F487054
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 968 | 326 | 1936 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0065388|Ga0501070_0065388_1860_2579 |
| Length | 228 |
| Sequence | MKVAVLGGTGSFGRALAARLAARGEDDVVIGSRDAARAQETARALGGGRVTXAANADAVRGADLAVLAVKAEGALDTARDVAAALGDTPLLSVASAIRFEKGTGMLPDPEALSLAERIQQVVGAPVAAGLHSIAAANLEEEQPDEDALVCGDDARAKELALELAGKLVGGRALDAGPLASARALEGLTAVIVNLNRRYKAHAGIRVTGVGSTEPAKSDAAGSPVETGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 202 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 203 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 206 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 1.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.92 |
| Rhizosphere | 89.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501070_0065388 | 3300049586 | Bacteria | 3011 |
| 2 | ARcpr5yngRDRAFT_c005838 | 3300000043 | Bacteria | 1126 |
| 3 | rootH1_10124033 | 3300003323 | Bacteria | 1689 |
| 4 | Ga0070658_10009263 | 3300005327 | Bacteria | 7917 |
| 5 | Ga0070658_10014198 | 3300005327 | Bacteria | 6394 |
| 6 | Ga0070658_10022247 | 3300005327 | Bacteria | 5087 |
| 7 | Ga0070676_10243061 | 3300005328 | Unclassified | 1198 |
| 8 | Ga0070676_10427949 | 3300005328 | Unclassified | 926 |
| 9 | Ga0070683_100061658 | 3300005329 | Bacteria | 3487 |
| 10 | Ga0070683_100113019 | 3300005329 | Bacteria | 2563 |
| 11 | Ga0070683_100148962 | 3300005329 | Bacteria | 2218 |
| 12 | Ga0070683_100154437 | 3300005329 | Bacteria | 2177 |
| 13 | Ga0070683_100259323 | 3300005329 | Unclassified | 1653 |
| 14 | Ga0070683_100402860 | 3300005329 | Bacteria | 1305 |
| 15 | Ga0070683_100488292 | 3300005329 | Bacteria | 1176 |
| 16 | Ga0070683_100508080 | 3300005329 | Bacteria | 1151 |
| 17 | Ga0070683_100700450 | 3300005329 | Bacteria | 970 |
| 18 | Ga0070670_100040987 | 3300005331 | Bacteria | 3980 |
| 19 | Ga0070670_100294906 | 3300005331 | Bacteria | 1418 |
| 20 | Ga0068869_100087340 | 3300005334 | Bacteria | 2339 |
| 21 | Ga0068869_100301274 | 3300005334 | Unclassified | 1294 |
| 22 | Ga0070680_100026798 | 3300005336 | Bacteria | 4610 |
| 23 | Ga0070680_100039300 | 3300005336 | Bacteria | 3829 |
| 24 | Ga0070680_100069087 | 3300005336 | Bacteria | 2901 |
| 25 | Ga0070680_100069416 | 3300005336 | Bacteria | 2893 |
| 26 | Ga0070680_100085864 | 3300005336 | Bacteria | 2601 |
| 27 | Ga0070680_100092401 | 3300005336 | Unclassified | 2506 |
| 28 | Ga0070680_100110737 | 3300005336 | Bacteria | 2286 |
| 29 | Ga0070680_100114340 | 3300005336 | Bacteria | 2248 |
| 30 | Ga0070680_100946967 | 3300005336 | Bacteria | 743 |
| 31 | Ga0070682_100005200 | 3300005337 | Bacteria | 7239 |
| 32 | Ga0070682_100086087 | 3300005337 | Bacteria | 2046 |
| 33 | Ga0070682_100370342 | 3300005337 | Unclassified | 1074 |
| 34 | Ga0068868_100216392 | 3300005338 | Bacteria | 1603 |
| 35 | Ga0068868_100380835 | 3300005338 | Bacteria | 1214 |
| 36 | Ga0070660_100000141 | 3300005339 | Bacteria | 46136 |
| 37 | Ga0070660_100024992 | 3300005339 | Bacteria | 4436 |
| 38 | Ga0070660_100045142 | 3300005339 | Bacteria | 3372 |
| 39 | Ga0070660_100075437 | 3300005339 | Bacteria | 2640 |
| 40 | Ga0070660_100269799 | 3300005339 | Bacteria | 1391 |
| 41 | Ga0070660_100413957 | 3300005339 | Bacteria | 1116 |
| 42 | Ga0070689_100137943 | 3300005340 | Bacteria | 1959 |
| 43 | Ga0070691_10116554 | 3300005341 | Unclassified | 1341 |
| 44 | Ga0070687_100393854 | 3300005343 | Bacteria | 906 |
| 45 | Ga0070661_100076595 | 3300005344 | Bacteria | 2465 |
| 46 | Ga0070661_100085519 | 3300005344 | Bacteria | 2331 |
| 47 | Ga0070661_100106742 | 3300005344 | Bacteria | 2088 |
| 48 | Ga0070661_100256049 | 3300005344 | Bacteria | 1352 |
| 49 | Ga0070692_10108630 | 3300005345 | Bacteria | 1531 |
| 50 | Ga0070692_10119508 | 3300005345 | Bacteria | 1468 |
| 51 | Ga0070692_10168488 | 3300005345 | Bacteria | 1261 |
| 52 | Ga0070675_100037133 | 3300005354 | Bacteria | 3967 |
| 53 | Ga0070675_100457647 | 3300005354 | Bacteria | 1145 |
| 54 | Ga0070675_100546551 | 3300005354 | Unclassified | 1047 |
| 55 | Ga0070671_100099125 | 3300005355 | Bacteria | 2444 |
| 56 | Ga0070671_100156104 | 3300005355 | Bacteria | 1928 |
| 57 | Ga0070671_100268051 | 3300005355 | Bacteria | 1451 |
| 58 | Ga0070674_100004376 | 3300005356 | Bacteria | 8049 |
| 59 | Ga0070674_100112366 | 3300005356 | Bacteria | 2002 |
| 60 | Ga0070674_100297083 | 3300005356 | Bacteria | 1286 |
| 61 | Ga0070673_100004322 | 3300005364 | Bacteria | 8972 |
| 62 | Ga0070688_100039891 | 3300005365 | Bacteria | 2875 |
| 63 | Ga0070659_100045334 | 3300005366 | Bacteria | 3444 |
| 64 | Ga0070659_100107364 | 3300005366 | Bacteria | 2251 |
| 65 | Ga0070659_100337007 | 3300005366 | Archaea | 1263 |
| 66 | Ga0070659_100479249 | 3300005366 | Unclassified | 1058 |
| 67 | Ga0070659_100819718 | 3300005366 | Bacteria | 810 |
| 68 | Ga0070659_100884775 | 3300005366 | Bacteria | 780 |
| 69 | Ga0070667_100039410 | 3300005367 | Bacteria | 3960 |
| 70 | Ga0070709_10631885 | 3300005434 | Bacteria | 827 |
| 71 | Ga0070714_100013238 | 3300005435 | Bacteria | 6604 |
| 72 | Ga0070714_100161027 | 3300005435 | Unclassified | 2030 |
| 73 | Ga0070714_100373210 | 3300005435 | Bacteria | 1343 |
| 74 | Ga0070714_100385862 | 3300005435 | Bacteria | 1321 |
| 75 | Ga0070714_100958465 | 3300005435 | Bacteria | 832 |
| 76 | Ga0070713_100008136 | 3300005436 | Bacteria | 7422 |
| 77 | Ga0070713_100627023 | 3300005436 | Bacteria | 1023 |
| 78 | Ga0070710_10005073 | 3300005437 | Bacteria | 6234 |
| 79 | Ga0070701_10210323 | 3300005438 | Bacteria | 1155 |
| 80 | Ga0070711_100008772 | 3300005439 | Bacteria | 6204 |
| 81 | Ga0070711_100166806 | 3300005439 | Bacteria | 1675 |
| 82 | Ga0070711_100196315 | 3300005439 | Bacteria | 1554 |
| 83 | Ga0070705_100044011 | 3300005440 | Bacteria | 2562 |
| 84 | Ga0070705_100091886 | 3300005440 | Bacteria | 1893 |
| 85 | Ga0070700_100540348 | 3300005441 | Bacteria | 904 |
| 86 | Ga0070708_100020278 | 3300005445 | Bacteria | 5604 |
| 87 | Ga0070708_100035433 | 3300005445 | Bacteria | 4348 |
| 88 | Ga0070708_100287778 | 3300005445 | Bacteria | 1547 |
| 89 | Ga0070708_100428461 | 3300005445 | Bacteria | 1248 |
| 90 | Ga0070708_100490479 | 3300005445 | Unclassified | 1159 |
| 91 | Ga0070678_100004460 | 3300005456 | Bacteria | 7941 |
| 92 | Ga0070678_100407951 | 3300005456 | Bacteria | 1182 |
| 93 | Ga0070662_100333096 | 3300005457 | Bacteria | 1240 |
| 94 | Ga0070681_10010143 | 3300005458 | Bacteria | 9289 |
| 95 | Ga0070681_10011312 | 3300005458 | Bacteria | 8830 |
| 96 | Ga0070681_10016995 | 3300005458 | Bacteria | 7270 |
| 97 | Ga0070681_10019208 | 3300005458 | Bacteria | 6840 |
| 98 | Ga0070681_10019616 | 3300005458 | Bacteria | 6771 |
| 99 | Ga0070681_10038511 | 3300005458 | Bacteria | 4794 |
| 100 | Ga0070681_10041634 | 3300005458 | Bacteria | 4604 |
| 101 | Ga0070681_10103926 | 3300005458 | Bacteria | 2784 |
| 102 | Ga0070681_10239825 | 3300005458 | Bacteria | 1727 |
| 103 | Ga0070681_10403916 | 3300005458 | Unclassified | 1278 |
| 104 | Ga0070681_10663927 | 3300005458 | Bacteria | 958 |
| 105 | Ga0068867_100129312 | 3300005459 | Archaea | 1961 |
| 106 | Ga0068867_100408513 | 3300005459 | Bacteria | 1147 |
| 107 | Ga0068867_100731562 | 3300005459 | Bacteria | 876 |
| 108 | Ga0070685_10009042 | 3300005466 | Bacteria | 5138 |
| 109 | Ga0070706_100324394 | 3300005467 | Bacteria | 1436 |
| 110 | Ga0070706_100626554 | 3300005467 | Bacteria | 999 |
| 111 | Ga0070706_100738479 | 3300005467 | Unclassified | 912 |
| 112 | Ga0070707_100127301 | 3300005468 | Bacteria | 2475 |
| 113 | Ga0070707_100139317 | 3300005468 | Bacteria | 2361 |
| 114 | Ga0070698_100021664 | 3300005471 | Bacteria | 6728 |
| 115 | Ga0070698_100095683 | 3300005471 | Bacteria | 2947 |
| 116 | Ga0070698_100161352 | 3300005471 | Bacteria | 2185 |
| 117 | Ga0070699_100053597 | 3300005518 | Bacteria | 3491 |
| 118 | Ga0070699_100067511 | 3300005518 | Bacteria | 3106 |
| 119 | Ga0070679_100004270 | 3300005530 | Bacteria | 13182 |
| 120 | Ga0070679_100006992 | 3300005530 | Bacteria | 10533 |
| 121 | Ga0070679_100010498 | 3300005530 | Bacteria | 8786 |
| 122 | Ga0070679_100091994 | 3300005530 | Bacteria | 3021 |
| 123 | Ga0070679_100099303 | 3300005530 | Bacteria | 2898 |
| 124 | Ga0070679_100132438 | 3300005530 | Bacteria | 2474 |
| 125 | Ga0070679_100206936 | 3300005530 | Bacteria | 1926 |
| 126 | Ga0070679_100217198 | 3300005530 | Bacteria | 1874 |
| 127 | Ga0070679_100253219 | 3300005530 | Bacteria | 1717 |
| 128 | Ga0070679_100254554 | 3300005530 | Bacteria | 1711 |
| 129 | Ga0070684_100024170 | 3300005535 | Bacteria | 5094 |
| 130 | Ga0070684_100041329 | 3300005535 | Bacteria | 3974 |
| 131 | Ga0070684_100099385 | 3300005535 | Bacteria | 2597 |
| 132 | Ga0070684_100142643 | 3300005535 | Bacteria | 2167 |
| 133 | Ga0070684_100161435 | 3300005535 | Bacteria | 2033 |
| 134 | Ga0070684_100415848 | 3300005535 | Bacteria | 1241 |
| 135 | Ga0070684_100512999 | 3300005535 | Unclassified | 1111 |
| 136 | Ga0070684_100602490 | 3300005535 | Bacteria | 1021 |
| 137 | Ga0070697_100319665 | 3300005536 | Bacteria | 1336 |
| 138 | Ga0068853_100164163 | 3300005539 | Bacteria | 2006 |
| 139 | Ga0068853_100266946 | 3300005539 | Bacteria | 1575 |
| 140 | Ga0070672_100407910 | 3300005543 | Unclassified | 1165 |
| 141 | Ga0070696_100209381 | 3300005546 | Bacteria | 1459 |
| 142 | Ga0070696_100242834 | 3300005546 | Bacteria | 1359 |
| 143 | Ga0070696_100262286 | 3300005546 | Bacteria | 1310 |
| 144 | Ga0070693_100225249 | 3300005547 | Bacteria | 1231 |
| 145 | Ga0070693_100343185 | 3300005547 | Bacteria | 1020 |
| 146 | Ga0070665_100127287 | 3300005548 | Bacteria | 2549 |
| 147 | Ga0070665_100292857 | 3300005548 | Bacteria | 1630 |
| 148 | Ga0070665_100306623 | 3300005548 | Archaea | 1591 |
| 149 | Ga0070704_100520669 | 3300005549 | Unclassified | 1035 |
| 150 | Ga0070704_100548511 | 3300005549 | Bacteria | 1010 |
| 151 | Ga0070704_100586817 | 3300005549 | Unclassified | 978 |
| 152 | Ga0070704_100889435 | 3300005549 | Unclassified | 800 |
| 153 | Ga0068855_100013855 | 3300005563 | Bacteria | 9721 |
| 154 | Ga0068855_100036700 | 3300005563 | Bacteria | 5831 |
| 155 | Ga0068855_100068208 | 3300005563 | Bacteria | 4141 |
| 156 | Ga0068855_100461178 | 3300005563 | Bacteria | 1385 |
| 157 | Ga0068855_100543685 | 3300005563 | Bacteria | 1258 |
| 158 | Ga0068855_100778154 | 3300005563 | Bacteria | 1018 |
| 159 | Ga0070664_100364114 | 3300005564 | Bacteria | 1317 |
| 160 | Ga0068857_100010455 | 3300005577 | Bacteria | 8065 |
| 161 | Ga0068857_100065971 | 3300005577 | Bacteria | 3220 |
| 162 | Ga0068857_100091854 | 3300005577 | Bacteria | 2717 |
| 163 | Ga0068857_100092415 | 3300005577 | Bacteria | 2709 |
| 164 | Ga0068854_100400282 | 3300005578 | Bacteria | 1136 |
| 165 | Ga0068856_100060773 | 3300005614 | Bacteria | 3733 |
| 166 | Ga0068856_100439530 | 3300005614 | Bacteria | 1325 |
| 167 | Ga0068856_100610528 | 3300005614 | Bacteria | 1112 |
| 168 | Ga0070702_100142474 | 3300005615 | Bacteria | 1528 |
| 169 | Ga0070702_100652543 | 3300005615 | Bacteria | 796 |
| 170 | Ga0068852_100035592 | 3300005616 | Bacteria | 4155 |
| 171 | Ga0068852_100304103 | 3300005616 | Bacteria | 1545 |
| 172 | Ga0068852_100306213 | 3300005616 | Bacteria | 1539 |
| 173 | Ga0068852_100558882 | 3300005616 | Unclassified | 1145 |
| 174 | Ga0068859_100068053 | 3300005617 | Bacteria | 3596 |
| 175 | Ga0068864_100005593 | 3300005618 | Bacteria | 10305 |
| 176 | Ga0068866_10006435 | 3300005718 | Unclassified | 4892 |
| 177 | Ga0068870_10026164 | 3300005840 | Bacteria | 2906 |
| 178 | Ga0068870_10035405 | 3300005840 | Bacteria | 2561 |
| 179 | Ga0068870_10038120 | 3300005840 | Bacteria | 2480 |
| 180 | Ga0068862_100355516 | 3300005844 | Bacteria | 1360 |
| 181 | Ga0081455_10054633 | 3300005937 | Bacteria | 3402 |
| 182 | Ga0081455_10054685 | 3300005937 | Bacteria | 3401 |
| 183 | Ga0081540_1064907 | 3300005983 | Bacteria | 1720 |
| 184 | Ga0070717_10060585 | 3300006028 | Bacteria | 3134 |
| 185 | Ga0070717_10280969 | 3300006028 | Bacteria | 1476 |
| 186 | Ga0070717_10304560 | 3300006028 | Bacteria | 1417 |
| 187 | Ga0070717_10321332 | 3300006028 | Bacteria | 1379 |
| 188 | Ga0070717_10487805 | 3300006028 | Bacteria | 1113 |
| 189 | Ga0070717_10620105 | 3300006028 | Bacteria | 981 |
| 190 | Ga0070715_10002136 | 3300006163 | Bacteria | 5982 |
| 191 | Ga0070715_10048819 | 3300006163 | Bacteria | 1811 |
| 192 | Ga0070716_100436485 | 3300006173 | Bacteria | 951 |
| 193 | Ga0070716_100708186 | 3300006173 | Unclassified | 770 |
| 194 | Ga0070712_100049442 | 3300006175 | Bacteria | 2920 |
| 195 | Ga0070712_100154288 | 3300006175 | Bacteria | 1766 |
| 196 | Ga0070712_100255454 | 3300006175 | Bacteria | 1402 |
| 197 | Ga0070712_100523522 | 3300006175 | Bacteria | 996 |
| 198 | Ga0097621_100774682 | 3300006237 | Unclassified | 887 |
| 199 | Ga0068871_100596811 | 3300006358 | Unclassified | 1004 |
| 200 | Ga0075428_100332071 | 3300006844 | Bacteria | 1633 |
| 201 | Ga0075428_100997892 | 3300006844 | Unclassified | 886 |
| 202 | Ga0075433_10060802 | 3300006852 | Unclassified | 3308 |
| 203 | Ga0075433_10145159 | 3300006852 | Bacteria | 2110 |
| 204 | Ga0075433_10196308 | 3300006852 | Bacteria | 1795 |
| 205 | Ga0075434_100000856 | 3300006871 | Bacteria | 24284 |
| 206 | Ga0075434_100046314 | 3300006871 | Bacteria | 4315 |
| 207 | Ga0075434_100090943 | 3300006871 | Bacteria | 3053 |
| 208 | Ga0075434_100206118 | 3300006871 | Bacteria | 1987 |
| 209 | Ga0075434_100432845 | 3300006871 | Bacteria | 1337 |
| 210 | Ga0068865_100117874 | 3300006881 | Bacteria | 1969 |
| 211 | Ga0068865_100254118 | 3300006881 | Bacteria | 1388 |
| 212 | Ga0068865_100467797 | 3300006881 | Bacteria | 1045 |
| 213 | Ga0075436_100110287 | 3300006914 | Bacteria | 1920 |
| 214 | Ga0097620_100068047 | 3300006931 | Bacteria | 3596 |
| 215 | Ga0075435_100033871 | 3300007076 | Bacteria | 4042 |
| 216 | Ga0075435_100048799 | 3300007076 | Bacteria | 3402 |
| 217 | Ga0075435_100298528 | 3300007076 | Archaea | 1377 |
| 218 | Ga0105250_10206688 | 3300009092 | Unclassified | 829 |
| 219 | Ga0105240_10214101 | 3300009093 | Bacteria | 2249 |
| 220 | Ga0105240_10226762 | 3300009093 | Bacteria | 2174 |
| 221 | Ga0105240_10321672 | 3300009093 | Bacteria | 1763 |
| 222 | Ga0105240_10447591 | 3300009093 | Unclassified | 1446 |
| 223 | Ga0105240_10587907 | 3300009093 | Bacteria | 1227 |
| 224 | Ga0105240_10853715 | 3300009093 | Bacteria | 982 |
| 225 | Ga0111539_10044976 | 3300009094 | Bacteria | 5287 |
| 226 | Ga0111539_10079526 | 3300009094 | Bacteria | 3857 |
| 227 | Ga0111539_10130152 | 3300009094 | Bacteria | 2947 |
| 228 | Ga0111539_10141918 | 3300009094 | Bacteria | 2812 |
| 229 | Ga0111539_10905987 | 3300009094 | Bacteria | 1026 |
| 230 | Ga0105245_10018193 | 3300009098 | Bacteria | 6144 |
| 231 | Ga0105245_10091983 | 3300009098 | Bacteria | 2793 |
| 232 | Ga0105245_10100430 | 3300009098 | Bacteria | 2676 |
| 233 | Ga0105245_10189494 | 3300009098 | Bacteria | 1969 |
| 234 | Ga0105245_10295660 | 3300009098 | Bacteria | 1587 |
| 235 | Ga0105245_10954438 | 3300009098 | Bacteria | 900 |
| 236 | Ga0105245_11038860 | 3300009098 | Unclassified | 864 |
| 237 | Ga0114129_10037661 | 3300009147 | Bacteria | 6827 |
| 238 | Ga0114129_10104085 | 3300009147 | Unclassified | 3923 |
| 239 | Ga0114129_10128810 | 3300009147 | Bacteria | 3478 |
| 240 | Ga0114129_10149913 | 3300009147 | Unclassified | 3192 |
| 241 | Ga0114129_10194214 | 3300009147 | Unclassified | 2754 |
| 242 | Ga0105243_10060594 | 3300009148 | Bacteria | 3023 |
| 243 | Ga0105243_10134530 | 3300009148 | Bacteria | 2102 |
| 244 | Ga0105243_10188686 | 3300009148 | Unclassified | 1799 |
| 245 | Ga0105243_10378785 | 3300009148 | Archaea | 1308 |
| 246 | Ga0105243_10391045 | 3300009148 | Bacteria | 1289 |
| 247 | Ga0105242_10046732 | 3300009176 | Bacteria | 3513 |
| 248 | Ga0105242_10608878 | 3300009176 | Bacteria | 1056 |
| 249 | Ga0105248_10554847 | 3300009177 | Bacteria | 1296 |
| 250 | Ga0105248_10707338 | 3300009177 | Bacteria | 1137 |
| 251 | Ga0105237_10124095 | 3300009545 | Bacteria | 2577 |
| 252 | Ga0105237_10539385 | 3300009545 | Bacteria | 1173 |
| 253 | Ga0105238_10027641 | 3300009551 | Bacteria | 5782 |
| 254 | Ga0105238_10100867 | 3300009551 | Bacteria | 2869 |
| 255 | Ga0105249_11043727 | 3300009553 | Bacteria | 887 |
| 256 | Ga0105239_10067620 | 3300010375 | Bacteria | 3925 |
| 257 | Ga0105239_10697127 | 3300010375 | Unclassified | 1161 |
| 258 | Ga0105246_10162316 | 3300011119 | Bacteria | 1703 |
| 259 | Ga0105246_10204979 | 3300011119 | Archaea | 1536 |
| 260 | Ga0157373_10260045 | 3300013100 | Bacteria | 1228 |
| 261 | Ga0157370_10038941 | 3300013104 | Bacteria | 4598 |
| 262 | Ga0157370_10042293 | 3300013104 | Bacteria | 4392 |
| 263 | Ga0157370_10070379 | 3300013104 | Bacteria | 3302 |
| 264 | Ga0157370_10121797 | 3300013104 | Bacteria | 2435 |
| 265 | Ga0157370_10572336 | 3300013104 | Bacteria | 1035 |
| 266 | Ga0157369_10003174 | 3300013105 | Bacteria | 19621 |
| 267 | Ga0157369_10007800 | 3300013105 | Bacteria | 12319 |
| 268 | Ga0157369_10020636 | 3300013105 | Bacteria | 7367 |
| 269 | Ga0157369_10099309 | 3300013105 | Bacteria | 3103 |
| 270 | Ga0157369_10282203 | 3300013105 | Bacteria | 1730 |
| 271 | Ga0157369_10408043 | 3300013105 | Bacteria | 1409 |
| 272 | Ga0157369_11312754 | 3300013105 | Bacteria | 737 |
| 273 | Ga0157374_10035733 | 3300013296 | Bacteria | 4547 |
| 274 | Ga0157374_10035761 | 3300013296 | Bacteria | 4545 |
| 275 | Ga0157374_10342973 | 3300013296 | Bacteria | 1483 |
| 276 | Ga0157374_10429045 | 3300013296 | Bacteria | 1321 |
| 277 | Ga0157374_10561280 | 3300013296 | Bacteria | 1150 |
| 278 | Ga0157372_10037542 | 3300013307 | Bacteria | 5345 |
| 279 | Ga0157372_10042481 | 3300013307 | Bacteria | 5029 |
| 280 | Ga0157372_10113628 | 3300013307 | Bacteria | 3103 |
| 281 | Ga0157372_10202832 | 3300013307 | Bacteria | 2298 |
| 282 | Ga0157372_10203257 | 3300013307 | Bacteria | 2295 |
| 283 | Ga0157372_10218808 | 3300013307 | Bacteria | 2207 |
| 284 | Ga0157372_10836054 | 3300013307 | Bacteria | 1069 |
| 285 | Ga0157375_10509514 | 3300013308 | Unclassified | 1367 |
| 286 | Ga0163163_10050633 | 3300014325 | Bacteria | 4090 |
| 287 | Ga0182008_10132073 | 3300014497 | Bacteria | 1245 |
| 288 | Ga0157377_10120260 | 3300014745 | Bacteria | 1591 |
| 289 | Ga0157377_10177680 | 3300014745 | Bacteria | 1336 |
| 290 | Ga0157377_10184904 | 3300014745 | Bacteria | 1313 |
| 291 | Ga0157377_10274657 | 3300014745 | Bacteria | 1102 |
| 292 | Ga0157376_10004382 | 3300014969 | Bacteria | 9823 |
| 293 | Ga0157376_10118346 | 3300014969 | Bacteria | 2344 |
| 294 | Ga0197907_10523178 | 3300020069 | Bacteria | 1966 |
| 295 | Ga0206356_10952328 | 3300020070 | Bacteria | 799 |
| 296 | Ga0206354_10326775 | 3300020081 | Bacteria | 952 |
| 297 | Ga0206354_10880655 | 3300020081 | Bacteria | 1744 |
| 298 | Ga0206354_11636846 | 3300020081 | Unclassified | 1755 |
| 299 | Ga0206353_10078595 | 3300020082 | Unclassified | 1037 |
| 300 | Ga0206353_10273473 | 3300020082 | Bacteria | 10875 |
| 301 | Ga0206353_10919582 | 3300020082 | Bacteria | 8099 |
| 302 | Ga0206353_11754634 | 3300020082 | Bacteria | 4231 |
| 303 | Ga0206353_12055637 | 3300020082 | Bacteria | 3447 |
| 304 | Ga0213875_10216983 | 3300021388 | Bacteria | 901 |
| 305 | Ga0207692_10025468 | 3300025898 | Bacteria | 2764 |
| 306 | Ga0207688_10109466 | 3300025901 | Bacteria | 1602 |
| 307 | Ga0207688_10157381 | 3300025901 | Bacteria | 1345 |
| 308 | Ga0207688_10178379 | 3300025901 | Unclassified | 1266 |
| 309 | Ga0207688_10329181 | 3300025901 | Unclassified | 938 |
| 310 | Ga0207699_10047512 | 3300025906 | Bacteria | 2517 |
| 311 | Ga0207643_10055240 | 3300025908 | Bacteria | 2258 |
| 312 | Ga0207643_10064888 | 3300025908 | Bacteria | 2090 |
| 313 | Ga0207643_10135230 | 3300025908 | Bacteria | 1469 |
| 314 | Ga0207705_10015626 | 3300025909 | Bacteria | 5449 |
| 315 | Ga0207705_10117488 | 3300025909 | Bacteria | 1970 |
| 316 | Ga0207705_10222360 | 3300025909 | Unclassified | 1434 |
| 317 | Ga0207684_10835336 | 3300025910 | Bacteria | 777 |
| 318 | Ga0207654_10564774 | 3300025911 | Bacteria | 809 |
| 319 | Ga0207707_10003449 | 3300025912 | Bacteria | 14018 |
| 320 | Ga0207707_10018119 | 3300025912 | Bacteria | 6136 |
| 321 | Ga0207707_10037958 | 3300025912 | Bacteria | 4208 |
| 322 | Ga0207707_10047308 | 3300025912 | Bacteria | 3746 |
| 323 | Ga0207707_10087046 | 3300025912 | Bacteria | 2730 |
| 324 | Ga0207707_10109594 | 3300025912 | Bacteria | 2413 |
| 325 | Ga0207707_10130480 | 3300025912 | Bacteria | 2198 |
| 326 | Ga0207707_10143146 | 3300025912 | Bacteria | 2090 |
| 327 | Ga0207707_10575164 | 3300025912 | Bacteria | 955 |
| 328 | Ga0207707_10631519 | 3300025912 | Unclassified | 904 |
| 329 | Ga0207695_10113214 | 3300025913 | Bacteria | 2690 |
| 330 | Ga0207671_10189613 | 3300025914 | Bacteria | 1603 |
| 331 | Ga0207693_10002632 | 3300025915 | Bacteria | 15592 |
| 332 | Ga0207693_10015956 | 3300025915 | Bacteria | 6013 |
| 333 | Ga0207693_10023757 | 3300025915 | Bacteria | 4865 |
| 334 | Ga0207693_10037906 | 3300025915 | Bacteria | 3798 |
| 335 | Ga0207663_10016445 | 3300025916 | Bacteria | 4103 |
| 336 | Ga0207663_10035143 | 3300025916 | Bacteria | 3003 |
| 337 | Ga0207663_10224132 | 3300025916 | Bacteria | 1370 |
| 338 | Ga0207660_10030754 | 3300025917 | Bacteria | 3691 |
| 339 | Ga0207660_10063744 | 3300025917 | Bacteria | 2658 |
| 340 | Ga0207660_10071772 | 3300025917 | Bacteria | 2520 |
| 341 | Ga0207660_10088801 | 3300025917 | Bacteria | 2287 |
| 342 | Ga0207660_10195025 | 3300025917 | Bacteria | 1579 |
| 343 | Ga0207660_10213397 | 3300025917 | Unclassified | 1512 |
| 344 | Ga0207657_10000109 | 3300025919 | Bacteria | 80516 |
| 345 | Ga0207657_10000325 | 3300025919 | Bacteria | 50816 |
| 346 | Ga0207657_10000392 | 3300025919 | Bacteria | 46205 |
| 347 | Ga0207657_10004556 | 3300025919 | Bacteria | 14649 |
| 348 | Ga0207657_10005779 | 3300025919 | Bacteria | 12898 |
| 349 | Ga0207657_10170948 | 3300025919 | Bacteria | 1761 |
| 350 | Ga0207657_10221303 | 3300025919 | Bacteria | 1516 |
| 351 | Ga0207657_10595780 | 3300025919 | Bacteria | 863 |
| 352 | Ga0207657_10597366 | 3300025919 | Bacteria | 861 |
| 353 | Ga0207657_10651131 | 3300025919 | Bacteria | 820 |
| 354 | Ga0207649_10040825 | 3300025920 | Bacteria | 2823 |
| 355 | Ga0207649_10060092 | 3300025920 | Bacteria | 2387 |
| 356 | Ga0207649_10445693 | 3300025920 | Unclassified | 976 |
| 357 | Ga0207652_10033006 | 3300025921 | Bacteria | 4358 |
| 358 | Ga0207652_10050142 | 3300025921 | Bacteria | 3575 |
| 359 | Ga0207652_10087679 | 3300025921 | Bacteria | 2729 |
| 360 | Ga0207652_10114291 | 3300025921 | Bacteria | 2397 |
| 361 | Ga0207652_10142786 | 3300025921 | Bacteria | 2141 |
| 362 | Ga0207652_10192353 | 3300025921 | Bacteria | 1835 |
| 363 | Ga0207652_10221857 | 3300025921 | Bacteria | 1703 |
| 364 | Ga0207652_10556286 | 3300025921 | Bacteria | 1031 |
| 365 | Ga0207646_10029716 | 3300025922 | Bacteria | 4963 |
| 366 | Ga0207646_10515185 | 3300025922 | Bacteria | 1077 |
| 367 | Ga0207694_10172523 | 3300025924 | Bacteria | 1752 |
| 368 | Ga0207694_10589898 | 3300025924 | Bacteria | 934 |
| 369 | Ga0207650_10013242 | 3300025925 | Bacteria | 5705 |
| 370 | Ga0207650_10028716 | 3300025925 | Bacteria | 3992 |
| 371 | Ga0207659_10039607 | 3300025926 | Bacteria | 3289 |
| 372 | Ga0207659_10077850 | 3300025926 | Bacteria | 2442 |
| 373 | Ga0207659_10098028 | 3300025926 | Bacteria | 2203 |
| 374 | Ga0207687_10032336 | 3300025927 | Bacteria | 3543 |
| 375 | Ga0207687_10192677 | 3300025927 | Bacteria | 1588 |
| 376 | Ga0207687_10628549 | 3300025927 | Bacteria | 907 |
| 377 | Ga0207687_10654309 | 3300025927 | Bacteria | 889 |
| 378 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 379 | Ga0207700_10175000 | 3300025928 | Bacteria | 1793 |
| 380 | Ga0207664_10003680 | 3300025929 | Bacteria | 10277 |
| 381 | Ga0207664_10019393 | 3300025929 | Bacteria | 5026 |
| 382 | Ga0207664_10168919 | 3300025929 | Bacteria | 1870 |
| 383 | Ga0207664_10297933 | 3300025929 | Unclassified | 1418 |
| 384 | Ga0207664_10349047 | 3300025929 | Bacteria | 1309 |
| 385 | Ga0207664_10354340 | 3300025929 | Bacteria | 1299 |
| 386 | Ga0207644_10235969 | 3300025931 | Bacteria | 1455 |
| 387 | Ga0207644_10538955 | 3300025931 | Bacteria | 965 |
| 388 | Ga0207690_10035414 | 3300025932 | Bacteria | 3225 |
| 389 | Ga0207690_10067293 | 3300025932 | Bacteria | 2456 |
| 390 | Ga0207690_10342636 | 3300025932 | Bacteria | 1180 |
| 391 | Ga0207686_10047340 | 3300025934 | Bacteria | 2658 |
| 392 | Ga0207686_10090298 | 3300025934 | Bacteria | 2021 |
| 393 | Ga0207686_10104212 | 3300025934 | Bacteria | 1900 |
| 394 | Ga0207709_10053617 | 3300025935 | Unclassified | 2482 |
| 395 | Ga0207709_10212256 | 3300025935 | Bacteria | 1390 |
| 396 | Ga0207709_10349500 | 3300025935 | Bacteria | 1116 |
| 397 | Ga0207709_10515551 | 3300025935 | Bacteria | 935 |
| 398 | Ga0207670_10200985 | 3300025936 | Bacteria | 1514 |
| 399 | Ga0207669_10001844 | 3300025937 | Bacteria | 8980 |
| 400 | Ga0207669_10036314 | 3300025937 | Bacteria | 2814 |
| 401 | Ga0207669_10046341 | 3300025937 | Bacteria | 2569 |
| 402 | Ga0207665_10000420 | 3300025939 | Bacteria | 29260 |
| 403 | Ga0207665_10243482 | 3300025939 | Bacteria | 1326 |
| 404 | Ga0207665_10446102 | 3300025939 | Bacteria | 992 |
| 405 | Ga0207691_10254130 | 3300025940 | Bacteria | 1516 |
| 406 | Ga0207691_10347968 | 3300025940 | Unclassified | 1268 |
| 407 | Ga0207711_10345287 | 3300025941 | Bacteria | 1378 |
| 408 | Ga0207689_10082078 | 3300025942 | Bacteria | 2650 |
| 409 | Ga0207689_10230626 | 3300025942 | Bacteria | 1530 |
| 410 | Ga0207661_10052857 | 3300025944 | Bacteria | 3248 |
| 411 | Ga0207661_10075877 | 3300025944 | Bacteria | 2760 |
| 412 | Ga0207661_10078742 | 3300025944 | Bacteria | 2715 |
| 413 | Ga0207661_10135711 | 3300025944 | Bacteria | 2113 |
| 414 | Ga0207661_10354207 | 3300025944 | Bacteria | 1325 |
| 415 | Ga0207661_10567943 | 3300025944 | Unclassified | 1040 |
| 416 | Ga0207661_10680975 | 3300025944 | Bacteria | 945 |
| 417 | Ga0207679_10120464 | 3300025945 | Bacteria | 2088 |
| 418 | Ga0207667_10036631 | 3300025949 | Bacteria | 5255 |
| 419 | Ga0207667_10046561 | 3300025949 | Bacteria | 4592 |
| 420 | Ga0207667_10547983 | 3300025949 | Bacteria | 1170 |
| 421 | Ga0207667_10607187 | 3300025949 | Bacteria | 1103 |
| 422 | Ga0207667_10764574 | 3300025949 | Bacteria | 965 |
| 423 | Ga0207651_10062973 | 3300025960 | Unclassified | 2588 |
| 424 | Ga0207712_10297007 | 3300025961 | Bacteria | 1324 |
| 425 | Ga0207668_10122476 | 3300025972 | Bacteria | 1972 |
| 426 | Ga0207658_10042144 | 3300025986 | Bacteria | 3309 |
| 427 | Ga0207677_10407865 | 3300026023 | Bacteria | 1154 |
| 428 | Ga0207639_10180560 | 3300026041 | Bacteria | 1795 |
| 429 | Ga0207639_10190061 | 3300026041 | Bacteria | 1753 |
| 430 | Ga0207639_10236399 | 3300026041 | Bacteria | 1586 |
| 431 | Ga0207708_10088719 | 3300026075 | Bacteria | 2382 |
| 432 | Ga0207708_10094880 | 3300026075 | Bacteria | 2303 |
| 433 | Ga0207708_10505203 | 3300026075 | Unclassified | 1014 |
| 434 | Ga0207702_10074079 | 3300026078 | Bacteria | 2938 |
| 435 | Ga0207702_10464080 | 3300026078 | Bacteria | 1230 |
| 436 | Ga0207702_10762767 | 3300026078 | Bacteria | 955 |
| 437 | Ga0207702_11157915 | 3300026078 | Unclassified | 767 |
| 438 | Ga0207641_10799984 | 3300026088 | Unclassified | 933 |
| 439 | Ga0207648_10140154 | 3300026089 | Archaea | 2131 |
| 440 | Ga0207674_10028144 | 3300026116 | Bacteria | 5936 |
| 441 | Ga0207674_10030435 | 3300026116 | Bacteria | 5674 |
| 442 | Ga0207674_10077100 | 3300026116 | Unclassified | 3339 |
| 443 | Ga0207674_10485576 | 3300026116 | Bacteria | 1194 |
| 444 | Ga0207675_100201305 | 3300026118 | Bacteria | 1913 |
| 445 | Ga0207675_100286147 | 3300026118 | Bacteria | 1602 |
| 446 | Ga0207683_10039793 | 3300026121 | Bacteria | 4101 |
| 447 | Ga0207683_10128024 | 3300026121 | Bacteria | 2283 |
| 448 | Ga0207698_10456017 | 3300026142 | Bacteria | 1235 |
| 449 | Ga0207698_10519468 | 3300026142 | Bacteria | 1162 |
| 450 | Ga0207698_10773585 | 3300026142 | Unclassified | 960 |
| 451 | Ga0207428_10329495 | 3300027907 | Archaea | 1126 |
| 452 | Ga0268266_10070810 | 3300028379 | Bacteria | 3022 |
| 453 | Ga0268266_10166631 | 3300028379 | Bacteria | 1997 |
| 454 | Ga0265319_1041552 | 3300028563 | Bacteria | 1551 |
| 455 | Ga0265319_1055798 | 3300028563 | Bacteria | 1292 |
| 456 | Ga0265318_10036741 | 3300028577 | Bacteria | 1878 |
| 457 | Ga0265322_10019676 | 3300028654 | Unclassified | 1936 |
| 458 | Ga0265338_10005706 | 3300028800 | Bacteria | 16098 |
| 459 | Ga0265338_10109819 | 3300028800 | Bacteria | 2224 |
| 460 | Ga0265338_10137658 | 3300028800 | Bacteria | 1917 |
| 461 | Ga0265338_10215297 | 3300028800 | Unclassified | 1439 |
| 462 | Ga0265330_10054771 | 3300031235 | Unclassified | 1743 |
| 463 | Ga0265325_10036263 | 3300031241 | Bacteria | 2614 |
| 464 | Ga0265339_10237437 | 3300031249 | Bacteria | 886 |
| 465 | Ga0265327_10009587 | 3300031251 | Bacteria | 6958 |
| 466 | Ga0265327_10022852 | 3300031251 | Unclassified | 3722 |
| 467 | Ga0265327_10038359 | 3300031251 | Bacteria | 2614 |
| 468 | Ga0265316_10013780 | 3300031344 | Bacteria | 7161 |
| 469 | Ga0265316_10160370 | 3300031344 | Archaea | 1681 |
| 470 | Ga0265316_10338148 | 3300031344 | Bacteria | 1091 |
| 471 | Ga0265313_10003420 | 3300031595 | Bacteria | 12855 |
| 472 | Ga0265313_10052378 | 3300031595 | Bacteria | 1948 |
| 473 | Ga0265313_10172203 | 3300031595 | Bacteria | 914 |
| 474 | Ga0265314_10015476 | 3300031711 | Bacteria | 6052 |
| 475 | Ga0265314_10209706 | 3300031711 | Bacteria | 1145 |
| 476 | Ga0307405_10671464 | 3300031731 | Bacteria | 855 |
| 477 | Ga0307413_10634953 | 3300031824 | Unclassified | 879 |
| 478 | Ga0307412_10255665 | 3300031911 | Bacteria | 1363 |
| 479 | Ga0307409_100067092 | 3300031995 | Bacteria | 2832 |
| 480 | Ga0307409_100166591 | 3300031995 | Bacteria | 1934 |
| 481 | Ga0307409_100322288 | 3300031995 | Bacteria | 1447 |
| 482 | Ga0307416_100112938 | 3300032002 | Bacteria | 2399 |
| 483 | Ga0307416_100275487 | 3300032002 | Bacteria | 1655 |
| 484 | Ga0307416_100349707 | 3300032002 | Bacteria | 1495 |
| 485 | Ga0307416_100691924 | 3300032002 | Bacteria | 1108 |
| 486 | Ga0307416_100734622 | 3300032002 | Unclassified | 1079 |
| 487 | Ga0307416_101237819 | 3300032002 | Bacteria | 852 |
| 488 | Ga0307415_100232024 | 3300032126 | Bacteria | 1487 |
| 489 | Ga0373938_0037760 | 3300034957 | Bacteria | 1062 |
| 490 | Ga0373926_0028125 | 3300035083 | Bacteria | 1973 |
| 491 | Ga0373944_0002757 | 3300035089 | Bacteria | 4489 |
| 492 | Ga0373936_0019516 | 3300035113 | Bacteria | 2627 |
| 493 | Ga0373960_0019706 | 3300035121 | Bacteria | 1775 |
| 494 | Ga0373943_0002270 | 3300035170 | Bacteria | 8724 |
| 495 | Ga0373943_0002605 | 3300035170 | Bacteria | 8200 |
| 496 | Ga0373943_0017086 | 3300035170 | Bacteria | 3318 |
| 497 | Ga0373946_0005213 | 3300035171 | Bacteria | 4686 |
| 498 | Ga0373961_0002107 | 3300035241 | Bacteria | 5282 |
| 499 | Ga0373924_0050298 | 3300035410 | Bacteria | 1726 |
| 500 | Ga0373931_0043351 | 3300035691 | Bacteria | 2369 |
| 501 | Ga0373931_0129964 | 3300035691 | Bacteria | 1448 |
| 502 | Ga0373931_0133184 | 3300035691 | Bacteria | 1433 |
| 503 | Ga0373935_0010709 | 3300035692 | Bacteria | 5508 |
| 504 | Ga0373927_0227515 | 3300035695 | Bacteria | 1225 |
| 505 | Ga0373947_0004295 | 3300035725 | Bacteria | 8372 |
| 506 | Ga0373947_0006306 | 3300035725 | Bacteria | 6892 |
| 507 | Ga0373937_0018964 | 3300036401 | Bacteria | 6152 |
| 508 | Ga0373925_0009496 | 3300037068 | Bacteria | 7082 |
| 509 | Ga0373925_0012976 | 3300037068 | Bacteria | 6032 |
| 510 | Ga0373925_0060588 | 3300037068 | Bacteria | 2842 |
| 511 | Ga0395899_0044108 | 3300037312 | Bacteria | 3323 |
| 512 | Ga0395899_0066065 | 3300037312 | Bacteria | 2656 |
| 513 | Ga0395899_0078142 | 3300037312 | Bacteria | 2413 |
| 514 | Ga0395899_0078284 | 3300037312 | Bacteria | 2410 |
| 515 | Ga0395899_0654611 | 3300037312 | Bacteria | 663 |
| 516 | Ga0395900_0021514 | 3300037418 | Bacteria | 6596 |
| 517 | Ga0395900_0026867 | 3300037418 | Bacteria | 5890 |
| 518 | Ga0395900_0038495 | 3300037418 | Bacteria | 4929 |
| 519 | Ga0395900_0044163 | 3300037418 | Bacteria | 4593 |
| 520 | Ga0395900_0055461 | 3300037418 | Bacteria | 4081 |
| 521 | Ga0395900_0126952 | 3300037418 | Bacteria | 2616 |
| 522 | Ga0395900_0251551 | 3300037418 | Unclassified | 1768 |
| 523 | Ga0395900_0367183 | 3300037418 | Bacteria | 1410 |
| 524 | Ga0395900_0450252 | 3300037418 | Bacteria | 1244 |
| 525 | Ga0395900_0585211 | 3300037418 | Unclassified | 1058 |
| 526 | Ga0395900_0668039 | 3300037418 | Bacteria | 975 |
| 527 | Ga0395900_0840859 | 3300037418 | Bacteria | 844 |
| 528 | Ga0395900_0967026 | 3300037418 | Bacteria | 772 |
| 529 | Ga0395898_0000734 | 3300037466 | Bacteria | 57441 |
| 530 | Ga0395898_0047977 | 3300037466 | Bacteria | 4189 |
| 531 | Ga0395898_0058255 | 3300037466 | Bacteria | 3761 |
| 532 | Ga0395898_0139424 | 3300037466 | Bacteria | 2321 |
| 533 | Ga0395898_0142971 | 3300037466 | Bacteria | 2290 |
| 534 | Ga0395898_0176553 | 3300037466 | Unclassified | 2042 |
| 535 | Ga0395898_0263549 | 3300037466 | Bacteria | 1644 |
| 536 | Ga0395898_0286313 | 3300037466 | Bacteria | 1572 |
| 537 | Ga0395898_0436843 | 3300037466 | Bacteria | 1247 |
| 538 | Ga0395898_0456870 | 3300037466 | Bacteria | 1216 |
| 539 | Ga0395898_0604326 | 3300037466 | Unclassified | 1039 |
| 540 | Ga0395898_0674366 | 3300037466 | Bacteria | 976 |
| 541 | Ga0395898_0853872 | 3300037466 | Unclassified | 849 |
| 542 | Ga0395905_0076570 | 3300037471 | Bacteria | 3135 |
| 543 | Ga0395905_0112821 | 3300037471 | Bacteria | 2553 |
| 544 | Ga0395905_0210917 | 3300037471 | Bacteria | 1820 |
| 545 | Ga0395905_0218593 | 3300037471 | Bacteria | 1784 |
| 546 | Ga0395905_0262861 | 3300037471 | Unclassified | 1611 |
| 547 | Ga0395905_0311565 | 3300037471 | Unclassified | 1462 |
| 548 | Ga0395905_0380684 | 3300037471 | Bacteria | 1305 |
| 549 | Ga0395905_0541267 | 3300037471 | Unclassified | 1065 |
| 550 | Ga0436364_0118239 | 3300037853 | Bacteria | 2441 |
| 551 | Ga0395901_0008579 | 3300038443 | Bacteria | 10330 |
| 552 | Ga0395901_0009547 | 3300038443 | Bacteria | 9842 |
| 553 | Ga0395901_0018425 | 3300038443 | Bacteria | 7126 |
| 554 | Ga0395901_0024554 | 3300038443 | Bacteria | 6189 |
| 555 | Ga0395901_0030426 | 3300038443 | Bacteria | 5561 |
| 556 | Ga0395901_0071540 | 3300038443 | Bacteria | 3614 |
| 557 | Ga0395901_0140198 | 3300038443 | Bacteria | 2541 |
| 558 | Ga0395901_0245321 | 3300038443 | Bacteria | 1867 |
| 559 | Ga0395901_0601744 | 3300038443 | Bacteria | 1108 |
| 560 | Ga0395901_0971884 | 3300038443 | Bacteria | 827 |
| 561 | Ga0436365_1686693 | 3300039437 | Bacteria | 2855 |
| 562 | Ga0436360_0741409 | 3300039438 | Bacteria | 7115 |
| 563 | Ga0436360_1127993 | 3300039438 | Bacteria | 3954 |
| 564 | Ga0436363_0072152 | 3300039450 | Bacteria | 1354 |
| 565 | Ga0436363_0810503 | 3300039450 | Bacteria | 1261 |
| 566 | Ga0436362_0477997 | 3300039453 | Bacteria | 2289 |
| 567 | Ga0439461_0029059 | 3300041410 | Bacteria | 1142 |
| 568 | Ga0439466_0092353 | 3300041411 | Unclassified | 948 |
| 569 | Ga0451839_0633760 | 3300041496 | Bacteria | 2219 |
| 570 | Ga0451853_3726911 | 3300041512 | Bacteria | 6283 |
| 571 | Ga0439433_0006418 | 3300041999 | Bacteria | 2531 |
| 572 | Ga0439437_002107 | 3300042000 | Bacteria | 2110 |
| 573 | Ga0439462_0008846 | 3300042015 | Bacteria | 2544 |
| 574 | Ga0439446_0001570 | 3300042156 | Bacteria | 5248 |
| 575 | Ga0439446_0015700 | 3300042156 | Bacteria | 2102 |
| 576 | Ga0439434_0009365 | 3300042435 | Bacteria | 2878 |
| 577 | Ga0450918_010134 | 3300042531 | Bacteria | 1645 |
| 578 | Ga0451577_0797908 | 3300042876 | Bacteria | 853 |
| 579 | Ga0466969_0001492 | 3300044656 | Bacteria | 12584 |
| 580 | Ga0466969_0065900 | 3300044656 | Bacteria | 1750 |
| 581 | Ga0466966_0027033 | 3300044684 | Bacteria | 3742 |
| 582 | Ga0466966_0030445 | 3300044684 | Bacteria | 3505 |
| 583 | Ga0466961_0006192 | 3300044693 | Bacteria | 7596 |
| 584 | Ga0466961_0017370 | 3300044693 | Bacteria | 4621 |
| 585 | Ga0466961_0034206 | 3300044693 | Bacteria | 3263 |
| 586 | Ga0466961_0241091 | 3300044693 | Unclassified | 1111 |
| 587 | Ga0466961_0249123 | 3300044693 | Unclassified | 1091 |
| 588 | Ga0466961_0402219 | 3300044693 | Bacteria | 831 |
| 589 | Ga0466963_0000920 | 3300044694 | Bacteria | 14997 |
| 590 | Ga0466963_0001756 | 3300044694 | Bacteria | 11812 |
| 591 | Ga0466963_0005751 | 3300044694 | Bacteria | 7290 |
| 592 | Ga0466963_0007483 | 3300044694 | Bacteria | 6514 |
| 593 | Ga0466963_0031583 | 3300044694 | Bacteria | 3424 |
| 594 | Ga0466963_0051662 | 3300044694 | Bacteria | 2725 |
| 595 | Ga0466963_0069983 | 3300044694 | Bacteria | 2359 |
| 596 | Ga0466963_0072407 | 3300044694 | Bacteria | 2322 |
| 597 | Ga0466963_0411625 | 3300044694 | Bacteria | 953 |
| 598 | Ga0466963_0423799 | 3300044694 | Bacteria | 938 |
| 599 | Ga0466964_0011711 | 3300044706 | Bacteria | 3317 |
| 600 | Ga0466964_0029782 | 3300044706 | Bacteria | 2157 |
| 601 | Ga0466964_0062289 | 3300044706 | Bacteria | 1555 |
| 602 | Ga0466964_0091662 | 3300044706 | Unclassified | 1324 |
| 603 | Ga0466964_0107164 | 3300044706 | Bacteria | 1241 |
| 604 | Ga0466971_0010097 | 3300044719 | Bacteria | 4123 |
| 605 | Ga0466971_0045428 | 3300044719 | Bacteria | 1973 |
| 606 | Ga0466971_0056857 | 3300044719 | Bacteria | 1764 |
| 607 | Ga0466957_0002635 | 3300044842 | Bacteria | 9684 |
| 608 | Ga0466957_0173551 | 3300044842 | Bacteria | 1405 |
| 609 | Ga0466957_0217979 | 3300044842 | Bacteria | 1259 |
| 610 | Ga0466960_0017316 | 3300044901 | Bacteria | 3140 |
| 611 | Ga0466959_0011136 | 3300045049 | Bacteria | 6454 |
| 612 | Ga0466959_0021632 | 3300045049 | Bacteria | 4747 |
| 613 | Ga0466959_0028325 | 3300045049 | Bacteria | 4154 |
| 614 | Ga0466959_0075240 | 3300045049 | Bacteria | 2440 |
| 615 | Ga0466959_0076025 | 3300045049 | Bacteria | 2425 |
| 616 | Ga0466958_0010546 | 3300045836 | Bacteria | 5179 |
| 617 | Ga0466958_0028733 | 3300045836 | Bacteria | 3298 |
| 618 | Ga0466958_0040565 | 3300045836 | Bacteria | 2798 |
| 619 | Ga0466958_0136470 | 3300045836 | Bacteria | 1543 |
| 620 | Ga0466958_0170145 | 3300045836 | Bacteria | 1379 |
| 621 | Ga0466958_0327693 | 3300045836 | Bacteria | 984 |
| 622 | Ga0466958_0349482 | 3300045836 | Bacteria | 952 |
| 623 | Ga0466958_0549636 | 3300045836 | Unclassified | 750 |
| 624 | Ga0466967_0000981 | 3300045976 | Bacteria | 15497 |
| 625 | Ga0466967_0010558 | 3300045976 | Bacteria | 6935 |
| 626 | Ga0466967_0017094 | 3300045976 | Bacteria | 5745 |
| 627 | Ga0466967_0018052 | 3300045976 | Bacteria | 5626 |
| 628 | Ga0466967_0055904 | 3300045976 | Bacteria | 3478 |
| 629 | Ga0466967_0078124 | 3300045976 | Bacteria | 2981 |
| 630 | Ga0466967_0085101 | 3300045976 | Bacteria | 2862 |
| 631 | Ga0466967_0085663 | 3300045976 | Bacteria | 2853 |
| 632 | Ga0466967_0086194 | 3300045976 | Bacteria | 2845 |
| 633 | Ga0466967_0315558 | 3300045976 | Bacteria | 1506 |
| 634 | Ga0466967_0483600 | 3300045976 | Bacteria | 1213 |
| 635 | Ga0466967_0604682 | 3300045976 | Bacteria | 1082 |
| 636 | Ga0495592_0003791 | 3300046454 | Bacteria | 10912 |
| 637 | Ga0495592_0089887 | 3300046454 | Bacteria | 2205 |
| 638 | Ga0495592_0257108 | 3300046454 | Bacteria | 1152 |
| 639 | Ga0495629_0011568 | 3300046459 | Bacteria | 6411 |
| 640 | Ga0495629_0080537 | 3300046459 | Bacteria | 2273 |
| 641 | Ga0495629_0155733 | 3300046459 | Bacteria | 1588 |
| 642 | Ga0495641_0004513 | 3300046461 | Bacteria | 9792 |
| 643 | Ga0495651_0035164 | 3300046462 | Bacteria | 3902 |
| 644 | Ga0495651_0066162 | 3300046462 | Bacteria | 2759 |
| 645 | Ga0495651_0113468 | 3300046462 | Bacteria | 2000 |
| 646 | Ga0495651_0294953 | 3300046462 | Bacteria | 1090 |
| 647 | Ga0495653_0043753 | 3300046463 | Bacteria | 3479 |
| 648 | Ga0495653_0150988 | 3300046463 | Bacteria | 1623 |
| 649 | Ga0495582_0000257 | 3300046473 | Bacteria | 29665 |
| 650 | Ga0495582_0123871 | 3300046473 | Bacteria | 1458 |
| 651 | Ga0495582_0123990 | 3300046473 | Bacteria | 1457 |
| 652 | Ga0495639_0010906 | 3300046475 | Bacteria | 3912 |
| 653 | Ga0495662_0005108 | 3300046476 | Bacteria | 6575 |
| 654 | Ga0495662_0211202 | 3300046476 | Bacteria | 957 |
| 655 | Ga0495664_0025737 | 3300046477 | Bacteria | 3425 |
| 656 | Ga0495594_0029611 | 3300046499 | Bacteria | 2960 |
| 657 | Ga0495608_0073474 | 3300046511 | Bacteria | 2230 |
| 658 | Ga0495608_0242859 | 3300046511 | Unclassified | 1125 |
| 659 | Ga0495608_0336107 | 3300046511 | Bacteria | 931 |
| 660 | Ga0495628_0007369 | 3300046516 | Bacteria | 9522 |
| 661 | Ga0495628_0329897 | 3300046516 | Bacteria | 1125 |
| 662 | Ga0495630_0032971 | 3300046517 | Bacteria | 3862 |
| 663 | Ga0495630_0055571 | 3300046517 | Bacteria | 2967 |
| 664 | Ga0495630_0076366 | 3300046517 | Bacteria | 2524 |
| 665 | Ga0495630_0102125 | 3300046517 | Bacteria | 2169 |
| 666 | Ga0495630_0333467 | 3300046517 | Bacteria | 1160 |
| 667 | Ga0495644_0223439 | 3300046523 | Bacteria | 728 |
| 668 | Ga0495652_0036009 | 3300046529 | Bacteria | 4305 |
| 669 | Ga0495652_0190217 | 3300046529 | Bacteria | 1567 |
| 670 | Ga0495652_0260177 | 3300046529 | Bacteria | 1281 |
| 671 | Ga0495665_0000792 | 3300046531 | Bacteria | 16534 |
| 672 | Ga0495665_0138214 | 3300046531 | Bacteria | 1274 |
| 673 | Ga0495640_0037570 | 3300046533 | Bacteria | 3415 |
| 674 | Ga0495640_0311035 | 3300046533 | Bacteria | 977 |
| 675 | Ga0495587_0246714 | 3300046536 | Unclassified | 1004 |
| 676 | Ga0495598_0063270 | 3300046537 | Bacteria | 1147 |
| 677 | Ga0495598_0158844 | 3300046537 | Bacteria | 794 |
| 678 | Ga0495645_0038607 | 3300046543 | Bacteria | 3482 |
| 679 | Ga0495645_0113754 | 3300046543 | Bacteria | 1913 |
| 680 | Ga0495645_0372908 | 3300046543 | Bacteria | 915 |
| 681 | Ga0495667_0057785 | 3300046559 | Bacteria | 2549 |
| 682 | Ga0495667_0101563 | 3300046559 | Unclassified | 1861 |
| 683 | Ga0495667_0210199 | 3300046559 | Bacteria | 1243 |
| 684 | Ga0495634_0211166 | 3300046642 | Bacteria | 1201 |
| 685 | Ga0495635_0096077 | 3300046663 | Bacteria | 2025 |
| 686 | Ga0495635_0121259 | 3300046663 | Bacteria | 1783 |
| 687 | Ga0495659_0087330 | 3300046664 | Unclassified | 1193 |
| 688 | Ga0495657_0024246 | 3300046675 | Bacteria | 4324 |
| 689 | Ga0495657_0093456 | 3300046675 | Bacteria | 1925 |
| 690 | Ga0495657_0105218 | 3300046675 | Bacteria | 1793 |
| 691 | Ga0495599_0029606 | 3300046678 | Bacteria | 3432 |
| 692 | Ga0495599_0033185 | 3300046678 | Bacteria | 3243 |
| 693 | Ga0495599_0085683 | 3300046678 | Unclassified | 1968 |
| 694 | Ga0495646_0070507 | 3300046680 | Bacteria | 2058 |
| 695 | Ga0495647_0031956 | 3300046681 | Bacteria | 1959 |
| 696 | Ga0495658_0001295 | 3300046683 | Bacteria | 13106 |
| 697 | Ga0495658_0002040 | 3300046683 | Bacteria | 10278 |
| 698 | Ga0495658_0330822 | 3300046683 | Bacteria | 967 |
| 699 | Ga0495658_0426264 | 3300046683 | Bacteria | 846 |
| 700 | Ga0495613_0010420 | 3300046689 | Bacteria | 6903 |
| 701 | Ga0495613_0071957 | 3300046689 | Bacteria | 2520 |
| 702 | Ga0495613_0373177 | 3300046689 | Bacteria | 977 |
| 703 | Ga0495624_0401972 | 3300046690 | Bacteria | 822 |
| 704 | Ga0495589_0118856 | 3300046794 | Bacteria | 1273 |
| 705 | Ga0495600_0046393 | 3300046809 | Bacteria | 2835 |
| 706 | Ga0495600_0067172 | 3300046809 | Bacteria | 2344 |
| 707 | Ga0495600_0196928 | 3300046809 | Bacteria | 1295 |
| 708 | Ga0495581_0002821 | 3300047315 | Bacteria | 9928 |
| 709 | Ga0495604_0018967 | 3300047317 | Bacteria | 5508 |
| 710 | Ga0495604_0206890 | 3300047317 | Bacteria | 1358 |
| 711 | Ga0495674_0009918 | 3300047319 | Bacteria | 9033 |
| 712 | Ga0495674_0066320 | 3300047319 | Bacteria | 3132 |
| 713 | Ga0495674_0236317 | 3300047319 | Bacteria | 1507 |
| 714 | Ga0495674_0356551 | 3300047319 | Bacteria | 1186 |
| 715 | Ga0495676_0000193 | 3300047321 | Bacteria | 48356 |
| 716 | Ga0495676_0159483 | 3300047321 | Bacteria | 1597 |
| 717 | Ga0495680_0003689 | 3300047322 | Bacteria | 14957 |
| 718 | Ga0495680_0050051 | 3300047322 | Bacteria | 3268 |
| 719 | Ga0495680_0084715 | 3300047322 | Bacteria | 2388 |
| 720 | Ga0495680_0433347 | 3300047322 | Unclassified | 902 |
| 721 | Ga0495675_0101988 | 3300047444 | Bacteria | 1795 |
| 722 | Ga0495684_0028325 | 3300047471 | Bacteria | 4301 |
| 723 | Ga0495684_0147848 | 3300047471 | Bacteria | 1758 |
| 724 | Ga0495593_0003920 | 3300047673 | Bacteria | 8888 |
| 725 | Ga0495593_0149622 | 3300047673 | Bacteria | 1181 |
| 726 | Ga0495602_0064594 | 3300048088 | Bacteria | 3163 |
| 727 | Ga0495602_0066515 | 3300048088 | Bacteria | 3104 |
| 728 | Ga0495602_0152774 | 3300048088 | Bacteria | 1812 |
| 729 | Ga0495614_0014067 | 3300048089 | Bacteria | 3509 |
| 730 | Ga0495614_0309765 | 3300048089 | Bacteria | 731 |
| 731 | Ga0496100_0012031 | 3300048903 | Bacteria | 4947 |
| 732 | Ga0496100_0013077 | 3300048903 | Bacteria | 4777 |
| 733 | Ga0496100_0021223 | 3300048903 | Bacteria | 3908 |
| 734 | Ga0496100_0117159 | 3300048903 | Unclassified | 1859 |
| 735 | Ga0496100_0149309 | 3300048903 | Bacteria | 1665 |
| 736 | Ga0496100_0170574 | 3300048903 | Bacteria | 1567 |
| 737 | Ga0496100_1301607 | 3300048903 | Unclassified | 573 |
| 738 | Ga0496101_0005342 | 3300048904 | Bacteria | 8187 |
| 739 | Ga0496101_0011996 | 3300048904 | Bacteria | 5774 |
| 740 | Ga0496101_0015799 | 3300048904 | Bacteria | 5094 |
| 741 | Ga0496101_0096614 | 3300048904 | Unclassified | 2205 |
| 742 | Ga0496101_0107589 | 3300048904 | Bacteria | 2095 |
| 743 | Ga0496101_0286906 | 3300048904 | Unclassified | 1287 |
| 744 | Ga0496102_0034725 | 3300048905 | Bacteria | 4537 |
| 745 | Ga0496102_0036770 | 3300048905 | Bacteria | 4413 |
| 746 | Ga0496102_0071015 | 3300048905 | Bacteria | 3197 |
| 747 | Ga0496102_0191987 | 3300048905 | Bacteria | 1925 |
| 748 | Ga0496102_0250277 | 3300048905 | Bacteria | 1671 |
| 749 | Ga0496102_0445349 | 3300048905 | Unclassified | 1215 |
| 750 | Ga0496102_0692671 | 3300048905 | Bacteria | 942 |
| 751 | Ga0496103_0024000 | 3300048906 | Bacteria | 3679 |
| 752 | Ga0496103_0095364 | 3300048906 | Bacteria | 1880 |
| 753 | Ga0496103_0115423 | 3300048906 | Archaea | 1708 |
| 754 | Ga0496103_0245203 | 3300048906 | Bacteria | 1153 |
| 755 | Ga0496104_0002397 | 3300048907 | Bacteria | 16148 |
| 756 | Ga0496104_0122293 | 3300048907 | Bacteria | 2499 |
| 757 | Ga0496104_0837373 | 3300048907 | Bacteria | 825 |
| 758 | Ga0496105_0033671 | 3300048908 | Bacteria | 4209 |
| 759 | Ga0496105_0044703 | 3300048908 | Bacteria | 3653 |
| 760 | Ga0496105_0055182 | 3300048908 | Bacteria | 3281 |
| 761 | Ga0496106_0008396 | 3300048909 | Bacteria | 7641 |
| 762 | Ga0496106_0017578 | 3300048909 | Bacteria | 5289 |
| 763 | Ga0496106_0018196 | 3300048909 | Bacteria | 5196 |
| 764 | Ga0496106_0075051 | 3300048909 | Bacteria | 2589 |
| 765 | Ga0496106_0151236 | 3300048909 | Bacteria | 1831 |
| 766 | Ga0496106_0417161 | 3300048909 | Bacteria | 1079 |
| 767 | Ga0496106_0456010 | 3300048909 | Bacteria | 1027 |
| 768 | Ga0496106_0654876 | 3300048909 | Bacteria | 839 |
| 769 | Ga0496106_0692057 | 3300048909 | Bacteria | 813 |
| 770 | Ga0496107_0006357 | 3300048910 | Bacteria | 8120 |
| 771 | Ga0496107_0010172 | 3300048910 | Bacteria | 6525 |
| 772 | Ga0496107_0049700 | 3300048910 | Bacteria | 3022 |
| 773 | Ga0496107_0079973 | 3300048910 | Bacteria | 2383 |
| 774 | Ga0496107_0104832 | 3300048910 | Bacteria | 2075 |
| 775 | Ga0496107_0277818 | 3300048910 | Bacteria | 1247 |
| 776 | Ga0496107_0568042 | 3300048910 | Bacteria | 839 |
| 777 | Ga0496108_0077814 | 3300048911 | Bacteria | 2806 |
| 778 | Ga0496109_0001455 | 3300048912 | Bacteria | 19626 |
| 779 | Ga0496109_0014627 | 3300048912 | Bacteria | 6828 |
| 780 | Ga0496109_0096697 | 3300048912 | Bacteria | 2736 |
| 781 | Ga0496109_0169845 | 3300048912 | Bacteria | 2045 |
| 782 | Ga0496109_0252324 | 3300048912 | Archaea | 1661 |
| 783 | Ga0496109_0397558 | 3300048912 | Bacteria | 1302 |
| 784 | Ga0496109_0403964 | 3300048912 | Bacteria | 1290 |
| 785 | Ga0496109_0422805 | 3300048912 | Bacteria | 1259 |
| 786 | Ga0496109_0560052 | 3300048912 | Bacteria | 1078 |
| 787 | Ga0496109_0572389 | 3300048912 | Bacteria | 1065 |
| 788 | Ga0496109_1340298 | 3300048912 | Unclassified | 651 |
| 789 | Ga0496109_1490324 | 3300048912 | Unclassified | 611 |
| 790 | Ga0496110_0004243 | 3300048913 | Bacteria | 11090 |
| 791 | Ga0496110_0039332 | 3300048913 | Bacteria | 4118 |
| 792 | Ga0496110_0072147 | 3300048913 | Bacteria | 3063 |
| 793 | Ga0496110_0112496 | 3300048913 | Bacteria | 2448 |
| 794 | Ga0496110_0121397 | 3300048913 | Bacteria | 2354 |
| 795 | Ga0496110_0277176 | 3300048913 | Bacteria | 1527 |
| 796 | Ga0496110_0322002 | 3300048913 | Bacteria | 1408 |
| 797 | Ga0496110_0390575 | 3300048913 | Bacteria | 1268 |
| 798 | Ga0496110_0455875 | 3300048913 | Bacteria | 1165 |
| 799 | Ga0496110_0812358 | 3300048913 | Bacteria | 840 |
| 800 | Ga0496111_0004777 | 3300048914 | Bacteria | 8595 |
| 801 | Ga0496111_0006341 | 3300048914 | Bacteria | 7671 |
| 802 | Ga0496111_0019125 | 3300048914 | Bacteria | 4754 |
| 803 | Ga0496111_0083309 | 3300048914 | Bacteria | 2337 |
| 804 | Ga0496111_0402660 | 3300048914 | Archaea | 1011 |
| 805 | Ga0496111_0645437 | 3300048914 | Bacteria | 772 |
| 806 | Ga0496112_0024833 | 3300048915 | Bacteria | 5748 |
| 807 | Ga0496112_0068434 | 3300048915 | Bacteria | 3506 |
| 808 | Ga0496112_0084995 | 3300048915 | Bacteria | 3130 |
| 809 | Ga0496112_0102851 | 3300048915 | Bacteria | 2826 |
| 810 | Ga0496112_0240461 | 3300048915 | Bacteria | 1763 |
| 811 | Ga0496112_0382720 | 3300048915 | Bacteria | 1348 |
| 812 | Ga0496112_1053067 | 3300048915 | Bacteria | 732 |
| 813 | Ga0496113_0059650 | 3300048916 | Bacteria | 2874 |
| 814 | Ga0496113_0569643 | 3300048916 | Bacteria | 908 |
| 815 | Ga0496114_0009965 | 3300048917 | Bacteria | 7552 |
| 816 | Ga0496114_0018032 | 3300048917 | Bacteria | 5703 |
| 817 | Ga0496114_0048190 | 3300048917 | Bacteria | 3544 |
| 818 | Ga0496114_0081228 | 3300048917 | Bacteria | 2738 |
| 819 | Ga0496114_0261175 | 3300048917 | Bacteria | 1525 |
| 820 | Ga0496114_0263381 | 3300048917 | Unclassified | 1518 |
| 821 | Ga0496115_0000516 | 3300048918 | Bacteria | 30049 |
| 822 | Ga0496115_0058722 | 3300048918 | Bacteria | 3096 |
| 823 | Ga0496115_0076461 | 3300048918 | Bacteria | 2721 |
| 824 | Ga0496115_0094861 | 3300048918 | Bacteria | 2441 |
| 825 | Ga0496115_0258383 | 3300048918 | Bacteria | 1433 |
| 826 | Ga0496115_0621253 | 3300048918 | Bacteria | 857 |
| 827 | Ga0501031_0079970 | 3300049568 | Bacteria | 2130 |
| 828 | Ga0501031_0135887 | 3300049568 | Bacteria | 1606 |
| 829 | Ga0501033_0093281 | 3300049570 | Bacteria | 2201 |
| 830 | Ga0501034_0753338 | 3300049571 | Bacteria | 869 |
| 831 | Ga0501036_0006569 | 3300049572 | Bacteria | 9445 |
| 832 | Ga0501036_0056924 | 3300049572 | Bacteria | 3312 |
| 833 | Ga0501036_0132843 | 3300049572 | Bacteria | 2100 |
| 834 | Ga0501036_0761701 | 3300049572 | Bacteria | 798 |
| 835 | Ga0501037_0007340 | 3300049573 | Bacteria | 8061 |
| 836 | Ga0501037_0253134 | 3300049573 | Bacteria | 1232 |
| 837 | Ga0501038_0008002 | 3300049574 | Bacteria | 9742 |
| 838 | Ga0501038_0022572 | 3300049574 | Bacteria | 5636 |
| 839 | Ga0501039_0007145 | 3300049575 | Bacteria | 8506 |
| 840 | Ga0501039_0007538 | 3300049575 | Bacteria | 8315 |
| 841 | Ga0501039_0087419 | 3300049575 | Bacteria | 2428 |
| 842 | Ga0501040_0002451 | 3300049576 | Bacteria | 11951 |
| 843 | Ga0501040_0125708 | 3300049576 | Bacteria | 1801 |
| 844 | Ga0501040_0134413 | 3300049576 | Bacteria | 1740 |
| 845 | Ga0501041_0005392 | 3300049577 | Bacteria | 7492 |
| 846 | Ga0501041_0060161 | 3300049577 | Bacteria | 2325 |
| 847 | Ga0501041_0069905 | 3300049577 | Bacteria | 2154 |
| 848 | Ga0501042_0000234 | 3300049578 | Bacteria | 26725 |
| 849 | Ga0501042_0005842 | 3300049578 | Bacteria | 7950 |
| 850 | Ga0501042_0674658 | 3300049578 | Bacteria | 751 |
| 851 | Ga0501043_0005686 | 3300049579 | Bacteria | 10043 |
| 852 | Ga0501046_0015071 | 3300049580 | Bacteria | 6500 |
| 853 | Ga0501046_0250843 | 3300049580 | Bacteria | 1303 |
| 854 | Ga0501047_0021853 | 3300049581 | Bacteria | 6144 |
| 855 | Ga0501048_0015195 | 3300049582 | Bacteria | 5688 |
| 856 | Ga0501067_0000441 | 3300049583 | Bacteria | 22733 |
| 857 | Ga0501067_0011138 | 3300049583 | Bacteria | 4974 |
| 858 | Ga0501067_0019403 | 3300049583 | Unclassified | 3763 |
| 859 | Ga0501067_0046738 | 3300049583 | Bacteria | 2402 |
| 860 | Ga0501068_0050954 | 3300049584 | Bacteria | 2503 |
| 861 | Ga0501068_0466793 | 3300049584 | Bacteria | 817 |
| 862 | Ga0501069_0002063 | 3300049585 | Bacteria | 10100 |
| 863 | Ga0501069_0002928 | 3300049585 | Bacteria | 8762 |
| 864 | Ga0501069_0002951 | 3300049585 | Bacteria | 8743 |
| 865 | Ga0501069_0024211 | 3300049585 | Bacteria | 3311 |
| 866 | Ga0501069_0032885 | 3300049585 | Bacteria | 2855 |
| 867 | Ga0501069_0113977 | 3300049585 | Bacteria | 1541 |
| 868 | Ga0501069_0156552 | 3300049585 | Bacteria | 1311 |
| 869 | Ga0501069_0482761 | 3300049585 | Bacteria | 738 |
| 870 | Ga0501070_0000336 | 3300049586 | Bacteria | 42631 |
| 871 | Ga0501070_0013670 | 3300049586 | Bacteria | 6838 |
| 872 | Ga0501070_0087800 | 3300049586 | Bacteria | 2574 |
| 873 | Ga0501071_0004444 | 3300049587 | Bacteria | 8897 |
| 874 | Ga0501071_0011395 | 3300049587 | Bacteria | 5989 |
| 875 | Ga0501071_0478911 | 3300049587 | Unclassified | 954 |
| 876 | Ga0501072_0026813 | 3300049588 | Bacteria | 4495 |
| 877 | Ga0501072_0040611 | 3300049588 | Bacteria | 3654 |
| 878 | Ga0501072_0041804 | 3300049588 | Bacteria | 3600 |
| 879 | Ga0501072_0194469 | 3300049588 | Bacteria | 1617 |
| 880 | Ga0501072_0203094 | 3300049588 | Unclassified | 1580 |
| 881 | Ga0501072_0337091 | 3300049588 | Bacteria | 1198 |
| 882 | Ga0501073_0076294 | 3300049589 | Unclassified | 2332 |
| 883 | Ga0501074_0010905 | 3300049590 | Bacteria | 6596 |
| 884 | Ga0501074_0040449 | 3300049590 | Bacteria | 3376 |
| 885 | Ga0501074_0306243 | 3300049590 | Bacteria | 1129 |
| 886 | Ga0501074_0546031 | 3300049590 | Bacteria | 820 |
| 887 | Ga0501075_0005653 | 3300049591 | Bacteria | 8555 |
| 888 | Ga0501075_0011369 | 3300049591 | Bacteria | 6301 |
| 889 | Ga0501076_0015847 | 3300049592 | Bacteria | 5702 |
| 890 | Ga0501076_0070691 | 3300049592 | Bacteria | 2791 |
| 891 | Ga0501076_0136809 | 3300049592 | Bacteria | 1989 |
| 892 | Ga0501076_0153553 | 3300049592 | Bacteria | 1873 |
| 893 | Ga0501077_0067737 | 3300049593 | Bacteria | 2263 |
| 894 | Ga0501079_0021233 | 3300049741 | Bacteria | 4965 |
| 895 | Ga0501079_0153833 | 3300049741 | Bacteria | 1793 |
| 896 | Ga0501079_0357642 | 3300049741 | Bacteria | 1144 |
| 897 | Ga0501080_0002879 | 3300049742 | Bacteria | 15130 |
| 898 | Ga0501080_0032445 | 3300049742 | Bacteria | 4871 |
| 899 | Ga0501080_0239354 | 3300049742 | Bacteria | 1657 |
| 900 | Ga0501080_0285579 | 3300049742 | Unclassified | 1499 |
| 901 | Ga0501080_0517965 | 3300049742 | Unclassified | 1064 |
| 902 | Ga0501081_0005592 | 3300049743 | Bacteria | 8118 |
| 903 | Ga0501081_0111404 | 3300049743 | Unclassified | 1942 |
| 904 | Ga0501081_0440565 | 3300049743 | Bacteria | 967 |
| 905 | Ga0501083_0017361 | 3300049744 | Bacteria | 5017 |
| 906 | Ga0501083_0223526 | 3300049744 | Bacteria | 1226 |
| 907 | Ga0501035_0051455 | 3300049822 | Bacteria | 3688 |
| 908 | Ga0501035_0293698 | 3300049822 | Bacteria | 1371 |
| 909 | Ga0501045_0000885 | 3300049824 | Bacteria | 19468 |
| 910 | Ga0501045_0082827 | 3300049824 | Bacteria | 2366 |
| 911 | Ga0501045_0095063 | 3300049824 | Bacteria | 2205 |
| 912 | Ga0501045_0302501 | 3300049824 | Bacteria | 1190 |
| 913 | nmdc:mga05p37_115638_c1 | 3300050507 | Bacteria | 3297 |
| 914 | nmdc:mga05p37_253952_c1 | 3300050507 | Bacteria | 2107 |
| 915 | nmdc:mga05p37_385545_c1 | 3300050507 | Bacteria | 1641 |
| 916 | nmdc:mga05p37_485714_c1 | 3300050507 | Unclassified | 1421 |
| 917 | nmdc:mga05p37_70792_c1 | 3300050507 | Bacteria | 4290 |
| 918 | nmdc:mga05p37_90554_c1 | 3300050507 | Bacteria | 3769 |
| 919 | nmdc:mga08y16_192999_c1 | 3300050511 | Archaea | 2112 |
| 920 | nmdc:mga08y16_56826_c1 | 3300050511 | Bacteria | 4089 |
| 921 | nmdc:mga08y16_673824_c1 | 3300050511 | Bacteria | 1036 |
| 922 | nmdc:mga0n895_22609_c1 | 3300050512 | Bacteria | 5898 |
| 923 | nmdc:mga0n895_252404_c1 | 3300050512 | Bacteria | 1790 |
| 924 | nmdc:mga0n895_402443_c1 | 3300050512 | Bacteria | 1384 |
| 925 | nmdc:mga0n895_788968_c1 | 3300050512 | Bacteria | 941 |
| 926 | nmdc:mga0rr50_219377_c1 | 3300050513 | Bacteria | 1570 |
| 927 | nmdc:mga0rr50_81643_c1 | 3300050513 | Bacteria | 2495 |
| 928 | nmdc:mga08x19_190111_c1 | 3300050514 | Bacteria | 1404 |
| 929 | nmdc:mga08x19_89279_c1 | 3300050514 | Bacteria | 2032 |
| 930 | nmdc:mga0a205_219684_c1 | 3300050515 | Bacteria | 1786 |
| 931 | nmdc:mga0a205_221338_c1 | 3300050515 | Bacteria | 1778 |
| 932 | nmdc:mga0a205_42550_c1 | 3300050515 | Bacteria | 4377 |
| 933 | Ga0495601_0014402 | 3300053077 | Bacteria | 4765 |
| 934 | Ga0495601_0222972 | 3300053077 | Bacteria | 1231 |
| 935 | Ga0495612_0125542 | 3300053078 | Bacteria | 1106 |
| 936 | Ga0495595_0006981 | 3300053084 | Bacteria | 4612 |
| 937 | Ga0495595_0058600 | 3300053084 | Bacteria | 1798 |
| 938 | Ga0495595_0138634 | 3300053084 | Bacteria | 1192 |
| 939 | Ga0495619_0005282 | 3300053085 | Bacteria | 8185 |
| 940 | Ga0495619_0008250 | 3300053085 | Bacteria | 6591 |
| 941 | Ga0495619_0121151 | 3300053085 | Bacteria | 1794 |
| 942 | Ga0495619_0207114 | 3300053085 | Unclassified | 1358 |
| 943 | Ga0495619_0684303 | 3300053085 | Bacteria | 698 |
| 944 | Ga0501084_0001593 | 3300054114 | Bacteria | 17970 |
| 945 | Ga0501084_0020358 | 3300054114 | Bacteria | 5532 |
| 946 | Ga0501084_0333313 | 3300054114 | Unclassified | 1281 |
| 947 | Ga0501084_0343635 | 3300054114 | Bacteria | 1260 |
| 948 | Ga0501084_0498687 | 3300054114 | Bacteria | 1029 |
| 949 | Ga0590075_057522 | 3300059424 | Bacteria | 1001 |
| 950 | Ga0501082_0010836 | 3300060353 | Bacteria | 7851 |
| 951 | Ga0501082_0015139 | 3300060353 | Bacteria | 6646 |
| 952 | Ga0501082_0066608 | 3300060353 | Unclassified | 3102 |
| 953 | Ga0501082_0085831 | 3300060353 | Bacteria | 2715 |
| 954 | Ga0501082_0226170 | 3300060353 | Bacteria | 1628 |
| 955 | Ga0501082_0677422 | 3300060353 | Bacteria | 903 |
| 956 | Ga0466962_0000681 | 3300061719 | Bacteria | 15108 |
| 957 | Ga0466962_0005492 | 3300061719 | Bacteria | 6095 |
| 958 | Ga0466962_0020139 | 3300061719 | Bacteria | 3206 |
| 959 | Ga0466962_0060403 | 3300061719 | Bacteria | 1809 |
| 960 | Ga0466962_0155068 | 3300061719 | Bacteria | 1112 |
| 961 | Ga0530510_0011213 | 3300061734 | Bacteria | 6289 |
| 962 | Ga0530510_0027001 | 3300061734 | Bacteria | 4112 |
| 963 | Ga0530510_0031452 | 3300061734 | Bacteria | 3816 |
| 964 | Ga0530510_0039674 | 3300061734 | Bacteria | 3399 |
| 965 | Ga0530510_0061566 | 3300061734 | Bacteria | 2717 |
| 966 | Ga0530510_0095664 | 3300061734 | Unclassified | 2170 |
| 967 | Ga0530510_0314526 | 3300061734 | Bacteria | 1173 |
| 968 | Ga0530510_0324962 | 3300061734 | Unclassified | 1153 |
| 969 | Ga0501070_0065388 | |||
| 970 | ARcpr5yngRDRAFT_c005838 | |||
| 971 | rootH1_10124033 | |||
| 972 | Ga0070658_10009263 | |||
| 973 | Ga0070658_10014198 | |||
| 974 | Ga0070658_10022247 | |||
| 975 | Ga0070676_10243061 | |||
| 976 | Ga0070676_10427949 | |||
| 977 | Ga0070683_100061658 | |||
| 978 | Ga0070683_100113019 | |||
| 979 | Ga0070683_100148962 | |||
| 980 | Ga0070683_100154437 | |||
| 981 | Ga0070683_100259323 | |||
| 982 | Ga0070683_100402860 | |||
| 983 | Ga0070683_100488292 | |||
| 984 | Ga0070683_100508080 | |||
| 985 | Ga0070683_100700450 | |||
| 986 | Ga0070670_100040987 | |||
| 987 | Ga0070670_100294906 | |||
| 988 | Ga0068869_100087340 | |||
| 989 | Ga0068869_100301274 | |||
| 990 | Ga0070680_100026798 | |||
| 991 | Ga0070680_100039300 | |||
| 992 | Ga0070680_100069087 | |||
| 993 | Ga0070680_100069416 | |||
| 994 | Ga0070680_100085864 | |||
| 995 | Ga0070680_100092401 | |||
| 996 | Ga0070680_100110737 | |||
| 997 | Ga0070680_100114340 | |||
| 998 | Ga0070680_100946967 | |||
| 999 | Ga0070682_100005200 | |||
| 1000 | Ga0070682_100086087 | |||
| 1001 | Ga0070682_100370342 | |||
| 1002 | Ga0068868_100216392 | |||
| 1003 | Ga0068868_100380835 | |||
| 1004 | Ga0070660_100000141 | |||
| 1005 | Ga0070660_100024992 | |||
| 1006 | Ga0070660_100045142 | |||
| 1007 | Ga0070660_100075437 | |||
| 1008 | Ga0070660_100269799 | |||
| 1009 | Ga0070660_100413957 | |||
| 1010 | Ga0070689_100137943 | |||
| 1011 | Ga0070691_10116554 | |||
| 1012 | Ga0070687_100393854 | |||
| 1013 | Ga0070661_100076595 | |||
| 1014 | Ga0070661_100085519 | |||
| 1015 | Ga0070661_100106742 | |||
| 1016 | Ga0070661_100256049 | |||
| 1017 | Ga0070692_10108630 | |||
| 1018 | Ga0070692_10119508 | |||
| 1019 | Ga0070692_10168488 | |||
| 1020 | Ga0070675_100037133 | |||
| 1021 | Ga0070675_100457647 | |||
| 1022 | Ga0070675_100546551 | |||
| 1023 | Ga0070671_100099125 | |||
| 1024 | Ga0070671_100156104 | |||
| 1025 | Ga0070671_100268051 | |||
| 1026 | Ga0070674_100004376 | |||
| 1027 | Ga0070674_100112366 | |||
| 1028 | Ga0070674_100297083 | |||
| 1029 | Ga0070673_100004322 | |||
| 1030 | Ga0070688_100039891 | |||
| 1031 | Ga0070659_100045334 | |||
| 1032 | Ga0070659_100107364 | |||
| 1033 | Ga0070659_100337007 | |||
| 1034 | Ga0070659_100479249 | |||
| 1035 | Ga0070659_100819718 | |||
| 1036 | Ga0070659_100884775 | |||
| 1037 | Ga0070667_100039410 | |||
| 1038 | Ga0070709_10631885 | |||
| 1039 | Ga0070714_100013238 | |||
| 1040 | Ga0070714_100161027 | |||
| 1041 | Ga0070714_100373210 | |||
| 1042 | Ga0070714_100385862 | |||
| 1043 | Ga0070714_100958465 | |||
| 1044 | Ga0070713_100008136 | |||
| 1045 | Ga0070713_100627023 | |||
| 1046 | Ga0070710_10005073 | |||
| 1047 | Ga0070701_10210323 | |||
| 1048 | Ga0070711_100008772 | |||
| 1049 | Ga0070711_100166806 | |||
| 1050 | Ga0070711_100196315 | |||
| 1051 | Ga0070705_100044011 | |||
| 1052 | Ga0070705_100091886 | |||
| 1053 | Ga0070700_100540348 | |||
| 1054 | Ga0070708_100020278 | |||
| 1055 | Ga0070708_100035433 | |||
| 1056 | Ga0070708_100287778 | |||
| 1057 | Ga0070708_100428461 | |||
| 1058 | Ga0070708_100490479 | |||
| 1059 | Ga0070678_100004460 | |||
| 1060 | Ga0070678_100407951 | |||
| 1061 | Ga0070662_100333096 | |||
| 1062 | Ga0070681_10010143 | |||
| 1063 | Ga0070681_10011312 | |||
| 1064 | Ga0070681_10016995 | |||
| 1065 | Ga0070681_10019208 | |||
| 1066 | Ga0070681_10019616 | |||
| 1067 | Ga0070681_10038511 | |||
| 1068 | Ga0070681_10041634 | |||
| 1069 | Ga0070681_10103926 | |||
| 1070 | Ga0070681_10239825 | |||
| 1071 | Ga0070681_10403916 | |||
| 1072 | Ga0070681_10663927 | |||
| 1073 | Ga0068867_100129312 | |||
| 1074 | Ga0068867_100408513 | |||
| 1075 | Ga0068867_100731562 | |||
| 1076 | Ga0070685_10009042 | |||
| 1077 | Ga0070706_100324394 | |||
| 1078 | Ga0070706_100626554 | |||
| 1079 | Ga0070706_100738479 | |||
| 1080 | Ga0070707_100127301 | |||
| 1081 | Ga0070707_100139317 | |||
| 1082 | Ga0070698_100021664 | |||
| 1083 | Ga0070698_100095683 | |||
| 1084 | Ga0070698_100161352 | |||
| 1085 | Ga0070699_100053597 | |||
| 1086 | Ga0070699_100067511 | |||
| 1087 | Ga0070679_100004270 | |||
| 1088 | Ga0070679_100006992 | |||
| 1089 | Ga0070679_100010498 | |||
| 1090 | Ga0070679_100091994 | |||
| 1091 | Ga0070679_100099303 | |||
| 1092 | Ga0070679_100132438 | |||
| 1093 | Ga0070679_100206936 | |||
| 1094 | Ga0070679_100217198 | |||
| 1095 | Ga0070679_100253219 | |||
| 1096 | Ga0070679_100254554 | |||
| 1097 | Ga0070684_100024170 | |||
| 1098 | Ga0070684_100041329 | |||
| 1099 | Ga0070684_100099385 | |||
| 1100 | Ga0070684_100142643 | |||
| 1101 | Ga0070684_100161435 | |||
| 1102 | Ga0070684_100415848 | |||
| 1103 | Ga0070684_100512999 | |||
| 1104 | Ga0070684_100602490 | |||
| 1105 | Ga0070697_100319665 | |||
| 1106 | Ga0068853_100164163 | |||
| 1107 | Ga0068853_100266946 | |||
| 1108 | Ga0070672_100407910 | |||
| 1109 | Ga0070696_100209381 | |||
| 1110 | Ga0070696_100242834 | |||
| 1111 | Ga0070696_100262286 | |||
| 1112 | Ga0070693_100225249 | |||
| 1113 | Ga0070693_100343185 | |||
| 1114 | Ga0070665_100127287 | |||
| 1115 | Ga0070665_100292857 | |||
| 1116 | Ga0070665_100306623 | |||
| 1117 | Ga0070704_100520669 | |||
| 1118 | Ga0070704_100548511 | |||
| 1119 | Ga0070704_100586817 | |||
| 1120 | Ga0070704_100889435 | |||
| 1121 | Ga0068855_100013855 | |||
| 1122 | Ga0068855_100036700 | |||
| 1123 | Ga0068855_100068208 | |||
| 1124 | Ga0068855_100461178 | |||
| 1125 | Ga0068855_100543685 | |||
| 1126 | Ga0068855_100778154 | |||
| 1127 | Ga0070664_100364114 | |||
| 1128 | Ga0068857_100010455 | |||
| 1129 | Ga0068857_100065971 | |||
| 1130 | Ga0068857_100091854 | |||
| 1131 | Ga0068857_100092415 | |||
| 1132 | Ga0068854_100400282 | |||
| 1133 | Ga0068856_100060773 | |||
| 1134 | Ga0068856_100439530 | |||
| 1135 | Ga0068856_100610528 | |||
| 1136 | Ga0070702_100142474 | |||
| 1137 | Ga0070702_100652543 | |||
| 1138 | Ga0068852_100035592 | |||
| 1139 | Ga0068852_100304103 | |||
| 1140 | Ga0068852_100306213 | |||
| 1141 | Ga0068852_100558882 | |||
| 1142 | Ga0068859_100068053 | |||
| 1143 | Ga0068864_100005593 | |||
| 1144 | Ga0068866_10006435 | |||
| 1145 | Ga0068870_10026164 | |||
| 1146 | Ga0068870_10035405 | |||
| 1147 | Ga0068870_10038120 | |||
| 1148 | Ga0068862_100355516 | |||
| 1149 | Ga0081455_10054633 | |||
| 1150 | Ga0081455_10054685 | |||
| 1151 | Ga0081540_1064907 | |||
| 1152 | Ga0070717_10060585 | |||
| 1153 | Ga0070717_10280969 | |||
| 1154 | Ga0070717_10304560 | |||
| 1155 | Ga0070717_10321332 | |||
| 1156 | Ga0070717_10487805 | |||
| 1157 | Ga0070717_10620105 | |||
| 1158 | Ga0070715_10002136 | |||
| 1159 | Ga0070715_10048819 | |||
| 1160 | Ga0070716_100436485 | |||
| 1161 | Ga0070716_100708186 | |||
| 1162 | Ga0070712_100049442 | |||
| 1163 | Ga0070712_100154288 | |||
| 1164 | Ga0070712_100255454 | |||
| 1165 | Ga0070712_100523522 | |||
| 1166 | Ga0097621_100774682 | |||
| 1167 | Ga0068871_100596811 | |||
| 1168 | Ga0075428_100332071 | |||
| 1169 | Ga0075428_100997892 | |||
| 1170 | Ga0075433_10060802 | |||
| 1171 | Ga0075433_10145159 | |||
| 1172 | Ga0075433_10196308 | |||
| 1173 | Ga0075434_100000856 | |||
| 1174 | Ga0075434_100046314 | |||
| 1175 | Ga0075434_100090943 | |||
| 1176 | Ga0075434_100206118 | |||
| 1177 | Ga0075434_100432845 | |||
| 1178 | Ga0068865_100117874 | |||
| 1179 | Ga0068865_100254118 | |||
| 1180 | Ga0068865_100467797 | |||
| 1181 | Ga0075436_100110287 | |||
| 1182 | Ga0097620_100068047 | |||
| 1183 | Ga0075435_100033871 | |||
| 1184 | Ga0075435_100048799 | |||
| 1185 | Ga0075435_100298528 | |||
| 1186 | Ga0105250_10206688 | |||
| 1187 | Ga0105240_10214101 | |||
| 1188 | Ga0105240_10226762 | |||
| 1189 | Ga0105240_10321672 | |||
| 1190 | Ga0105240_10447591 | |||
| 1191 | Ga0105240_10587907 | |||
| 1192 | Ga0105240_10853715 | |||
| 1193 | Ga0111539_10044976 | |||
| 1194 | Ga0111539_10079526 | |||
| 1195 | Ga0111539_10130152 | |||
| 1196 | Ga0111539_10141918 | |||
| 1197 | Ga0111539_10905987 | |||
| 1198 | Ga0105245_10018193 | |||
| 1199 | Ga0105245_10091983 | |||
| 1200 | Ga0105245_10100430 | |||
| 1201 | Ga0105245_10189494 | |||
| 1202 | Ga0105245_10295660 | |||
| 1203 | Ga0105245_10954438 | |||
| 1204 | Ga0105245_11038860 | |||
| 1205 | Ga0114129_10037661 | |||
| 1206 | Ga0114129_10104085 | |||
| 1207 | Ga0114129_10128810 | |||
| 1208 | Ga0114129_10149913 | |||
| 1209 | Ga0114129_10194214 | |||
| 1210 | Ga0105243_10060594 | |||
| 1211 | Ga0105243_10134530 | |||
| 1212 | Ga0105243_10188686 | |||
| 1213 | Ga0105243_10378785 | |||
| 1214 | Ga0105243_10391045 | |||
| 1215 | Ga0105242_10046732 | |||
| 1216 | Ga0105242_10608878 | |||
| 1217 | Ga0105248_10554847 | |||
| 1218 | Ga0105248_10707338 | |||
| 1219 | Ga0105237_10124095 | |||
| 1220 | Ga0105237_10539385 | |||
| 1221 | Ga0105238_10027641 | |||
| 1222 | Ga0105238_10100867 | |||
| 1223 | Ga0105249_11043727 | |||
| 1224 | Ga0105239_10067620 | |||
| 1225 | Ga0105239_10697127 | |||
| 1226 | Ga0105246_10162316 | |||
| 1227 | Ga0105246_10204979 | |||
| 1228 | Ga0157373_10260045 | |||
| 1229 | Ga0157370_10038941 | |||
| 1230 | Ga0157370_10042293 | |||
| 1231 | Ga0157370_10070379 | |||
| 1232 | Ga0157370_10121797 | |||
| 1233 | Ga0157370_10572336 | |||
| 1234 | Ga0157369_10003174 | |||
| 1235 | Ga0157369_10007800 | |||
| 1236 | Ga0157369_10020636 | |||
| 1237 | Ga0157369_10099309 | |||
| 1238 | Ga0157369_10282203 | |||
| 1239 | Ga0157369_10408043 | |||
| 1240 | Ga0157369_11312754 | |||
| 1241 | Ga0157374_10035733 | |||
| 1242 | Ga0157374_10035761 | |||
| 1243 | Ga0157374_10342973 | |||
| 1244 | Ga0157374_10429045 | |||
| 1245 | Ga0157374_10561280 | |||
| 1246 | Ga0157372_10037542 | |||
| 1247 | Ga0157372_10042481 | |||
| 1248 | Ga0157372_10113628 | |||
| 1249 | Ga0157372_10202832 | |||
| 1250 | Ga0157372_10203257 | |||
| 1251 | Ga0157372_10218808 | |||
| 1252 | Ga0157372_10836054 | |||
| 1253 | Ga0157375_10509514 | |||
| 1254 | Ga0163163_10050633 | |||
| 1255 | Ga0182008_10132073 | |||
| 1256 | Ga0157377_10120260 | |||
| 1257 | Ga0157377_10177680 | |||
| 1258 | Ga0157377_10184904 | |||
| 1259 | Ga0157377_10274657 | |||
| 1260 | Ga0157376_10004382 | |||
| 1261 | Ga0157376_10118346 | |||
| 1262 | Ga0197907_10523178 | |||
| 1263 | Ga0206356_10952328 | |||
| 1264 | Ga0206354_10326775 | |||
| 1265 | Ga0206354_10880655 | |||
| 1266 | Ga0206354_11636846 | |||
| 1267 | Ga0206353_10078595 | |||
| 1268 | Ga0206353_10273473 | |||
| 1269 | Ga0206353_10919582 | |||
| 1270 | Ga0206353_11754634 | |||
| 1271 | Ga0206353_12055637 | |||
| 1272 | Ga0213875_10216983 | |||
| 1273 | Ga0207692_10025468 | |||
| 1274 | Ga0207688_10109466 | |||
| 1275 | Ga0207688_10157381 | |||
| 1276 | Ga0207688_10178379 | |||
| 1277 | Ga0207688_10329181 | |||
| 1278 | Ga0207699_10047512 | |||
| 1279 | Ga0207643_10055240 | |||
| 1280 | Ga0207643_10064888 | |||
| 1281 | Ga0207643_10135230 | |||
| 1282 | Ga0207705_10015626 | |||
| 1283 | Ga0207705_10117488 | |||
| 1284 | Ga0207705_10222360 | |||
| 1285 | Ga0207684_10835336 | |||
| 1286 | Ga0207654_10564774 | |||
| 1287 | Ga0207707_10003449 | |||
| 1288 | Ga0207707_10018119 | |||
| 1289 | Ga0207707_10037958 | |||
| 1290 | Ga0207707_10047308 | |||
| 1291 | Ga0207707_10087046 | |||
| 1292 | Ga0207707_10109594 | |||
| 1293 | Ga0207707_10130480 | |||
| 1294 | Ga0207707_10143146 | |||
| 1295 | Ga0207707_10575164 | |||
| 1296 | Ga0207707_10631519 | |||
| 1297 | Ga0207695_10113214 | |||
| 1298 | Ga0207671_10189613 | |||
| 1299 | Ga0207693_10002632 | |||
| 1300 | Ga0207693_10015956 | |||
| 1301 | Ga0207693_10023757 | |||
| 1302 | Ga0207693_10037906 | |||
| 1303 | Ga0207663_10016445 | |||
| 1304 | Ga0207663_10035143 | |||
| 1305 | Ga0207663_10224132 | |||
| 1306 | Ga0207660_10030754 | |||
| 1307 | Ga0207660_10063744 | |||
| 1308 | Ga0207660_10071772 | |||
| 1309 | Ga0207660_10088801 | |||
| 1310 | Ga0207660_10195025 | |||
| 1311 | Ga0207660_10213397 | |||
| 1312 | Ga0207657_10000109 | |||
| 1313 | Ga0207657_10000325 | |||
| 1314 | Ga0207657_10000392 | |||
| 1315 | Ga0207657_10004556 | |||
| 1316 | Ga0207657_10005779 | |||
| 1317 | Ga0207657_10170948 | |||
| 1318 | Ga0207657_10221303 | |||
| 1319 | Ga0207657_10595780 | |||
| 1320 | Ga0207657_10597366 | |||
| 1321 | Ga0207657_10651131 | |||
| 1322 | Ga0207649_10040825 | |||
| 1323 | Ga0207649_10060092 | |||
| 1324 | Ga0207649_10445693 | |||
| 1325 | Ga0207652_10033006 | |||
| 1326 | Ga0207652_10050142 | |||
| 1327 | Ga0207652_10087679 | |||
| 1328 | Ga0207652_10114291 | |||
| 1329 | Ga0207652_10142786 | |||
| 1330 | Ga0207652_10192353 | |||
| 1331 | Ga0207652_10221857 | |||
| 1332 | Ga0207652_10556286 | |||
| 1333 | Ga0207646_10029716 | |||
| 1334 | Ga0207646_10515185 | |||
| 1335 | Ga0207694_10172523 | |||
| 1336 | Ga0207694_10589898 | |||
| 1337 | Ga0207650_10013242 | |||
| 1338 | Ga0207650_10028716 | |||
| 1339 | Ga0207659_10039607 | |||
| 1340 | Ga0207659_10077850 | |||
| 1341 | Ga0207659_10098028 | |||
| 1342 | Ga0207687_10032336 | |||
| 1343 | Ga0207687_10192677 | |||
| 1344 | Ga0207687_10628549 | |||
| 1345 | Ga0207687_10654309 | |||
| 1346 | Ga0207700_10000001 | |||
| 1347 | Ga0207700_10175000 | |||
| 1348 | Ga0207664_10003680 | |||
| 1349 | Ga0207664_10019393 | |||
| 1350 | Ga0207664_10168919 | |||
| 1351 | Ga0207664_10297933 | |||
| 1352 | Ga0207664_10349047 | |||
| 1353 | Ga0207664_10354340 | |||
| 1354 | Ga0207644_10235969 | |||
| 1355 | Ga0207644_10538955 | |||
| 1356 | Ga0207690_10035414 | |||
| 1357 | Ga0207690_10067293 | |||
| 1358 | Ga0207690_10342636 | |||
| 1359 | Ga0207686_10047340 | |||
| 1360 | Ga0207686_10090298 | |||
| 1361 | Ga0207686_10104212 | |||
| 1362 | Ga0207709_10053617 | |||
| 1363 | Ga0207709_10212256 | |||
| 1364 | Ga0207709_10349500 | |||
| 1365 | Ga0207709_10515551 | |||
| 1366 | Ga0207670_10200985 | |||
| 1367 | Ga0207669_10001844 | |||
| 1368 | Ga0207669_10036314 | |||
| 1369 | Ga0207669_10046341 | |||
| 1370 | Ga0207665_10000420 | |||
| 1371 | Ga0207665_10243482 | |||
| 1372 | Ga0207665_10446102 | |||
| 1373 | Ga0207691_10254130 | |||
| 1374 | Ga0207691_10347968 | |||
| 1375 | Ga0207711_10345287 | |||
| 1376 | Ga0207689_10082078 | |||
| 1377 | Ga0207689_10230626 | |||
| 1378 | Ga0207661_10052857 | |||
| 1379 | Ga0207661_10075877 | |||
| 1380 | Ga0207661_10078742 | |||
| 1381 | Ga0207661_10135711 | |||
| 1382 | Ga0207661_10354207 | |||
| 1383 | Ga0207661_10567943 | |||
| 1384 | Ga0207661_10680975 | |||
| 1385 | Ga0207679_10120464 | |||
| 1386 | Ga0207667_10036631 | |||
| 1387 | Ga0207667_10046561 | |||
| 1388 | Ga0207667_10547983 | |||
| 1389 | Ga0207667_10607187 | |||
| 1390 | Ga0207667_10764574 | |||
| 1391 | Ga0207651_10062973 | |||
| 1392 | Ga0207712_10297007 | |||
| 1393 | Ga0207668_10122476 | |||
| 1394 | Ga0207658_10042144 | |||
| 1395 | Ga0207677_10407865 | |||
| 1396 | Ga0207639_10180560 | |||
| 1397 | Ga0207639_10190061 | |||
| 1398 | Ga0207639_10236399 | |||
| 1399 | Ga0207708_10088719 | |||
| 1400 | Ga0207708_10094880 | |||
| 1401 | Ga0207708_10505203 | |||
| 1402 | Ga0207702_10074079 | |||
| 1403 | Ga0207702_10464080 | |||
| 1404 | Ga0207702_10762767 | |||
| 1405 | Ga0207702_11157915 | |||
| 1406 | Ga0207641_10799984 | |||
| 1407 | Ga0207648_10140154 | |||
| 1408 | Ga0207674_10028144 | |||
| 1409 | Ga0207674_10030435 | |||
| 1410 | Ga0207674_10077100 | |||
| 1411 | Ga0207674_10485576 | |||
| 1412 | Ga0207675_100201305 | |||
| 1413 | Ga0207675_100286147 | |||
| 1414 | Ga0207683_10039793 | |||
| 1415 | Ga0207683_10128024 | |||
| 1416 | Ga0207698_10456017 | |||
| 1417 | Ga0207698_10519468 | |||
| 1418 | Ga0207698_10773585 | |||
| 1419 | Ga0207428_10329495 | |||
| 1420 | Ga0268266_10070810 | |||
| 1421 | Ga0268266_10166631 | |||
| 1422 | Ga0265319_1041552 | |||
| 1423 | Ga0265319_1055798 | |||
| 1424 | Ga0265318_10036741 | |||
| 1425 | Ga0265322_10019676 | |||
| 1426 | Ga0265338_10005706 | |||
| 1427 | Ga0265338_10109819 | |||
| 1428 | Ga0265338_10137658 | |||
| 1429 | Ga0265338_10215297 | |||
| 1430 | Ga0265330_10054771 | |||
| 1431 | Ga0265325_10036263 | |||
| 1432 | Ga0265339_10237437 | |||
| 1433 | Ga0265327_10009587 | |||
| 1434 | Ga0265327_10022852 | |||
| 1435 | Ga0265327_10038359 | |||
| 1436 | Ga0265316_10013780 | |||
| 1437 | Ga0265316_10160370 | |||
| 1438 | Ga0265316_10338148 | |||
| 1439 | Ga0265313_10003420 | |||
| 1440 | Ga0265313_10052378 | |||
| 1441 | Ga0265313_10172203 | |||
| 1442 | Ga0265314_10015476 | |||
| 1443 | Ga0265314_10209706 | |||
| 1444 | Ga0307405_10671464 | |||
| 1445 | Ga0307413_10634953 | |||
| 1446 | Ga0307412_10255665 | |||
| 1447 | Ga0307409_100067092 | |||
| 1448 | Ga0307409_100166591 | |||
| 1449 | Ga0307409_100322288 | |||
| 1450 | Ga0307416_100112938 | |||
| 1451 | Ga0307416_100275487 | |||
| 1452 | Ga0307416_100349707 | |||
| 1453 | Ga0307416_100691924 | |||
| 1454 | Ga0307416_100734622 | |||
| 1455 | Ga0307416_101237819 | |||
| 1456 | Ga0307415_100232024 | |||
| 1457 | Ga0373938_0037760 | |||
| 1458 | Ga0373926_0028125 | |||
| 1459 | Ga0373944_0002757 | |||
| 1460 | Ga0373936_0019516 | |||
| 1461 | Ga0373960_0019706 | |||
| 1462 | Ga0373943_0002270 | |||
| 1463 | Ga0373943_0002605 | |||
| 1464 | Ga0373943_0017086 | |||
| 1465 | Ga0373946_0005213 | |||
| 1466 | Ga0373961_0002107 | |||
| 1467 | Ga0373924_0050298 | |||
| 1468 | Ga0373931_0043351 | |||
| 1469 | Ga0373931_0129964 | |||
| 1470 | Ga0373931_0133184 | |||
| 1471 | Ga0373935_0010709 | |||
| 1472 | Ga0373927_0227515 | |||
| 1473 | Ga0373947_0004295 | |||
| 1474 | Ga0373947_0006306 | |||
| 1475 | Ga0373937_0018964 | |||
| 1476 | Ga0373925_0009496 | |||
| 1477 | Ga0373925_0012976 | |||
| 1478 | Ga0373925_0060588 | |||
| 1479 | Ga0395899_0044108 | |||
| 1480 | Ga0395899_0066065 | |||
| 1481 | Ga0395899_0078142 | |||
| 1482 | Ga0395899_0078284 | |||
| 1483 | Ga0395899_0654611 | |||
| 1484 | Ga0395900_0021514 | |||
| 1485 | Ga0395900_0026867 | |||
| 1486 | Ga0395900_0038495 | |||
| 1487 | Ga0395900_0044163 | |||
| 1488 | Ga0395900_0055461 | |||
| 1489 | Ga0395900_0126952 | |||
| 1490 | Ga0395900_0251551 | |||
| 1491 | Ga0395900_0367183 | |||
| 1492 | Ga0395900_0450252 | |||
| 1493 | Ga0395900_0585211 | |||
| 1494 | Ga0395900_0668039 | |||
| 1495 | Ga0395900_0840859 | |||
| 1496 | Ga0395900_0967026 | |||
| 1497 | Ga0395898_0000734 | |||
| 1498 | Ga0395898_0047977 | |||
| 1499 | Ga0395898_0058255 | |||
| 1500 | Ga0395898_0139424 | |||
| 1501 | Ga0395898_0142971 | |||
| 1502 | Ga0395898_0176553 | |||
| 1503 | Ga0395898_0263549 | |||
| 1504 | Ga0395898_0286313 | |||
| 1505 | Ga0395898_0436843 | |||
| 1506 | Ga0395898_0456870 | |||
| 1507 | Ga0395898_0604326 | |||
| 1508 | Ga0395898_0674366 | |||
| 1509 | Ga0395898_0853872 | |||
| 1510 | Ga0395905_0076570 | |||
| 1511 | Ga0395905_0112821 | |||
| 1512 | Ga0395905_0210917 | |||
| 1513 | Ga0395905_0218593 | |||
| 1514 | Ga0395905_0262861 | |||
| 1515 | Ga0395905_0311565 | |||
| 1516 | Ga0395905_0380684 | |||
| 1517 | Ga0395905_0541267 | |||
| 1518 | Ga0436364_0118239 | |||
| 1519 | Ga0395901_0008579 | |||
| 1520 | Ga0395901_0009547 | |||
| 1521 | Ga0395901_0018425 | |||
| 1522 | Ga0395901_0024554 | |||
| 1523 | Ga0395901_0030426 | |||
| 1524 | Ga0395901_0071540 | |||
| 1525 | Ga0395901_0140198 | |||
| 1526 | Ga0395901_0245321 | |||
| 1527 | Ga0395901_0601744 | |||
| 1528 | Ga0395901_0971884 | |||
| 1529 | Ga0436365_1686693 | |||
| 1530 | Ga0436360_0741409 | |||
| 1531 | Ga0436360_1127993 | |||
| 1532 | Ga0436363_0072152 | |||
| 1533 | Ga0436363_0810503 | |||
| 1534 | Ga0436362_0477997 | |||
| 1535 | Ga0439461_0029059 | |||
| 1536 | Ga0439466_0092353 | |||
| 1537 | Ga0451839_0633760 | |||
| 1538 | Ga0451853_3726911 | |||
| 1539 | Ga0439433_0006418 | |||
| 1540 | Ga0439437_002107 | |||
| 1541 | Ga0439462_0008846 | |||
| 1542 | Ga0439446_0001570 | |||
| 1543 | Ga0439446_0015700 | |||
| 1544 | Ga0439434_0009365 | |||
| 1545 | Ga0450918_010134 | |||
| 1546 | Ga0451577_0797908 | |||
| 1547 | Ga0466969_0001492 | |||
| 1548 | Ga0466969_0065900 | |||
| 1549 | Ga0466966_0027033 | |||
| 1550 | Ga0466966_0030445 | |||
| 1551 | Ga0466961_0006192 | |||
| 1552 | Ga0466961_0017370 | |||
| 1553 | Ga0466961_0034206 | |||
| 1554 | Ga0466961_0241091 | |||
| 1555 | Ga0466961_0249123 | |||
| 1556 | Ga0466961_0402219 | |||
| 1557 | Ga0466963_0000920 | |||
| 1558 | Ga0466963_0001756 | |||
| 1559 | Ga0466963_0005751 | |||
| 1560 | Ga0466963_0007483 | |||
| 1561 | Ga0466963_0031583 | |||
| 1562 | Ga0466963_0051662 | |||
| 1563 | Ga0466963_0069983 | |||
| 1564 | Ga0466963_0072407 | |||
| 1565 | Ga0466963_0411625 | |||
| 1566 | Ga0466963_0423799 | |||
| 1567 | Ga0466964_0011711 | |||
| 1568 | Ga0466964_0029782 | |||
| 1569 | Ga0466964_0062289 | |||
| 1570 | Ga0466964_0091662 | |||
| 1571 | Ga0466964_0107164 | |||
| 1572 | Ga0466971_0010097 | |||
| 1573 | Ga0466971_0045428 | |||
| 1574 | Ga0466971_0056857 | |||
| 1575 | Ga0466957_0002635 | |||
| 1576 | Ga0466957_0173551 | |||
| 1577 | Ga0466957_0217979 | |||
| 1578 | Ga0466960_0017316 | |||
| 1579 | Ga0466959_0011136 | |||
| 1580 | Ga0466959_0021632 | |||
| 1581 | Ga0466959_0028325 | |||
| 1582 | Ga0466959_0075240 | |||
| 1583 | Ga0466959_0076025 | |||
| 1584 | Ga0466958_0010546 | |||
| 1585 | Ga0466958_0028733 | |||
| 1586 | Ga0466958_0040565 | |||
| 1587 | Ga0466958_0136470 | |||
| 1588 | Ga0466958_0170145 | |||
| 1589 | Ga0466958_0327693 | |||
| 1590 | Ga0466958_0349482 | |||
| 1591 | Ga0466958_0549636 | |||
| 1592 | Ga0466967_0000981 | |||
| 1593 | Ga0466967_0010558 | |||
| 1594 | Ga0466967_0017094 | |||
| 1595 | Ga0466967_0018052 | |||
| 1596 | Ga0466967_0055904 | |||
| 1597 | Ga0466967_0078124 | |||
| 1598 | Ga0466967_0085101 | |||
| 1599 | Ga0466967_0085663 | |||
| 1600 | Ga0466967_0086194 | |||
| 1601 | Ga0466967_0315558 | |||
| 1602 | Ga0466967_0483600 | |||
| 1603 | Ga0466967_0604682 | |||
| 1604 | Ga0495592_0003791 | |||
| 1605 | Ga0495592_0089887 | |||
| 1606 | Ga0495592_0257108 | |||
| 1607 | Ga0495629_0011568 | |||
| 1608 | Ga0495629_0080537 | |||
| 1609 | Ga0495629_0155733 | |||
| 1610 | Ga0495641_0004513 | |||
| 1611 | Ga0495651_0035164 | |||
| 1612 | Ga0495651_0066162 | |||
| 1613 | Ga0495651_0113468 | |||
| 1614 | Ga0495651_0294953 | |||
| 1615 | Ga0495653_0043753 | |||
| 1616 | Ga0495653_0150988 | |||
| 1617 | Ga0495582_0000257 | |||
| 1618 | Ga0495582_0123871 | |||
| 1619 | Ga0495582_0123990 | |||
| 1620 | Ga0495639_0010906 | |||
| 1621 | Ga0495662_0005108 | |||
| 1622 | Ga0495662_0211202 | |||
| 1623 | Ga0495664_0025737 | |||
| 1624 | Ga0495594_0029611 | |||
| 1625 | Ga0495608_0073474 | |||
| 1626 | Ga0495608_0242859 | |||
| 1627 | Ga0495608_0336107 | |||
| 1628 | Ga0495628_0007369 | |||
| 1629 | Ga0495628_0329897 | |||
| 1630 | Ga0495630_0032971 | |||
| 1631 | Ga0495630_0055571 | |||
| 1632 | Ga0495630_0076366 | |||
| 1633 | Ga0495630_0102125 | |||
| 1634 | Ga0495630_0333467 | |||
| 1635 | Ga0495644_0223439 | |||
| 1636 | Ga0495652_0036009 | |||
| 1637 | Ga0495652_0190217 | |||
| 1638 | Ga0495652_0260177 | |||
| 1639 | Ga0495665_0000792 | |||
| 1640 | Ga0495665_0138214 | |||
| 1641 | Ga0495640_0037570 | |||
| 1642 | Ga0495640_0311035 | |||
| 1643 | Ga0495587_0246714 | |||
| 1644 | Ga0495598_0063270 | |||
| 1645 | Ga0495598_0158844 | |||
| 1646 | Ga0495645_0038607 | |||
| 1647 | Ga0495645_0113754 | |||
| 1648 | Ga0495645_0372908 | |||
| 1649 | Ga0495667_0057785 | |||
| 1650 | Ga0495667_0101563 | |||
| 1651 | Ga0495667_0210199 | |||
| 1652 | Ga0495634_0211166 | |||
| 1653 | Ga0495635_0096077 | |||
| 1654 | Ga0495635_0121259 | |||
| 1655 | Ga0495659_0087330 | |||
| 1656 | Ga0495657_0024246 | |||
| 1657 | Ga0495657_0093456 | |||
| 1658 | Ga0495657_0105218 | |||
| 1659 | Ga0495599_0029606 | |||
| 1660 | Ga0495599_0033185 | |||
| 1661 | Ga0495599_0085683 | |||
| 1662 | Ga0495646_0070507 | |||
| 1663 | Ga0495647_0031956 | |||
| 1664 | Ga0495658_0001295 | |||
| 1665 | Ga0495658_0002040 | |||
| 1666 | Ga0495658_0330822 | |||
| 1667 | Ga0495658_0426264 | |||
| 1668 | Ga0495613_0010420 | |||
| 1669 | Ga0495613_0071957 | |||
| 1670 | Ga0495613_0373177 | |||
| 1671 | Ga0495624_0401972 | |||
| 1672 | Ga0495589_0118856 | |||
| 1673 | Ga0495600_0046393 | |||
| 1674 | Ga0495600_0067172 | |||
| 1675 | Ga0495600_0196928 | |||
| 1676 | Ga0495581_0002821 | |||
| 1677 | Ga0495604_0018967 | |||
| 1678 | Ga0495604_0206890 | |||
| 1679 | Ga0495674_0009918 | |||
| 1680 | Ga0495674_0066320 | |||
| 1681 | Ga0495674_0236317 | |||
| 1682 | Ga0495674_0356551 | |||
| 1683 | Ga0495676_0000193 | |||
| 1684 | Ga0495676_0159483 | |||
| 1685 | Ga0495680_0003689 | |||
| 1686 | Ga0495680_0050051 | |||
| 1687 | Ga0495680_0084715 | |||
| 1688 | Ga0495680_0433347 | |||
| 1689 | Ga0495675_0101988 | |||
| 1690 | Ga0495684_0028325 | |||
| 1691 | Ga0495684_0147848 | |||
| 1692 | Ga0495593_0003920 | |||
| 1693 | Ga0495593_0149622 | |||
| 1694 | Ga0495602_0064594 | |||
| 1695 | Ga0495602_0066515 | |||
| 1696 | Ga0495602_0152774 | |||
| 1697 | Ga0495614_0014067 | |||
| 1698 | Ga0495614_0309765 | |||
| 1699 | Ga0496100_0012031 | |||
| 1700 | Ga0496100_0013077 | |||
| 1701 | Ga0496100_0021223 | |||
| 1702 | Ga0496100_0117159 | |||
| 1703 | Ga0496100_0149309 | |||
| 1704 | Ga0496100_0170574 | |||
| 1705 | Ga0496100_1301607 | |||
| 1706 | Ga0496101_0005342 | |||
| 1707 | Ga0496101_0011996 | |||
| 1708 | Ga0496101_0015799 | |||
| 1709 | Ga0496101_0096614 | |||
| 1710 | Ga0496101_0107589 | |||
| 1711 | Ga0496101_0286906 | |||
| 1712 | Ga0496102_0034725 | |||
| 1713 | Ga0496102_0036770 | |||
| 1714 | Ga0496102_0071015 | |||
| 1715 | Ga0496102_0191987 | |||
| 1716 | Ga0496102_0250277 | |||
| 1717 | Ga0496102_0445349 | |||
| 1718 | Ga0496102_0692671 | |||
| 1719 | Ga0496103_0024000 | |||
| 1720 | Ga0496103_0095364 | |||
| 1721 | Ga0496103_0115423 | |||
| 1722 | Ga0496103_0245203 | |||
| 1723 | Ga0496104_0002397 | |||
| 1724 | Ga0496104_0122293 | |||
| 1725 | Ga0496104_0837373 | |||
| 1726 | Ga0496105_0033671 | |||
| 1727 | Ga0496105_0044703 | |||
| 1728 | Ga0496105_0055182 | |||
| 1729 | Ga0496106_0008396 | |||
| 1730 | Ga0496106_0017578 | |||
| 1731 | Ga0496106_0018196 | |||
| 1732 | Ga0496106_0075051 | |||
| 1733 | Ga0496106_0151236 | |||
| 1734 | Ga0496106_0417161 | |||
| 1735 | Ga0496106_0456010 | |||
| 1736 | Ga0496106_0654876 | |||
| 1737 | Ga0496106_0692057 | |||
| 1738 | Ga0496107_0006357 | |||
| 1739 | Ga0496107_0010172 | |||
| 1740 | Ga0496107_0049700 | |||
| 1741 | Ga0496107_0079973 | |||
| 1742 | Ga0496107_0104832 | |||
| 1743 | Ga0496107_0277818 | |||
| 1744 | Ga0496107_0568042 | |||
| 1745 | Ga0496108_0077814 | |||
| 1746 | Ga0496109_0001455 | |||
| 1747 | Ga0496109_0014627 | |||
| 1748 | Ga0496109_0096697 | |||
| 1749 | Ga0496109_0169845 | |||
| 1750 | Ga0496109_0252324 | |||
| 1751 | Ga0496109_0397558 | |||
| 1752 | Ga0496109_0403964 | |||
| 1753 | Ga0496109_0422805 | |||
| 1754 | Ga0496109_0560052 | |||
| 1755 | Ga0496109_0572389 | |||
| 1756 | Ga0496109_1340298 | |||
| 1757 | Ga0496109_1490324 | |||
| 1758 | Ga0496110_0004243 | |||
| 1759 | Ga0496110_0039332 | |||
| 1760 | Ga0496110_0072147 | |||
| 1761 | Ga0496110_0112496 | |||
| 1762 | Ga0496110_0121397 | |||
| 1763 | Ga0496110_0277176 | |||
| 1764 | Ga0496110_0322002 | |||
| 1765 | Ga0496110_0390575 | |||
| 1766 | Ga0496110_0455875 | |||
| 1767 | Ga0496110_0812358 | |||
| 1768 | Ga0496111_0004777 | |||
| 1769 | Ga0496111_0006341 | |||
| 1770 | Ga0496111_0019125 | |||
| 1771 | Ga0496111_0083309 | |||
| 1772 | Ga0496111_0402660 | |||
| 1773 | Ga0496111_0645437 | |||
| 1774 | Ga0496112_0024833 | |||
| 1775 | Ga0496112_0068434 | |||
| 1776 | Ga0496112_0084995 | |||
| 1777 | Ga0496112_0102851 | |||
| 1778 | Ga0496112_0240461 | |||
| 1779 | Ga0496112_0382720 | |||
| 1780 | Ga0496112_1053067 | |||
| 1781 | Ga0496113_0059650 | |||
| 1782 | Ga0496113_0569643 | |||
| 1783 | Ga0496114_0009965 | |||
| 1784 | Ga0496114_0018032 | |||
| 1785 | Ga0496114_0048190 | |||
| 1786 | Ga0496114_0081228 | |||
| 1787 | Ga0496114_0261175 | |||
| 1788 | Ga0496114_0263381 | |||
| 1789 | Ga0496115_0000516 | |||
| 1790 | Ga0496115_0058722 | |||
| 1791 | Ga0496115_0076461 | |||
| 1792 | Ga0496115_0094861 | |||
| 1793 | Ga0496115_0258383 | |||
| 1794 | Ga0496115_0621253 | |||
| 1795 | Ga0501031_0079970 | |||
| 1796 | Ga0501031_0135887 | |||
| 1797 | Ga0501033_0093281 | |||
| 1798 | Ga0501034_0753338 | |||
| 1799 | Ga0501036_0006569 | |||
| 1800 | Ga0501036_0056924 | |||
| 1801 | Ga0501036_0132843 | |||
| 1802 | Ga0501036_0761701 | |||
| 1803 | Ga0501037_0007340 | |||
| 1804 | Ga0501037_0253134 | |||
| 1805 | Ga0501038_0008002 | |||
| 1806 | Ga0501038_0022572 | |||
| 1807 | Ga0501039_0007145 | |||
| 1808 | Ga0501039_0007538 | |||
| 1809 | Ga0501039_0087419 | |||
| 1810 | Ga0501040_0002451 | |||
| 1811 | Ga0501040_0125708 | |||
| 1812 | Ga0501040_0134413 | |||
| 1813 | Ga0501041_0005392 | |||
| 1814 | Ga0501041_0060161 | |||
| 1815 | Ga0501041_0069905 | |||
| 1816 | Ga0501042_0000234 | |||
| 1817 | Ga0501042_0005842 | |||
| 1818 | Ga0501042_0674658 | |||
| 1819 | Ga0501043_0005686 | |||
| 1820 | Ga0501046_0015071 | |||
| 1821 | Ga0501046_0250843 | |||
| 1822 | Ga0501047_0021853 | |||
| 1823 | Ga0501048_0015195 | |||
| 1824 | Ga0501067_0000441 | |||
| 1825 | Ga0501067_0011138 | |||
| 1826 | Ga0501067_0019403 | |||
| 1827 | Ga0501067_0046738 | |||
| 1828 | Ga0501068_0050954 | |||
| 1829 | Ga0501068_0466793 | |||
| 1830 | Ga0501069_0002063 | |||
| 1831 | Ga0501069_0002928 | |||
| 1832 | Ga0501069_0002951 | |||
| 1833 | Ga0501069_0024211 | |||
| 1834 | Ga0501069_0032885 | |||
| 1835 | Ga0501069_0113977 | |||
| 1836 | Ga0501069_0156552 | |||
| 1837 | Ga0501069_0482761 | |||
| 1838 | Ga0501070_0000336 | |||
| 1839 | Ga0501070_0013670 | |||
| 1840 | Ga0501070_0087800 | |||
| 1841 | Ga0501071_0004444 | |||
| 1842 | Ga0501071_0011395 | |||
| 1843 | Ga0501071_0478911 | |||
| 1844 | Ga0501072_0026813 | |||
| 1845 | Ga0501072_0040611 | |||
| 1846 | Ga0501072_0041804 | |||
| 1847 | Ga0501072_0194469 | |||
| 1848 | Ga0501072_0203094 | |||
| 1849 | Ga0501072_0337091 | |||
| 1850 | Ga0501073_0076294 | |||
| 1851 | Ga0501074_0010905 | |||
| 1852 | Ga0501074_0040449 | |||
| 1853 | Ga0501074_0306243 | |||
| 1854 | Ga0501074_0546031 | |||
| 1855 | Ga0501075_0005653 | |||
| 1856 | Ga0501075_0011369 | |||
| 1857 | Ga0501076_0015847 | |||
| 1858 | Ga0501076_0070691 | |||
| 1859 | Ga0501076_0136809 | |||
| 1860 | Ga0501076_0153553 | |||
| 1861 | Ga0501077_0067737 | |||
| 1862 | Ga0501079_0021233 | |||
| 1863 | Ga0501079_0153833 | |||
| 1864 | Ga0501079_0357642 | |||
| 1865 | Ga0501080_0002879 | |||
| 1866 | Ga0501080_0032445 | |||
| 1867 | Ga0501080_0239354 | |||
| 1868 | Ga0501080_0285579 | |||
| 1869 | Ga0501080_0517965 | |||
| 1870 | Ga0501081_0005592 | |||
| 1871 | Ga0501081_0111404 | |||
| 1872 | Ga0501081_0440565 | |||
| 1873 | Ga0501083_0017361 | |||
| 1874 | Ga0501083_0223526 | |||
| 1875 | Ga0501035_0051455 | |||
| 1876 | Ga0501035_0293698 | |||
| 1877 | Ga0501045_0000885 | |||
| 1878 | Ga0501045_0082827 | |||
| 1879 | Ga0501045_0095063 | |||
| 1880 | Ga0501045_0302501 | |||
| 1881 | nmdc:mga05p37_115638_c1 | |||
| 1882 | nmdc:mga05p37_253952_c1 | |||
| 1883 | nmdc:mga05p37_385545_c1 | |||
| 1884 | nmdc:mga05p37_485714_c1 | |||
| 1885 | nmdc:mga05p37_70792_c1 | |||
| 1886 | nmdc:mga05p37_90554_c1 | |||
| 1887 | nmdc:mga08y16_192999_c1 | |||
| 1888 | nmdc:mga08y16_56826_c1 | |||
| 1889 | nmdc:mga08y16_673824_c1 | |||
| 1890 | nmdc:mga0n895_22609_c1 | |||
| 1891 | nmdc:mga0n895_252404_c1 | |||
| 1892 | nmdc:mga0n895_402443_c1 | |||
| 1893 | nmdc:mga0n895_788968_c1 | |||
| 1894 | nmdc:mga0rr50_219377_c1 | |||
| 1895 | nmdc:mga0rr50_81643_c1 | |||
| 1896 | nmdc:mga08x19_190111_c1 | |||
| 1897 | nmdc:mga08x19_89279_c1 | |||
| 1898 | nmdc:mga0a205_219684_c1 | |||
| 1899 | nmdc:mga0a205_221338_c1 | |||
| 1900 | nmdc:mga0a205_42550_c1 | |||
| 1901 | Ga0495601_0014402 | |||
| 1902 | Ga0495601_0222972 | |||
| 1903 | Ga0495612_0125542 | |||
| 1904 | Ga0495595_0006981 | |||
| 1905 | Ga0495595_0058600 | |||
| 1906 | Ga0495595_0138634 | |||
| 1907 | Ga0495619_0005282 | |||
| 1908 | Ga0495619_0008250 | |||
| 1909 | Ga0495619_0121151 | |||
| 1910 | Ga0495619_0207114 | |||
| 1911 | Ga0495619_0684303 | |||
| 1912 | Ga0501084_0001593 | |||
| 1913 | Ga0501084_0020358 | |||
| 1914 | Ga0501084_0333313 | |||
| 1915 | Ga0501084_0343635 | |||
| 1916 | Ga0501084_0498687 | |||
| 1917 | Ga0590075_057522 | |||
| 1918 | Ga0501082_0010836 | |||
| 1919 | Ga0501082_0015139 | |||
| 1920 | Ga0501082_0066608 | |||
| 1921 | Ga0501082_0085831 | |||
| 1922 | Ga0501082_0226170 | |||
| 1923 | Ga0501082_0677422 | |||
| 1924 | Ga0466962_0000681 | |||
| 1925 | Ga0466962_0005492 | |||
| 1926 | Ga0466962_0020139 | |||
| 1927 | Ga0466962_0060403 | |||
| 1928 | Ga0466962_0155068 | |||
| 1929 | Ga0530510_0011213 | |||
| 1930 | Ga0530510_0027001 | |||
| 1931 | Ga0530510_0031452 | |||
| 1932 | Ga0530510_0039674 | |||
| 1933 | Ga0530510_0061566 | |||
| 1934 | Ga0530510_0095664 | |||
| 1935 | Ga0530510_0314526 | |||
| 1936 | Ga0530510_0324962 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5n2i-assembly2.cif.gz_D | f420:nadph oxidoreductase from thermobifida fusca with nadp+ bound | 0.9585 | 1 | 205 |
| 5n2i-assembly2.cif.gz_D | f420:nadph oxidoreductase from thermobifida fusca with nadp+ bound | 0.9495 | 1 | 205 |
| 1jay-assembly1.cif.gz_B | structure of coenzyme f420h2:nadp+ oxidoreductase (fno) with its substrates bound | 0.9294 | 1 | 202 |
| 1jay-assembly1.cif.gz_B | structure of coenzyme f420h2:nadp+ oxidoreductase (fno) with its substrates bound | 0.9078 | 1 | 202 |
| 3dtt-assembly1.cif.gz_A | crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution | 0.8759 | 3 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5QMG5_99_194_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9797 | 2 | 30 | 3.40.50.720 |
| af_A0A0R0IJI3_1_109_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.95 | 3 | 45 | 3.40.50.720 |
| af_O15229_1_369_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9423 | 2 | 31 | 3.50.50.60 |
| 5n2iB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9412 | 1 | 205 | 3.40.50.720 |
| 5n2iB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9325 | 1 | 205 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GBC5-F1-model_v4 | Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein | 0.9976 | 1 | 206 |
GO:0005886
GO:0008823 GO:0015677 GO:0052851 |
| AF-A0A538GBC5-F1-model_v4 | Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein | 0.9927 | 1 | 206 |
GO:0005886
GO:0008823 GO:0015677 GO:0052851 |
| AF-A0A7V9EGV9-F1-model_v4 | NAD(P)-binding domain-containing protein | 0.9912 | 1 | 169 |
GO:0005886
GO:0008823 GO:0015677 GO:0052851 |
| AF-A0A538JIJ5-F1-model_v4 | Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein | 0.9899 | 1 | 205 |
GO:0005886
GO:0008823 GO:0015677 GO:0052851 |
| AF-A0A538IIS3-F1-model_v4 | NADPH-dependent F420 reductase | 0.9894 | 30 | 206 |
GO:0005886
GO:0008823 GO:0015677 GO:0052851 |