1541
284 Ga0451855_0219103 3300041511 Bacteria 1235
285 Ga0451853_0251760 3300041512 Bacteria 1948
286 Ga0439431_0005475 3300041997 Bacteria 2804
287 Ga0439432_001792 3300042006 Bacteria 8046
288 Ga0439432_001919 3300042006 Bacteria 7853
289 Ga0439451_000063 3300042009 Bacteria 19874
290 Ga0439452_010488 3300042010 Bacteria 2692
291 Ga0439456_000020 3300042013 Bacteria 60976
292 Ga0450911_000287 3300042115 Bacteria 18551
293 Ga0450919_000393 3300042121 Bacteria 5307
294 Ga0450920_024532 3300042122 Bacteria 1172
295 Ga0450903_000746 3300042138 Bacteria 6404
296 Ga0450906_001439 3300042145 Bacteria 5182
297 Ga0450907_016462 3300042146 Bacteria 1234
298 Ga0450909_000079 3300042185 Bacteria 8864
299 Ga0466963_0013723 3300044694 Bacteria 4983
300 Ga0466960_0001264 3300044901 Bacteria 9161
301 Ga0451576_0162146 3300045051 Bacteria 2334
302 Ga0451576_0169878 3300045051 Bacteria 2276
303 Ga0466958_0037647 3300045836 Bacteria 2899
304 Ga0466967_0319267 3300045976 Bacteria 1497
305 Ga0495617_000126 3300046452 Bacteria 50425
306 Ga0495592_0096392 3300046454 Bacteria 2114
307 Ga0495590_0000259 3300046457 Bacteria 28903
308 Ga0495638_0000120 3300046460 Bacteria 127382
309 Ga0495638_0004264 3300046460 Bacteria 10875
310 Ga0495638_0011436 3300046460 Bacteria 6115
311 Ga0495650_0001726 3300046471 Bacteria 20009
312 Ga0495580_0056217 3300046472 Bacteria 2772
313 Ga0495605_0002084 3300046474 Bacteria 12577
314 Ga0495605_0003178 3300046474 Bacteria 9873
315 Ga0495605_0016357 3300046474 Bacteria 4015
316 Ga0495662_0007062 3300046476 Bacteria 5577
317 Ga0495584_0000541 3300046491 Bacteria 25637
318 Ga0495585_0093002 3300046492 Bacteria 1622
319 Ga0495607_0000344 3300046501 Bacteria 48079
320 Ga0495607_0000634 3300046501 Bacteria 34119
321 Ga0495607_0002322 3300046501 Bacteria 15588
322 Ga0495607_0010393 3300046501 Bacteria 6259
323 Ga0495607_0054966 3300046501 Bacteria 2292
324 Ga0495583_0001840 3300046506 Bacteria 19799
325 Ga0495583_0018173 3300046506 Bacteria 3709
326 Ga0495583_0020427 3300046506 Bacteria 3432
327 Ga0495583_0044699 3300046506 Bacteria 2053
328 Ga0495606_0037706 3300046507 Bacteria 3279
329 Ga0495606_0133806 3300046507 Bacteria 1471
330 Ga0495610_0027856 3300046512 Bacteria 2996
331 Ga0495610_0052968 3300046512 Bacteria 1968
332 Ga0495610_0077361 3300046512 Bacteria 1536
333 Ga0495616_0001672 3300046513 Bacteria 15148
334 Ga0495620_0011472 3300046515 Bacteria 4622
335 Ga0495620_0023682 3300046515 Bacteria 2931
336 Ga0495631_0010208 3300046518 Bacteria 4657
337 Ga0495632_0000698 3300046519 Bacteria 30511
338 Ga0495632_0003194 3300046519 Bacteria 11804
339 Ga0495632_0005281 3300046519 Bacteria 8579
340 Ga0495632_0008220 3300046519 Bacteria 6438
341 Ga0495637_0011398 3300046520 Bacteria 4272
342 Ga0495643_0004466 3300046522 Bacteria 9770
343 Ga0495643_0009358 3300046522 Bacteria 6093
344 Ga0495643_0023480 3300046522 Bacteria 3506
345 Ga0495648_0030724 3300046524 Bacteria 3547
346 Ga0495642_0000247 3300046528 Bacteria 30419
347 Ga0495654_0001276 3300046530 Bacteria 17680
348 Ga0495654_0006494 3300046530 Bacteria 6639
349 Ga0495654_0063147 3300046530 Bacteria 1774
350 Ga0495609_0002286 3300046538 Bacteria 11931
351 Ga0495609_0092087 3300046538 Bacteria 1318
352 Ga0495597_0042162 3300046542 Bacteria 2036
353 Ga0495622_0068275 3300046557 Bacteria 1642
354 Ga0495633_0034232 3300046558 Bacteria 2444
355 Ga0495633_0052187 3300046558 Bacteria 1927
356 Ga0495668_0006710 3300046616 Bacteria 7497
357 Ga0495668_0042162 3300046616 Bacteria 2541
358 Ga0495611_0003176 3300046648 Bacteria 7277
359 Ga0495625_0031212 3300046660 Bacteria 3965
360 Ga0495625_0036037 3300046660 Bacteria 3640
361 Ga0495625_0045964 3300046660 Bacteria 3153
362 Ga0495659_0035533 3300046664 Bacteria 1757
363 Ga0495661_0000926 3300046665 Bacteria 26760
364 Ga0495661_0002886 3300046665 Bacteria 13006
365 Ga0495670_0000057 3300046691 Bacteria 54709
366 Ga0495649_0000153 3300046694 Bacteria 60597
367 Ga0495649_0080699 3300046694 Bacteria 1740
368 Ga0495589_0000057 3300046794 Bacteria 108136
369 Ga0495589_0152434 3300046794 Bacteria 1103
370 Ga0495660_0003453 3300046810 Bacteria 9762
371 Ga0495660_0118521 3300046810 Bacteria 1342
372 Ga0495636_0001971 3300047318 Bacteria 7865
373 Ga0495672_0001002 3300047320 Bacteria 29119
374 Ga0495672_0075473 3300047320 Bacteria 1896
375 Ga0495687_000432 3300047443 Bacteria 51756
376 Ga0495685_002554 3300047447 Bacteria 5720
377 Ga0495673_0010554 3300047469 Bacteria 5013
378 Ga0495681_0029559 3300047470 Bacteria 2803
379 Ga0495681_0054962 3300047470 Bacteria 1859
380 Ga0495686_0009124 3300047472 Bacteria 7187
381 Ga0495626_0000626 3300048091 Bacteria 34453
382 Ga0496101_0010159 3300048904 Bacteria 6210
383 Ga0496105_0153805 3300048908 Bacteria 1890
384 Ga0496106_0000806 3300048909 Bacteria 22724
385 Ga0496106_0043911 3300048909 Bacteria 3355
386 Ga0496109_0462649 3300048912 Bacteria 1198
387 Ga0496111_0087925 3300048914 Bacteria 2275
388 Ga0496111_0137484 3300048914 Bacteria 1810
389 Ga0496113_0139080 3300048916 Bacteria 1910
390 Ga0496116_0000049 3300048919 Bacteria 314452
391 Ga0496116_0006317 3300048919 Bacteria 10781
392 Ga0496117_0001805 3300048920 Bacteria 29093
393 Ga0496117_0026899 3300048920 Bacteria 4492
394 Ga0496117_0088813 3300048920 Bacteria 1998
395 Ga0496118_0222858 3300048921 Bacteria 1096
396 Ga0496119_0000147 3300048922 Bacteria 98899
397 Ga0496119_0071624 3300048922 Bacteria 2028
398 Ga0496120_0031039 3300048923 Bacteria 3241
399 Ga0496121_0097525 3300048924 Bacteria 2277
400 Ga0496122_0000137 3300048925 Bacteria 170016
401 Ga0496122_0002390 3300048925 Bacteria 26829
402 Ga0496122_0015666 3300048925 Bacteria 7231
403 Ga0496122_0022317 3300048925 Bacteria 5631
404 Ga0496122_0034805 3300048925 Bacteria 4112
405 Ga0496122_0044250 3300048925 Bacteria 3477
406 Ga0496123_0000022 3300048926 Bacteria 361832
407 Ga0496123_0002146 3300048926 Bacteria 25206
408 Ga0496123_0008160 3300048926 Bacteria 9659
409 Ga0496123_0012560 3300048926 Bacteria 7209
410 Ga0496123_0014576 3300048926 Bacteria 6505
411 Ga0496123_0043877 3300048926 Bacteria 3064
412 Ga0496124_0001807 3300048927 Bacteria 29648
413 Ga0496124_0003713 3300048927 Bacteria 18423
414 Ga0496124_0022940 3300048927 Bacteria 5710
415 Ga0496124_0028250 3300048927 Bacteria 5021
416 Ga0496124_0037204 3300048927 Bacteria 4235
417 Ga0496124_0045105 3300048927 Bacteria 3780
418 Ga0496124_0060309 3300048927 Bacteria 3182
419 Ga0496125_0000143 3300048928 Bacteria 156688
420 Ga0496125_0000264 3300048928 Bacteria 108134
421 Ga0496125_0000774 3300048928 Bacteria 52227
422 Ga0496125_0001930 3300048928 Bacteria 28338
423 Ga0496125_0002881 3300048928 Bacteria 21656
424 Ga0496125_0003847 3300048928 Bacteria 17804
425 Ga0496125_0030421 3300048928 Bacteria 4831
426 Ga0496126_0000081 3300048929 Bacteria 218818
427 Ga0495678_000585 3300049459 Bacteria 34385
428 Ga0501033_0134972 3300049570 Unclassified 1786
429 Ga0501038_0354409 3300049574 Bacteria 1142
430 Ga0501040_0061713 3300049576 Bacteria 2578
431 Ga0501041_0017938 3300049577 Bacteria 4213
432 Ga0501041_0090665 3300049577 Bacteria 1887
433 Ga0501042_0043739 3300049578 Bacteria 3189
434 Ga0501048_0092922 3300049582 Unclassified 2128
435 Ga0501068_0069138 3300049584 Unclassified 2153
436 Ga0501070_0278098 3300049586 Bacteria 1366
437 Ga0501072_0059587 3300049588 Bacteria 3010
438 Ga0501074_0192238 3300049590 Bacteria 1455
439 Ga0501075_0011676 3300049591 Bacteria 6223
440 Ga0501076_0068859 3300049592 Bacteria 2827
441 Ga0501079_0003288 3300049741 Bacteria 11844
442 Ga0501080_0032207 3300049742 Bacteria 4888
443 Ga0501080_0117457 3300049742 Bacteria 2466
444 Ga0501081_0004940 3300049743 Bacteria 8573
445 Ga0501081_0106405 3300049743 Bacteria 1988
446 Ga0501083_0103059 3300049744 Bacteria 1881
447 Ga0501045_0031311 3300049824 Bacteria 3853
448 nmdc:mga03683_4451_c1 3300050489 Bacteria 4651
449 nmdc:mga03n38_5211_c1 3300050490 Bacteria 4402
450 nmdc:mga00v17_189067_c1 3300050491 Bacteria 1329
451 nmdc:mga0yw44_18736_c1 3300050492 Bacteria 3799
452 nmdc:mga0yw44_26771_c1 3300050492 Bacteria 3298
453 nmdc:mga0k408_9994_c1 3300050493 Bacteria 5123
454 nmdc:mga06z11_8982_c1 3300050494 Bacteria 4195
455 nmdc:mga07m45_24765_c1 3300050496 Bacteria 3289
456 nmdc:mga07m45_8115_c1 3300050496 Bacteria 5382
457 nmdc:mga07m45_84774_c1 3300050496 Bacteria 1811
458 nmdc:mga05p37_207334_c1 3300050507 Bacteria 2370
459 nmdc:mga05p37_61681_c1 3300050507 Bacteria 4615
460 nmdc:mga06r32_33183_c1 3300050510 Unclassified 4861
461 nmdc:mga08y16_292253_c1 3300050511 Bacteria 1680
462 nmdc:mga08y16_395_c1 3300050511 Bacteria 39889
463 nmdc:mga0n895_54383_c1 3300050512 Bacteria 3938
464 nmdc:mga0a205_43424_c3 3300050515 Bacteria 1289
465 nmdc:mga0sz30_4360_c1 3300050516 Bacteria 5109
466 Ga0500610_0043546 3300053079 Bacteria 2326
467 Ga0500578_0056889 3300053086 Bacteria 2500
468 Ga0500556_0000065 3300053104 Bacteria 106261
469 Ga0500556_0004759 3300053104 Bacteria 3851
470 Ga0500594_0011673 3300053118 Bacteria 2054
471 Ga0500618_003428 3300053125 Bacteria 5433
472 Ga0500618_003947 3300053125 Bacteria 4913
473 Ga0500658_0000607 3300053134 Bacteria 14856
474 Ga0500559_0004585 3300053136 Bacteria 6534
475 Ga0500568_0000004 3300053139 Bacteria 621666
476 Ga0500568_0000070 3300053139 Bacteria 99663
477 Ga0500568_0000101 3300053139 Bacteria 78689
478 Ga0500568_0028278 3300053139 Bacteria 2338
479 Ga0500616_0000473 3300053153 Bacteria 52175
480 Ga0500616_0013319 3300053153 Bacteria 4781
481 Ga0500616_0039954 3300053153 Bacteria 2526
482 Ga0500616_0099542 3300053153 Bacteria 1424
483 Ga0500645_002411 3300053730 Bacteria 8375
484 Ga0501084_0016794 3300054114 Bacteria 6082
485 Ga0501082_0009434 3300060353 Bacteria 8400
486 Ga0501082_0081142 3300060353 Bacteria 2799
487 Ga0466962_0020934 3300061719 Bacteria 3143
488 Ga0530510_0144507 3300061734 Bacteria 1754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0020934 Ga0466962_0020934_647_1513 267
2 3300044694 Ga0466963_0013723 Ga0466963_0013723_130_996 269
3 3300044901 Ga0466960_0001264 Ga0466960_0001264_6547_7413 269
4 3300045836 Ga0466958_0037647 Ga0466958_0037647_1021_1887 269
5 3300045976 Ga0466967_0319267 Ga0466967_0319267_439_1305 269
6 3300026078 Ga0207702_10410343 Ga0207702_104103432 271
7 iso_pu_bacteria 2551306086 2551694553 272
8 iso_pu_bacteria 2551306092 2551733209 272
9 3300009011 Ga0105251_10004202 Ga0105251_100042028 275
10 3300046460 Ga0495638_0004264 Ga0495638_0004264_8405_9262 275
11 3300053104 Ga0500556_0004759 Ga0500556_0004759_2682_3539 275
12 3300013104 Ga0157370_10142609 Ga0157370_101426091 276
13 iso_pu_bacteria 2844533157 2844533771 277
14 3300005981 Ga0081538_10005439 Ga0081538_100054392 279
15 3300006852 Ga0075433_10057721 Ga0075433_100577216 279
16 3300006871 Ga0075434_100006245 Ga0075434_10000624511 279
17 3300006914 Ga0075436_100208470 Ga0075436_1002084701 279
18 3300007076 Ga0075435_100122555 Ga0075435_1001225553 279
19 3300050512 nmdc:mga0n895_54383_c1 nmdc:mga0n895_54383_c1_2558_3454 279
20 3300050515 nmdc:mga0a205_43424_c3 nmdc:mga0a205_43424_c3_48_944 279
21 3300046507 Ga0495606_0133806 Ga0495606_0133806_540_1394 283
22 3300053153 Ga0500616_0039954 Ga0500616_0039954_894_1748 283
23 iso_pu_bacteria 2513237305 2514423237 287
24 iso_pu_bacteria 2883291878 2883294994 290
25 iso_pu_bacteria 2883354860 2883356532 290
26 3300005546 Ga0070696_100053595 Ga0070696_1000535954 291
27 3300006871 Ga0075434_100346899 Ga0075434_1003468991 291
28 3300009147 Ga0114129_10280815 Ga0114129_102808153 291
29 3300014497 Ga0182008_10125801 Ga0182008_101258011 291
30 3300025981 Ga0207640_10430796 Ga0207640_104307961 291
31 3300048909 Ga0496106_0043911 Ga0496106_0043911_1101_1976 291
32 3300048912 Ga0496109_0462649 Ga0496109_0462649_185_1060 291
33 3300048914 Ga0496111_0087925 Ga0496111_0087925_553_1428 291
34 3300048916 Ga0496113_0139080 Ga0496113_0139080_472_1347 291
35 3300050507 nmdc:mga05p37_207334_c1 nmdc:mga05p37_207334_c1_24_899 291
36 iso_pu_bacteria 2508501127 2509139599 291
37 iso_pu_bacteria 2509276021 2509386179 291
38 iso_pu_bacteria 2509276033 2509441732 291
39 iso_pu_bacteria 2510065019 2510137582 291
40 iso_pu_bacteria 2510065057 2510303665 291
41 iso_pu_bacteria 2510461069 2510843094 291
42 iso_pu_bacteria 2510461076 2510893527 291
43 iso_pu_bacteria 2510917022 2511135479 291
44 iso_pu_bacteria 2510917028 2511186770 291
45 iso_pu_bacteria 2510917030 2511199752 291
46 iso_pu_bacteria 2511231022 2511364842 291
47 iso_pu_bacteria 2511231052 2511502960 291
48 iso_pu_bacteria 2512047086 2512534223 291
49 iso_pu_bacteria 2513237084 2513571901 291
50 iso_pu_bacteria 2513237085 2513576056 291
51 iso_pu_bacteria 2513237086 2513585287 291
52 iso_pu_bacteria 2513237091 2513617131 291
53 iso_pu_bacteria 2513237093 2513635862 291
54 iso_pu_bacteria 2513237103 2513712698 291
55 iso_pu_bacteria 2513237140 2513882872 291
56 iso_pu_bacteria 2513237143 2513902900 291
57 iso_pu_bacteria 2513237144 2513908056 291
58 iso_pu_bacteria 2513237146 2513927836 291
59 iso_pu_bacteria 2513237159 2513999736 291
60 iso_pu_bacteria 2513237162 2514019022 291
61 iso_pu_bacteria 2515075009 2515109420 291
62 iso_pu_bacteria 2515154107 2515610367 291
63 iso_pu_bacteria 2515154113 2515633463 291
64 iso_pu_bacteria 2515154114 2515641662 291
65 iso_pu_bacteria 2515154116 2515660499 291
66 iso_pu_bacteria 2515154134 2515742521 291
67 iso_pu_bacteria 2516653046 2516894365 291
68 iso_pu_bacteria 2516653077 2517042289 291
69 iso_pu_bacteria 2516653085 2517081515 291
70 iso_pu_bacteria 2517093000 2517099527 291
71 iso_pu_bacteria 2517287029 2517411726 291
72 iso_pu_bacteria 2523231067 2523467506 291
73 iso_pu_bacteria 2529292951 2530650082 291
74 iso_pu_bacteria 2551306084 2551679833 291
75 iso_pu_bacteria 2551306085 2551685976 291
76 iso_pu_bacteria 2551306087 2551698071 291
77 iso_pu_bacteria 2551306089 2551710437 291
78 iso_pu_bacteria 2551306089 2551711855 291
79 iso_pu_bacteria 2551306090 2551715711 291
80 iso_pu_bacteria 2551306091 2551726323 291
81 iso_pu_bacteria 2551306093 2551740293 291
82 iso_pu_bacteria 2551306093 2551746383 291
83 iso_pu_bacteria 2582581298 2585221484 291
84 iso_pu_bacteria 2582581299 2585230825 291
85 iso_pu_bacteria 2582581306 2585269238 291
86 iso_pu_bacteria 2582581307 2585276467 291
87 iso_pu_bacteria 2582581308 2585277846 291
88 iso_pu_bacteria 2582581315 2585328663 291
89 iso_pu_bacteria 2582581316 2585336249 291
90 iso_pu_bacteria 2582581865 2585390766 291
91 iso_pu_bacteria 2582581866 2585395120 291
92 iso_pu_bacteria 2582581867 2585401871 291
93 iso_pu_bacteria 2585427526 2585528591 291
94 iso_pu_bacteria 2585427527 2585533288 291
95 iso_pu_bacteria 2585427528 2585539410 291
96 iso_pu_bacteria 2585427529 2585544346 291
97 iso_pu_bacteria 2585427530 2585555712 291
98 iso_pu_bacteria 2585427531 2585562930 291
99 iso_pu_bacteria 2585427590 2585820285 291
100 iso_pu_bacteria 2585427593 2585837364 291
101 iso_pu_bacteria 2585427608 2585901698 291
102 iso_pu_bacteria 2585427609 2585908575 291
103 iso_pu_bacteria 2585428125 2587983995 291
104 iso_pu_bacteria 2597489888 2597862914 291
105 iso_pu_bacteria 2597489889 2597868715 291
106 iso_pu_bacteria 2599185167 2599396486 291
107 iso_pu_bacteria 2599185170 2599416731 291
108 iso_pu_bacteria 2599185179 2599453457 291
109 iso_pu_bacteria 2599185189 2599507515 291
110 iso_pu_bacteria 2599185190 2599514738 291
111 iso_pu_bacteria 2599185191 2599517279 291
112 iso_pu_bacteria 2599185212 2599613680 291
113 iso_pu_bacteria 2599185236 2599719691 291
114 iso_pu_bacteria 2599185248 2599772112 291
115 iso_pu_bacteria 2599185288 2599883048 291
116 iso_pu_bacteria 2599185289 2599888135 291
117 iso_pu_bacteria 2599185290 2599893997 291
118 iso_pu_bacteria 2599185291 2599900152 291
119 iso_pu_bacteria 2599185303 2599951725 291
120 iso_pu_bacteria 2599185305 2599962404 291
121 iso_pu_bacteria 2599185306 2599965034 291
122 iso_pu_bacteria 2599185308 2599976242 291
123 iso_pu_bacteria 2599185313 2600006716 291
124 iso_pu_bacteria 2599185314 2600010378 291
125 iso_pu_bacteria 2599185315 2600018537 291
126 iso_pu_bacteria 2599185316 2600023834 291
127 iso_pu_bacteria 2599185317 2600031962 291
128 iso_pu_bacteria 2599185318 2600037177 291
129 iso_pu_bacteria 2599185319 2600044072 291
130 iso_pu_bacteria 2599185321 2600053056 291
131 iso_pu_bacteria 2599185322 2600060622 291
132 iso_pu_bacteria 2599185323 2600067651 291
133 iso_pu_bacteria 2599185324 2600071374 291
134 iso_pu_bacteria 2599185325 2600077884 291
135 iso_pu_bacteria 2600254930 2600359891 291
136 iso_pu_bacteria 2600255296 2601691436 291
137 iso_pu_bacteria 2615840624 2616294483 291
138 iso_pu_bacteria 2615840626 2616309232 291
139 iso_pu_bacteria 2615840698 2616552274 291
140 iso_pu_bacteria 2619619299 2621301013 291
141 iso_pu_bacteria 2643221568 2643854672 291
142 iso_pu_bacteria 2643221571 2643870932 291
143 iso_pu_bacteria 2643221650 2644284048 291
144 iso_pu_bacteria 2643221688 2644494084 291
145 iso_pu_bacteria 2643221713 2644625188 291
146 iso_pu_bacteria 2667528170 2671092463 291
147 iso_pu_bacteria 2667528174 2671115542 291
148 iso_pu_bacteria 2667528176 2671128176 291
149 iso_pu_bacteria 2675903420 2677896755 291
150 iso_pu_bacteria 2675903515 2678261280 291
151 iso_pu_bacteria 2718217927 2719389004 291
152 iso_pu_bacteria 2718217997 2719668507 291
153 iso_pu_bacteria 2718218199 2720489200 291
154 iso_pu_bacteria 2718218232 2720609890 291
155 iso_pu_bacteria 2718218233 2720617315 291
156 iso_pu_bacteria 2718218235 2720628457 291
157 iso_pu_bacteria 2718218269 2720772410 291
158 iso_pu_bacteria 2718218423 2721402680 291
159 iso_pu_bacteria 2721755556 2723029839 291
160 iso_pu_bacteria 2721755607 2723247734 291
161 iso_pu_bacteria 2721755684 2723564208 291
162 iso_pu_bacteria 2721755685 2723570106 291
163 iso_pu_bacteria 2721755686 2723574955 291
164 iso_pu_bacteria 2721755809 2724034746 291
165 iso_pu_bacteria 2721755819 2724092439 291
166 iso_pu_bacteria 2721755822 2724101653 291
167 iso_pu_bacteria 2721755823 2724112814 291
168 iso_pu_bacteria 2724679232 2725949766 291
169 iso_pu_bacteria 2728369352 2730110372 291
170 iso_pu_bacteria 2738541265 2738670363 291
171 iso_pu_bacteria 2738541282 2738748756 291
172 iso_pu_bacteria 2738541293 2738799750 291
173 iso_pu_bacteria 2738541294 2738809641 291
174 iso_pu_bacteria 2738541303 2738857798 291
175 iso_pu_bacteria 2738541309 2738897001 291
176 iso_pu_bacteria 2738541333 2739033868 291
177 iso_pu_bacteria 2738543031 2739347947 291
178 iso_pu_bacteria 2744054620 2745006597 291
179 iso_pu_bacteria 2751185800 2753360929 291
180 iso_pu_bacteria 2765235942 2766064948 291
181 iso_pu_bacteria 2775506902 2776268618 291
182 iso_pu_bacteria 2775506904 2776285301 291
183 iso_pu_bacteria 2791354903 2791924187 291
184 iso_pu_bacteria 2791355256 2793297748 291
185 iso_pu_bacteria 2791355259 2793312931 291
186 iso_pu_bacteria 2791355260 2793322561 291
187 iso_pu_bacteria 2791355261 2793329333 291
188 iso_pu_bacteria 2791355262 2793336518 291
189 iso_pu_bacteria 2791355263 2793343765 291
190 iso_pu_bacteria 2791355265 2793356278 291
191 iso_pu_bacteria 2791355266 2793359868 291
192 iso_pu_bacteria 2791355267 2793368520 291
193 iso_pu_bacteria 2802429605 2805928521 291
194 iso_pu_bacteria 2802429633 2806045800 291
195 iso_pu_bacteria 2802429634 2806053372 291
196 iso_pu_bacteria 2802429635 2806061086 291
197 iso_pu_bacteria 2802429636 2806066259 291
198 iso_pu_bacteria 2802429637 2806073161 291
199 iso_pu_bacteria 2806310737 2807408417 291
200 iso_pu_bacteria 2806310745 2807456731 291
201 iso_pu_bacteria 2808606361 2808858874 291
202 iso_pu_bacteria 2808606378 2808938964 291
203 iso_pu_bacteria 2808606383 2808967378 291
204 iso_pu_bacteria 2808606385 2808975784 291
205 iso_pu_bacteria 2808606388 2808990578 291
206 iso_pu_bacteria 2808606389 2809002209 291
207 iso_pu_bacteria 2816332298 2817489684 291
208 iso_pu_bacteria 2818991448 2819611808 291
209 iso_pu_bacteria 2818991453 2819641923 291
210 iso_pu_bacteria 2818991461 2819682915 291
211 iso_pu_bacteria 2825651385 2825653983 291
212 iso_pu_bacteria 2834028612 2834029560 291
213 iso_pu_bacteria 2837651117 2837654088 291
214 iso_pu_bacteria 2837678835 2837679069 291
215 iso_pu_bacteria 2838016132 2838016285 291
216 iso_pu_bacteria 2838022645 2838024744 291
217 iso_pu_bacteria 2838029111 2838030408 291
218 iso_pu_bacteria 2838035591 2838036842 291
219 iso_pu_bacteria 2838042994 2838046856 291
220 iso_pu_bacteria 2838048938 2838049601 291
221 iso_pu_bacteria 2838061910 2838065342 291
222 iso_pu_bacteria 2838068647 2838068812 291
223 iso_pu_bacteria 2838661181 2838662122 291
224 iso_pu_bacteria 2838668709 2838668883 291
225 iso_pu_bacteria 2838680041 2838685655 291
226 iso_pu_bacteria 2838686498 2838688009 291
227 iso_pu_bacteria 2838694306 2838700441 291
228 iso_pu_bacteria 2838701080 2838701457 291
229 iso_pu_bacteria 2838707686 2838713696 291
230 iso_pu_bacteria 2838729681 2838732187 291
231 iso_pu_bacteria 2838742623 2838745394 291
232 iso_pu_bacteria 2839993093 2839994517 291
233 iso_pu_bacteria 2840764183 2840768764 291
234 iso_pu_bacteria 2841851746 2841851750 291
235 iso_pu_bacteria 2841864319 2841869602 291
236 iso_pu_bacteria 2842077413 2842082867 291
237 iso_pu_bacteria 2842110456 2842116053 291
238 iso_pu_bacteria 2842118031 2842123985 291
239 iso_pu_bacteria 2842146304 2842146478 291
240 iso_pu_bacteria 2842156927 2842159175 291
241 iso_pu_bacteria 2842163707 2842166070 291
242 iso_pu_bacteria 2842180545 2842182789 291
243 iso_pu_bacteria 2842192696 2842194131 291
244 iso_pu_bacteria 2842198810 2842200151 291
245 iso_pu_bacteria 2842217011 2842222781 291
246 iso_pu_bacteria 2842229732 2842233153 291
247 iso_pu_bacteria 2842237096 2842243099 291
248 iso_pu_bacteria 2842243621 2842247570 291
249 iso_pu_bacteria 2842250916 2842251292 291
250 iso_pu_bacteria 2842257432 2842261341 291
251 iso_pu_bacteria 2842264693 2842265150 291
252 iso_pu_bacteria 2842271015 2842273043 291
253 iso_pu_bacteria 2842285085 2842288132 291
254 iso_pu_bacteria 2842291075 2842297182 291
255 iso_pu_bacteria 2842304105 2842309478 291
256 iso_pu_bacteria 2842311132 2842315791 291
257 iso_pu_bacteria 2842317721 2842319540 291
258 iso_pu_bacteria 2842341865 2842346078 291
259 iso_pu_bacteria 2842363717 2842367901 291
260 iso_pu_bacteria 2842370503 2842376512 291
261 iso_pu_bacteria 2842377471 2842383569 291
262 iso_pu_bacteria 2842384541 2842390742 291
263 iso_pu_bacteria 2842395702 2842399391 291
264 iso_pu_bacteria 2842402390 2842405398 291
265 iso_pu_bacteria 2842409023 2842411845 291
266 iso_pu_bacteria 2842415677 2842418628 291
267 iso_pu_bacteria 2842422224 2842422958 291
268 iso_pu_bacteria 2842428310 2842428797 291
269 iso_pu_bacteria 2842434925 2842435410 291
270 iso_pu_bacteria 2842441272 2842441727 291
271 iso_pu_bacteria 2842447887 2842448229 291
272 iso_pu_bacteria 2842462802 2842463221 291
273 iso_pu_bacteria 2842469257 2842469741 291
274 iso_pu_bacteria 2842475841 2842477312 291
275 iso_pu_bacteria 2842489311 2842490890 291
276 iso_pu_bacteria 2842495871 2842498697 291
277 iso_pu_bacteria 2842502639 2842504109 291
278 iso_pu_bacteria 2842521101 2842525667 291
279 iso_pu_bacteria 2842826826 2842831726 291
280 iso_pu_bacteria 2842837860 2842842219 291
281 iso_pu_bacteria 2844454524 2844461413 291
282 iso_pu_bacteria 2852387548 2852393130 291
283 iso_pu_bacteria 2852612431 2852614923 291
284 iso_pu_bacteria 2852667396 2852669891 291
285 iso_pu_bacteria 2855825444 2855827000 291
286 iso_pu_bacteria 2855839649 2855842396 291
287 iso_pu_bacteria 2857516855 2857522589 291
288 iso_pu_bacteria 2858800743 2858803212 291
289 iso_pu_bacteria 2860867994 2860869555 291
290 iso_pu_bacteria 2882632389 2882639223 291
291 iso_pu_bacteria 2885312484 2885318729 291
292 iso_pu_bacteria 2888343758 2888348712 291
293 iso_pu_bacteria 2908446538 2908448480 291
294 iso_pu_bacteria 2912963787 2912966732 291
295 iso_pu_bacteria 2913036834 2913037571 291
296 iso_pu_bacteria 2915986958 2915991007 291
297 iso_pu_bacteria 2915993759 2915996683 291
298 iso_pu_bacteria 2916000859 2916005093 291
299 iso_pu_bacteria 2916007675 2916013427 291
300 iso_pu_bacteria 2916014648 2916016949 291
301 iso_pu_bacteria 2916021584 2916028206 291
302 iso_pu_bacteria 2916028427 2916029279 291
303 iso_pu_bacteria 2916035215 2916038345 291
304 iso_pu_bacteria 2916041962 2916044909 291
305 iso_pu_bacteria 2916048683 2916049263 291
306 iso_pu_bacteria 2916055098 2916058216 291
307 iso_pu_bacteria 2916068649 2916076298 291
308 iso_pu_bacteria 2916076590 2916083129 291
309 iso_pu_bacteria 2919100787 2919103620 291
310 iso_pu_bacteria 2919166419 2919169006 291
311 iso_pu_bacteria 2919450847 2919451611 291
312 iso_pu_bacteria 2921201388 2921202122 291
313 iso_pu_bacteria 2921208531 2921213317 291
314 iso_pu_bacteria 2921237296 2921242318 291
315 iso_pu_bacteria 2921244191 2921247742 291
316 iso_pu_bacteria 2921257292 2921260122 291
317 iso_pu_bacteria 2921263974 2921266117 291
318 iso_pu_bacteria 2921282425 2921288353 291
319 iso_pu_bacteria 2921289301 2921289569 291
320 iso_pu_bacteria 2921296804 2921298705 291
321 iso_pu_bacteria 2923556063 2923560519 291
322 iso_pu_bacteria 2923586266 2923591551 291
323 iso_pu_bacteria 2924144063 2924148267 291
324 iso_pu_bacteria 2924150972 2924152107 291
325 iso_pu_bacteria 2924158325 2924164043 291
326 iso_pu_bacteria 2924165586 2924168681 291
327 iso_pu_bacteria 2924172951 2924175347 291
328 iso_pu_bacteria 2924179722 2924183831 291
329 iso_pu_bacteria 2924186466 2924189968 291
330 iso_pu_bacteria 2924193448 2924193743 291
331 iso_pu_bacteria 2924207177 2924214046 291
332 iso_pu_bacteria 2924214083 2924220638 291
333 iso_pu_bacteria 2924221636 2924221798 291
334 iso_pu_bacteria 2924228884 2924232430 291
335 iso_pu_bacteria 2924754689 2924759727 291
336 iso_pu_bacteria 2929189879 2929191534 291
337 iso_pu_bacteria 2931369376 2931371563 291
338 iso_pu_bacteria 2931390751 2931392623 291
339 iso_pu_bacteria 2933570622 2933575923 291
340 iso_pu_bacteria 2933586486 2933592270 291
341 iso_pu_bacteria 2933599457 2933599480 291
342 iso_pu_bacteria 2935894831 2935900305 291
343 iso_pu_bacteria 2935901341 2935906509 291
344 iso_pu_bacteria 2936367885 2936373575 291
345 iso_pu_bacteria 2936375103 2936378357 291
346 iso_pu_bacteria 2936381700 2936386630 291
347 iso_pu_bacteria 2936996657 2937000020 291
348 iso_pu_bacteria 2937002841 2937007020 291
349 iso_pu_bacteria 2937009748 2937015489 291
350 iso_pu_bacteria 2937016420 2937018209 291
351 iso_pu_bacteria 2937023124 2937026738 291
352 iso_pu_bacteria 2937042894 2937047845 291
353 iso_pu_bacteria 2937049772 2937052376 291
354 iso_pu_bacteria 2937056579 2937062205 291
355 iso_pu_bacteria 2937063883 2937067620 291
356 iso_pu_bacteria 2937071275 2937071434 291
357 iso_pu_bacteria 2937091812 2937093428 291
358 iso_pu_bacteria 2937098957 2937102280 291
359 iso_pu_bacteria 2937106411 2937111378 291
360 iso_pu_bacteria 2937113482 2937114861 291
361 iso_pu_bacteria 2937119839 2937123665 291
362 iso_pu_bacteria 2937126314 2937129357 291
363 iso_pu_bacteria 2937836603 2937838702 291
364 iso_pu_bacteria 2945928738 2945929036 291
365 iso_pu_bacteria 2945961074 2945962169 291
366 iso_pu_bacteria 2946006987 2946011254 291
367 iso_pu_bacteria 2946027586 2946029812 291
368 iso_pu_bacteria 2947233263 2947236384 291
369 iso_pu_bacteria 2957382221 2957386118 291
370 iso_pu_bacteria 2957388812 2957392097 291
371 iso_pu_bacteria 2957395598 2957398469 291
372 iso_pu_bacteria 2957402308 2957406299 291
373 iso_pu_bacteria 2957408893 2957409052 291
374 iso_pu_bacteria 2957415311 2957421257 291
375 iso_pu_bacteria 2957422303 2957429958 291
376 iso_pu_bacteria 2957430029 2957436815 291
377 iso_pu_bacteria 2957450854 2957451683 291
378 iso_pu_bacteria 2957457609 2957459070 291
379 iso_pu_bacteria 2957464669 2957468371 291
380 iso_pu_bacteria 2957471148 2957472266 291
381 iso_pu_bacteria 2957478035 2957481135 291
382 iso_pu_bacteria 2957484790 2957487576 291
383 iso_pu_bacteria 2957491536 2957495306 291
384 iso_pu_bacteria 2957498199 2957498685 291
385 iso_pu_bacteria 2957505466 2957508687 291
386 iso_pu_bacteria 2960584000 2960585348 291
387 iso_pu_bacteria 2960597568 2960598811 291
388 iso_pu_bacteria 2960603979 2960608302 291
389 iso_pu_bacteria 2960610863 2960617217 291
390 iso_pu_bacteria 2960624210 2960628111 291
391 iso_pu_bacteria 2960637947 2960638985 291
392 iso_pu_bacteria 2960645483 2960650122 291
393 iso_pu_bacteria 2960667422 2960671531 291
394 iso_pu_bacteria 2960674078 2960677407 291
395 iso_pu_bacteria 2960687367 2960692378 291
396 iso_pu_bacteria 2964607997 2964612976 291
397 iso_pu_bacteria 2964615318 2964620436 291
398 iso_pu_bacteria 2964621998 2964622379 291
399 iso_pu_bacteria 2964628898 2964629976 291
400 iso_pu_bacteria 2964636051 2964638215 291
401 iso_pu_bacteria 2964643177 2964647276 291
402 iso_pu_bacteria 2964649959 2964652300 291
403 iso_pu_bacteria 2964656573 2964657765 291
404 iso_pu_bacteria 2964663802 2964670846 291
405 iso_pu_bacteria 2964670856 2964673662 291
406 iso_pu_bacteria 2964678106 2964681826 291
407 iso_pu_bacteria 2964685014 2964688197 291
408 iso_pu_bacteria 2964691889 2964697669 291
409 iso_pu_bacteria 2964698721 2964702993 291
410 iso_pu_bacteria 2964705432 2964712436 291
411 iso_pu_bacteria 2964712639 2964717474 291
412 iso_pu_bacteria 2964719344 2964720071 291
413 iso_pu_bacteria 2967664464 2967670858 291
414 iso_pu_bacteria 2967671571 2967674415 291
415 iso_pu_bacteria 2967678726 2967685938 291
416 iso_pu_bacteria 2967693043 2967696194 291
417 iso_pu_bacteria 2967699805 2967705649 291
418 iso_pu_bacteria 2967706974 2967710070 291
419 iso_pu_bacteria 2967714385 2967720044 291
420 iso_pu_bacteria 2967721400 2967724858 291
421 iso_pu_bacteria 2967735183 2967735352 291
422 iso_pu_bacteria 2967742019 2967746839 291
423 iso_pu_bacteria 2967748971 2967752407 291
424 iso_pu_bacteria 2967755722 2967758873 291
425 iso_pu_bacteria 2967762386 2967769237 291
426 iso_pu_bacteria 2967775926 2967776392 291
427 iso_pu_bacteria 2970019648 2970022213 291
428 iso_pu_bacteria 2970033650 2970040567 291
429 iso_pu_bacteria 2970040964 2970043466 291
430 iso_pu_bacteria 2970047711 2970050576 291
431 iso_pu_bacteria 2970054988 2970058440 291
432 iso_pu_bacteria 2970061556 2970067050 291
433 iso_pu_bacteria 2970068827 2970075750 291
434 iso_pu_bacteria 2970076120 2970079151 291
435 iso_pu_bacteria 2970082768 2970083459 291
436 iso_pu_bacteria 2970088815 2970090069 291
437 iso_pu_bacteria 2970095765 2970100388 291
438 iso_pu_bacteria 2970102677 2970108899 291
439 iso_pu_bacteria 2970109326 2970112728 291
440 iso_pu_bacteria 2970116247 2970121313 291
441 iso_pu_bacteria 2970129317 2970134369 291
442 iso_pu_bacteria 2970136068 2970141276 291
443 iso_pu_bacteria 2970149975 2970152751 291
444 iso_pu_bacteria 2970156795 2970157902 291
445 iso_pu_bacteria 2970164137 2970166758 291
446 iso_pu_bacteria 2970170962 2970173417 291
447 iso_pu_bacteria 2970177841 2970183075 291
448 iso_pu_bacteria 2970184632 2970187721 291
449 iso_pu_bacteria 2970191845 2970195098 291
450 iso_pu_bacteria 2970540015 2970547616 291
451 iso_pu_bacteria 2977516862 2977522555 291
452 iso_pu_bacteria 2977537788 2977541039 291
453 iso_pu_bacteria 2977551784 2977556919 291
454 iso_pu_bacteria 2977558990 2977564005 291
455 iso_pu_bacteria 2977565890 2977567197 291
456 iso_pu_bacteria 2977572785 2977576083 291
457 iso_pu_bacteria 2977579622 2977579782 291
458 iso_pu_bacteria 2996893221 2996895718 291
459 iso_pu_bacteria 3005445848 3005451303 291
460 iso_pu_bacteria 3007419365 3007422873 291
461 iso_pu_bacteria 639633055 639645722 291
462 iso_pu_bacteria 648276728 648735874 291
463 iso_pu_bacteria 8001845381 8001847527 291
464 iso_pu_bacteria 8003992118 8003994937 291
465 iso_pu_bacteria 8004395343 8004401304 291
466 iso_pu_bacteria 8005275841 8005276423 291
467 iso_pu_bacteria 8005282627 8005288654 291
468 iso_pu_bacteria 8005289223 8005290152 291
469 iso_pu_bacteria 8005301065 8005302139 291
470 iso_pu_bacteria 8005307578 8005311589 291
471 iso_pu_bacteria 8005376324 8005382500 291
472 iso_pu_bacteria 8005395548 8005397827 291
473 iso_pu_bacteria 8005430974 8005431889 291
474 iso_pu_bacteria 8005460587 8005466429 291
475 iso_pu_bacteria 8005484373 8005487858 291
476 iso_pu_bacteria 8005497431 8005502707 291
477 iso_pu_bacteria 8005556819 8005558769 291
478 iso_pu_bacteria 8005563573 8005563740 291
479 iso_pu_bacteria 8005570704 8005576521 291
480 iso_pu_bacteria 8005619151 8005623914 291
481 iso_pu_bacteria 8005626139 8005629178 291
482 iso_pu_bacteria 8005645114 8005647510 291
483 iso_pu_bacteria 8005668836 8005674136 291
484 iso_pu_bacteria 8005682033 8005684188 291
485 iso_pu_bacteria 8005688590 8005692938 291
486 iso_pu_bacteria 8005695170 8005700471 291
487 iso_pu_bacteria 8018127388 8018129123 291
488 iso_pu_bacteria 8018150411 8018150560 291
489 iso_pu_bacteria 8018163183 8018164123 291
490 iso_pu_bacteria 8018176218 8018177440 291
491 iso_pu_bacteria 8019769354 8019770629 291
492 iso_pu_bacteria 8023680758 8023686118 291
493 iso_pu_bacteria 8024479707 8024486538 291
494 iso_pu_bacteria 8024486573 8024493088 291
495 iso_pu_bacteria 8024501048 8024501824 291
496 iso_pu_bacteria 8054285046 8054289708 291
497 iso_pu_bacteria 8054347763 8054351987 291
498 iso_pu_bacteria 8054503363 8054505137 291
499 iso_pu_bacteria 8055617313 8055621824 291
500 iso_pu_bacteria 8055817908 8055819659 291
501 iso_pu_bacteria 8056115690 8056117892 291
502 iso_pu_bacteria 8056120720 8056123410 291
503 iso_pu_bacteria 8056131705 8056133465 291
504 iso_pu_bacteria 8056148874 8056149738 291
505 iso_pu_bacteria 8056155041 8056158990 291
506 iso_pu_bacteria 8056161164 8056164878 291
507 iso_pu_bacteria 8056375014 8056376326 291
508 iso_pu_bacteria 8056382006 8056383710 291
509 iso_pu_bacteria 8057798959 8057803037 291
510 iso_pu_bacteria 8057874678 8057876941 291
511 3300005467 Ga0070706_100031215 Ga0070706_1000312152 292
512 3300005468 Ga0070707_100186096 Ga0070707_1001860962 292
513 3300005539 Ga0068853_100071926 Ga0068853_1000719262 292
514 3300009551 Ga0105238_10015173 Ga0105238_100151734 292
515 3300025922 Ga0207646_10179258 Ga0207646_101792581 292
516 3300025924 Ga0207694_10191747 Ga0207694_101917472 292
517 3300026041 Ga0207639_10041124 Ga0207639_100411243 292
518 3300046472 Ga0495580_0056217 Ga0495580_0056217_781_1662 292
519 iso_pu_bacteria 2511231156 2511822776 292
520 3300005546 Ga0070696_100137841 Ga0070696_1001378412 294
521 3300025912 Ga0207707_10117418 Ga0207707_101174182 294
522 3300045051 Ga0451576_0169878 Ga0451576_0169878_1090_1983 294
523 3300049577 Ga0501041_0090665 Ga0501041_0090665_972_1868 294
524 3300049588 Ga0501072_0059587 Ga0501072_0059587_1731_2627 294
525 3300049742 Ga0501080_0032207 Ga0501080_0032207_2498_3382 294
526 3300049742 Ga0501080_0117457 Ga0501080_0117457_1331_2227 294
527 3300049743 Ga0501081_0106405 Ga0501081_0106405_777_1673 294
528 3300049824 Ga0501045_0031311 Ga0501045_0031311_1296_2192 294
529 3300060353 Ga0501082_0081142 Ga0501082_0081142_219_1115 294
530 iso_pu_bacteria 2856342000 2856347221 294
531 2162886011 MRS1b_contig_6409452 MRS1b_0107.00000080 295
532 3300002737 JGI25162J39368_1000144 JGI25162J39368_100014475 295
533 3300002987 JGI25159J45721_1001687 JGI25159J45721_10016876 295
534 3300002987 JGI25159J45721_1017590 JGI25159J45721_10175902 295
535 3300003187 JGI25151J46595_10000525 JGI25151J46595_1000052520 295
536 3300003187 JGI25151J46595_10001176 JGI25151J46595_100011766 295
537 3300003187 JGI25151J46595_10003084 JGI25151J46595_100030844 295
538 3300003214 JGI25165J46597_1000075 JGI25165J46597_100007556 295
539 3300003215 JGI25153J46596_10000604 JGI25153J46596_1000060420 295
540 3300003215 JGI25153J46596_10001294 JGI25153J46596_1000129413 295
541 3300003215 JGI25153J46596_10008110 JGI25153J46596_100081104 295
542 3300003320 rootH2_10003773 rootH2_1000377317 295
543 3300003322 rootL2_10003291 rootL2_1000329114 295
544 3300003323 rootH1_10031216 rootH1_100312167 295
545 3300003323 rootH1_10066597 rootH1_100665974 295
546 3300003354 JGI25160J50197_1005886 JGI25160J50197_10058863 295
547 3300003354 JGI25160J50197_1017236 JGI25160J50197_10172362 295
548 3300003374 JGI25161J50226_1000450 JGI25161J50226_10004507 295
549 3300003374 JGI25161J50226_1000813 JGI25161J50226_10008134 295
550 3300003752 Ga0055539_1000151 Ga0055539_100015154 295
551 3300003756 Ga0055533_1000154 Ga0055533_100015454 295
552 3300003758 Ga0055532_1000165 Ga0055532_100016542 295
553 3300003759 Ga0055525_1000204 Ga0055525_100020454 295
554 3300003761 Ga0055535_1008953 Ga0055535_10089532 295
555 3300003771 Ga0055526_1004776 Ga0055526_10047767 295
556 3300003771 Ga0055526_1004873 Ga0055526_10048736 295
557 3300003775 Ga0055524_1002154 Ga0055524_10021543 295
558 3300003775 Ga0055524_1005381 Ga0055524_10053814 295
559 3300003775 Ga0055524_1012830 Ga0055524_10128302 295
560 3300003790 Ga0055528_1000501 Ga0055528_100050115 295
561 3300003790 Ga0055528_1001700 Ga0055528_10017008 295
562 3300003790 Ga0055528_1005030 Ga0055528_10050305 295
563 3300003791 Ga0055530_10000229 Ga0055530_1000022940 295
564 3300003792 Ga0055540_1000240 Ga0055540_100024040 295
565 3300003792 Ga0055540_1000487 Ga0055540_10004874 295
566 3300003792 Ga0055540_1015377 Ga0055540_10153772 295
567 3300003794 Ga0055531_10036425 Ga0055531_100364252 295
568 3300003841 Ga0055541_1000101 Ga0055541_100010154 295
569 3300004625 Ga0055543_1000045 Ga0055543_100004526 295
570 3300004625 Ga0055543_1000739 Ga0055543_10007395 295
571 3300005262 Ga0065165_1002947 Ga0065165_100294710 295
572 3300005262 Ga0065165_1005055 Ga0065165_10050553 295
573 3300005288 Ga0065714_10003857 Ga0065714_100038576 295
574 3300005289 Ga0065704_10000520 Ga0065704_100005205 295
575 3300005289 Ga0065704_10004936 Ga0065704_100049363 295
576 3300005289 Ga0065704_10015702 Ga0065704_100157022 295
577 3300005290 Ga0065712_10001701 Ga0065712_100017015 295
578 3300005331 Ga0070670_100000162 Ga0070670_10000016264 295
579 3300005331 Ga0070670_100004443 Ga0070670_1000044431 295
580 3300005331 Ga0070670_100008174 Ga0070670_1000081746 295
581 3300005337 Ga0070682_100389043 Ga0070682_1003890431 295
582 3300005344 Ga0070661_100000132 Ga0070661_10000013258 295
583 3300005347 Ga0070668_100210793 Ga0070668_1002107932 295
584 3300005353 Ga0070669_100019731 Ga0070669_1000197315 295
585 3300005353 Ga0070669_100229201 Ga0070669_1002292011 295
586 3300005356 Ga0070674_100201654 Ga0070674_1002016542 295
587 3300005457 Ga0070662_100001797 Ga0070662_1000017975 295
588 3300005539 Ga0068853_100109016 Ga0068853_1001090162 295
589 3300005546 Ga0070696_100036258 Ga0070696_1000362583 295
590 3300005548 Ga0070665_100095006 Ga0070665_1000950062 295
591 3300005564 Ga0070664_100009020 Ga0070664_1000090209 295
592 3300005564 Ga0070664_100335867 Ga0070664_1003358672 295
593 3300005578 Ga0068854_100009040 Ga0068854_1000090403 295
594 3300005578 Ga0068854_100066566 Ga0068854_1000665663 295
595 3300005614 Ga0068856_100134285 Ga0068856_1001342853 295
596 3300005719 Ga0068861_100083876 Ga0068861_1000838762 295
597 3300005834 Ga0068851_10000084 Ga0068851_1000008431 295
598 3300006038 Ga0075365_10001089 Ga0075365_1000108910 295
599 3300006038 Ga0075365_10045794 Ga0075365_100457943 295
600 3300006038 Ga0075365_10295899 Ga0075365_102958991 295
601 3300006048 Ga0075363_100005396 Ga0075363_1000053964 295
602 3300006051 Ga0075364_10020258 Ga0075364_100202582 295
603 3300006178 Ga0075367_10024535 Ga0075367_100245354 295
604 3300006186 Ga0075369_10003675 Ga0075369_100036754 295
605 3300006186 Ga0075369_10091069 Ga0075369_100910692 295
606 3300006195 Ga0075366_10000314 Ga0075366_100003146 295
607 3300006195 Ga0075366_10265207 Ga0075366_102652071 295
608 3300006353 Ga0075370_10015973 Ga0075370_100159734 295
609 3300006847 Ga0075431_100020334 Ga0075431_1000203342 295
610 3300009011 Ga0105251_10000973 Ga0105251_100009736 295
611 3300009011 Ga0105251_10007395 Ga0105251_100073952 295
612 3300009036 Ga0105244_10002541 Ga0105244_100025414 295
613 3300009036 Ga0105244_10005299 Ga0105244_100052999 295
614 3300009092 Ga0105250_10000565 Ga0105250_100005656 295
615 3300009092 Ga0105250_10033184 Ga0105250_100331842 295
616 3300009094 Ga0111539_10000857 Ga0111539_100008575 295
617 3300009094 Ga0111539_10605933 Ga0111539_106059331 295
618 3300009147 Ga0114129_10037407 Ga0114129_100374075 295
619 3300009147 Ga0114129_10886160 Ga0114129_108861602 295
620 3300009148 Ga0105243_10024955 Ga0105243_100249554 295
621 3300009148 Ga0105243_10113683 Ga0105243_101136832 295
622 3300009176 Ga0105242_10000440 Ga0105242_1000044014 295
623 3300009545 Ga0105237_10006053 Ga0105237_1000605311 295
624 3300009765 Ga0123341_1000003 Ga0123341_1000003140 295
625 3300009766 Ga0123342_1008736 Ga0123342_100873610 295
626 3300009766 Ga0123342_1039304 Ga0123342_10393042 295
627 3300011119 Ga0105246_10000194 Ga0105246_1000019412 295
628 3300011119 Ga0105246_10003325 Ga0105246_1000332510 295
629 3300013100 Ga0157373_10020543 Ga0157373_100205435 295
630 3300013102 Ga0157371_10000948 Ga0157371_1000094813 295
631 3300013105 Ga0157369_10017826 Ga0157369_100178268 295
632 3300013105 Ga0157369_10091512 Ga0157369_100915122 295
633 3300013308 Ga0157375_10025179 Ga0157375_100251791 295
634 3300013308 Ga0157375_10385648 Ga0157375_103856482 295
635 3300014497 Ga0182008_10007784 Ga0182008_100077846 295
636 3300015261 Ga0182006_1001262 Ga0182006_100126210 295
637 3300015262 Ga0182007_10006537 Ga0182007_100065371 295
638 3300017792 Ga0163161_10165629 Ga0163161_101656292 295
639 3300017792 Ga0163161_10244627 Ga0163161_102446272 295
640 3300025208 Ga0209436_100004 Ga0209436_10000479 295
641 3300025224 Ga0209784_100138 Ga0209784_10013854 295
642 3300025225 Ga0209566_100179 Ga0209566_10017954 295
643 3300025226 Ga0209674_100186 Ga0209674_10018654 295
644 3300025229 Ga0209147_100195 Ga0209147_10019554 295
645 3300025230 Ga0209563_100148 Ga0209563_10014854 295
646 3300025233 Ga0209437_100131 Ga0209437_10013153 295
647 3300025242 Ga0209258_100339 Ga0209258_10033954 295
648 3300025245 Ga0207425_1000018 Ga0207425_100001896 295
649 3300025245 Ga0207425_1001189 Ga0207425_10011897 295
650 3300025245 Ga0207425_1009736 Ga0207425_10097361 295
651 3300025246 Ga0209646_1000516 Ga0209646_10005165 295
652 3300025253 Ga0209677_100137 Ga0209677_10013754 295
653 3300025253 Ga0209677_102216 Ga0209677_1022163 295
654 3300025256 Ga0209759_1007623 Ga0209759_10076233 295
655 3300025258 Ga0209129_1000026 Ga0209129_1000026233 295
656 3300025258 Ga0209129_1001031 Ga0209129_10010312 295
657 3300025261 Ga0209233_1000132 Ga0209233_100013272 295
658 3300025261 Ga0209233_1000162 Ga0209233_1000162103 295
659 3300025272 Ga0209455_1010914 Ga0209455_10109142 295
660 3300025273 Ga0209673_1000182 Ga0209673_1000182107 295
661 3300025273 Ga0209673_1002211 Ga0209673_10022114 295
662 3300025273 Ga0209673_1003064 Ga0209673_10030644 295
663 3300025273 Ga0209673_1007133 Ga0209673_10071334 295
664 3300025284 Ga0209130_1000001 Ga0209130_1000001345 295
665 3300025284 Ga0209130_1000300 Ga0209130_10003009 295
666 3300025284 Ga0209130_1014902 Ga0209130_10149022 295
667 3300025291 Ga0209675_1013505 Ga0209675_10135052 295
668 3300025292 Ga0209676_1002489 Ga0209676_10024898 295
669 3300025292 Ga0209676_1044808 Ga0209676_10448081 295
670 3300025294 Ga0209025_1000035 Ga0209025_1000035233 295
671 3300025294 Ga0209025_1000082 Ga0209025_1000082232 295
672 3300025294 Ga0209025_1000084 Ga0209025_100008476 295
673 3300025294 Ga0209025_1003836 Ga0209025_10038366 295
674 3300025294 Ga0209025_1016317 Ga0209025_10163174 295
675 3300025295 Ga0209564_1001848 Ga0209564_10018485 295
676 3300025297 Ga0209758_1000040 Ga0209758_1000040233 295
677 3300025297 Ga0209758_1000543 Ga0209758_100054326 295
678 3300025297 Ga0209758_1001081 Ga0209758_100108116 295
679 3300025297 Ga0209758_1001082 Ga0209758_100108220 295
680 3300025297 Ga0209758_1005768 Ga0209758_10057685 295
681 3300025297 Ga0209758_1006633 Ga0209758_10066335 295
682 3300025297 Ga0209758_1016173 Ga0209758_10161732 295
683 3300025297 Ga0209758_1048406 Ga0209758_10484062 295
684 3300025298 Ga0209050_1000287 Ga0209050_100028745 295
685 3300025299 Ga0209256_1001307 Ga0209256_100130715 295
686 3300025299 Ga0209256_1002707 Ga0209256_10027077 295
687 3300025299 Ga0209256_1009033 Ga0209256_10090332 295
688 3300025299 Ga0209256_1010314 Ga0209256_10103144 295
689 3300025302 Ga0207426_1000005 Ga0207426_1000005950 295
690 3300025302 Ga0207426_1000035 Ga0207426_10000359 295
691 3300025302 Ga0207426_1000311 Ga0207426_100031184 295
692 3300025303 Ga0209051_1000070 Ga0209051_100007031 295
693 3300025303 Ga0209051_1000199 Ga0209051_100019945 295
694 3300025303 Ga0209051_1001994 Ga0209051_100199412 295
695 3300025303 Ga0209051_1009545 Ga0209051_10095453 295
696 3300025304 Ga0209257_1003511 Ga0209257_10035116 295
697 3300025304 Ga0209257_1006081 Ga0209257_10060815 295
698 3300025304 Ga0209257_1023979 Ga0209257_10239791 295
699 3300025321 Ga0207656_10000034 Ga0207656_1000003433 295
700 3300025711 Ga0207696_1000063 Ga0207696_100006318 295
701 3300025728 Ga0207655_1000006 Ga0207655_100000669 295
702 3300025728 Ga0207655_1001435 Ga0207655_100143516 295
703 3300025728 Ga0207655_1003383 Ga0207655_100338311 295
704 3300025735 Ga0207713_1000872 Ga0207713_100087223 295
705 3300025735 Ga0207713_1002294 Ga0207713_100229412 295
706 3300025735 Ga0207713_1019275 Ga0207713_10192753 295
707 3300025913 Ga0207695_10000187 Ga0207695_1000018716 295
708 3300025914 Ga0207671_10000079 Ga0207671_1000007971 295
709 3300025914 Ga0207671_10000784 Ga0207671_1000078436 295
710 3300025920 Ga0207649_10000002 Ga0207649_1000000259 295
711 3300025923 Ga0207681_10002018 Ga0207681_100020182 295
712 3300025923 Ga0207681_10006063 Ga0207681_100060636 295
713 3300025923 Ga0207681_10068387 Ga0207681_100683873 295
714 3300025925 Ga0207650_10000154 Ga0207650_1000015482 295
715 3300025925 Ga0207650_10000684 Ga0207650_1000068418 295
716 3300025925 Ga0207650_10007516 Ga0207650_100075168 295
717 3300025933 Ga0207706_10001646 Ga0207706_1000164622 295
718 3300025934 Ga0207686_10009678 Ga0207686_100096784 295
719 3300025935 Ga0207709_10067715 Ga0207709_100677153 295
720 3300025935 Ga0207709_10122294 Ga0207709_101222943 295
721 3300025938 Ga0207704_10176369 Ga0207704_101763692 295
722 3300025945 Ga0207679_10000006 Ga0207679_10000006432 295
723 3300025945 Ga0207679_10202605 Ga0207679_102026052 295
724 3300025981 Ga0207640_10034496 Ga0207640_100344964 295
725 3300025981 Ga0207640_10043175 Ga0207640_100431752 295
726 3300026041 Ga0207639_10088029 Ga0207639_100880293 295
727 3300026041 Ga0207639_10490792 Ga0207639_104907922 295
728 3300026067 Ga0207678_10214030 Ga0207678_102140302 295
729 3300026078 Ga0207702_10373845 Ga0207702_103738451 295
730 3300026118 Ga0207675_100003793 Ga0207675_1000037937 295
731 3300027111 Ga0209281_1000141 Ga0209281_10001416 295
732 3300027312 Ga0209371_1006037 Ga0209371_10060374 295
733 3300027907 Ga0207428_10000053 Ga0207428_100000535 295
734 3300028380 Ga0268265_10053530 Ga0268265_100535303 295
735 3300028794 Ga0307515_10000029 Ga0307515_1000002957 295
736 3300028794 Ga0307515_10003876 Ga0307515_100038761 295
737 3300028794 Ga0307515_10011732 Ga0307515_1001173214 295
738 3300030500 Ga0268256_1006018 Ga0268256_10060184 295
739 3300030744 Ga0316181_1107564 Ga0316181_11075645 295
740 3300031456 Ga0307513_10000259 Ga0307513_1000025976 295
741 3300031456 Ga0307513_10098659 Ga0307513_100986593 295
742 3300031456 Ga0307513_10190115 Ga0307513_101901151 295
743 3300031548 Ga0307408_100020630 Ga0307408_1000206304 295
744 3300031730 Ga0307516_10314623 Ga0307516_103146232 295
745 3300031731 Ga0307405_10000428 Ga0307405_1000042811 295
746 3300031824 Ga0307413_10024282 Ga0307413_100242823 295
747 3300031852 Ga0307410_10166628 Ga0307410_101666282 295
748 3300031903 Ga0307407_10085576 Ga0307407_100855762 295
749 3300031911 Ga0307412_10001421 Ga0307412_100014214 295
750 3300031995 Ga0307409_100036664 Ga0307409_1000366642 295
751 3300032002 Ga0307416_100105827 Ga0307416_1001058272 295
752 3300032002 Ga0307416_100353257 Ga0307416_1003532572 295
753 3300032002 Ga0307416_100493515 Ga0307416_1004935152 295
754 3300032005 Ga0307411_10055812 Ga0307411_100558123 295
755 3300032126 Ga0307415_100010381 Ga0307415_1000103815 295
756 3300036712 Ga0316584_0366820 Ga0316584_0366820_44_931 295
757 3300037466 Ga0395898_0067790 Ga0395898_0067790_84_977 295
758 3300038443 Ga0395901_0005143 Ga0395901_0005143_5895_6788 295
759 3300041404 Ga0439436_0003510 Ga0439436_0003510_164_1057 295
760 3300041405 Ga0439438_000804 Ga0439438_000804_12511_13398 295
761 3300041407 Ga0439447_006388 Ga0439447_006388_923_1810 295
762 3300041411 Ga0439466_0001830 Ga0439466_0001830_6084_6971 295
763 3300041413 Ga0439465_0004127 Ga0439465_0004127_1100_1990 295
764 3300041413 Ga0439465_0009269 Ga0439465_0009269_488_1378 295
765 3300041413 Ga0439465_0054017 Ga0439465_0054017_332_1222 295
766 3300041458 Ga0451798_0208875 Ga0451798_0208875_197_1087 295
767 3300041491 Ga0451833_1093313 Ga0451833_1093313_1361_2251 295
768 3300041494 Ga0451837_0109501 Ga0451837_0109501_635_1525 295
769 3300041496 Ga0451839_1218978 Ga0451839_1218978_1550_2440 295
770 3300041498 Ga0451841_0040778 Ga0451841_0040778_720_1610 295
771 3300041501 Ga0451845_0462619 Ga0451845_0462619_143_1033 295
772 3300041505 Ga0451849_0485518 Ga0451849_0485518_423_1313 295
773 3300041507 Ga0451851_0421752 Ga0451851_0421752_608_1498 295
774 3300041511 Ga0451855_0219103 Ga0451855_0219103_302_1192 295
775 3300041512 Ga0451853_0251760 Ga0451853_0251760_723_1613 295
776 3300041997 Ga0439431_0005475 Ga0439431_0005475_206_1099 295
777 3300042006 Ga0439432_001792 Ga0439432_001792_5303_6190 295
778 3300042006 Ga0439432_001919 Ga0439432_001919_27_914 295
779 3300042009 Ga0439451_000063 Ga0439451_000063_15496_16383 295
780 3300042010 Ga0439452_010488 Ga0439452_010488_1368_2255 295
781 3300042013 Ga0439456_000020 Ga0439456_000020_38588_39478 295
782 3300042115 Ga0450911_000287 Ga0450911_000287_15639_16526 295
783 3300042121 Ga0450919_000393 Ga0450919_000393_2612_3499 295
784 3300042122 Ga0450920_024532 Ga0450920_024532_241_1134 295
785 3300042138 Ga0450903_000746 Ga0450903_000746_2026_2913 295
786 3300042145 Ga0450906_001439 Ga0450906_001439_803_1690 295
787 3300042146 Ga0450907_016462 Ga0450907_016462_289_1182 295
788 3300042185 Ga0450909_000079 Ga0450909_000079_6458_7345 295
789 3300045051 Ga0451576_0162146 Ga0451576_0162146_1364_2251 295
790 3300046454 Ga0495592_0096392 Ga0495592_0096392_835_1725 295
791 3300046460 Ga0495638_0000120 Ga0495638_0000120_23545_24435 295
792 3300046460 Ga0495638_0011436 Ga0495638_0011436_4229_5119 295
793 3300046474 Ga0495605_0003178 Ga0495605_0003178_8513_9403 295
794 3300046474 Ga0495605_0016357 Ga0495605_0016357_310_1200 295
795 3300046476 Ga0495662_0007062 Ga0495662_0007062_2837_3727 295
796 3300046492 Ga0495585_0093002 Ga0495585_0093002_267_1157 295
797 3300046501 Ga0495607_0000634 Ga0495607_0000634_8355_9242 295
798 3300046501 Ga0495607_0002322 Ga0495607_0002322_7770_8657 295
799 3300046501 Ga0495607_0010393 Ga0495607_0010393_1362_2249 295
800 3300046501 Ga0495607_0054966 Ga0495607_0054966_772_1662 295
801 3300046506 Ga0495583_0001840 Ga0495583_0001840_11897_12784 295
802 3300046506 Ga0495583_0018173 Ga0495583_0018173_2251_3141 295
803 3300046506 Ga0495583_0044699 Ga0495583_0044699_250_1140 295
804 3300046507 Ga0495606_0037706 Ga0495606_0037706_434_1324 295
805 3300046512 Ga0495610_0027856 Ga0495610_0027856_767_1657 295
806 3300046512 Ga0495610_0052968 Ga0495610_0052968_941_1831 295
807 3300046512 Ga0495610_0077361 Ga0495610_0077361_318_1208 295
808 3300046515 Ga0495620_0011472 Ga0495620_0011472_1425_2315 295
809 3300046515 Ga0495620_0023682 Ga0495620_0023682_10_897 295
810 3300046518 Ga0495631_0010208 Ga0495631_0010208_1644_2534 295
811 3300046519 Ga0495632_0003194 Ga0495632_0003194_6318_7208 295
812 3300046519 Ga0495632_0005281 Ga0495632_0005281_6174_7064 295
813 3300046519 Ga0495632_0008220 Ga0495632_0008220_5186_6073 295
814 3300046522 Ga0495643_0009358 Ga0495643_0009358_1016_1906 295
815 3300046522 Ga0495643_0023480 Ga0495643_0023480_468_1358 295
816 3300046530 Ga0495654_0001276 Ga0495654_0001276_11883_12770 295
817 3300046530 Ga0495654_0063147 Ga0495654_0063147_849_1739 295
818 3300046538 Ga0495609_0092087 Ga0495609_0092087_313_1203 295
819 3300046542 Ga0495597_0042162 Ga0495597_0042162_300_1190 295
820 3300046557 Ga0495622_0068275 Ga0495622_0068275_470_1360 295
821 3300046558 Ga0495633_0034232 Ga0495633_0034232_1535_2425 295
822 3300046558 Ga0495633_0052187 Ga0495633_0052187_150_1037 295
823 3300046616 Ga0495668_0006710 Ga0495668_0006710_3018_3908 295
824 3300046616 Ga0495668_0042162 Ga0495668_0042162_1242_2132 295
825 3300046660 Ga0495625_0031212 Ga0495625_0031212_1826_2716 295
826 3300046660 Ga0495625_0036037 Ga0495625_0036037_2538_3428 295
827 3300046660 Ga0495625_0045964 Ga0495625_0045964_1309_2199 295
828 3300046664 Ga0495659_0035533 Ga0495659_0035533_358_1245 295
829 3300046665 Ga0495661_0000926 Ga0495661_0000926_25500_26387 295
830 3300046665 Ga0495661_0002886 Ga0495661_0002886_11033_11920 295
831 3300046691 Ga0495670_0000057 Ga0495670_0000057_41709_42596 295
832 3300046694 Ga0495649_0080699 Ga0495649_0080699_650_1540 295
833 3300046794 Ga0495589_0152434 Ga0495589_0152434_183_1070 295
834 3300046810 Ga0495660_0003453 Ga0495660_0003453_6986_7876 295
835 3300046810 Ga0495660_0118521 Ga0495660_0118521_325_1215 295
836 3300047320 Ga0495672_0075473 Ga0495672_0075473_830_1717 295
837 3300047470 Ga0495681_0029559 Ga0495681_0029559_118_1005 295
838 3300047470 Ga0495681_0054962 Ga0495681_0054962_905_1795 295
839 3300047472 Ga0495686_0009124 Ga0495686_0009124_1441_2331 295
840 3300048909 Ga0496106_0000806 Ga0496106_0000806_3936_4826 295
841 3300048914 Ga0496111_0137484 Ga0496111_0137484_109_999 295
842 3300048919 Ga0496116_0000049 Ga0496116_0000049_219665_220555 295
843 3300048920 Ga0496117_0001805 Ga0496117_0001805_7067_7954 295
844 3300048920 Ga0496117_0026899 Ga0496117_0026899_2711_3601 295
845 3300048920 Ga0496117_0088813 Ga0496117_0088813_54_941 295
846 3300048921 Ga0496118_0222858 Ga0496118_0222858_21_911 295
847 3300048922 Ga0496119_0000147 Ga0496119_0000147_78765_79670 295
848 3300048922 Ga0496119_0071624 Ga0496119_0071624_12_905 295
849 3300048923 Ga0496120_0031039 Ga0496120_0031039_2224_3114 295
850 3300048925 Ga0496122_0000137 Ga0496122_0000137_96548_97438 295
851 3300048925 Ga0496122_0002390 Ga0496122_0002390_5153_6058 295
852 3300048925 Ga0496122_0015666 Ga0496122_0015666_1439_2329 295
853 3300048925 Ga0496122_0022317 Ga0496122_0022317_880_1770 295
854 3300048925 Ga0496122_0034805 Ga0496122_0034805_88_975 295
855 3300048925 Ga0496122_0044250 Ga0496122_0044250_1205_2095 295
856 3300048926 Ga0496123_0000022 Ga0496123_0000022_71102_71992 295
857 3300048926 Ga0496123_0002146 Ga0496123_0002146_20921_21826 295
858 3300048926 Ga0496123_0008160 Ga0496123_0008160_1252_2142 295
859 3300048926 Ga0496123_0012560 Ga0496123_0012560_3155_4042 295
860 3300048926 Ga0496123_0014576 Ga0496123_0014576_4985_5875 295
861 3300048927 Ga0496124_0001807 Ga0496124_0001807_16911_17801 295
862 3300048927 Ga0496124_0003713 Ga0496124_0003713_11717_12604 295
863 3300048927 Ga0496124_0022940 Ga0496124_0022940_2794_3684 295
864 3300048927 Ga0496124_0028250 Ga0496124_0028250_4074_4964 295
865 3300048927 Ga0496124_0037204 Ga0496124_0037204_90_977 295
866 3300048927 Ga0496124_0045105 Ga0496124_0045105_1607_2497 295
867 3300048928 Ga0496125_0000143 Ga0496125_0000143_54582_55484 295
868 3300048928 Ga0496125_0000264 Ga0496125_0000264_77987_78877 295
869 3300048928 Ga0496125_0000774 Ga0496125_0000774_45851_46744 295
870 3300048928 Ga0496125_0001930 Ga0496125_0001930_20399_21286 295
871 3300048928 Ga0496125_0002881 Ga0496125_0002881_16810_17703 295
872 3300048928 Ga0496125_0003847 Ga0496125_0003847_12757_13644 295
873 3300048929 Ga0496126_0000081 Ga0496126_0000081_203274_204164 295
874 3300049570 Ga0501033_0134972 Ga0501033_0134972_577_1467 295
875 3300049574 Ga0501038_0354409 Ga0501038_0354409_53_943 295
876 3300049576 Ga0501040_0061713 Ga0501040_0061713_1215_2105 295
877 3300049577 Ga0501041_0017938 Ga0501041_0017938_2118_3008 295
878 3300049578 Ga0501042_0043739 Ga0501042_0043739_2270_3160 295
879 3300049582 Ga0501048_0092922 Ga0501048_0092922_860_1750 295
880 3300049584 Ga0501068_0069138 Ga0501068_0069138_1173_2063 295
881 3300049586 Ga0501070_0278098 Ga0501070_0278098_257_1150 295
882 3300049590 Ga0501074_0192238 Ga0501074_0192238_209_1099 295
883 3300049591 Ga0501075_0011676 Ga0501075_0011676_232_1122 295
884 3300049592 Ga0501076_0068859 Ga0501076_0068859_1450_2340 295
885 3300049741 Ga0501079_0003288 Ga0501079_0003288_7602_8492 295
886 3300049743 Ga0501081_0004940 Ga0501081_0004940_5901_6791 295
887 3300049744 Ga0501083_0103059 Ga0501083_0103059_521_1411 295
888 3300050489 nmdc:mga03683_4451_c1 nmdc:mga03683_4451_c1_1520_2410 295
889 3300050490 nmdc:mga03n38_5211_c1 nmdc:mga03n38_5211_c1_2007_2897 295
890 3300050492 nmdc:mga0yw44_18736_c1 nmdc:mga0yw44_18736_c1_1393_2283 295
891 3300050492 nmdc:mga0yw44_26771_c1 nmdc:mga0yw44_26771_c1_1189_2079 295
892 3300050493 nmdc:mga0k408_9994_c1 nmdc:mga0k408_9994_c1_1294_2184 295
893 3300050494 nmdc:mga06z11_8982_c1 nmdc:mga06z11_8982_c1_1003_1893 295
894 3300050496 nmdc:mga07m45_24765_c1 nmdc:mga07m45_24765_c1_690_1580 295
895 3300050496 nmdc:mga07m45_8115_c1 nmdc:mga07m45_8115_c1_1653_2543 295
896 3300050496 nmdc:mga07m45_84774_c1 nmdc:mga07m45_84774_c1_76_966 295
897 3300050507 nmdc:mga05p37_61681_c1 nmdc:mga05p37_61681_c1_1908_2795 295
898 3300050510 nmdc:mga06r32_33183_c1 nmdc:mga06r32_33183_c1_1083_1970 295
899 3300050511 nmdc:mga08y16_292253_c1 nmdc:mga08y16_292253_c1_210_1097 295
900 3300050511 nmdc:mga08y16_395_c1 nmdc:mga08y16_395_c1_34112_34999 295
901 3300050516 nmdc:mga0sz30_4360_c1 nmdc:mga0sz30_4360_c1_1380_2270 295
902 3300053079 Ga0500610_0043546 Ga0500610_0043546_891_1781 295
903 3300053086 Ga0500578_0056889 Ga0500578_0056889_897_1787 295
904 3300053104 Ga0500556_0000065 Ga0500556_0000065_71064_71969 295
905 3300053118 Ga0500594_0011673 Ga0500594_0011673_737_1627 295
906 3300053125 Ga0500618_003428 Ga0500618_003428_2764_3654 295
907 3300053125 Ga0500618_003947 Ga0500618_003947_2297_3187 295
908 3300053134 Ga0500658_0000607 Ga0500658_0000607_9785_10675 295
909 3300053136 Ga0500559_0004585 Ga0500559_0004585_2871_3761 295
910 3300053139 Ga0500568_0000004 Ga0500568_0000004_359915_360802 295
911 3300053139 Ga0500568_0000070 Ga0500568_0000070_32439_33329 295
912 3300053139 Ga0500568_0000101 Ga0500568_0000101_3824_4714 295
913 3300053139 Ga0500568_0028278 Ga0500568_0028278_613_1506 295
914 3300053153 Ga0500616_0000473 Ga0500616_0000473_23627_24517 295
915 3300053153 Ga0500616_0013319 Ga0500616_0013319_110_997 295
916 3300053153 Ga0500616_0099542 Ga0500616_0099542_274_1179 295
917 3300053730 Ga0500645_002411 Ga0500645_002411_5763_6668 295
918 3300054114 Ga0501084_0016794 Ga0501084_0016794_4108_4998 295
919 3300060353 Ga0501082_0009434 Ga0501082_0009434_109_999 295
920 3300061734 Ga0530510_0144507 Ga0530510_0144507_581_1471 295
921 2162886007 SwRhRL2b_contig_3754702 SwRhRL2b_0100.00007490 296
922 3300002773 JGI25152J39213_1000087 JGI25152J39213_100008743 296
923 3300002774 JGI25150J39212_1000017 JGI25150J39212_10000177 296
924 3300002774 JGI25150J39212_1000093 JGI25150J39212_100009330 296
925 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007240 296
926 3300003215 JGI25153J46596_10006139 JGI25153J46596_100061391 296
927 3300005937 Ga0081455_10279752 Ga0081455_102797522 296
928 3300009036 Ga0105244_10039061 Ga0105244_100390612 296
929 3300009093 Ga0105240_10000097 Ga0105240_1000009715 296
930 3300009545 Ga0105237_10005732 Ga0105237_100057327 296
931 3300010375 Ga0105239_10006934 Ga0105239_1000693413 296
932 3300013104 Ga0157370_10073945 Ga0157370_100739453 296
933 3300015262 Ga0182007_10001007 Ga0182007_1000100714 296
934 3300015265 Ga0182005_1013218 Ga0182005_10132183 296
935 3300025986 Ga0207658_10115183 Ga0207658_101151833 296
936 3300037471 Ga0395905_0034039 Ga0395905_0034039_1305_2210 296
937 3300039062 Ga0400483_140709 Ga0400483_140709_6810_7766 296
938 3300039062 Ga0400483_274668 Ga0400483_274668_1855_2811 296
939 3300046452 Ga0495617_000126 Ga0495617_000126_4886_5845 296
940 3300046457 Ga0495590_0000259 Ga0495590_0000259_1642_2601 296
941 3300046471 Ga0495650_0001726 Ga0495650_0001726_2165_3124 296
942 3300046474 Ga0495605_0002084 Ga0495605_0002084_4750_5709 296
943 3300046491 Ga0495584_0000541 Ga0495584_0000541_5008_5913 296
944 3300046501 Ga0495607_0000344 Ga0495607_0000344_4964_5923 296
945 3300046506 Ga0495583_0020427 Ga0495583_0020427_1141_2100 296
946 3300046513 Ga0495616_0001672 Ga0495616_0001672_9453_10412 296
947 3300046519 Ga0495632_0000698 Ga0495632_0000698_24588_25493 296
948 3300046520 Ga0495637_0011398 Ga0495637_0011398_1873_2778 296
949 3300046522 Ga0495643_0004466 Ga0495643_0004466_2219_3178 296
950 3300046524 Ga0495648_0030724 Ga0495648_0030724_605_1564 296
951 3300046528 Ga0495642_0000247 Ga0495642_0000247_5022_5927 296
952 3300046530 Ga0495654_0006494 Ga0495654_0006494_5035_5994 296
953 3300046538 Ga0495609_0002286 Ga0495609_0002286_5057_5962 296
954 3300046648 Ga0495611_0003176 Ga0495611_0003176_4758_5717 296
955 3300046694 Ga0495649_0000153 Ga0495649_0000153_5061_5966 296
956 3300046794 Ga0495589_0000057 Ga0495589_0000057_4970_5929 296
957 3300047318 Ga0495636_0001971 Ga0495636_0001971_3180_4139 296
958 3300047320 Ga0495672_0001002 Ga0495672_0001002_4974_5933 296
959 3300047443 Ga0495687_000432 Ga0495687_000432_5045_6004 296
960 3300047447 Ga0495685_002554 Ga0495685_002554_3487_4446 296
961 3300047469 Ga0495673_0010554 Ga0495673_0010554_3651_4610 296
962 3300048091 Ga0495626_0000626 Ga0495626_0000626_4956_5861 296
963 3300048904 Ga0496101_0010159 Ga0496101_0010159_1558_2481 296
964 3300048908 Ga0496105_0153805 Ga0496105_0153805_661_1584 296
965 3300048919 Ga0496116_0006317 Ga0496116_0006317_2424_3347 296
966 3300048924 Ga0496121_0097525 Ga0496121_0097525_793_1716 296
967 3300048926 Ga0496123_0043877 Ga0496123_0043877_1401_2324 296
968 3300048927 Ga0496124_0060309 Ga0496124_0060309_842_1765 296
969 3300048928 Ga0496125_0030421 Ga0496125_0030421_3475_4398 296
970 3300049459 Ga0495678_000585 Ga0495678_000585_28593_29498 296
971 3300050491 nmdc:mga00v17_189067_c1 nmdc:mga00v17_189067_c1_197_1120 296
972 iso_pu_bacteria 2970524798 2970527934 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

32

268

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

30

269

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

274

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9579 8 294
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.9544 10 294
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.9537 10 294
7a6g-assembly1.cif.gz_A structural characterization of l-proline amide hydrolase from pseudomonas syringae 0.9512 10 293
1mtz-assembly1.cif.gz_A crystal structure of the tricorn interacting factor f1 0.9459 10 294
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9649 16 294 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9591 8 293 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9582 16 294 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9544 10 294 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9353 10 294 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A519SZ51-F1-model_v4 Alpha/beta fold hydrolase 0.9638 21 291 GO:0006508
GO:0008233
GO:0016020
AF-Q5H3E8-F1-model_v4 Proline imino-peptidase 0.9635 10 291 GO:0006508
GO:0008233
AF-A0A2S8MC16-F1-model_v4 deleted 0.9633 65 294
AF-A0A7Y0B0M8-F1-model_v4 Proline iminopeptidase-family hydrolase 0.9606 10 294 GO:0006508
GO:0008233
AF-A0A536IBX7-F1-model_v4 Alpha/beta fold hydrolase 0.9593 10 295 GO:0004177
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
96.93 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map