F486870
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 961 | 349 | 1922 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0123418|Ga0395898_0123418_266_1282 |
| Length | 317 |
| Sequence | VLIRVGSRGSRLALTQAELAAARLRAPGMEIALMPITTAGDRDRTKPFGQIGSRGVFVKELEEALLEGRIDVAVHSAKDMTSSDPAGLAVGAYVERDDPRDALCGAEAIRPGMRIGTASARRKAQLLALEPTLSIEPLRGNIDTRLRKRGERGLDAVVLAACGLDRLGLAHEIGLRLDPETMLPEAAQGALALQVRAGEESLVADVDHAETRRRVEAERTVVAAVEGGCLAPVAAHHDGTTLTGLIAAEDGSWIDLGPRAGAVLERVAGDRKPFPPGRIGAAFEPSDPTGWLIVAGLSIALALGVAYARHRPGGATG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 185 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 214 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.83 |
| Nodule | 0 |
| Rhizoplane | 10.82 |
| Rhizosphere | 87.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395898_0123418 | 3300037466 | Bacteria | 2482 |
| 2 | JGI25407J50210_10001067 | 3300003373 | Bacteria | 6025 |
| 3 | Ga0070658_10037764 | 3300005327 | Bacteria | 3893 |
| 4 | Ga0070683_100037562 | 3300005329 | Bacteria | 4433 |
| 5 | Ga0070683_100254295 | 3300005329 | Bacteria | 1671 |
| 6 | Ga0070690_100080852 | 3300005330 | Bacteria | 2126 |
| 7 | Ga0068869_100088418 | 3300005334 | Bacteria | 2325 |
| 8 | Ga0070680_100020568 | 3300005336 | Bacteria | 5239 |
| 9 | Ga0070680_100023083 | 3300005336 | Bacteria | 4958 |
| 10 | Ga0070680_100049179 | 3300005336 | Bacteria | 3436 |
| 11 | Ga0070680_100077430 | 3300005336 | Bacteria | 2739 |
| 12 | Ga0070680_100296143 | 3300005336 | Bacteria | 1372 |
| 13 | Ga0070682_100137262 | 3300005337 | Bacteria | 1663 |
| 14 | Ga0070660_100008257 | 3300005339 | Bacteria | 7278 |
| 15 | Ga0070660_100020167 | 3300005339 | Bacteria | 4895 |
| 16 | Ga0070660_100045357 | 3300005339 | Bacteria | 3365 |
| 17 | Ga0070660_100054065 | 3300005339 | Bacteria | 3099 |
| 18 | Ga0070660_100078063 | 3300005339 | Unclassified | 2596 |
| 19 | Ga0070660_100296139 | 3300005339 | Bacteria | 1326 |
| 20 | Ga0070691_10031993 | 3300005341 | Bacteria | 2470 |
| 21 | Ga0070691_10086887 | 3300005341 | Unclassified | 1537 |
| 22 | Ga0070661_100056424 | 3300005344 | Bacteria | 2878 |
| 23 | Ga0070692_10014373 | 3300005345 | Bacteria | 3718 |
| 24 | Ga0070692_10018151 | 3300005345 | Bacteria | 3377 |
| 25 | Ga0070668_100053143 | 3300005347 | Bacteria | 3124 |
| 26 | Ga0070669_100340478 | 3300005353 | Bacteria | 1215 |
| 27 | Ga0070671_100136151 | 3300005355 | Bacteria | 2071 |
| 28 | Ga0070671_100164199 | 3300005355 | Bacteria | 1877 |
| 29 | Ga0070671_100435585 | 3300005355 | Bacteria | 1124 |
| 30 | Ga0070674_100005755 | 3300005356 | Bacteria | 7192 |
| 31 | Ga0070674_100055508 | 3300005356 | Bacteria | 2743 |
| 32 | Ga0070673_100109765 | 3300005364 | Bacteria | 2286 |
| 33 | Ga0070688_100182657 | 3300005365 | Bacteria | 1456 |
| 34 | Ga0070659_100004574 | 3300005366 | Bacteria | 9892 |
| 35 | Ga0070659_100024028 | 3300005366 | Bacteria | 4669 |
| 36 | Ga0070659_100037243 | 3300005366 | Bacteria | 3791 |
| 37 | Ga0070659_100282099 | 3300005366 | Bacteria | 1382 |
| 38 | Ga0070703_10029379 | 3300005406 | Bacteria | 1650 |
| 39 | Ga0070709_10006188 | 3300005434 | Bacteria | 6515 |
| 40 | Ga0070709_10038468 | 3300005434 | Bacteria | 2929 |
| 41 | Ga0070709_10068543 | 3300005434 | Unclassified | 2282 |
| 42 | Ga0070709_10132751 | 3300005434 | Bacteria | 1701 |
| 43 | Ga0070709_10327033 | 3300005434 | Bacteria | 1127 |
| 44 | Ga0070709_10351815 | 3300005434 | Unclassified | 1089 |
| 45 | Ga0070714_100004838 | 3300005435 | Bacteria | 10221 |
| 46 | Ga0070714_100008551 | 3300005435 | Bacteria | 8003 |
| 47 | Ga0070714_100026860 | 3300005435 | Bacteria | 4761 |
| 48 | Ga0070714_100052155 | 3300005435 | Bacteria | 3488 |
| 49 | Ga0070714_100061379 | 3300005435 | Bacteria | 3229 |
| 50 | Ga0070714_100070139 | 3300005435 | Bacteria | 3029 |
| 51 | Ga0070714_100083695 | 3300005435 | Bacteria | 2783 |
| 52 | Ga0070714_100231522 | 3300005435 | Bacteria | 1702 |
| 53 | Ga0070713_100001060 | 3300005436 | Bacteria | 17565 |
| 54 | Ga0070713_100008471 | 3300005436 | Bacteria | 7293 |
| 55 | Ga0070710_10003601 | 3300005437 | Bacteria | 7338 |
| 56 | Ga0070710_10008982 | 3300005437 | Bacteria | 4882 |
| 57 | Ga0070710_10105674 | 3300005437 | Bacteria | 1683 |
| 58 | Ga0070701_10065807 | 3300005438 | Bacteria | 1925 |
| 59 | Ga0070711_100009812 | 3300005439 | Bacteria | 5905 |
| 60 | Ga0070711_100016495 | 3300005439 | Bacteria | 4693 |
| 61 | Ga0070700_100156245 | 3300005441 | Bacteria | 1565 |
| 62 | Ga0070700_100189187 | 3300005441 | Unclassified | 1438 |
| 63 | Ga0070694_100047908 | 3300005444 | Bacteria | 2873 |
| 64 | Ga0070694_100086507 | 3300005444 | Bacteria | 2191 |
| 65 | Ga0070694_100408916 | 3300005444 | Bacteria | 1064 |
| 66 | Ga0070678_100129016 | 3300005456 | Bacteria | 2006 |
| 67 | Ga0070662_100032975 | 3300005457 | Bacteria | 3644 |
| 68 | Ga0070681_10039443 | 3300005458 | Bacteria | 4734 |
| 69 | Ga0070681_10071482 | 3300005458 | Bacteria | 3434 |
| 70 | Ga0070681_10245233 | 3300005458 | Bacteria | 1705 |
| 71 | Ga0068867_100022590 | 3300005459 | Bacteria | 4497 |
| 72 | Ga0068867_100084604 | 3300005459 | Bacteria | 2397 |
| 73 | Ga0070706_100058985 | 3300005467 | Bacteria | 3542 |
| 74 | Ga0070706_100122634 | 3300005467 | Bacteria | 2423 |
| 75 | Ga0070707_100051967 | 3300005468 | Bacteria | 3928 |
| 76 | Ga0070707_100064103 | 3300005468 | Bacteria | 3527 |
| 77 | Ga0070707_100421842 | 3300005468 | Bacteria | 1294 |
| 78 | Ga0070698_100015246 | 3300005471 | Bacteria | 8127 |
| 79 | Ga0070698_100016183 | 3300005471 | Bacteria | 7875 |
| 80 | Ga0070698_100022054 | 3300005471 | Bacteria | 6668 |
| 81 | Ga0070699_100082858 | 3300005518 | Bacteria | 2797 |
| 82 | Ga0070679_100022080 | 3300005530 | Bacteria | 6217 |
| 83 | Ga0070679_100033495 | 3300005530 | Bacteria | 5087 |
| 84 | Ga0070679_100036271 | 3300005530 | Bacteria | 4894 |
| 85 | Ga0070679_100052882 | 3300005530 | Bacteria | 4043 |
| 86 | Ga0070679_100082777 | 3300005530 | Unclassified | 3198 |
| 87 | Ga0070684_100020666 | 3300005535 | Bacteria | 5461 |
| 88 | Ga0070684_100071138 | 3300005535 | Bacteria | 3062 |
| 89 | Ga0070684_100126064 | 3300005535 | Bacteria | 2306 |
| 90 | Ga0070684_100542332 | 3300005535 | Bacteria | 1079 |
| 91 | Ga0070697_100158263 | 3300005536 | Bacteria | 1913 |
| 92 | Ga0070697_100188955 | 3300005536 | Bacteria | 1748 |
| 93 | Ga0068853_100325429 | 3300005539 | Bacteria | 1426 |
| 94 | Ga0070695_100029461 | 3300005545 | Bacteria | 3411 |
| 95 | Ga0070695_100140979 | 3300005545 | Bacteria | 1671 |
| 96 | Ga0070696_100015889 | 3300005546 | Bacteria | 5060 |
| 97 | Ga0070696_100061459 | 3300005546 | Bacteria | 2628 |
| 98 | Ga0070693_100023061 | 3300005547 | Bacteria | 3320 |
| 99 | Ga0070693_100248803 | 3300005547 | Bacteria | 1177 |
| 100 | Ga0070704_100015256 | 3300005549 | Bacteria | 4822 |
| 101 | Ga0070704_100017012 | 3300005549 | Bacteria | 4612 |
| 102 | Ga0070704_100158114 | 3300005549 | Bacteria | 1789 |
| 103 | Ga0070704_100162942 | 3300005549 | Bacteria | 1765 |
| 104 | Ga0068855_100052856 | 3300005563 | Bacteria | 4781 |
| 105 | Ga0068855_100061944 | 3300005563 | Bacteria | 4369 |
| 106 | Ga0068855_100152857 | 3300005563 | Bacteria | 2624 |
| 107 | Ga0068855_100208157 | 3300005563 | Bacteria | 2199 |
| 108 | Ga0070664_100091185 | 3300005564 | Unclassified | 2638 |
| 109 | Ga0068857_100038685 | 3300005577 | Bacteria | 4224 |
| 110 | Ga0068857_100604640 | 3300005577 | Bacteria | 1037 |
| 111 | Ga0068856_100083532 | 3300005614 | Bacteria | 3172 |
| 112 | Ga0068852_100076060 | 3300005616 | Bacteria | 2964 |
| 113 | Ga0068859_100488406 | 3300005617 | Bacteria | 1327 |
| 114 | Ga0068864_100070632 | 3300005618 | Bacteria | 3039 |
| 115 | Ga0068866_10125952 | 3300005718 | Bacteria | 1450 |
| 116 | Ga0068861_100007739 | 3300005719 | Bacteria | 7381 |
| 117 | Ga0068861_100094875 | 3300005719 | Bacteria | 2362 |
| 118 | Ga0068861_100097859 | 3300005719 | Bacteria | 2328 |
| 119 | Ga0068861_100184110 | 3300005719 | Bacteria | 1741 |
| 120 | Ga0068851_10008024 | 3300005834 | Bacteria | 4870 |
| 121 | Ga0068870_10097759 | 3300005840 | Bacteria | 1653 |
| 122 | Ga0068863_100172157 | 3300005841 | Unclassified | 2077 |
| 123 | Ga0068858_100432309 | 3300005842 | Bacteria | 1267 |
| 124 | Ga0068862_100278360 | 3300005844 | Bacteria | 1533 |
| 125 | Ga0081455_10004421 | 3300005937 | Bacteria | 15777 |
| 126 | Ga0081455_10018767 | 3300005937 | Bacteria | 6563 |
| 127 | Ga0081538_10000053 | 3300005981 | Bacteria | 109213 |
| 128 | Ga0081538_10000094 | 3300005981 | Bacteria | 86715 |
| 129 | Ga0081538_10000100 | 3300005981 | Bacteria | 83917 |
| 130 | Ga0081538_10024011 | 3300005981 | Bacteria | 4359 |
| 131 | Ga0081538_10034170 | 3300005981 | Bacteria | 3367 |
| 132 | Ga0081538_10082099 | 3300005981 | Bacteria | 1711 |
| 133 | Ga0081540_1017275 | 3300005983 | Bacteria | 4473 |
| 134 | Ga0070717_10005467 | 3300006028 | Bacteria | 9275 |
| 135 | Ga0070717_10007849 | 3300006028 | Bacteria | 7943 |
| 136 | Ga0070717_10034859 | 3300006028 | Bacteria | 4070 |
| 137 | Ga0070717_10205975 | 3300006028 | Bacteria | 1725 |
| 138 | Ga0070717_10363118 | 3300006028 | Bacteria | 1296 |
| 139 | Ga0075365_10210969 | 3300006038 | Bacteria | 1361 |
| 140 | Ga0075364_10254025 | 3300006051 | Bacteria | 1195 |
| 141 | Ga0075432_10008519 | 3300006058 | Bacteria | 3497 |
| 142 | Ga0070715_10011394 | 3300006163 | Bacteria | 3201 |
| 143 | Ga0070715_10038124 | 3300006163 | Bacteria | 1993 |
| 144 | Ga0070716_100001457 | 3300006173 | Bacteria | 10535 |
| 145 | Ga0070716_100008190 | 3300006173 | Bacteria | 5181 |
| 146 | Ga0070716_100143012 | 3300006173 | Bacteria | 1528 |
| 147 | Ga0070712_100211865 | 3300006175 | Bacteria | 1528 |
| 148 | Ga0075367_10225184 | 3300006178 | Bacteria | 1174 |
| 149 | Ga0097621_100281031 | 3300006237 | Bacteria | 1465 |
| 150 | Ga0075428_100002460 | 3300006844 | Bacteria | 20102 |
| 151 | Ga0075428_100005053 | 3300006844 | Bacteria | 14668 |
| 152 | Ga0075428_100012212 | 3300006844 | Bacteria | 9550 |
| 153 | Ga0075428_100379218 | 3300006844 | Bacteria | 1516 |
| 154 | Ga0075431_100002910 | 3300006847 | Bacteria | 16568 |
| 155 | Ga0075431_100033329 | 3300006847 | Bacteria | 5309 |
| 156 | Ga0075431_100070213 | 3300006847 | Bacteria | 3614 |
| 157 | Ga0075431_100134492 | 3300006847 | Unclassified | 2549 |
| 158 | Ga0075431_100363473 | 3300006847 | Bacteria | 1453 |
| 159 | Ga0075433_10002265 | 3300006852 | Bacteria | 14625 |
| 160 | Ga0075433_10024118 | 3300006852 | Bacteria | 5129 |
| 161 | Ga0075433_10071464 | 3300006852 | Bacteria | 3050 |
| 162 | Ga0075433_10086955 | 3300006852 | Bacteria | 2761 |
| 163 | Ga0075433_10113133 | 3300006852 | Bacteria | 2408 |
| 164 | Ga0075434_100001294 | 3300006871 | Bacteria | 20866 |
| 165 | Ga0075434_100003374 | 3300006871 | Bacteria | 14296 |
| 166 | Ga0075434_100009463 | 3300006871 | Bacteria | 9085 |
| 167 | Ga0075434_100033764 | 3300006871 | Bacteria | 5051 |
| 168 | Ga0075434_100145869 | 3300006871 | Bacteria | 2387 |
| 169 | Ga0075429_100008378 | 3300006880 | Bacteria | 9000 |
| 170 | Ga0068865_100018192 | 3300006881 | Bacteria | 4532 |
| 171 | Ga0075436_100000915 | 3300006914 | Bacteria | 19663 |
| 172 | Ga0075436_100006395 | 3300006914 | Bacteria | 8074 |
| 173 | Ga0075436_100008390 | 3300006914 | Bacteria | 7065 |
| 174 | Ga0075436_100020398 | 3300006914 | Bacteria | 4549 |
| 175 | Ga0075436_100272928 | 3300006914 | Bacteria | 1208 |
| 176 | Ga0097620_100488357 | 3300006931 | Bacteria | 1327 |
| 177 | Ga0075435_100001243 | 3300007076 | Bacteria | 16320 |
| 178 | Ga0075435_100028080 | 3300007076 | Bacteria | 4410 |
| 179 | Ga0075435_100103033 | 3300007076 | Bacteria | 2366 |
| 180 | Ga0075435_100120794 | 3300007076 | Bacteria | 2186 |
| 181 | Ga0075435_100331419 | 3300007076 | Archaea | 1303 |
| 182 | Ga0105240_10040117 | 3300009093 | Bacteria | 5992 |
| 183 | Ga0105240_10073540 | 3300009093 | Bacteria | 4220 |
| 184 | Ga0105240_10119265 | 3300009093 | Bacteria | 3178 |
| 185 | Ga0105240_10251425 | 3300009093 | Bacteria | 2044 |
| 186 | Ga0111539_10003095 | 3300009094 | Bacteria | 22053 |
| 187 | Ga0111539_10035714 | 3300009094 | Bacteria | 6017 |
| 188 | Ga0105245_10006126 | 3300009098 | Bacteria | 10579 |
| 189 | Ga0105245_10047671 | 3300009098 | Bacteria | 3830 |
| 190 | Ga0105245_10186618 | 3300009098 | Bacteria | 1984 |
| 191 | Ga0105245_10684038 | 3300009098 | Bacteria | 1058 |
| 192 | Ga0114129_10000141 | 3300009147 | Bacteria | 75420 |
| 193 | Ga0114129_10003813 | 3300009147 | Bacteria | 21253 |
| 194 | Ga0114129_10142466 | 3300009147 | Bacteria | 3285 |
| 195 | Ga0114129_10788334 | 3300009147 | Bacteria | 1213 |
| 196 | Ga0105243_10100630 | 3300009148 | Bacteria | 2398 |
| 197 | Ga0105243_10129849 | 3300009148 | Bacteria | 2136 |
| 198 | Ga0105243_10136046 | 3300009148 | Bacteria | 2091 |
| 199 | Ga0105243_10143766 | 3300009148 | Bacteria | 2039 |
| 200 | Ga0105242_10024082 | 3300009176 | Bacteria | 4805 |
| 201 | Ga0105242_10066229 | 3300009176 | Bacteria | 2982 |
| 202 | Ga0105242_10121783 | 3300009176 | Bacteria | 2240 |
| 203 | Ga0105242_10258774 | 3300009176 | Unclassified | 1571 |
| 204 | Ga0105248_10212958 | 3300009177 | Bacteria | 2177 |
| 205 | Ga0105248_10593259 | 3300009177 | Bacteria | 1250 |
| 206 | Ga0105238_10053645 | 3300009551 | Bacteria | 4051 |
| 207 | Ga0105249_10009086 | 3300009553 | Bacteria | 8690 |
| 208 | Ga0105249_10026677 | 3300009553 | Bacteria | 5209 |
| 209 | Ga0105239_10095749 | 3300010375 | Bacteria | 3279 |
| 210 | Ga0105246_10338207 | 3300011119 | Unclassified | 1229 |
| 211 | Ga0157371_10116002 | 3300013102 | Bacteria | 1902 |
| 212 | Ga0157370_10033132 | 3300013104 | Bacteria | 5037 |
| 213 | Ga0157370_10068805 | 3300013104 | Bacteria | 3345 |
| 214 | Ga0157369_10089572 | 3300013105 | Bacteria | 3285 |
| 215 | Ga0157374_10008652 | 3300013296 | Bacteria | 8712 |
| 216 | Ga0157378_10396830 | 3300013297 | Unclassified | 1358 |
| 217 | Ga0163162_10316400 | 3300013306 | Bacteria | 1693 |
| 218 | Ga0157372_10100565 | 3300013307 | Bacteria | 3299 |
| 219 | Ga0157372_10284795 | 3300013307 | Bacteria | 1922 |
| 220 | Ga0157375_10578672 | 3300013308 | Unclassified | 1283 |
| 221 | Ga0157375_10785346 | 3300013308 | Bacteria | 1102 |
| 222 | Ga0163163_10128882 | 3300014325 | Bacteria | 2569 |
| 223 | Ga0157380_10005200 | 3300014326 | Bacteria | 9095 |
| 224 | Ga0157380_10060201 | 3300014326 | Bacteria | 3033 |
| 225 | Ga0182008_10009436 | 3300014497 | Bacteria | 5264 |
| 226 | Ga0157377_10018073 | 3300014745 | Bacteria | 3660 |
| 227 | Ga0157379_10107811 | 3300014968 | Unclassified | 2501 |
| 228 | Ga0157376_10159817 | 3300014969 | Bacteria | 2041 |
| 229 | Ga0157376_10320910 | 3300014969 | Bacteria | 1472 |
| 230 | Ga0182007_10012200 | 3300015262 | Bacteria | 3315 |
| 231 | Ga0163161_10008822 | 3300017792 | Bacteria | 6969 |
| 232 | Ga0163161_10229610 | 3300017792 | Bacteria | 1440 |
| 233 | Ga0197907_10972893 | 3300020069 | Bacteria | 1525 |
| 234 | Ga0206356_10739625 | 3300020070 | Bacteria | 3248 |
| 235 | Ga0206354_10143858 | 3300020081 | Unclassified | 1371 |
| 236 | Ga0206354_10579909 | 3300020081 | Bacteria | 2543 |
| 237 | Ga0206353_10543908 | 3300020082 | Bacteria | 1596 |
| 238 | Ga0206353_11152913 | 3300020082 | Bacteria | 3899 |
| 239 | Ga0206353_11689011 | 3300020082 | Bacteria | 14322 |
| 240 | Ga0213875_10139329 | 3300021388 | Bacteria | 1135 |
| 241 | Ga0213871_10002981 | 3300021441 | Bacteria | 3200 |
| 242 | Ga0207656_10004008 | 3300025321 | Bacteria | 5107 |
| 243 | Ga0207653_10004251 | 3300025885 | Bacteria | 4499 |
| 244 | Ga0207692_10012508 | 3300025898 | Bacteria | 3647 |
| 245 | Ga0207692_10017163 | 3300025898 | Bacteria | 3223 |
| 246 | Ga0207688_10005694 | 3300025901 | Bacteria | 6773 |
| 247 | Ga0207685_10008146 | 3300025905 | Bacteria | 2966 |
| 248 | Ga0207685_10057699 | 3300025905 | Bacteria | 1524 |
| 249 | Ga0207699_10002004 | 3300025906 | Bacteria | 9617 |
| 250 | Ga0207699_10039861 | 3300025906 | Bacteria | 2702 |
| 251 | Ga0207699_10179391 | 3300025906 | Unclassified | 1422 |
| 252 | Ga0207643_10206819 | 3300025908 | Bacteria | 1197 |
| 253 | Ga0207705_10044675 | 3300025909 | Bacteria | 3184 |
| 254 | Ga0207705_10144245 | 3300025909 | Bacteria | 1780 |
| 255 | Ga0207705_10219367 | 3300025909 | Bacteria | 1444 |
| 256 | Ga0207684_10118109 | 3300025910 | Bacteria | 2272 |
| 257 | Ga0207707_10008396 | 3300025912 | Bacteria | 8961 |
| 258 | Ga0207707_10040872 | 3300025912 | Bacteria | 4049 |
| 259 | Ga0207695_10085325 | 3300025913 | Bacteria | 3187 |
| 260 | Ga0207695_10230599 | 3300025913 | Bacteria | 1756 |
| 261 | Ga0207693_10000282 | 3300025915 | Bacteria | 47278 |
| 262 | Ga0207693_10007638 | 3300025915 | Bacteria | 8877 |
| 263 | Ga0207693_10035896 | 3300025915 | Bacteria | 3907 |
| 264 | Ga0207663_10044668 | 3300025916 | Bacteria | 2721 |
| 265 | Ga0207663_10118368 | 3300025916 | Bacteria | 1809 |
| 266 | Ga0207660_10178611 | 3300025917 | Bacteria | 1647 |
| 267 | Ga0207660_10263106 | 3300025917 | Bacteria | 1365 |
| 268 | Ga0207660_10268093 | 3300025917 | Bacteria | 1352 |
| 269 | Ga0207657_10000988 | 3300025919 | Bacteria | 30190 |
| 270 | Ga0207657_10033885 | 3300025919 | Bacteria | 4598 |
| 271 | Ga0207657_10077510 | 3300025919 | Unclassified | 2800 |
| 272 | Ga0207657_10080178 | 3300025919 | Bacteria | 2744 |
| 273 | Ga0207657_10201020 | 3300025919 | Bacteria | 1603 |
| 274 | Ga0207657_10350582 | 3300025919 | Bacteria | 1164 |
| 275 | Ga0207652_10087226 | 3300025921 | Bacteria | 2737 |
| 276 | Ga0207646_10001768 | 3300025922 | Bacteria | 26172 |
| 277 | Ga0207646_10120866 | 3300025922 | Bacteria | 2353 |
| 278 | Ga0207646_10148490 | 3300025922 | Bacteria | 2113 |
| 279 | Ga0207646_10355995 | 3300025922 | Bacteria | 1322 |
| 280 | Ga0207646_10491985 | 3300025922 | Bacteria | 1105 |
| 281 | Ga0207681_10278020 | 3300025923 | Bacteria | 1317 |
| 282 | Ga0207687_10015169 | 3300025927 | Bacteria | 5049 |
| 283 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 284 | Ga0207700_10015530 | 3300025928 | Bacteria | 5027 |
| 285 | Ga0207700_10069117 | 3300025928 | Bacteria | 2710 |
| 286 | Ga0207664_10012931 | 3300025929 | Bacteria | 5980 |
| 287 | Ga0207664_10032025 | 3300025929 | Bacteria | 4027 |
| 288 | Ga0207664_10047082 | 3300025929 | Bacteria | 3387 |
| 289 | Ga0207664_10063827 | 3300025929 | Bacteria | 2944 |
| 290 | Ga0207664_10100754 | 3300025929 | Bacteria | 2385 |
| 291 | Ga0207664_10111667 | 3300025929 | Bacteria | 2274 |
| 292 | Ga0207664_10132587 | 3300025929 | Bacteria | 2099 |
| 293 | Ga0207644_10123627 | 3300025931 | Bacteria | 1973 |
| 294 | Ga0207690_10012589 | 3300025932 | Bacteria | 5064 |
| 295 | Ga0207690_10039559 | 3300025932 | Unclassified | 3077 |
| 296 | Ga0207690_10177336 | 3300025932 | Bacteria | 1602 |
| 297 | Ga0207706_10010201 | 3300025933 | Bacteria | 8593 |
| 298 | Ga0207706_10041071 | 3300025933 | Bacteria | 4101 |
| 299 | Ga0207686_10010201 | 3300025934 | Bacteria | 5108 |
| 300 | Ga0207686_10230059 | 3300025934 | Bacteria | 1343 |
| 301 | Ga0207709_10094126 | 3300025935 | Unclassified | 1966 |
| 302 | Ga0207709_10242955 | 3300025935 | Bacteria | 1311 |
| 303 | Ga0207669_10231393 | 3300025937 | Bacteria | 1364 |
| 304 | Ga0207704_10218237 | 3300025938 | Bacteria | 1409 |
| 305 | Ga0207704_10313786 | 3300025938 | Bacteria | 1207 |
| 306 | Ga0207665_10004972 | 3300025939 | Bacteria | 8869 |
| 307 | Ga0207665_10027771 | 3300025939 | Bacteria | 3738 |
| 308 | Ga0207711_10143958 | 3300025941 | Bacteria | 2146 |
| 309 | Ga0207689_10082630 | 3300025942 | Bacteria | 2641 |
| 310 | Ga0207661_10062637 | 3300025944 | Bacteria | 3010 |
| 311 | Ga0207661_10090489 | 3300025944 | Bacteria | 2548 |
| 312 | Ga0207661_10116265 | 3300025944 | Bacteria | 2270 |
| 313 | Ga0207661_10318684 | 3300025944 | Bacteria | 1397 |
| 314 | Ga0207679_10069445 | 3300025945 | Unclassified | 2651 |
| 315 | Ga0207679_10220337 | 3300025945 | Bacteria | 1596 |
| 316 | Ga0207667_10101806 | 3300025949 | Bacteria | 2963 |
| 317 | Ga0207667_10138760 | 3300025949 | Bacteria | 2503 |
| 318 | Ga0207667_10159659 | 3300025949 | Bacteria | 2319 |
| 319 | Ga0207651_10528870 | 3300025960 | Bacteria | 1023 |
| 320 | Ga0207668_10062865 | 3300025972 | Bacteria | 2616 |
| 321 | Ga0207658_10002326 | 3300025986 | Bacteria | 13958 |
| 322 | Ga0207677_10183427 | 3300026023 | Bacteria | 1648 |
| 323 | Ga0207678_10296639 | 3300026067 | Unclassified | 1389 |
| 324 | Ga0207708_10000684 | 3300026075 | Bacteria | 25753 |
| 325 | Ga0207708_10040507 | 3300026075 | Bacteria | 3551 |
| 326 | Ga0207702_10100980 | 3300026078 | Bacteria | 2546 |
| 327 | Ga0207702_10381501 | 3300026078 | Bacteria | 1355 |
| 328 | Ga0207702_10602393 | 3300026078 | Bacteria | 1078 |
| 329 | Ga0207641_10153622 | 3300026088 | Unclassified | 2087 |
| 330 | Ga0207641_10532558 | 3300026088 | Bacteria | 1144 |
| 331 | Ga0207648_10011247 | 3300026089 | Bacteria | 8438 |
| 332 | Ga0207648_10352013 | 3300026089 | Bacteria | 1328 |
| 333 | Ga0207648_10443595 | 3300026089 | Bacteria | 1181 |
| 334 | Ga0207676_10240663 | 3300026095 | Bacteria | 1623 |
| 335 | Ga0207675_100000929 | 3300026118 | Bacteria | 29254 |
| 336 | Ga0207675_100336280 | 3300026118 | Bacteria | 1477 |
| 337 | Ga0207683_10034207 | 3300026121 | Bacteria | 4416 |
| 338 | Ga0207683_10037498 | 3300026121 | Bacteria | 4221 |
| 339 | Ga0207683_10063512 | 3300026121 | Bacteria | 3253 |
| 340 | Ga0207683_10219356 | 3300026121 | Bacteria | 1733 |
| 341 | Ga0207698_10767550 | 3300026142 | Bacteria | 964 |
| 342 | Ga0207428_10000108 | 3300027907 | Bacteria | 115378 |
| 343 | Ga0207428_10099829 | 3300027907 | Bacteria | 2244 |
| 344 | Ga0207428_10321501 | 3300027907 | Bacteria | 1143 |
| 345 | Ga0265319_1000635 | 3300028563 | Bacteria | 23180 |
| 346 | Ga0265334_10002590 | 3300028573 | Bacteria | 8429 |
| 347 | Ga0265318_10003761 | 3300028577 | Bacteria | 7549 |
| 348 | Ga0265322_10001612 | 3300028654 | Bacteria | 7210 |
| 349 | Ga0265322_10032636 | 3300028654 | Bacteria | 1485 |
| 350 | Ga0265338_10005641 | 3300028800 | Bacteria | 16249 |
| 351 | Ga0265338_10007196 | 3300028800 | Bacteria | 13912 |
| 352 | Ga0265338_10075508 | 3300028800 | Bacteria | 2859 |
| 353 | Ga0265338_10144941 | 3300028800 | Bacteria | 1854 |
| 354 | Ga0265324_10022996 | 3300029957 | Bacteria | 2223 |
| 355 | Ga0265324_10033318 | 3300029957 | Bacteria | 1798 |
| 356 | Ga0265330_10000327 | 3300031235 | Bacteria | 34205 |
| 357 | Ga0265330_10046743 | 3300031235 | Bacteria | 1906 |
| 358 | Ga0265332_10003969 | 3300031238 | Bacteria | 7049 |
| 359 | Ga0265332_10116072 | 3300031238 | Bacteria | 1126 |
| 360 | Ga0265320_10092767 | 3300031240 | Bacteria | 1397 |
| 361 | Ga0265329_10025187 | 3300031242 | Bacteria | 1971 |
| 362 | Ga0265340_10002177 | 3300031247 | Bacteria | 11216 |
| 363 | Ga0265331_10004733 | 3300031250 | Bacteria | 8414 |
| 364 | Ga0265327_10017812 | 3300031251 | Bacteria | 4432 |
| 365 | Ga0265316_10020939 | 3300031344 | Bacteria | 5552 |
| 366 | Ga0265316_10159049 | 3300031344 | Bacteria | 1689 |
| 367 | Ga0307408_100118146 | 3300031548 | Bacteria | 2050 |
| 368 | Ga0265313_10005397 | 3300031595 | Bacteria | 9426 |
| 369 | Ga0265314_10002591 | 3300031711 | Bacteria | 18287 |
| 370 | Ga0265342_10011070 | 3300031712 | Bacteria | 6191 |
| 371 | Ga0265342_10130077 | 3300031712 | Bacteria | 1411 |
| 372 | Ga0307406_10009746 | 3300031901 | Bacteria | 5401 |
| 373 | Ga0307409_100187828 | 3300031995 | Bacteria | 1836 |
| 374 | Ga0307416_100019684 | 3300032002 | Bacteria | 4793 |
| 375 | Ga0307416_100212948 | 3300032002 | Unclassified | 1845 |
| 376 | Ga0307411_10410369 | 3300032005 | Bacteria | 1122 |
| 377 | Ga0307415_100021919 | 3300032126 | Bacteria | 3935 |
| 378 | Ga0307415_100050027 | 3300032126 | Bacteria | 2829 |
| 379 | Ga0316583_10021232 | 3300032133 | Bacteria | 2328 |
| 380 | Ga0373948_0012084 | 3300034817 | Bacteria | 1538 |
| 381 | Ga0373928_0015661 | 3300035084 | Bacteria | 1545 |
| 382 | Ga0373940_0004842 | 3300035088 | Bacteria | 2873 |
| 383 | Ga0373940_0019686 | 3300035088 | Bacteria | 1708 |
| 384 | Ga0373949_0005830 | 3300035090 | Bacteria | 2738 |
| 385 | Ga0373952_0002137 | 3300035092 | Bacteria | 3553 |
| 386 | Ga0373932_0075588 | 3300035112 | Bacteria | 1054 |
| 387 | Ga0373960_0029407 | 3300035121 | Unclassified | 1523 |
| 388 | Ga0373943_0000198 | 3300035170 | Bacteria | 24537 |
| 389 | Ga0373943_0072902 | 3300035170 | Unclassified | 1743 |
| 390 | Ga0373961_0008795 | 3300035241 | Bacteria | 2460 |
| 391 | Ga0373962_0005248 | 3300035242 | Bacteria | 3133 |
| 392 | Ga0373931_0097985 | 3300035691 | Bacteria | 1645 |
| 393 | Ga0373935_0109936 | 3300035692 | Bacteria | 1828 |
| 394 | Ga0373935_0494438 | 3300035692 | Bacteria | 887 |
| 395 | Ga0373933_0172015 | 3300035724 | Bacteria | 1379 |
| 396 | Ga0373933_0186160 | 3300035724 | Bacteria | 1325 |
| 397 | Ga0373947_0000463 | 3300035725 | Bacteria | 23167 |
| 398 | Ga0373937_0109487 | 3300036401 | Bacteria | 2569 |
| 399 | Ga0373925_0024512 | 3300037068 | Bacteria | 4405 |
| 400 | Ga0395899_0000862 | 3300037312 | Bacteria | 28881 |
| 401 | Ga0395899_0002568 | 3300037312 | Bacteria | 14676 |
| 402 | Ga0395899_0005918 | 3300037312 | Bacteria | 9496 |
| 403 | Ga0395899_0008133 | 3300037312 | Bacteria | 8079 |
| 404 | Ga0395899_0009554 | 3300037312 | Bacteria | 7445 |
| 405 | Ga0395899_0037927 | 3300037312 | Bacteria | 3612 |
| 406 | Ga0395899_0082410 | 3300037312 | Bacteria | 2340 |
| 407 | Ga0395899_0085266 | 3300037312 | Unclassified | 2295 |
| 408 | Ga0395899_0182321 | 3300037312 | Bacteria | 1473 |
| 409 | Ga0395900_0001219 | 3300037418 | Bacteria | 31689 |
| 410 | Ga0395900_0001266 | 3300037418 | Bacteria | 30887 |
| 411 | Ga0395900_0001485 | 3300037418 | Bacteria | 27947 |
| 412 | Ga0395900_0004452 | 3300037418 | Bacteria | 14842 |
| 413 | Ga0395900_0005059 | 3300037418 | Bacteria | 13833 |
| 414 | Ga0395900_0009112 | 3300037418 | Bacteria | 10167 |
| 415 | Ga0395900_0019826 | 3300037418 | Bacteria | 6853 |
| 416 | Ga0395900_0024066 | 3300037418 | Bacteria | 6233 |
| 417 | Ga0395900_0046723 | 3300037418 | Bacteria | 4458 |
| 418 | Ga0395900_0068678 | 3300037418 | Bacteria | 3642 |
| 419 | Ga0395900_0068882 | 3300037418 | Bacteria | 3636 |
| 420 | Ga0395900_0166180 | 3300037418 | Bacteria | 2248 |
| 421 | Ga0395900_0171588 | 3300037418 | Bacteria | 2207 |
| 422 | Ga0395900_0188797 | 3300037418 | Bacteria | 2091 |
| 423 | Ga0395900_0351242 | 3300037418 | Bacteria | 1448 |
| 424 | Ga0395900_0497844 | 3300037418 | Bacteria | 1169 |
| 425 | Ga0395898_0012615 | 3300037466 | Bacteria | 8736 |
| 426 | Ga0395898_0015047 | 3300037466 | Bacteria | 7942 |
| 427 | Ga0395898_0016535 | 3300037466 | Bacteria | 7545 |
| 428 | Ga0395898_0020108 | 3300037466 | Bacteria | 6783 |
| 429 | Ga0395898_0022431 | 3300037466 | Bacteria | 6394 |
| 430 | Ga0395898_0027937 | 3300037466 | Bacteria | 5658 |
| 431 | Ga0395898_0036950 | 3300037466 | Bacteria | 4847 |
| 432 | Ga0395898_0040672 | 3300037466 | Bacteria | 4595 |
| 433 | Ga0395898_0041721 | 3300037466 | Bacteria | 4531 |
| 434 | Ga0395898_0054574 | 3300037466 | Bacteria | 3899 |
| 435 | Ga0395898_0068165 | 3300037466 | Bacteria | 3443 |
| 436 | Ga0395898_0071572 | 3300037466 | Bacteria | 3350 |
| 437 | Ga0395898_0085312 | 3300037466 | Bacteria | 3043 |
| 438 | Ga0395898_0180539 | 3300037466 | Unclassified | 2017 |
| 439 | Ga0395898_0220145 | 3300037466 | Bacteria | 1811 |
| 440 | Ga0395898_0270203 | 3300037466 | Bacteria | 1622 |
| 441 | Ga0395898_0489806 | 3300037466 | Bacteria | 1170 |
| 442 | Ga0395905_0000640 | 3300037471 | Bacteria | 46768 |
| 443 | Ga0395905_0001564 | 3300037471 | Bacteria | 27335 |
| 444 | Ga0395905_0007797 | 3300037471 | Bacteria | 10619 |
| 445 | Ga0395905_0008242 | 3300037471 | Bacteria | 10291 |
| 446 | Ga0395905_0020747 | 3300037471 | Bacteria | 6221 |
| 447 | Ga0395905_0063663 | 3300037471 | Bacteria | 3450 |
| 448 | Ga0395905_0066894 | 3300037471 | Bacteria | 3365 |
| 449 | Ga0395905_0093548 | 3300037471 | Bacteria | 2819 |
| 450 | Ga0395905_0093695 | 3300037471 | Bacteria | 2817 |
| 451 | Ga0395905_0160799 | 3300037471 | Bacteria | 2111 |
| 452 | Ga0395905_0299866 | 3300037471 | Bacteria | 1494 |
| 453 | Ga0395905_0500768 | 3300037471 | Bacteria | 1115 |
| 454 | Ga0436364_0533197 | 3300037853 | Bacteria | 1358 |
| 455 | Ga0395901_0000978 | 3300038443 | Bacteria | 30977 |
| 456 | Ga0395901_0001883 | 3300038443 | Bacteria | 21647 |
| 457 | Ga0395901_0002270 | 3300038443 | Bacteria | 19615 |
| 458 | Ga0395901_0002692 | 3300038443 | Bacteria | 17910 |
| 459 | Ga0395901_0011802 | 3300038443 | Bacteria | 8859 |
| 460 | Ga0395901_0015905 | 3300038443 | Bacteria | 7667 |
| 461 | Ga0395901_0016559 | 3300038443 | Bacteria | 7511 |
| 462 | Ga0395901_0032992 | 3300038443 | Bacteria | 5342 |
| 463 | Ga0395901_0035193 | 3300038443 | Bacteria | 5174 |
| 464 | Ga0395901_0057609 | 3300038443 | Bacteria | 4041 |
| 465 | Ga0395901_0114956 | 3300038443 | Bacteria | 2826 |
| 466 | Ga0395901_0138285 | 3300038443 | Bacteria | 2560 |
| 467 | Ga0395901_0143583 | 3300038443 | Bacteria | 2509 |
| 468 | Ga0395901_0257143 | 3300038443 | Bacteria | 1818 |
| 469 | Ga0395901_0341483 | 3300038443 | Bacteria | 1547 |
| 470 | Ga0395901_0449267 | 3300038443 | Bacteria | 1318 |
| 471 | Ga0436360_1292831 | 3300039438 | Bacteria | 2303 |
| 472 | Ga0436363_1287539 | 3300039450 | Bacteria | 3055 |
| 473 | Ga0439439_0044680 | 3300041406 | Bacteria | 1154 |
| 474 | Ga0439461_0012809 | 3300041410 | Bacteria | 1575 |
| 475 | Ga0451793_0979246 | 3300041452 | Bacteria | 1709 |
| 476 | Ga0451853_3576152 | 3300041512 | Bacteria | 1629 |
| 477 | Ga0451853_3629479 | 3300041512 | Bacteria | 1413 |
| 478 | Ga0439448_0012082 | 3300042005 | Bacteria | 2579 |
| 479 | Ga0439455_0016834 | 3300042012 | Bacteria | 1695 |
| 480 | Ga0439456_031407 | 3300042013 | Bacteria | 1138 |
| 481 | Ga0439446_0005591 | 3300042156 | Bacteria | 3238 |
| 482 | Ga0466969_0003306 | 3300044656 | Bacteria | 8575 |
| 483 | Ga0466969_0013131 | 3300044656 | Bacteria | 4364 |
| 484 | Ga0466969_0085238 | 3300044656 | Bacteria | 1502 |
| 485 | Ga0466972_0029041 | 3300044658 | Bacteria | 2724 |
| 486 | Ga0466972_0070793 | 3300044658 | Bacteria | 1664 |
| 487 | Ga0466965_0013693 | 3300044683 | Unclassified | 3830 |
| 488 | Ga0466965_0049114 | 3300044683 | Bacteria | 2091 |
| 489 | Ga0466965_0230224 | 3300044683 | Unclassified | 990 |
| 490 | Ga0466966_0004938 | 3300044684 | Bacteria | 8765 |
| 491 | Ga0466966_0008431 | 3300044684 | Bacteria | 6821 |
| 492 | Ga0466966_0063700 | 3300044684 | Bacteria | 2323 |
| 493 | Ga0466966_0202162 | 3300044684 | Bacteria | 1202 |
| 494 | Ga0466961_0011545 | 3300044693 | Bacteria | 5649 |
| 495 | Ga0466961_0026593 | 3300044693 | Bacteria | 3719 |
| 496 | Ga0466961_0033324 | 3300044693 | Bacteria | 3310 |
| 497 | Ga0466961_0049106 | 3300044693 | Bacteria | 2697 |
| 498 | Ga0466961_0148650 | 3300044693 | Bacteria | 1464 |
| 499 | Ga0466963_0000095 | 3300044694 | Bacteria | 31064 |
| 500 | Ga0466963_0004541 | 3300044694 | Bacteria | 8082 |
| 501 | Ga0466963_0004612 | 3300044694 | Bacteria | 8029 |
| 502 | Ga0466963_0005966 | 3300044694 | Bacteria | 7176 |
| 503 | Ga0466963_0015015 | 3300044694 | Bacteria | 4786 |
| 504 | Ga0466963_0017054 | 3300044694 | Bacteria | 4523 |
| 505 | Ga0466963_0017204 | 3300044694 | Bacteria | 4504 |
| 506 | Ga0466963_0019732 | 3300044694 | Bacteria | 4233 |
| 507 | Ga0466963_0021258 | 3300044694 | Bacteria | 4091 |
| 508 | Ga0466963_0029166 | 3300044694 | Bacteria | 3549 |
| 509 | Ga0466963_0030131 | 3300044694 | Bacteria | 3498 |
| 510 | Ga0466963_0052948 | 3300044694 | Bacteria | 2694 |
| 511 | Ga0466963_0116124 | 3300044694 | Bacteria | 1839 |
| 512 | Ga0466963_0202221 | 3300044694 | Bacteria | 1389 |
| 513 | Ga0466963_0246167 | 3300044694 | Bacteria | 1254 |
| 514 | Ga0466963_0255268 | 3300044694 | Bacteria | 1230 |
| 515 | Ga0466963_0346179 | 3300044694 | Bacteria | 1046 |
| 516 | Ga0466964_0000465 | 3300044706 | Bacteria | 12455 |
| 517 | Ga0466964_0007441 | 3300044706 | Bacteria | 4097 |
| 518 | Ga0466964_0008767 | 3300044706 | Bacteria | 3802 |
| 519 | Ga0466964_0024459 | 3300044706 | Bacteria | 2354 |
| 520 | Ga0466964_0167302 | 3300044706 | Bacteria | 1032 |
| 521 | Ga0466971_0001664 | 3300044719 | Bacteria | 9395 |
| 522 | Ga0466971_0016536 | 3300044719 | Unclassified | 3257 |
| 523 | Ga0466971_0053198 | 3300044719 | Bacteria | 1824 |
| 524 | Ga0466971_0066685 | 3300044719 | Bacteria | 1631 |
| 525 | Ga0466971_0091631 | 3300044719 | Bacteria | 1392 |
| 526 | Ga0466968_0002238 | 3300044735 | Bacteria | 7071 |
| 527 | Ga0466968_0006803 | 3300044735 | Bacteria | 4326 |
| 528 | Ga0466968_0025288 | 3300044735 | Bacteria | 2431 |
| 529 | Ga0466968_0031074 | 3300044735 | Bacteria | 2214 |
| 530 | Ga0466968_0039968 | 3300044735 | Bacteria | 1976 |
| 531 | Ga0466968_0080358 | 3300044735 | Bacteria | 1432 |
| 532 | Ga0466968_0083542 | 3300044735 | Bacteria | 1407 |
| 533 | Ga0466970_0004679 | 3300044765 | Bacteria | 6757 |
| 534 | Ga0466970_0177079 | 3300044765 | Bacteria | 1183 |
| 535 | Ga0466957_0001672 | 3300044842 | Bacteria | 11652 |
| 536 | Ga0466957_0004210 | 3300044842 | Bacteria | 7978 |
| 537 | Ga0466957_0015443 | 3300044842 | Bacteria | 4460 |
| 538 | Ga0466957_0020943 | 3300044842 | Bacteria | 3848 |
| 539 | Ga0466957_0025135 | 3300044842 | Bacteria | 3528 |
| 540 | Ga0466957_0066648 | 3300044842 | Bacteria | 2220 |
| 541 | Ga0466957_0070018 | 3300044842 | Bacteria | 2167 |
| 542 | Ga0466957_0072128 | 3300044842 | Bacteria | 2137 |
| 543 | Ga0466957_0073883 | 3300044842 | Bacteria | 2114 |
| 544 | Ga0466957_0151095 | 3300044842 | Bacteria | 1502 |
| 545 | Ga0466960_0001521 | 3300044901 | Bacteria | 8449 |
| 546 | Ga0466960_0124262 | 3300044901 | Bacteria | 1355 |
| 547 | Ga0466959_0002457 | 3300045049 | Bacteria | 11851 |
| 548 | Ga0466959_0005583 | 3300045049 | Bacteria | 8642 |
| 549 | Ga0466959_0011442 | 3300045049 | Bacteria | 6376 |
| 550 | Ga0466959_0026369 | 3300045049 | Bacteria | 4307 |
| 551 | Ga0466959_0109105 | 3300045049 | Bacteria | 1976 |
| 552 | Ga0466959_0254129 | 3300045049 | Bacteria | 1212 |
| 553 | Ga0466959_0417316 | 3300045049 | Bacteria | 911 |
| 554 | Ga0451576_0408613 | 3300045051 | Bacteria | 1424 |
| 555 | Ga0466958_0001908 | 3300045836 | Bacteria | 10200 |
| 556 | Ga0466958_0002667 | 3300045836 | Bacteria | 9029 |
| 557 | Ga0466958_0009659 | 3300045836 | Bacteria | 5382 |
| 558 | Ga0466958_0011393 | 3300045836 | Bacteria | 5008 |
| 559 | Ga0466958_0029313 | 3300045836 | Bacteria | 3266 |
| 560 | Ga0466958_0089370 | 3300045836 | Bacteria | 1904 |
| 561 | Ga0466958_0090580 | 3300045836 | Bacteria | 1892 |
| 562 | Ga0466958_0117544 | 3300045836 | Bacteria | 1662 |
| 563 | Ga0466958_0229725 | 3300045836 | Bacteria | 1185 |
| 564 | Ga0466958_0258213 | 3300045836 | Unclassified | 1115 |
| 565 | Ga0466958_0263946 | 3300045836 | Bacteria | 1102 |
| 566 | Ga0466967_0000676 | 3300045976 | Bacteria | 17274 |
| 567 | Ga0466967_0003281 | 3300045976 | Bacteria | 10494 |
| 568 | Ga0466967_0004469 | 3300045976 | Bacteria | 9438 |
| 569 | Ga0466967_0010011 | 3300045976 | Bacteria | 7082 |
| 570 | Ga0466967_0011240 | 3300045976 | Bacteria | 6766 |
| 571 | Ga0466967_0012377 | 3300045976 | Bacteria | 6521 |
| 572 | Ga0466967_0019227 | 3300045976 | Bacteria | 5487 |
| 573 | Ga0466967_0030709 | 3300045976 | Bacteria | 4511 |
| 574 | Ga0466967_0040726 | 3300045976 | Bacteria | 4001 |
| 575 | Ga0466967_0051313 | 3300045976 | Bacteria | 3614 |
| 576 | Ga0466967_0058374 | 3300045976 | Bacteria | 3411 |
| 577 | Ga0466967_0065864 | 3300045976 | Bacteria | 3226 |
| 578 | Ga0466967_0068035 | 3300045976 | Bacteria | 3178 |
| 579 | Ga0466967_0097862 | 3300045976 | Bacteria | 2678 |
| 580 | Ga0466967_0112673 | 3300045976 | Bacteria | 2501 |
| 581 | Ga0466967_0169802 | 3300045976 | Bacteria | 2051 |
| 582 | Ga0466967_0177756 | 3300045976 | Bacteria | 2005 |
| 583 | Ga0466967_0195313 | 3300045976 | Bacteria | 1914 |
| 584 | Ga0466967_0204631 | 3300045976 | Bacteria | 1870 |
| 585 | Ga0466967_0547148 | 3300045976 | Unclassified | 1139 |
| 586 | Ga0466967_0607901 | 3300045976 | Bacteria | 1079 |
| 587 | Ga0495627_076578 | 3300046453 | Unclassified | 973 |
| 588 | Ga0495592_0042691 | 3300046454 | Bacteria | 3395 |
| 589 | Ga0495592_0090270 | 3300046454 | Bacteria | 2198 |
| 590 | Ga0495592_0175584 | 3300046454 | Unclassified | 1463 |
| 591 | Ga0495603_0000081 | 3300046455 | Bacteria | 42501 |
| 592 | Ga0495603_0165798 | 3300046455 | Bacteria | 1280 |
| 593 | Ga0495629_0079661 | 3300046459 | Bacteria | 2287 |
| 594 | Ga0495629_0141270 | 3300046459 | Bacteria | 1675 |
| 595 | Ga0495629_0353297 | 3300046459 | Bacteria | 1002 |
| 596 | Ga0495641_0002133 | 3300046461 | Bacteria | 15953 |
| 597 | Ga0495641_0010605 | 3300046461 | Bacteria | 5322 |
| 598 | Ga0495651_0209544 | 3300046462 | Bacteria | 1358 |
| 599 | Ga0495651_0235532 | 3300046462 | Bacteria | 1258 |
| 600 | Ga0495653_0051290 | 3300046463 | Bacteria | 3168 |
| 601 | Ga0495653_0139181 | 3300046463 | Bacteria | 1709 |
| 602 | Ga0495582_0027562 | 3300046473 | Bacteria | 3115 |
| 603 | Ga0495582_0252168 | 3300046473 | Bacteria | 1012 |
| 604 | Ga0495662_0052778 | 3300046476 | Bacteria | 1963 |
| 605 | Ga0495662_0141439 | 3300046476 | Bacteria | 1184 |
| 606 | Ga0495584_0014513 | 3300046491 | Bacteria | 4013 |
| 607 | Ga0495584_0092599 | 3300046491 | Bacteria | 1525 |
| 608 | Ga0495584_0224471 | 3300046491 | Bacteria | 955 |
| 609 | Ga0495585_0077077 | 3300046492 | Unclassified | 1810 |
| 610 | Ga0495594_0000536 | 3300046499 | Bacteria | 19443 |
| 611 | Ga0495596_0061758 | 3300046500 | Bacteria | 1459 |
| 612 | Ga0495596_0061914 | 3300046500 | Unclassified | 1457 |
| 613 | Ga0495607_0070757 | 3300046501 | Unclassified | 1948 |
| 614 | Ga0495608_0006235 | 3300046511 | Bacteria | 8464 |
| 615 | Ga0495608_0106447 | 3300046511 | Bacteria | 1805 |
| 616 | Ga0495608_0426257 | 3300046511 | Unclassified | 809 |
| 617 | Ga0495630_0017298 | 3300046517 | Bacteria | 5281 |
| 618 | Ga0495630_0130037 | 3300046517 | Bacteria | 1912 |
| 619 | Ga0495631_0114062 | 3300046518 | Unclassified | 1162 |
| 620 | Ga0495637_0128200 | 3300046520 | Bacteria | 971 |
| 621 | Ga0495644_0008464 | 3300046523 | Bacteria | 3962 |
| 622 | Ga0495663_0015710 | 3300046525 | Unclassified | 2135 |
| 623 | Ga0495666_0019555 | 3300046526 | Bacteria | 3359 |
| 624 | Ga0495666_0134563 | 3300046526 | Bacteria | 1154 |
| 625 | Ga0495652_0120759 | 3300046529 | Unclassified | 2090 |
| 626 | Ga0495586_0120846 | 3300046535 | Bacteria | 1463 |
| 627 | Ga0495587_0011260 | 3300046536 | Bacteria | 5669 |
| 628 | Ga0495609_0034225 | 3300046538 | Unclassified | 2304 |
| 629 | Ga0495667_0025384 | 3300046559 | Bacteria | 3994 |
| 630 | Ga0495667_0058443 | 3300046559 | Bacteria | 2534 |
| 631 | Ga0495667_0059886 | 3300046559 | Bacteria | 2498 |
| 632 | Ga0495667_0143913 | 3300046559 | Bacteria | 1536 |
| 633 | Ga0495656_0069126 | 3300046615 | Unclassified | 1563 |
| 634 | Ga0495656_0120245 | 3300046615 | Bacteria | 1239 |
| 635 | Ga0495656_0206021 | 3300046615 | Bacteria | 978 |
| 636 | Ga0495634_0064947 | 3300046642 | Bacteria | 2419 |
| 637 | Ga0495634_0202561 | 3300046642 | Bacteria | 1232 |
| 638 | Ga0495635_0131522 | 3300046663 | Bacteria | 1706 |
| 639 | Ga0495659_0065526 | 3300046664 | Bacteria | 1351 |
| 640 | Ga0495659_0137573 | 3300046664 | Bacteria | 973 |
| 641 | Ga0495588_0002678 | 3300046674 | Bacteria | 7625 |
| 642 | Ga0495588_0128966 | 3300046674 | Bacteria | 1334 |
| 643 | Ga0495657_0073386 | 3300046675 | Bacteria | 2229 |
| 644 | Ga0495657_0083062 | 3300046675 | Unclassified | 2068 |
| 645 | Ga0495599_0050417 | 3300046678 | Bacteria | 2608 |
| 646 | Ga0495599_0071124 | 3300046678 | Bacteria | 2171 |
| 647 | Ga0495646_0034028 | 3300046680 | Bacteria | 3166 |
| 648 | Ga0495646_0073986 | 3300046680 | Bacteria | 2001 |
| 649 | Ga0495646_0125367 | 3300046680 | Bacteria | 1450 |
| 650 | Ga0495647_0023856 | 3300046681 | Bacteria | 2222 |
| 651 | Ga0495613_0025650 | 3300046689 | Bacteria | 4392 |
| 652 | Ga0495613_0047146 | 3300046689 | Unclassified | 3183 |
| 653 | Ga0495624_0210753 | 3300046690 | Bacteria | 1179 |
| 654 | Ga0495670_0065767 | 3300046691 | Bacteria | 1828 |
| 655 | Ga0495600_0014203 | 3300046809 | Bacteria | 5017 |
| 656 | Ga0495581_0034383 | 3300047315 | Bacteria | 2933 |
| 657 | Ga0495581_0071126 | 3300047315 | Bacteria | 2013 |
| 658 | Ga0495604_0058379 | 3300047317 | Bacteria | 2963 |
| 659 | Ga0495604_0219087 | 3300047317 | Bacteria | 1311 |
| 660 | Ga0495674_0039772 | 3300047319 | Bacteria | 4212 |
| 661 | Ga0495674_0082453 | 3300047319 | Bacteria | 2757 |
| 662 | Ga0495676_0002817 | 3300047321 | Bacteria | 15665 |
| 663 | Ga0495676_0204108 | 3300047321 | Bacteria | 1372 |
| 664 | Ga0495680_0071197 | 3300047322 | Bacteria | 2648 |
| 665 | Ga0495680_0120624 | 3300047322 | Bacteria | 1936 |
| 666 | Ga0495680_0124632 | 3300047322 | Bacteria | 1899 |
| 667 | Ga0495680_0143697 | 3300047322 | Bacteria | 1744 |
| 668 | Ga0495675_0093888 | 3300047444 | Bacteria | 1882 |
| 669 | Ga0495684_0029449 | 3300047471 | Bacteria | 4214 |
| 670 | Ga0495684_0035091 | 3300047471 | Bacteria | 3848 |
| 671 | Ga0495684_0350490 | 3300047471 | Bacteria | 1048 |
| 672 | Ga0495602_0244232 | 3300048088 | Bacteria | 1341 |
| 673 | Ga0496100_0012806 | 3300048903 | Bacteria | 4820 |
| 674 | Ga0496100_0013565 | 3300048903 | Bacteria | 4705 |
| 675 | Ga0496100_0128670 | 3300048903 | Bacteria | 1780 |
| 676 | Ga0496101_0014642 | 3300048904 | Bacteria | 5274 |
| 677 | Ga0496101_0048493 | 3300048904 | Bacteria | 3053 |
| 678 | Ga0496101_0163765 | 3300048904 | Bacteria | 1707 |
| 679 | Ga0496101_0212930 | 3300048904 | Bacteria | 1497 |
| 680 | Ga0496101_0213762 | 3300048904 | Bacteria | 1495 |
| 681 | Ga0496101_0340692 | 3300048904 | Bacteria | 1177 |
| 682 | Ga0496101_0348559 | 3300048904 | Unclassified | 1163 |
| 683 | Ga0496102_0016639 | 3300048905 | Bacteria | 6430 |
| 684 | Ga0496102_0017600 | 3300048905 | Bacteria | 6262 |
| 685 | Ga0496102_0048059 | 3300048905 | Bacteria | 3879 |
| 686 | Ga0496102_0095778 | 3300048905 | Bacteria | 2751 |
| 687 | Ga0496102_0422367 | 3300048905 | Unclassified | 1252 |
| 688 | Ga0496103_0010103 | 3300048906 | Bacteria | 5580 |
| 689 | Ga0496103_0015355 | 3300048906 | Bacteria | 4555 |
| 690 | Ga0496103_0015863 | 3300048906 | Bacteria | 4492 |
| 691 | Ga0496104_0000865 | 3300048907 | Bacteria | 26083 |
| 692 | Ga0496104_0010631 | 3300048907 | Bacteria | 8224 |
| 693 | Ga0496104_0016341 | 3300048907 | Bacteria | 6740 |
| 694 | Ga0496104_0068058 | 3300048907 | Bacteria | 3383 |
| 695 | Ga0496104_0235398 | 3300048907 | Bacteria | 1743 |
| 696 | Ga0496104_0789962 | 3300048907 | Bacteria | 855 |
| 697 | Ga0496105_0000775 | 3300048908 | Bacteria | 21608 |
| 698 | Ga0496105_0004904 | 3300048908 | Bacteria | 10116 |
| 699 | Ga0496105_0045676 | 3300048908 | Bacteria | 3614 |
| 700 | Ga0496105_0063287 | 3300048908 | Bacteria | 3052 |
| 701 | Ga0496105_0092357 | 3300048908 | Bacteria | 2499 |
| 702 | Ga0496105_0191008 | 3300048908 | Unclassified | 1674 |
| 703 | Ga0496105_0216472 | 3300048908 | Bacteria | 1560 |
| 704 | Ga0496105_0296402 | 3300048908 | Bacteria | 1301 |
| 705 | Ga0496106_0014470 | 3300048909 | Bacteria | 5829 |
| 706 | Ga0496106_0058137 | 3300048909 | Bacteria | 2926 |
| 707 | Ga0496106_0083654 | 3300048909 | Bacteria | 2454 |
| 708 | Ga0496106_0141628 | 3300048909 | Unclassified | 1892 |
| 709 | Ga0496106_0204146 | 3300048909 | Bacteria | 1573 |
| 710 | Ga0496106_0362770 | 3300048909 | Bacteria | 1164 |
| 711 | Ga0496107_0000242 | 3300048910 | Bacteria | 28631 |
| 712 | Ga0496107_0006234 | 3300048910 | Bacteria | 8198 |
| 713 | Ga0496107_0021016 | 3300048910 | Bacteria | 4612 |
| 714 | Ga0496107_0041282 | 3300048910 | Bacteria | 3312 |
| 715 | Ga0496107_0056304 | 3300048910 | Bacteria | 2841 |
| 716 | Ga0496107_0307858 | 3300048910 | Unclassified | 1179 |
| 717 | Ga0496107_0367837 | 3300048910 | Bacteria | 1069 |
| 718 | Ga0496107_0369887 | 3300048910 | Bacteria | 1066 |
| 719 | Ga0496108_0003137 | 3300048911 | Bacteria | 13288 |
| 720 | Ga0496108_0005018 | 3300048911 | Bacteria | 10693 |
| 721 | Ga0496108_0010715 | 3300048911 | Bacteria | 7439 |
| 722 | Ga0496108_0022146 | 3300048911 | Bacteria | 5225 |
| 723 | Ga0496108_0023428 | 3300048911 | Bacteria | 5081 |
| 724 | Ga0496108_0033698 | 3300048911 | Bacteria | 4254 |
| 725 | Ga0496108_0043433 | 3300048911 | Bacteria | 3754 |
| 726 | Ga0496108_0196792 | 3300048911 | Unclassified | 1748 |
| 727 | Ga0496109_0001239 | 3300048912 | Bacteria | 21163 |
| 728 | Ga0496109_0008195 | 3300048912 | Bacteria | 8865 |
| 729 | Ga0496109_0018833 | 3300048912 | Bacteria | 6073 |
| 730 | Ga0496109_0041159 | 3300048912 | Bacteria | 4187 |
| 731 | Ga0496109_0041213 | 3300048912 | Bacteria | 4183 |
| 732 | Ga0496109_0062927 | 3300048912 | Bacteria | 3393 |
| 733 | Ga0496109_0081032 | 3300048912 | Bacteria | 2991 |
| 734 | Ga0496109_0233179 | 3300048912 | Bacteria | 1732 |
| 735 | Ga0496109_0247179 | 3300048912 | Bacteria | 1679 |
| 736 | Ga0496109_0304410 | 3300048912 | Unclassified | 1503 |
| 737 | Ga0496109_0601108 | 3300048912 | Bacteria | 1036 |
| 738 | Ga0496109_0618613 | 3300048912 | Bacteria | 1019 |
| 739 | Ga0496110_0011919 | 3300048913 | Bacteria | 7142 |
| 740 | Ga0496110_0029730 | 3300048913 | Bacteria | 4706 |
| 741 | Ga0496110_0046702 | 3300048913 | Unclassified | 3789 |
| 742 | Ga0496110_0048083 | 3300048913 | Bacteria | 3738 |
| 743 | Ga0496110_0065457 | 3300048913 | Bacteria | 3213 |
| 744 | Ga0496110_0149564 | 3300048913 | Unclassified | 2114 |
| 745 | Ga0496111_0003372 | 3300048914 | Bacteria | 9877 |
| 746 | Ga0496111_0024846 | 3300048914 | Bacteria | 4225 |
| 747 | Ga0496111_0116049 | 3300048914 | Bacteria | 1974 |
| 748 | Ga0496111_0116295 | 3300048914 | Bacteria | 1972 |
| 749 | Ga0496111_0329855 | 3300048914 | Bacteria | 1130 |
| 750 | Ga0496112_0003845 | 3300048915 | Bacteria | 12539 |
| 751 | Ga0496112_0019694 | 3300048915 | Bacteria | 6376 |
| 752 | Ga0496112_0093391 | 3300048915 | Bacteria | 2979 |
| 753 | Ga0496112_0099657 | 3300048915 | Bacteria | 2875 |
| 754 | Ga0496112_0116912 | 3300048915 | Unclassified | 2637 |
| 755 | Ga0496112_0314375 | 3300048915 | Bacteria | 1511 |
| 756 | Ga0496112_0578012 | 3300048915 | Bacteria | 1056 |
| 757 | Ga0496113_0001165 | 3300048916 | Bacteria | 14346 |
| 758 | Ga0496113_0001530 | 3300048916 | Bacteria | 12949 |
| 759 | Ga0496113_0026871 | 3300048916 | Bacteria | 4119 |
| 760 | Ga0496113_0069827 | 3300048916 | Bacteria | 2668 |
| 761 | Ga0496113_0085219 | 3300048916 | Unclassified | 2427 |
| 762 | Ga0496113_0299372 | 3300048916 | Bacteria | 1288 |
| 763 | Ga0496114_0003362 | 3300048917 | Bacteria | 12289 |
| 764 | Ga0496114_0015427 | 3300048917 | Bacteria | 6145 |
| 765 | Ga0496114_0024732 | 3300048917 | Bacteria | 4902 |
| 766 | Ga0496114_0026950 | 3300048917 | Bacteria | 4708 |
| 767 | Ga0496114_0044143 | 3300048917 | Bacteria | 3698 |
| 768 | Ga0496114_0178809 | 3300048917 | Bacteria | 1852 |
| 769 | Ga0496114_0256222 | 3300048917 | Unclassified | 1540 |
| 770 | Ga0496114_0279677 | 3300048917 | Unclassified | 1471 |
| 771 | Ga0496115_0005818 | 3300048918 | Bacteria | 8984 |
| 772 | Ga0496115_0034066 | 3300048918 | Bacteria | 4024 |
| 773 | Ga0496115_0054854 | 3300048918 | Bacteria | 3200 |
| 774 | Ga0496115_0226685 | 3300048918 | Unclassified | 1541 |
| 775 | Ga0496115_0530921 | 3300048918 | Bacteria | 942 |
| 776 | Ga0501031_0003333 | 3300049568 | Bacteria | 10307 |
| 777 | Ga0501031_0021919 | 3300049568 | Bacteria | 4162 |
| 778 | Ga0501032_0001554 | 3300049569 | Bacteria | 18314 |
| 779 | Ga0501033_0000899 | 3300049570 | Bacteria | 27196 |
| 780 | Ga0501033_0112125 | 3300049570 | Unclassified | 1984 |
| 781 | Ga0501033_0160533 | 3300049570 | Bacteria | 1618 |
| 782 | Ga0501034_0072921 | 3300049571 | Bacteria | 3442 |
| 783 | Ga0501036_0005487 | 3300049572 | Bacteria | 10285 |
| 784 | Ga0501036_0044330 | 3300049572 | Bacteria | 3767 |
| 785 | Ga0501036_0053302 | 3300049572 | Bacteria | 3425 |
| 786 | Ga0501037_0007386 | 3300049573 | Bacteria | 8039 |
| 787 | Ga0501037_0122124 | 3300049573 | Bacteria | 1872 |
| 788 | Ga0501038_0003802 | 3300049574 | Bacteria | 14046 |
| 789 | Ga0501038_0040949 | 3300049574 | Bacteria | 4042 |
| 790 | Ga0501039_0003976 | 3300049575 | Bacteria | 11110 |
| 791 | Ga0501039_0009033 | 3300049575 | Bacteria | 7594 |
| 792 | Ga0501040_0001387 | 3300049576 | Bacteria | 15298 |
| 793 | Ga0501040_0002266 | 3300049576 | Bacteria | 12360 |
| 794 | Ga0501040_0005466 | 3300049576 | Bacteria | 8221 |
| 795 | Ga0501040_0141222 | 3300049576 | Bacteria | 1697 |
| 796 | Ga0501041_0000474 | 3300049577 | Bacteria | 20418 |
| 797 | Ga0501041_0000895 | 3300049577 | Bacteria | 16124 |
| 798 | Ga0501042_0000930 | 3300049578 | Bacteria | 16501 |
| 799 | Ga0501042_0068233 | 3300049578 | Bacteria | 2542 |
| 800 | Ga0501043_0000693 | 3300049579 | Bacteria | 29791 |
| 801 | Ga0501043_0086178 | 3300049579 | Bacteria | 2468 |
| 802 | Ga0501043_0240756 | 3300049579 | Bacteria | 1395 |
| 803 | Ga0501046_0001855 | 3300049580 | Bacteria | 20125 |
| 804 | Ga0501046_0040284 | 3300049580 | Bacteria | 3734 |
| 805 | Ga0501046_0328908 | 3300049580 | Bacteria | 1112 |
| 806 | Ga0501047_0037685 | 3300049581 | Bacteria | 4676 |
| 807 | Ga0501047_0061174 | 3300049581 | Bacteria | 3634 |
| 808 | Ga0501047_0150034 | 3300049581 | Bacteria | 2208 |
| 809 | Ga0501047_0231175 | 3300049581 | Bacteria | 1703 |
| 810 | Ga0501048_0000867 | 3300049582 | Bacteria | 22328 |
| 811 | Ga0501048_0008074 | 3300049582 | Bacteria | 7967 |
| 812 | Ga0501048_0031868 | 3300049582 | Bacteria | 3812 |
| 813 | Ga0501067_0020755 | 3300049583 | Bacteria | 3634 |
| 814 | Ga0501067_0023040 | 3300049583 | Bacteria | 3449 |
| 815 | Ga0501067_0031144 | 3300049583 | Bacteria | 2960 |
| 816 | Ga0501067_0046875 | 3300049583 | Bacteria | 2399 |
| 817 | Ga0501067_0121005 | 3300049583 | Unclassified | 1456 |
| 818 | Ga0501067_0137929 | 3300049583 | Bacteria | 1358 |
| 819 | Ga0501067_0139502 | 3300049583 | Bacteria | 1350 |
| 820 | Ga0501067_0202908 | 3300049583 | Bacteria | 1104 |
| 821 | Ga0501068_0001514 | 3300049584 | Bacteria | 12364 |
| 822 | Ga0501068_0003100 | 3300049584 | Bacteria | 8878 |
| 823 | Ga0501068_0015027 | 3300049584 | Bacteria | 4439 |
| 824 | Ga0501068_0145475 | 3300049584 | Unclassified | 1487 |
| 825 | Ga0501069_0000605 | 3300049585 | Bacteria | 16589 |
| 826 | Ga0501069_0012648 | 3300049585 | Bacteria | 4490 |
| 827 | Ga0501069_0030644 | 3300049585 | Bacteria | 2955 |
| 828 | Ga0501069_0069892 | 3300049585 | Bacteria | 1966 |
| 829 | Ga0501070_0001149 | 3300049586 | Bacteria | 23709 |
| 830 | Ga0501070_0024878 | 3300049586 | Bacteria | 5021 |
| 831 | Ga0501070_0042253 | 3300049586 | Bacteria | 3797 |
| 832 | Ga0501070_0075545 | 3300049586 | Bacteria | 2790 |
| 833 | Ga0501070_0333152 | 3300049586 | Bacteria | 1233 |
| 834 | Ga0501070_0333798 | 3300049586 | Bacteria | 1232 |
| 835 | Ga0501071_0000330 | 3300049587 | Bacteria | 22815 |
| 836 | Ga0501071_0000677 | 3300049587 | Bacteria | 17791 |
| 837 | Ga0501071_0030359 | 3300049587 | Bacteria | 3822 |
| 838 | Ga0501072_0001627 | 3300049588 | Bacteria | 16809 |
| 839 | Ga0501072_0003411 | 3300049588 | Bacteria | 11969 |
| 840 | Ga0501072_0006557 | 3300049588 | Bacteria | 8862 |
| 841 | Ga0501072_0007942 | 3300049588 | Bacteria | 8055 |
| 842 | Ga0501072_0016896 | 3300049588 | Bacteria | 5606 |
| 843 | Ga0501072_0023091 | 3300049588 | Bacteria | 4829 |
| 844 | Ga0501072_0131910 | 3300049588 | Bacteria | 1991 |
| 845 | Ga0501073_0003204 | 3300049589 | Bacteria | 12288 |
| 846 | Ga0501073_0029285 | 3300049589 | Bacteria | 3935 |
| 847 | Ga0501073_0031588 | 3300049589 | Bacteria | 3778 |
| 848 | Ga0501073_0063173 | 3300049589 | Bacteria | 2583 |
| 849 | Ga0501073_0269778 | 3300049589 | Unclassified | 1174 |
| 850 | Ga0501074_0022586 | 3300049590 | Bacteria | 4572 |
| 851 | Ga0501074_0030757 | 3300049590 | Bacteria | 3890 |
| 852 | Ga0501074_0045687 | 3300049590 | Bacteria | 3167 |
| 853 | Ga0501074_0153769 | 3300049590 | Bacteria | 1644 |
| 854 | Ga0501075_0001209 | 3300049591 | Bacteria | 16714 |
| 855 | Ga0501075_0017103 | 3300049591 | Bacteria | 5234 |
| 856 | Ga0501075_0044640 | 3300049591 | Unclassified | 3325 |
| 857 | Ga0501075_0108908 | 3300049591 | Bacteria | 2106 |
| 858 | Ga0501075_0267954 | 3300049591 | Bacteria | 1301 |
| 859 | Ga0501075_0332283 | 3300049591 | Bacteria | 1158 |
| 860 | Ga0501076_0004029 | 3300049592 | Bacteria | 10380 |
| 861 | Ga0501076_0006243 | 3300049592 | Bacteria | 8630 |
| 862 | Ga0501076_0011459 | 3300049592 | Bacteria | 6606 |
| 863 | Ga0501076_0035541 | 3300049592 | Bacteria | 3897 |
| 864 | Ga0501076_0185501 | 3300049592 | Bacteria | 1696 |
| 865 | Ga0501076_0219026 | 3300049592 | Unclassified | 1556 |
| 866 | Ga0501077_0000576 | 3300049593 | Bacteria | 22271 |
| 867 | Ga0501077_0008185 | 3300049593 | Bacteria | 6465 |
| 868 | Ga0501077_0098818 | 3300049593 | Bacteria | 1850 |
| 869 | Ga0501077_0103972 | 3300049593 | Unclassified | 1800 |
| 870 | Ga0501079_0001513 | 3300049741 | Bacteria | 16457 |
| 871 | Ga0501079_0009336 | 3300049741 | Bacteria | 7433 |
| 872 | Ga0501079_0206946 | 3300049741 | Bacteria | 1533 |
| 873 | Ga0501080_0001056 | 3300049742 | Bacteria | 22640 |
| 874 | Ga0501080_0013393 | 3300049742 | Bacteria | 7543 |
| 875 | Ga0501080_0043951 | 3300049742 | Bacteria | 4159 |
| 876 | Ga0501080_0059685 | 3300049742 | Bacteria | 3549 |
| 877 | Ga0501080_0074751 | 3300049742 | Bacteria | 3152 |
| 878 | Ga0501080_0194526 | 3300049742 | Bacteria | 1863 |
| 879 | Ga0501081_0000753 | 3300049743 | Bacteria | 18947 |
| 880 | Ga0501081_0002176 | 3300049743 | Bacteria | 12311 |
| 881 | Ga0501081_0005108 | 3300049743 | Bacteria | 8450 |
| 882 | Ga0501083_0002444 | 3300049744 | Bacteria | 12712 |
| 883 | Ga0501035_0001594 | 3300049822 | Bacteria | 22969 |
| 884 | Ga0501035_0014199 | 3300049822 | Bacteria | 7351 |
| 885 | Ga0501035_0108614 | 3300049822 | Bacteria | 2432 |
| 886 | Ga0501044_0457884 | 3300049823 | Unclassified | 1181 |
| 887 | Ga0501045_0001276 | 3300049824 | Bacteria | 16726 |
| 888 | Ga0501045_0005255 | 3300049824 | Bacteria | 8957 |
| 889 | Ga0501045_0038043 | 3300049824 | Bacteria | 3499 |
| 890 | Ga0501045_0054993 | 3300049824 | Bacteria | 2911 |
| 891 | Ga0501045_0095770 | 3300049824 | Bacteria | 2196 |
| 892 | nmdc:mga03683_171769_c1 | 3300050489 | Bacteria | 985 |
| 893 | nmdc:mga00v17_368682_c1 | 3300050491 | Bacteria | 934 |
| 894 | nmdc:mga0yw44_181621_c1 | 3300050492 | Bacteria | 1385 |
| 895 | nmdc:mga0yw44_51448_c1 | 3300050492 | Bacteria | 2494 |
| 896 | nmdc:mga06z11_195294_c1 | 3300050494 | Bacteria | 1173 |
| 897 | nmdc:mga05p37_1712_c1 | 3300050507 | Bacteria | 25565 |
| 898 | nmdc:mga05p37_19624_c1 | 3300050507 | Bacteria | 8175 |
| 899 | nmdc:mga05p37_301655_c1 | 3300050507 | Unclassified | 1903 |
| 900 | nmdc:mga05p37_52672_c1 | 3300050507 | Bacteria | 5004 |
| 901 | nmdc:mga05p37_606736_c1 | 3300050507 | Bacteria | 1234 |
| 902 | nmdc:mga05p37_813115_c1 | 3300050507 | Bacteria | 1021 |
| 903 | nmdc:mga05p37_8903_c1 | 3300050507 | Bacteria | 11860 |
| 904 | nmdc:mga09592_118389_c1 | 3300050508 | Unclassified | 2273 |
| 905 | nmdc:mga09592_5828_c1 | 3300050508 | Bacteria | 10047 |
| 906 | nmdc:mga0qj67_291079_c1 | 3300050509 | Bacteria | 1323 |
| 907 | nmdc:mga06r32_28868_c1 | 3300050510 | Bacteria | 5193 |
| 908 | nmdc:mga06r32_49576_c1 | 3300050510 | Bacteria | 4015 |
| 909 | nmdc:mga06r32_560576_c1 | 3300050510 | Bacteria | 1116 |
| 910 | nmdc:mga06r32_66422_c1 | 3300050510 | Bacteria | 3480 |
| 911 | nmdc:mga08y16_19493_c1 | 3300050511 | Bacteria | 7151 |
| 912 | nmdc:mga08y16_580143_c1 | 3300050511 | Bacteria | 1132 |
| 913 | nmdc:mga08y16_60613_c1 | 3300050511 | Bacteria | 3952 |
| 914 | nmdc:mga08y16_786024_c1 | 3300050511 | Bacteria | 946 |
| 915 | nmdc:mga0n895_12180_c1 | 3300050512 | Bacteria | 7702 |
| 916 | nmdc:mga0n895_230390_c1 | 3300050512 | Unclassified | 1880 |
| 917 | nmdc:mga0n895_234673_c1 | 3300050512 | Bacteria | 1862 |
| 918 | nmdc:mga0n895_71764_c1 | 3300050512 | Bacteria | 3434 |
| 919 | nmdc:mga0n895_88875_c1 | 3300050512 | Bacteria | 3090 |
| 920 | nmdc:mga0rr50_157685_c1 | 3300050513 | Bacteria | 1840 |
| 921 | nmdc:mga0rr50_201488_c1 | 3300050513 | Bacteria | 1635 |
| 922 | nmdc:mga0rr50_33890_c1 | 3300050513 | Bacteria | 3652 |
| 923 | nmdc:mga0rr50_372_c1 | 3300050513 | Bacteria | 24510 |
| 924 | nmdc:mga0rr50_95152_c1 | 3300050513 | Bacteria | 2328 |
| 925 | nmdc:mga08x19_177286_c1 | 3300050514 | Bacteria | 1454 |
| 926 | nmdc:mga08x19_34795_c1 | 3300050514 | Bacteria | 3186 |
| 927 | nmdc:mga08x19_45511_c1 | 3300050514 | Bacteria | 2805 |
| 928 | nmdc:mga08x19_4620_c1 | 3300050514 | Bacteria | 8173 |
| 929 | nmdc:mga08x19_5986_c1 | 3300050514 | Bacteria | 7191 |
| 930 | nmdc:mga0a205_109138_c1 | 3300050515 | Bacteria | 2666 |
| 931 | nmdc:mga0a205_15513_c1 | 3300050515 | Bacteria | 7120 |
| 932 | nmdc:mga0a205_202628_c1 | 3300050515 | Unclassified | 1874 |
| 933 | nmdc:mga0a205_28071_c1 | 3300050515 | Bacteria | 5378 |
| 934 | nmdc:mga0a205_41740_c1 | 3300050515 | Bacteria | 4419 |
| 935 | nmdc:mga0a205_503541_c1 | 3300050515 | Unclassified | 1068 |
| 936 | Ga0495601_0006980 | 3300053077 | Bacteria | 6614 |
| 937 | Ga0495612_0014817 | 3300053078 | Bacteria | 3128 |
| 938 | Ga0495655_0107850 | 3300053083 | Bacteria | 833 |
| 939 | Ga0495595_0010344 | 3300053084 | Bacteria | 3876 |
| 940 | Ga0495595_0021019 | 3300053084 | Bacteria | 2847 |
| 941 | Ga0495595_0030604 | 3300053084 | Bacteria | 2415 |
| 942 | Ga0495619_0035292 | 3300053085 | Bacteria | 3252 |
| 943 | Ga0495619_0052545 | 3300053085 | Bacteria | 2694 |
| 944 | Ga0495619_0274774 | 3300053085 | Bacteria | 1167 |
| 945 | Ga0501084_0000985 | 3300054114 | Bacteria | 22070 |
| 946 | Ga0501084_0002974 | 3300054114 | Bacteria | 13727 |
| 947 | Ga0501084_0038205 | 3300054114 | Bacteria | 4013 |
| 948 | Ga0501084_0040964 | 3300054114 | Bacteria | 3875 |
| 949 | Ga0501084_0076185 | 3300054114 | Bacteria | 2811 |
| 950 | Ga0501082_0012784 | 3300060353 | Bacteria | 7215 |
| 951 | Ga0501082_0016180 | 3300060353 | Bacteria | 6419 |
| 952 | Ga0501082_0090400 | 3300060353 | Bacteria | 2643 |
| 953 | Ga0501082_0121059 | 3300060353 | Bacteria | 2268 |
| 954 | Ga0466962_0000096 | 3300061719 | Bacteria | 35253 |
| 955 | Ga0466962_0003609 | 3300061719 | Bacteria | 7374 |
| 956 | Ga0466962_0016261 | 3300061719 | Bacteria | 3588 |
| 957 | Ga0530510_0002722 | 3300061734 | Bacteria | 12171 |
| 958 | Ga0530510_0006950 | 3300061734 | Bacteria | 7888 |
| 959 | Ga0530510_0011066 | 3300061734 | Bacteria | 6328 |
| 960 | Ga0530510_0047359 | 3300061734 | Bacteria | 3106 |
| 961 | Ga0530510_0172463 | 3300061734 | Bacteria | 1602 |
| 962 | Ga0395898_0123418 | |||
| 963 | JGI25407J50210_10001067 | |||
| 964 | Ga0070658_10037764 | |||
| 965 | Ga0070683_100037562 | |||
| 966 | Ga0070683_100254295 | |||
| 967 | Ga0070690_100080852 | |||
| 968 | Ga0068869_100088418 | |||
| 969 | Ga0070680_100020568 | |||
| 970 | Ga0070680_100023083 | |||
| 971 | Ga0070680_100049179 | |||
| 972 | Ga0070680_100077430 | |||
| 973 | Ga0070680_100296143 | |||
| 974 | Ga0070682_100137262 | |||
| 975 | Ga0070660_100008257 | |||
| 976 | Ga0070660_100020167 | |||
| 977 | Ga0070660_100045357 | |||
| 978 | Ga0070660_100054065 | |||
| 979 | Ga0070660_100078063 | |||
| 980 | Ga0070660_100296139 | |||
| 981 | Ga0070691_10031993 | |||
| 982 | Ga0070691_10086887 | |||
| 983 | Ga0070661_100056424 | |||
| 984 | Ga0070692_10014373 | |||
| 985 | Ga0070692_10018151 | |||
| 986 | Ga0070668_100053143 | |||
| 987 | Ga0070669_100340478 | |||
| 988 | Ga0070671_100136151 | |||
| 989 | Ga0070671_100164199 | |||
| 990 | Ga0070671_100435585 | |||
| 991 | Ga0070674_100005755 | |||
| 992 | Ga0070674_100055508 | |||
| 993 | Ga0070673_100109765 | |||
| 994 | Ga0070688_100182657 | |||
| 995 | Ga0070659_100004574 | |||
| 996 | Ga0070659_100024028 | |||
| 997 | Ga0070659_100037243 | |||
| 998 | Ga0070659_100282099 | |||
| 999 | Ga0070703_10029379 | |||
| 1000 | Ga0070709_10006188 | |||
| 1001 | Ga0070709_10038468 | |||
| 1002 | Ga0070709_10068543 | |||
| 1003 | Ga0070709_10132751 | |||
| 1004 | Ga0070709_10327033 | |||
| 1005 | Ga0070709_10351815 | |||
| 1006 | Ga0070714_100004838 | |||
| 1007 | Ga0070714_100008551 | |||
| 1008 | Ga0070714_100026860 | |||
| 1009 | Ga0070714_100052155 | |||
| 1010 | Ga0070714_100061379 | |||
| 1011 | Ga0070714_100070139 | |||
| 1012 | Ga0070714_100083695 | |||
| 1013 | Ga0070714_100231522 | |||
| 1014 | Ga0070713_100001060 | |||
| 1015 | Ga0070713_100008471 | |||
| 1016 | Ga0070710_10003601 | |||
| 1017 | Ga0070710_10008982 | |||
| 1018 | Ga0070710_10105674 | |||
| 1019 | Ga0070701_10065807 | |||
| 1020 | Ga0070711_100009812 | |||
| 1021 | Ga0070711_100016495 | |||
| 1022 | Ga0070700_100156245 | |||
| 1023 | Ga0070700_100189187 | |||
| 1024 | Ga0070694_100047908 | |||
| 1025 | Ga0070694_100086507 | |||
| 1026 | Ga0070694_100408916 | |||
| 1027 | Ga0070678_100129016 | |||
| 1028 | Ga0070662_100032975 | |||
| 1029 | Ga0070681_10039443 | |||
| 1030 | Ga0070681_10071482 | |||
| 1031 | Ga0070681_10245233 | |||
| 1032 | Ga0068867_100022590 | |||
| 1033 | Ga0068867_100084604 | |||
| 1034 | Ga0070706_100058985 | |||
| 1035 | Ga0070706_100122634 | |||
| 1036 | Ga0070707_100051967 | |||
| 1037 | Ga0070707_100064103 | |||
| 1038 | Ga0070707_100421842 | |||
| 1039 | Ga0070698_100015246 | |||
| 1040 | Ga0070698_100016183 | |||
| 1041 | Ga0070698_100022054 | |||
| 1042 | Ga0070699_100082858 | |||
| 1043 | Ga0070679_100022080 | |||
| 1044 | Ga0070679_100033495 | |||
| 1045 | Ga0070679_100036271 | |||
| 1046 | Ga0070679_100052882 | |||
| 1047 | Ga0070679_100082777 | |||
| 1048 | Ga0070684_100020666 | |||
| 1049 | Ga0070684_100071138 | |||
| 1050 | Ga0070684_100126064 | |||
| 1051 | Ga0070684_100542332 | |||
| 1052 | Ga0070697_100158263 | |||
| 1053 | Ga0070697_100188955 | |||
| 1054 | Ga0068853_100325429 | |||
| 1055 | Ga0070695_100029461 | |||
| 1056 | Ga0070695_100140979 | |||
| 1057 | Ga0070696_100015889 | |||
| 1058 | Ga0070696_100061459 | |||
| 1059 | Ga0070693_100023061 | |||
| 1060 | Ga0070693_100248803 | |||
| 1061 | Ga0070704_100015256 | |||
| 1062 | Ga0070704_100017012 | |||
| 1063 | Ga0070704_100158114 | |||
| 1064 | Ga0070704_100162942 | |||
| 1065 | Ga0068855_100052856 | |||
| 1066 | Ga0068855_100061944 | |||
| 1067 | Ga0068855_100152857 | |||
| 1068 | Ga0068855_100208157 | |||
| 1069 | Ga0070664_100091185 | |||
| 1070 | Ga0068857_100038685 | |||
| 1071 | Ga0068857_100604640 | |||
| 1072 | Ga0068856_100083532 | |||
| 1073 | Ga0068852_100076060 | |||
| 1074 | Ga0068859_100488406 | |||
| 1075 | Ga0068864_100070632 | |||
| 1076 | Ga0068866_10125952 | |||
| 1077 | Ga0068861_100007739 | |||
| 1078 | Ga0068861_100094875 | |||
| 1079 | Ga0068861_100097859 | |||
| 1080 | Ga0068861_100184110 | |||
| 1081 | Ga0068851_10008024 | |||
| 1082 | Ga0068870_10097759 | |||
| 1083 | Ga0068863_100172157 | |||
| 1084 | Ga0068858_100432309 | |||
| 1085 | Ga0068862_100278360 | |||
| 1086 | Ga0081455_10004421 | |||
| 1087 | Ga0081455_10018767 | |||
| 1088 | Ga0081538_10000053 | |||
| 1089 | Ga0081538_10000094 | |||
| 1090 | Ga0081538_10000100 | |||
| 1091 | Ga0081538_10024011 | |||
| 1092 | Ga0081538_10034170 | |||
| 1093 | Ga0081538_10082099 | |||
| 1094 | Ga0081540_1017275 | |||
| 1095 | Ga0070717_10005467 | |||
| 1096 | Ga0070717_10007849 | |||
| 1097 | Ga0070717_10034859 | |||
| 1098 | Ga0070717_10205975 | |||
| 1099 | Ga0070717_10363118 | |||
| 1100 | Ga0075365_10210969 | |||
| 1101 | Ga0075364_10254025 | |||
| 1102 | Ga0075432_10008519 | |||
| 1103 | Ga0070715_10011394 | |||
| 1104 | Ga0070715_10038124 | |||
| 1105 | Ga0070716_100001457 | |||
| 1106 | Ga0070716_100008190 | |||
| 1107 | Ga0070716_100143012 | |||
| 1108 | Ga0070712_100211865 | |||
| 1109 | Ga0075367_10225184 | |||
| 1110 | Ga0097621_100281031 | |||
| 1111 | Ga0075428_100002460 | |||
| 1112 | Ga0075428_100005053 | |||
| 1113 | Ga0075428_100012212 | |||
| 1114 | Ga0075428_100379218 | |||
| 1115 | Ga0075431_100002910 | |||
| 1116 | Ga0075431_100033329 | |||
| 1117 | Ga0075431_100070213 | |||
| 1118 | Ga0075431_100134492 | |||
| 1119 | Ga0075431_100363473 | |||
| 1120 | Ga0075433_10002265 | |||
| 1121 | Ga0075433_10024118 | |||
| 1122 | Ga0075433_10071464 | |||
| 1123 | Ga0075433_10086955 | |||
| 1124 | Ga0075433_10113133 | |||
| 1125 | Ga0075434_100001294 | |||
| 1126 | Ga0075434_100003374 | |||
| 1127 | Ga0075434_100009463 | |||
| 1128 | Ga0075434_100033764 | |||
| 1129 | Ga0075434_100145869 | |||
| 1130 | Ga0075429_100008378 | |||
| 1131 | Ga0068865_100018192 | |||
| 1132 | Ga0075436_100000915 | |||
| 1133 | Ga0075436_100006395 | |||
| 1134 | Ga0075436_100008390 | |||
| 1135 | Ga0075436_100020398 | |||
| 1136 | Ga0075436_100272928 | |||
| 1137 | Ga0097620_100488357 | |||
| 1138 | Ga0075435_100001243 | |||
| 1139 | Ga0075435_100028080 | |||
| 1140 | Ga0075435_100103033 | |||
| 1141 | Ga0075435_100120794 | |||
| 1142 | Ga0075435_100331419 | |||
| 1143 | Ga0105240_10040117 | |||
| 1144 | Ga0105240_10073540 | |||
| 1145 | Ga0105240_10119265 | |||
| 1146 | Ga0105240_10251425 | |||
| 1147 | Ga0111539_10003095 | |||
| 1148 | Ga0111539_10035714 | |||
| 1149 | Ga0105245_10006126 | |||
| 1150 | Ga0105245_10047671 | |||
| 1151 | Ga0105245_10186618 | |||
| 1152 | Ga0105245_10684038 | |||
| 1153 | Ga0114129_10000141 | |||
| 1154 | Ga0114129_10003813 | |||
| 1155 | Ga0114129_10142466 | |||
| 1156 | Ga0114129_10788334 | |||
| 1157 | Ga0105243_10100630 | |||
| 1158 | Ga0105243_10129849 | |||
| 1159 | Ga0105243_10136046 | |||
| 1160 | Ga0105243_10143766 | |||
| 1161 | Ga0105242_10024082 | |||
| 1162 | Ga0105242_10066229 | |||
| 1163 | Ga0105242_10121783 | |||
| 1164 | Ga0105242_10258774 | |||
| 1165 | Ga0105248_10212958 | |||
| 1166 | Ga0105248_10593259 | |||
| 1167 | Ga0105238_10053645 | |||
| 1168 | Ga0105249_10009086 | |||
| 1169 | Ga0105249_10026677 | |||
| 1170 | Ga0105239_10095749 | |||
| 1171 | Ga0105246_10338207 | |||
| 1172 | Ga0157371_10116002 | |||
| 1173 | Ga0157370_10033132 | |||
| 1174 | Ga0157370_10068805 | |||
| 1175 | Ga0157369_10089572 | |||
| 1176 | Ga0157374_10008652 | |||
| 1177 | Ga0157378_10396830 | |||
| 1178 | Ga0163162_10316400 | |||
| 1179 | Ga0157372_10100565 | |||
| 1180 | Ga0157372_10284795 | |||
| 1181 | Ga0157375_10578672 | |||
| 1182 | Ga0157375_10785346 | |||
| 1183 | Ga0163163_10128882 | |||
| 1184 | Ga0157380_10005200 | |||
| 1185 | Ga0157380_10060201 | |||
| 1186 | Ga0182008_10009436 | |||
| 1187 | Ga0157377_10018073 | |||
| 1188 | Ga0157379_10107811 | |||
| 1189 | Ga0157376_10159817 | |||
| 1190 | Ga0157376_10320910 | |||
| 1191 | Ga0182007_10012200 | |||
| 1192 | Ga0163161_10008822 | |||
| 1193 | Ga0163161_10229610 | |||
| 1194 | Ga0197907_10972893 | |||
| 1195 | Ga0206356_10739625 | |||
| 1196 | Ga0206354_10143858 | |||
| 1197 | Ga0206354_10579909 | |||
| 1198 | Ga0206353_10543908 | |||
| 1199 | Ga0206353_11152913 | |||
| 1200 | Ga0206353_11689011 | |||
| 1201 | Ga0213875_10139329 | |||
| 1202 | Ga0213871_10002981 | |||
| 1203 | Ga0207656_10004008 | |||
| 1204 | Ga0207653_10004251 | |||
| 1205 | Ga0207692_10012508 | |||
| 1206 | Ga0207692_10017163 | |||
| 1207 | Ga0207688_10005694 | |||
| 1208 | Ga0207685_10008146 | |||
| 1209 | Ga0207685_10057699 | |||
| 1210 | Ga0207699_10002004 | |||
| 1211 | Ga0207699_10039861 | |||
| 1212 | Ga0207699_10179391 | |||
| 1213 | Ga0207643_10206819 | |||
| 1214 | Ga0207705_10044675 | |||
| 1215 | Ga0207705_10144245 | |||
| 1216 | Ga0207705_10219367 | |||
| 1217 | Ga0207684_10118109 | |||
| 1218 | Ga0207707_10008396 | |||
| 1219 | Ga0207707_10040872 | |||
| 1220 | Ga0207695_10085325 | |||
| 1221 | Ga0207695_10230599 | |||
| 1222 | Ga0207693_10000282 | |||
| 1223 | Ga0207693_10007638 | |||
| 1224 | Ga0207693_10035896 | |||
| 1225 | Ga0207663_10044668 | |||
| 1226 | Ga0207663_10118368 | |||
| 1227 | Ga0207660_10178611 | |||
| 1228 | Ga0207660_10263106 | |||
| 1229 | Ga0207660_10268093 | |||
| 1230 | Ga0207657_10000988 | |||
| 1231 | Ga0207657_10033885 | |||
| 1232 | Ga0207657_10077510 | |||
| 1233 | Ga0207657_10080178 | |||
| 1234 | Ga0207657_10201020 | |||
| 1235 | Ga0207657_10350582 | |||
| 1236 | Ga0207652_10087226 | |||
| 1237 | Ga0207646_10001768 | |||
| 1238 | Ga0207646_10120866 | |||
| 1239 | Ga0207646_10148490 | |||
| 1240 | Ga0207646_10355995 | |||
| 1241 | Ga0207646_10491985 | |||
| 1242 | Ga0207681_10278020 | |||
| 1243 | Ga0207687_10015169 | |||
| 1244 | Ga0207700_10000039 | |||
| 1245 | Ga0207700_10015530 | |||
| 1246 | Ga0207700_10069117 | |||
| 1247 | Ga0207664_10012931 | |||
| 1248 | Ga0207664_10032025 | |||
| 1249 | Ga0207664_10047082 | |||
| 1250 | Ga0207664_10063827 | |||
| 1251 | Ga0207664_10100754 | |||
| 1252 | Ga0207664_10111667 | |||
| 1253 | Ga0207664_10132587 | |||
| 1254 | Ga0207644_10123627 | |||
| 1255 | Ga0207690_10012589 | |||
| 1256 | Ga0207690_10039559 | |||
| 1257 | Ga0207690_10177336 | |||
| 1258 | Ga0207706_10010201 | |||
| 1259 | Ga0207706_10041071 | |||
| 1260 | Ga0207686_10010201 | |||
| 1261 | Ga0207686_10230059 | |||
| 1262 | Ga0207709_10094126 | |||
| 1263 | Ga0207709_10242955 | |||
| 1264 | Ga0207669_10231393 | |||
| 1265 | Ga0207704_10218237 | |||
| 1266 | Ga0207704_10313786 | |||
| 1267 | Ga0207665_10004972 | |||
| 1268 | Ga0207665_10027771 | |||
| 1269 | Ga0207711_10143958 | |||
| 1270 | Ga0207689_10082630 | |||
| 1271 | Ga0207661_10062637 | |||
| 1272 | Ga0207661_10090489 | |||
| 1273 | Ga0207661_10116265 | |||
| 1274 | Ga0207661_10318684 | |||
| 1275 | Ga0207679_10069445 | |||
| 1276 | Ga0207679_10220337 | |||
| 1277 | Ga0207667_10101806 | |||
| 1278 | Ga0207667_10138760 | |||
| 1279 | Ga0207667_10159659 | |||
| 1280 | Ga0207651_10528870 | |||
| 1281 | Ga0207668_10062865 | |||
| 1282 | Ga0207658_10002326 | |||
| 1283 | Ga0207677_10183427 | |||
| 1284 | Ga0207678_10296639 | |||
| 1285 | Ga0207708_10000684 | |||
| 1286 | Ga0207708_10040507 | |||
| 1287 | Ga0207702_10100980 | |||
| 1288 | Ga0207702_10381501 | |||
| 1289 | Ga0207702_10602393 | |||
| 1290 | Ga0207641_10153622 | |||
| 1291 | Ga0207641_10532558 | |||
| 1292 | Ga0207648_10011247 | |||
| 1293 | Ga0207648_10352013 | |||
| 1294 | Ga0207648_10443595 | |||
| 1295 | Ga0207676_10240663 | |||
| 1296 | Ga0207675_100000929 | |||
| 1297 | Ga0207675_100336280 | |||
| 1298 | Ga0207683_10034207 | |||
| 1299 | Ga0207683_10037498 | |||
| 1300 | Ga0207683_10063512 | |||
| 1301 | Ga0207683_10219356 | |||
| 1302 | Ga0207698_10767550 | |||
| 1303 | Ga0207428_10000108 | |||
| 1304 | Ga0207428_10099829 | |||
| 1305 | Ga0207428_10321501 | |||
| 1306 | Ga0265319_1000635 | |||
| 1307 | Ga0265334_10002590 | |||
| 1308 | Ga0265318_10003761 | |||
| 1309 | Ga0265322_10001612 | |||
| 1310 | Ga0265322_10032636 | |||
| 1311 | Ga0265338_10005641 | |||
| 1312 | Ga0265338_10007196 | |||
| 1313 | Ga0265338_10075508 | |||
| 1314 | Ga0265338_10144941 | |||
| 1315 | Ga0265324_10022996 | |||
| 1316 | Ga0265324_10033318 | |||
| 1317 | Ga0265330_10000327 | |||
| 1318 | Ga0265330_10046743 | |||
| 1319 | Ga0265332_10003969 | |||
| 1320 | Ga0265332_10116072 | |||
| 1321 | Ga0265320_10092767 | |||
| 1322 | Ga0265329_10025187 | |||
| 1323 | Ga0265340_10002177 | |||
| 1324 | Ga0265331_10004733 | |||
| 1325 | Ga0265327_10017812 | |||
| 1326 | Ga0265316_10020939 | |||
| 1327 | Ga0265316_10159049 | |||
| 1328 | Ga0307408_100118146 | |||
| 1329 | Ga0265313_10005397 | |||
| 1330 | Ga0265314_10002591 | |||
| 1331 | Ga0265342_10011070 | |||
| 1332 | Ga0265342_10130077 | |||
| 1333 | Ga0307406_10009746 | |||
| 1334 | Ga0307409_100187828 | |||
| 1335 | Ga0307416_100019684 | |||
| 1336 | Ga0307416_100212948 | |||
| 1337 | Ga0307411_10410369 | |||
| 1338 | Ga0307415_100021919 | |||
| 1339 | Ga0307415_100050027 | |||
| 1340 | Ga0316583_10021232 | |||
| 1341 | Ga0373948_0012084 | |||
| 1342 | Ga0373928_0015661 | |||
| 1343 | Ga0373940_0004842 | |||
| 1344 | Ga0373940_0019686 | |||
| 1345 | Ga0373949_0005830 | |||
| 1346 | Ga0373952_0002137 | |||
| 1347 | Ga0373932_0075588 | |||
| 1348 | Ga0373960_0029407 | |||
| 1349 | Ga0373943_0000198 | |||
| 1350 | Ga0373943_0072902 | |||
| 1351 | Ga0373961_0008795 | |||
| 1352 | Ga0373962_0005248 | |||
| 1353 | Ga0373931_0097985 | |||
| 1354 | Ga0373935_0109936 | |||
| 1355 | Ga0373935_0494438 | |||
| 1356 | Ga0373933_0172015 | |||
| 1357 | Ga0373933_0186160 | |||
| 1358 | Ga0373947_0000463 | |||
| 1359 | Ga0373937_0109487 | |||
| 1360 | Ga0373925_0024512 | |||
| 1361 | Ga0395899_0000862 | |||
| 1362 | Ga0395899_0002568 | |||
| 1363 | Ga0395899_0005918 | |||
| 1364 | Ga0395899_0008133 | |||
| 1365 | Ga0395899_0009554 | |||
| 1366 | Ga0395899_0037927 | |||
| 1367 | Ga0395899_0082410 | |||
| 1368 | Ga0395899_0085266 | |||
| 1369 | Ga0395899_0182321 | |||
| 1370 | Ga0395900_0001219 | |||
| 1371 | Ga0395900_0001266 | |||
| 1372 | Ga0395900_0001485 | |||
| 1373 | Ga0395900_0004452 | |||
| 1374 | Ga0395900_0005059 | |||
| 1375 | Ga0395900_0009112 | |||
| 1376 | Ga0395900_0019826 | |||
| 1377 | Ga0395900_0024066 | |||
| 1378 | Ga0395900_0046723 | |||
| 1379 | Ga0395900_0068678 | |||
| 1380 | Ga0395900_0068882 | |||
| 1381 | Ga0395900_0166180 | |||
| 1382 | Ga0395900_0171588 | |||
| 1383 | Ga0395900_0188797 | |||
| 1384 | Ga0395900_0351242 | |||
| 1385 | Ga0395900_0497844 | |||
| 1386 | Ga0395898_0012615 | |||
| 1387 | Ga0395898_0015047 | |||
| 1388 | Ga0395898_0016535 | |||
| 1389 | Ga0395898_0020108 | |||
| 1390 | Ga0395898_0022431 | |||
| 1391 | Ga0395898_0027937 | |||
| 1392 | Ga0395898_0036950 | |||
| 1393 | Ga0395898_0040672 | |||
| 1394 | Ga0395898_0041721 | |||
| 1395 | Ga0395898_0054574 | |||
| 1396 | Ga0395898_0068165 | |||
| 1397 | Ga0395898_0071572 | |||
| 1398 | Ga0395898_0085312 | |||
| 1399 | Ga0395898_0180539 | |||
| 1400 | Ga0395898_0220145 | |||
| 1401 | Ga0395898_0270203 | |||
| 1402 | Ga0395898_0489806 | |||
| 1403 | Ga0395905_0000640 | |||
| 1404 | Ga0395905_0001564 | |||
| 1405 | Ga0395905_0007797 | |||
| 1406 | Ga0395905_0008242 | |||
| 1407 | Ga0395905_0020747 | |||
| 1408 | Ga0395905_0063663 | |||
| 1409 | Ga0395905_0066894 | |||
| 1410 | Ga0395905_0093548 | |||
| 1411 | Ga0395905_0093695 | |||
| 1412 | Ga0395905_0160799 | |||
| 1413 | Ga0395905_0299866 | |||
| 1414 | Ga0395905_0500768 | |||
| 1415 | Ga0436364_0533197 | |||
| 1416 | Ga0395901_0000978 | |||
| 1417 | Ga0395901_0001883 | |||
| 1418 | Ga0395901_0002270 | |||
| 1419 | Ga0395901_0002692 | |||
| 1420 | Ga0395901_0011802 | |||
| 1421 | Ga0395901_0015905 | |||
| 1422 | Ga0395901_0016559 | |||
| 1423 | Ga0395901_0032992 | |||
| 1424 | Ga0395901_0035193 | |||
| 1425 | Ga0395901_0057609 | |||
| 1426 | Ga0395901_0114956 | |||
| 1427 | Ga0395901_0138285 | |||
| 1428 | Ga0395901_0143583 | |||
| 1429 | Ga0395901_0257143 | |||
| 1430 | Ga0395901_0341483 | |||
| 1431 | Ga0395901_0449267 | |||
| 1432 | Ga0436360_1292831 | |||
| 1433 | Ga0436363_1287539 | |||
| 1434 | Ga0439439_0044680 | |||
| 1435 | Ga0439461_0012809 | |||
| 1436 | Ga0451793_0979246 | |||
| 1437 | Ga0451853_3576152 | |||
| 1438 | Ga0451853_3629479 | |||
| 1439 | Ga0439448_0012082 | |||
| 1440 | Ga0439455_0016834 | |||
| 1441 | Ga0439456_031407 | |||
| 1442 | Ga0439446_0005591 | |||
| 1443 | Ga0466969_0003306 | |||
| 1444 | Ga0466969_0013131 | |||
| 1445 | Ga0466969_0085238 | |||
| 1446 | Ga0466972_0029041 | |||
| 1447 | Ga0466972_0070793 | |||
| 1448 | Ga0466965_0013693 | |||
| 1449 | Ga0466965_0049114 | |||
| 1450 | Ga0466965_0230224 | |||
| 1451 | Ga0466966_0004938 | |||
| 1452 | Ga0466966_0008431 | |||
| 1453 | Ga0466966_0063700 | |||
| 1454 | Ga0466966_0202162 | |||
| 1455 | Ga0466961_0011545 | |||
| 1456 | Ga0466961_0026593 | |||
| 1457 | Ga0466961_0033324 | |||
| 1458 | Ga0466961_0049106 | |||
| 1459 | Ga0466961_0148650 | |||
| 1460 | Ga0466963_0000095 | |||
| 1461 | Ga0466963_0004541 | |||
| 1462 | Ga0466963_0004612 | |||
| 1463 | Ga0466963_0005966 | |||
| 1464 | Ga0466963_0015015 | |||
| 1465 | Ga0466963_0017054 | |||
| 1466 | Ga0466963_0017204 | |||
| 1467 | Ga0466963_0019732 | |||
| 1468 | Ga0466963_0021258 | |||
| 1469 | Ga0466963_0029166 | |||
| 1470 | Ga0466963_0030131 | |||
| 1471 | Ga0466963_0052948 | |||
| 1472 | Ga0466963_0116124 | |||
| 1473 | Ga0466963_0202221 | |||
| 1474 | Ga0466963_0246167 | |||
| 1475 | Ga0466963_0255268 | |||
| 1476 | Ga0466963_0346179 | |||
| 1477 | Ga0466964_0000465 | |||
| 1478 | Ga0466964_0007441 | |||
| 1479 | Ga0466964_0008767 | |||
| 1480 | Ga0466964_0024459 | |||
| 1481 | Ga0466964_0167302 | |||
| 1482 | Ga0466971_0001664 | |||
| 1483 | Ga0466971_0016536 | |||
| 1484 | Ga0466971_0053198 | |||
| 1485 | Ga0466971_0066685 | |||
| 1486 | Ga0466971_0091631 | |||
| 1487 | Ga0466968_0002238 | |||
| 1488 | Ga0466968_0006803 | |||
| 1489 | Ga0466968_0025288 | |||
| 1490 | Ga0466968_0031074 | |||
| 1491 | Ga0466968_0039968 | |||
| 1492 | Ga0466968_0080358 | |||
| 1493 | Ga0466968_0083542 | |||
| 1494 | Ga0466970_0004679 | |||
| 1495 | Ga0466970_0177079 | |||
| 1496 | Ga0466957_0001672 | |||
| 1497 | Ga0466957_0004210 | |||
| 1498 | Ga0466957_0015443 | |||
| 1499 | Ga0466957_0020943 | |||
| 1500 | Ga0466957_0025135 | |||
| 1501 | Ga0466957_0066648 | |||
| 1502 | Ga0466957_0070018 | |||
| 1503 | Ga0466957_0072128 | |||
| 1504 | Ga0466957_0073883 | |||
| 1505 | Ga0466957_0151095 | |||
| 1506 | Ga0466960_0001521 | |||
| 1507 | Ga0466960_0124262 | |||
| 1508 | Ga0466959_0002457 | |||
| 1509 | Ga0466959_0005583 | |||
| 1510 | Ga0466959_0011442 | |||
| 1511 | Ga0466959_0026369 | |||
| 1512 | Ga0466959_0109105 | |||
| 1513 | Ga0466959_0254129 | |||
| 1514 | Ga0466959_0417316 | |||
| 1515 | Ga0451576_0408613 | |||
| 1516 | Ga0466958_0001908 | |||
| 1517 | Ga0466958_0002667 | |||
| 1518 | Ga0466958_0009659 | |||
| 1519 | Ga0466958_0011393 | |||
| 1520 | Ga0466958_0029313 | |||
| 1521 | Ga0466958_0089370 | |||
| 1522 | Ga0466958_0090580 | |||
| 1523 | Ga0466958_0117544 | |||
| 1524 | Ga0466958_0229725 | |||
| 1525 | Ga0466958_0258213 | |||
| 1526 | Ga0466958_0263946 | |||
| 1527 | Ga0466967_0000676 | |||
| 1528 | Ga0466967_0003281 | |||
| 1529 | Ga0466967_0004469 | |||
| 1530 | Ga0466967_0010011 | |||
| 1531 | Ga0466967_0011240 | |||
| 1532 | Ga0466967_0012377 | |||
| 1533 | Ga0466967_0019227 | |||
| 1534 | Ga0466967_0030709 | |||
| 1535 | Ga0466967_0040726 | |||
| 1536 | Ga0466967_0051313 | |||
| 1537 | Ga0466967_0058374 | |||
| 1538 | Ga0466967_0065864 | |||
| 1539 | Ga0466967_0068035 | |||
| 1540 | Ga0466967_0097862 | |||
| 1541 | Ga0466967_0112673 | |||
| 1542 | Ga0466967_0169802 | |||
| 1543 | Ga0466967_0177756 | |||
| 1544 | Ga0466967_0195313 | |||
| 1545 | Ga0466967_0204631 | |||
| 1546 | Ga0466967_0547148 | |||
| 1547 | Ga0466967_0607901 | |||
| 1548 | Ga0495627_076578 | |||
| 1549 | Ga0495592_0042691 | |||
| 1550 | Ga0495592_0090270 | |||
| 1551 | Ga0495592_0175584 | |||
| 1552 | Ga0495603_0000081 | |||
| 1553 | Ga0495603_0165798 | |||
| 1554 | Ga0495629_0079661 | |||
| 1555 | Ga0495629_0141270 | |||
| 1556 | Ga0495629_0353297 | |||
| 1557 | Ga0495641_0002133 | |||
| 1558 | Ga0495641_0010605 | |||
| 1559 | Ga0495651_0209544 | |||
| 1560 | Ga0495651_0235532 | |||
| 1561 | Ga0495653_0051290 | |||
| 1562 | Ga0495653_0139181 | |||
| 1563 | Ga0495582_0027562 | |||
| 1564 | Ga0495582_0252168 | |||
| 1565 | Ga0495662_0052778 | |||
| 1566 | Ga0495662_0141439 | |||
| 1567 | Ga0495584_0014513 | |||
| 1568 | Ga0495584_0092599 | |||
| 1569 | Ga0495584_0224471 | |||
| 1570 | Ga0495585_0077077 | |||
| 1571 | Ga0495594_0000536 | |||
| 1572 | Ga0495596_0061758 | |||
| 1573 | Ga0495596_0061914 | |||
| 1574 | Ga0495607_0070757 | |||
| 1575 | Ga0495608_0006235 | |||
| 1576 | Ga0495608_0106447 | |||
| 1577 | Ga0495608_0426257 | |||
| 1578 | Ga0495630_0017298 | |||
| 1579 | Ga0495630_0130037 | |||
| 1580 | Ga0495631_0114062 | |||
| 1581 | Ga0495637_0128200 | |||
| 1582 | Ga0495644_0008464 | |||
| 1583 | Ga0495663_0015710 | |||
| 1584 | Ga0495666_0019555 | |||
| 1585 | Ga0495666_0134563 | |||
| 1586 | Ga0495652_0120759 | |||
| 1587 | Ga0495586_0120846 | |||
| 1588 | Ga0495587_0011260 | |||
| 1589 | Ga0495609_0034225 | |||
| 1590 | Ga0495667_0025384 | |||
| 1591 | Ga0495667_0058443 | |||
| 1592 | Ga0495667_0059886 | |||
| 1593 | Ga0495667_0143913 | |||
| 1594 | Ga0495656_0069126 | |||
| 1595 | Ga0495656_0120245 | |||
| 1596 | Ga0495656_0206021 | |||
| 1597 | Ga0495634_0064947 | |||
| 1598 | Ga0495634_0202561 | |||
| 1599 | Ga0495635_0131522 | |||
| 1600 | Ga0495659_0065526 | |||
| 1601 | Ga0495659_0137573 | |||
| 1602 | Ga0495588_0002678 | |||
| 1603 | Ga0495588_0128966 | |||
| 1604 | Ga0495657_0073386 | |||
| 1605 | Ga0495657_0083062 | |||
| 1606 | Ga0495599_0050417 | |||
| 1607 | Ga0495599_0071124 | |||
| 1608 | Ga0495646_0034028 | |||
| 1609 | Ga0495646_0073986 | |||
| 1610 | Ga0495646_0125367 | |||
| 1611 | Ga0495647_0023856 | |||
| 1612 | Ga0495613_0025650 | |||
| 1613 | Ga0495613_0047146 | |||
| 1614 | Ga0495624_0210753 | |||
| 1615 | Ga0495670_0065767 | |||
| 1616 | Ga0495600_0014203 | |||
| 1617 | Ga0495581_0034383 | |||
| 1618 | Ga0495581_0071126 | |||
| 1619 | Ga0495604_0058379 | |||
| 1620 | Ga0495604_0219087 | |||
| 1621 | Ga0495674_0039772 | |||
| 1622 | Ga0495674_0082453 | |||
| 1623 | Ga0495676_0002817 | |||
| 1624 | Ga0495676_0204108 | |||
| 1625 | Ga0495680_0071197 | |||
| 1626 | Ga0495680_0120624 | |||
| 1627 | Ga0495680_0124632 | |||
| 1628 | Ga0495680_0143697 | |||
| 1629 | Ga0495675_0093888 | |||
| 1630 | Ga0495684_0029449 | |||
| 1631 | Ga0495684_0035091 | |||
| 1632 | Ga0495684_0350490 | |||
| 1633 | Ga0495602_0244232 | |||
| 1634 | Ga0496100_0012806 | |||
| 1635 | Ga0496100_0013565 | |||
| 1636 | Ga0496100_0128670 | |||
| 1637 | Ga0496101_0014642 | |||
| 1638 | Ga0496101_0048493 | |||
| 1639 | Ga0496101_0163765 | |||
| 1640 | Ga0496101_0212930 | |||
| 1641 | Ga0496101_0213762 | |||
| 1642 | Ga0496101_0340692 | |||
| 1643 | Ga0496101_0348559 | |||
| 1644 | Ga0496102_0016639 | |||
| 1645 | Ga0496102_0017600 | |||
| 1646 | Ga0496102_0048059 | |||
| 1647 | Ga0496102_0095778 | |||
| 1648 | Ga0496102_0422367 | |||
| 1649 | Ga0496103_0010103 | |||
| 1650 | Ga0496103_0015355 | |||
| 1651 | Ga0496103_0015863 | |||
| 1652 | Ga0496104_0000865 | |||
| 1653 | Ga0496104_0010631 | |||
| 1654 | Ga0496104_0016341 | |||
| 1655 | Ga0496104_0068058 | |||
| 1656 | Ga0496104_0235398 | |||
| 1657 | Ga0496104_0789962 | |||
| 1658 | Ga0496105_0000775 | |||
| 1659 | Ga0496105_0004904 | |||
| 1660 | Ga0496105_0045676 | |||
| 1661 | Ga0496105_0063287 | |||
| 1662 | Ga0496105_0092357 | |||
| 1663 | Ga0496105_0191008 | |||
| 1664 | Ga0496105_0216472 | |||
| 1665 | Ga0496105_0296402 | |||
| 1666 | Ga0496106_0014470 | |||
| 1667 | Ga0496106_0058137 | |||
| 1668 | Ga0496106_0083654 | |||
| 1669 | Ga0496106_0141628 | |||
| 1670 | Ga0496106_0204146 | |||
| 1671 | Ga0496106_0362770 | |||
| 1672 | Ga0496107_0000242 | |||
| 1673 | Ga0496107_0006234 | |||
| 1674 | Ga0496107_0021016 | |||
| 1675 | Ga0496107_0041282 | |||
| 1676 | Ga0496107_0056304 | |||
| 1677 | Ga0496107_0307858 | |||
| 1678 | Ga0496107_0367837 | |||
| 1679 | Ga0496107_0369887 | |||
| 1680 | Ga0496108_0003137 | |||
| 1681 | Ga0496108_0005018 | |||
| 1682 | Ga0496108_0010715 | |||
| 1683 | Ga0496108_0022146 | |||
| 1684 | Ga0496108_0023428 | |||
| 1685 | Ga0496108_0033698 | |||
| 1686 | Ga0496108_0043433 | |||
| 1687 | Ga0496108_0196792 | |||
| 1688 | Ga0496109_0001239 | |||
| 1689 | Ga0496109_0008195 | |||
| 1690 | Ga0496109_0018833 | |||
| 1691 | Ga0496109_0041159 | |||
| 1692 | Ga0496109_0041213 | |||
| 1693 | Ga0496109_0062927 | |||
| 1694 | Ga0496109_0081032 | |||
| 1695 | Ga0496109_0233179 | |||
| 1696 | Ga0496109_0247179 | |||
| 1697 | Ga0496109_0304410 | |||
| 1698 | Ga0496109_0601108 | |||
| 1699 | Ga0496109_0618613 | |||
| 1700 | Ga0496110_0011919 | |||
| 1701 | Ga0496110_0029730 | |||
| 1702 | Ga0496110_0046702 | |||
| 1703 | Ga0496110_0048083 | |||
| 1704 | Ga0496110_0065457 | |||
| 1705 | Ga0496110_0149564 | |||
| 1706 | Ga0496111_0003372 | |||
| 1707 | Ga0496111_0024846 | |||
| 1708 | Ga0496111_0116049 | |||
| 1709 | Ga0496111_0116295 | |||
| 1710 | Ga0496111_0329855 | |||
| 1711 | Ga0496112_0003845 | |||
| 1712 | Ga0496112_0019694 | |||
| 1713 | Ga0496112_0093391 | |||
| 1714 | Ga0496112_0099657 | |||
| 1715 | Ga0496112_0116912 | |||
| 1716 | Ga0496112_0314375 | |||
| 1717 | Ga0496112_0578012 | |||
| 1718 | Ga0496113_0001165 | |||
| 1719 | Ga0496113_0001530 | |||
| 1720 | Ga0496113_0026871 | |||
| 1721 | Ga0496113_0069827 | |||
| 1722 | Ga0496113_0085219 | |||
| 1723 | Ga0496113_0299372 | |||
| 1724 | Ga0496114_0003362 | |||
| 1725 | Ga0496114_0015427 | |||
| 1726 | Ga0496114_0024732 | |||
| 1727 | Ga0496114_0026950 | |||
| 1728 | Ga0496114_0044143 | |||
| 1729 | Ga0496114_0178809 | |||
| 1730 | Ga0496114_0256222 | |||
| 1731 | Ga0496114_0279677 | |||
| 1732 | Ga0496115_0005818 | |||
| 1733 | Ga0496115_0034066 | |||
| 1734 | Ga0496115_0054854 | |||
| 1735 | Ga0496115_0226685 | |||
| 1736 | Ga0496115_0530921 | |||
| 1737 | Ga0501031_0003333 | |||
| 1738 | Ga0501031_0021919 | |||
| 1739 | Ga0501032_0001554 | |||
| 1740 | Ga0501033_0000899 | |||
| 1741 | Ga0501033_0112125 | |||
| 1742 | Ga0501033_0160533 | |||
| 1743 | Ga0501034_0072921 | |||
| 1744 | Ga0501036_0005487 | |||
| 1745 | Ga0501036_0044330 | |||
| 1746 | Ga0501036_0053302 | |||
| 1747 | Ga0501037_0007386 | |||
| 1748 | Ga0501037_0122124 | |||
| 1749 | Ga0501038_0003802 | |||
| 1750 | Ga0501038_0040949 | |||
| 1751 | Ga0501039_0003976 | |||
| 1752 | Ga0501039_0009033 | |||
| 1753 | Ga0501040_0001387 | |||
| 1754 | Ga0501040_0002266 | |||
| 1755 | Ga0501040_0005466 | |||
| 1756 | Ga0501040_0141222 | |||
| 1757 | Ga0501041_0000474 | |||
| 1758 | Ga0501041_0000895 | |||
| 1759 | Ga0501042_0000930 | |||
| 1760 | Ga0501042_0068233 | |||
| 1761 | Ga0501043_0000693 | |||
| 1762 | Ga0501043_0086178 | |||
| 1763 | Ga0501043_0240756 | |||
| 1764 | Ga0501046_0001855 | |||
| 1765 | Ga0501046_0040284 | |||
| 1766 | Ga0501046_0328908 | |||
| 1767 | Ga0501047_0037685 | |||
| 1768 | Ga0501047_0061174 | |||
| 1769 | Ga0501047_0150034 | |||
| 1770 | Ga0501047_0231175 | |||
| 1771 | Ga0501048_0000867 | |||
| 1772 | Ga0501048_0008074 | |||
| 1773 | Ga0501048_0031868 | |||
| 1774 | Ga0501067_0020755 | |||
| 1775 | Ga0501067_0023040 | |||
| 1776 | Ga0501067_0031144 | |||
| 1777 | Ga0501067_0046875 | |||
| 1778 | Ga0501067_0121005 | |||
| 1779 | Ga0501067_0137929 | |||
| 1780 | Ga0501067_0139502 | |||
| 1781 | Ga0501067_0202908 | |||
| 1782 | Ga0501068_0001514 | |||
| 1783 | Ga0501068_0003100 | |||
| 1784 | Ga0501068_0015027 | |||
| 1785 | Ga0501068_0145475 | |||
| 1786 | Ga0501069_0000605 | |||
| 1787 | Ga0501069_0012648 | |||
| 1788 | Ga0501069_0030644 | |||
| 1789 | Ga0501069_0069892 | |||
| 1790 | Ga0501070_0001149 | |||
| 1791 | Ga0501070_0024878 | |||
| 1792 | Ga0501070_0042253 | |||
| 1793 | Ga0501070_0075545 | |||
| 1794 | Ga0501070_0333152 | |||
| 1795 | Ga0501070_0333798 | |||
| 1796 | Ga0501071_0000330 | |||
| 1797 | Ga0501071_0000677 | |||
| 1798 | Ga0501071_0030359 | |||
| 1799 | Ga0501072_0001627 | |||
| 1800 | Ga0501072_0003411 | |||
| 1801 | Ga0501072_0006557 | |||
| 1802 | Ga0501072_0007942 | |||
| 1803 | Ga0501072_0016896 | |||
| 1804 | Ga0501072_0023091 | |||
| 1805 | Ga0501072_0131910 | |||
| 1806 | Ga0501073_0003204 | |||
| 1807 | Ga0501073_0029285 | |||
| 1808 | Ga0501073_0031588 | |||
| 1809 | Ga0501073_0063173 | |||
| 1810 | Ga0501073_0269778 | |||
| 1811 | Ga0501074_0022586 | |||
| 1812 | Ga0501074_0030757 | |||
| 1813 | Ga0501074_0045687 | |||
| 1814 | Ga0501074_0153769 | |||
| 1815 | Ga0501075_0001209 | |||
| 1816 | Ga0501075_0017103 | |||
| 1817 | Ga0501075_0044640 | |||
| 1818 | Ga0501075_0108908 | |||
| 1819 | Ga0501075_0267954 | |||
| 1820 | Ga0501075_0332283 | |||
| 1821 | Ga0501076_0004029 | |||
| 1822 | Ga0501076_0006243 | |||
| 1823 | Ga0501076_0011459 | |||
| 1824 | Ga0501076_0035541 | |||
| 1825 | Ga0501076_0185501 | |||
| 1826 | Ga0501076_0219026 | |||
| 1827 | Ga0501077_0000576 | |||
| 1828 | Ga0501077_0008185 | |||
| 1829 | Ga0501077_0098818 | |||
| 1830 | Ga0501077_0103972 | |||
| 1831 | Ga0501079_0001513 | |||
| 1832 | Ga0501079_0009336 | |||
| 1833 | Ga0501079_0206946 | |||
| 1834 | Ga0501080_0001056 | |||
| 1835 | Ga0501080_0013393 | |||
| 1836 | Ga0501080_0043951 | |||
| 1837 | Ga0501080_0059685 | |||
| 1838 | Ga0501080_0074751 | |||
| 1839 | Ga0501080_0194526 | |||
| 1840 | Ga0501081_0000753 | |||
| 1841 | Ga0501081_0002176 | |||
| 1842 | Ga0501081_0005108 | |||
| 1843 | Ga0501083_0002444 | |||
| 1844 | Ga0501035_0001594 | |||
| 1845 | Ga0501035_0014199 | |||
| 1846 | Ga0501035_0108614 | |||
| 1847 | Ga0501044_0457884 | |||
| 1848 | Ga0501045_0001276 | |||
| 1849 | Ga0501045_0005255 | |||
| 1850 | Ga0501045_0038043 | |||
| 1851 | Ga0501045_0054993 | |||
| 1852 | Ga0501045_0095770 | |||
| 1853 | nmdc:mga03683_171769_c1 | |||
| 1854 | nmdc:mga00v17_368682_c1 | |||
| 1855 | nmdc:mga0yw44_181621_c1 | |||
| 1856 | nmdc:mga0yw44_51448_c1 | |||
| 1857 | nmdc:mga06z11_195294_c1 | |||
| 1858 | nmdc:mga05p37_1712_c1 | |||
| 1859 | nmdc:mga05p37_19624_c1 | |||
| 1860 | nmdc:mga05p37_301655_c1 | |||
| 1861 | nmdc:mga05p37_52672_c1 | |||
| 1862 | nmdc:mga05p37_606736_c1 | |||
| 1863 | nmdc:mga05p37_813115_c1 | |||
| 1864 | nmdc:mga05p37_8903_c1 | |||
| 1865 | nmdc:mga09592_118389_c1 | |||
| 1866 | nmdc:mga09592_5828_c1 | |||
| 1867 | nmdc:mga0qj67_291079_c1 | |||
| 1868 | nmdc:mga06r32_28868_c1 | |||
| 1869 | nmdc:mga06r32_49576_c1 | |||
| 1870 | nmdc:mga06r32_560576_c1 | |||
| 1871 | nmdc:mga06r32_66422_c1 | |||
| 1872 | nmdc:mga08y16_19493_c1 | |||
| 1873 | nmdc:mga08y16_580143_c1 | |||
| 1874 | nmdc:mga08y16_60613_c1 | |||
| 1875 | nmdc:mga08y16_786024_c1 | |||
| 1876 | nmdc:mga0n895_12180_c1 | |||
| 1877 | nmdc:mga0n895_230390_c1 | |||
| 1878 | nmdc:mga0n895_234673_c1 | |||
| 1879 | nmdc:mga0n895_71764_c1 | |||
| 1880 | nmdc:mga0n895_88875_c1 | |||
| 1881 | nmdc:mga0rr50_157685_c1 | |||
| 1882 | nmdc:mga0rr50_201488_c1 | |||
| 1883 | nmdc:mga0rr50_33890_c1 | |||
| 1884 | nmdc:mga0rr50_372_c1 | |||
| 1885 | nmdc:mga0rr50_95152_c1 | |||
| 1886 | nmdc:mga08x19_177286_c1 | |||
| 1887 | nmdc:mga08x19_34795_c1 | |||
| 1888 | nmdc:mga08x19_45511_c1 | |||
| 1889 | nmdc:mga08x19_4620_c1 | |||
| 1890 | nmdc:mga08x19_5986_c1 | |||
| 1891 | nmdc:mga0a205_109138_c1 | |||
| 1892 | nmdc:mga0a205_15513_c1 | |||
| 1893 | nmdc:mga0a205_202628_c1 | |||
| 1894 | nmdc:mga0a205_28071_c1 | |||
| 1895 | nmdc:mga0a205_41740_c1 | |||
| 1896 | nmdc:mga0a205_503541_c1 | |||
| 1897 | Ga0495601_0006980 | |||
| 1898 | Ga0495612_0014817 | |||
| 1899 | Ga0495655_0107850 | |||
| 1900 | Ga0495595_0010344 | |||
| 1901 | Ga0495595_0021019 | |||
| 1902 | Ga0495595_0030604 | |||
| 1903 | Ga0495619_0035292 | |||
| 1904 | Ga0495619_0052545 | |||
| 1905 | Ga0495619_0274774 | |||
| 1906 | Ga0501084_0000985 | |||
| 1907 | Ga0501084_0002974 | |||
| 1908 | Ga0501084_0038205 | |||
| 1909 | Ga0501084_0040964 | |||
| 1910 | Ga0501084_0076185 | |||
| 1911 | Ga0501082_0012784 | |||
| 1912 | Ga0501082_0016180 | |||
| 1913 | Ga0501082_0090400 | |||
| 1914 | Ga0501082_0121059 | |||
| 1915 | Ga0466962_0000096 | |||
| 1916 | Ga0466962_0003609 | |||
| 1917 | Ga0466962_0016261 | |||
| 1918 | Ga0530510_0002722 | |||
| 1919 | Ga0530510_0006950 | |||
| 1920 | Ga0530510_0011066 | |||
| 1921 | Ga0530510_0047359 | |||
| 1922 | Ga0530510_0172463 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5m6r-assembly1.cif.gz_A | human porphobilinogen deaminase in complex with reaction intermediate | 0.8229 | 1 | 241 |
| 8pnd-assembly1.cif.gz_A | the es3 intermediate of hydroxymethylbilane synthase r167q variant | 0.7882 | 2 | 241 |
| 5m7f-assembly2.cif.gz_B | human porphobilinogen deaminase in complex with dpm cofactor | 0.7819 | 1 | 241 |
| 7ccx-assembly2.cif.gz_C | crystal structure of the holo form of human hydroxymethylbilane synthase | 0.7784 | 1 | 241 |
| 5m7f-assembly1.cif.gz_A | human porphobilinogen deaminase in complex with dpm cofactor | 0.7779 | 1 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4htgA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9077 | 94 | 183 | 3.40.190.10 |
| 1ah5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9021 | 94 | 187 | 3.40.190.10 |
| 5ov6A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8576 | 1 | 91 | 3.40.190.10 |
| 1ah5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8434 | 94 | 187 | 3.40.190.10 |
| 1ah5A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8092 | 2 | 91 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MB32-F1-model_v4 | hydroxymethylbilane synthase (EC 2.5.1.61) | 0.8796 | 82 | 256 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-A0A377TL07-F1-model_v4 | Hydroxymethylbilane synthase (EC 2.5.1.61) | 0.8658 | 91 | 203 |
GO:0004418
GO:0005737 GO:0006782 |
| AF-A0A447SA06-F1-model_v4 | deleted | 0.8608 | 57 | 186 |
|
| AF-A0A498ESC5-F1-model_v4 | deleted | 0.8594 | 57 | 197 |
|
| AF-A0A353PDS2-F1-model_v4 | Hydroxymethylbilane synthase (EC 2.5.1.61) | 0.8592 | 75 | 203 |
GO:0004418
GO:0005737 GO:0006782 |