F486870

General Info

Members Datasets Scaffolds Average Seq Length
961 349 1922 274

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0123418|Ga0395898_0123418_266_1282
Length 317
Sequence VLIRVGSRGSRLALTQAELAAARLRAPGMEIALMPITTAGDRDRTKPFGQIGSRGVFVKELEEALLEGRIDVAVHSAKDMTSSDPAGLAVGAYVERDDPRDALCGAEAIRPGMRIGTASARRKAQLLALEPTLSIEPLRGNIDTRLRKRGERGLDAVVLAACGLDRLGLAHEIGLRLDPETMLPEAAQGALALQVRAGEESLVADVDHAETRRRVEAERTVVAAVEGGCLAPVAAHHDGTTLTGLIAAEDGSWIDLGPRAGAVLERVAGDRKPFPPGRIGAAFEPSDPTGWLIVAGLSIALALGVAYARHRPGGATG

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 10.82
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 7.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0123418 3300037466 Bacteria 2482
2 JGI25407J50210_10001067 3300003373 Bacteria 6025
3 Ga0070658_10037764 3300005327 Bacteria 3893
4 Ga0070683_100037562 3300005329 Bacteria 4433
5 Ga0070683_100254295 3300005329 Bacteria 1671
6 Ga0070690_100080852 3300005330 Bacteria 2126
7 Ga0068869_100088418 3300005334 Bacteria 2325
8 Ga0070680_100020568 3300005336 Bacteria 5239
9 Ga0070680_100023083 3300005336 Bacteria 4958
10 Ga0070680_100049179 3300005336 Bacteria 3436
11 Ga0070680_100077430 3300005336 Bacteria 2739
12 Ga0070680_100296143 3300005336 Bacteria 1372
13 Ga0070682_100137262 3300005337 Bacteria 1663
14 Ga0070660_100008257 3300005339 Bacteria 7278
15 Ga0070660_100020167 3300005339 Bacteria 4895
16 Ga0070660_100045357 3300005339 Bacteria 3365
17 Ga0070660_100054065 3300005339 Bacteria 3099
18 Ga0070660_100078063 3300005339 Unclassified 2596
19 Ga0070660_100296139 3300005339 Bacteria 1326
20 Ga0070691_10031993 3300005341 Bacteria 2470
21 Ga0070691_10086887 3300005341 Unclassified 1537
22 Ga0070661_100056424 3300005344 Bacteria 2878
23 Ga0070692_10014373 3300005345 Bacteria 3718
24 Ga0070692_10018151 3300005345 Bacteria 3377
25 Ga0070668_100053143 3300005347 Bacteria 3124
26 Ga0070669_100340478 3300005353 Bacteria 1215
27 Ga0070671_100136151 3300005355 Bacteria 2071
28 Ga0070671_100164199 3300005355 Bacteria 1877
29 Ga0070671_100435585 3300005355 Bacteria 1124
30 Ga0070674_100005755 3300005356 Bacteria 7192
31 Ga0070674_100055508 3300005356 Bacteria 2743
32 Ga0070673_100109765 3300005364 Bacteria 2286
33 Ga0070688_100182657 3300005365 Bacteria 1456
34 Ga0070659_100004574 3300005366 Bacteria 9892
35 Ga0070659_100024028 3300005366 Bacteria 4669
36 Ga0070659_100037243 3300005366 Bacteria 3791
37 Ga0070659_100282099 3300005366 Bacteria 1382
38 Ga0070703_10029379 3300005406 Bacteria 1650
39 Ga0070709_10006188 3300005434 Bacteria 6515
40 Ga0070709_10038468 3300005434 Bacteria 2929
41 Ga0070709_10068543 3300005434 Unclassified 2282
42 Ga0070709_10132751 3300005434 Bacteria 1701
43 Ga0070709_10327033 3300005434 Bacteria 1127
44 Ga0070709_10351815 3300005434 Unclassified 1089
45 Ga0070714_100004838 3300005435 Bacteria 10221
46 Ga0070714_100008551 3300005435 Bacteria 8003
47 Ga0070714_100026860 3300005435 Bacteria 4761
48 Ga0070714_100052155 3300005435 Bacteria 3488
49 Ga0070714_100061379 3300005435 Bacteria 3229
50 Ga0070714_100070139 3300005435 Bacteria 3029
51 Ga0070714_100083695 3300005435 Bacteria 2783
52 Ga0070714_100231522 3300005435 Bacteria 1702
53 Ga0070713_100001060 3300005436 Bacteria 17565
54 Ga0070713_100008471 3300005436 Bacteria 7293
55 Ga0070710_10003601 3300005437 Bacteria 7338
56 Ga0070710_10008982 3300005437 Bacteria 4882
57 Ga0070710_10105674 3300005437 Bacteria 1683
58 Ga0070701_10065807 3300005438 Bacteria 1925
59 Ga0070711_100009812 3300005439 Bacteria 5905
60 Ga0070711_100016495 3300005439 Bacteria 4693
61 Ga0070700_100156245 3300005441 Bacteria 1565
62 Ga0070700_100189187 3300005441 Unclassified 1438
63 Ga0070694_100047908 3300005444 Bacteria 2873
64 Ga0070694_100086507 3300005444 Bacteria 2191
65 Ga0070694_100408916 3300005444 Bacteria 1064
66 Ga0070678_100129016 3300005456 Bacteria 2006
67 Ga0070662_100032975 3300005457 Bacteria 3644
68 Ga0070681_10039443 3300005458 Bacteria 4734
69 Ga0070681_10071482 3300005458 Bacteria 3434
70 Ga0070681_10245233 3300005458 Bacteria 1705
71 Ga0068867_100022590 3300005459 Bacteria 4497
72 Ga0068867_100084604 3300005459 Bacteria 2397
73 Ga0070706_100058985 3300005467 Bacteria 3542
74 Ga0070706_100122634 3300005467 Bacteria 2423
75 Ga0070707_100051967 3300005468 Bacteria 3928
76 Ga0070707_100064103 3300005468 Bacteria 3527
77 Ga0070707_100421842 3300005468 Bacteria 1294
78 Ga0070698_100015246 3300005471 Bacteria 8127
79 Ga0070698_100016183 3300005471 Bacteria 7875
80 Ga0070698_100022054 3300005471 Bacteria 6668
81 Ga0070699_100082858 3300005518 Bacteria 2797
82 Ga0070679_100022080 3300005530 Bacteria 6217
83 Ga0070679_100033495 3300005530 Bacteria 5087
84 Ga0070679_100036271 3300005530 Bacteria 4894
85 Ga0070679_100052882 3300005530 Bacteria 4043
86 Ga0070679_100082777 3300005530 Unclassified 3198
87 Ga0070684_100020666 3300005535 Bacteria 5461
88 Ga0070684_100071138 3300005535 Bacteria 3062
89 Ga0070684_100126064 3300005535 Bacteria 2306
90 Ga0070684_100542332 3300005535 Bacteria 1079
91 Ga0070697_100158263 3300005536 Bacteria 1913
92 Ga0070697_100188955 3300005536 Bacteria 1748
93 Ga0068853_100325429 3300005539 Bacteria 1426
94 Ga0070695_100029461 3300005545 Bacteria 3411
95 Ga0070695_100140979 3300005545 Bacteria 1671
96 Ga0070696_100015889 3300005546 Bacteria 5060
97 Ga0070696_100061459 3300005546 Bacteria 2628
98 Ga0070693_100023061 3300005547 Bacteria 3320
99 Ga0070693_100248803 3300005547 Bacteria 1177
100 Ga0070704_100015256 3300005549 Bacteria 4822
101 Ga0070704_100017012 3300005549 Bacteria 4612
102 Ga0070704_100158114 3300005549 Bacteria 1789
103 Ga0070704_100162942 3300005549 Bacteria 1765
104 Ga0068855_100052856 3300005563 Bacteria 4781
105 Ga0068855_100061944 3300005563 Bacteria 4369
106 Ga0068855_100152857 3300005563 Bacteria 2624
107 Ga0068855_100208157 3300005563 Bacteria 2199
108 Ga0070664_100091185 3300005564 Unclassified 2638
109 Ga0068857_100038685 3300005577 Bacteria 4224
110 Ga0068857_100604640 3300005577 Bacteria 1037
111 Ga0068856_100083532 3300005614 Bacteria 3172
112 Ga0068852_100076060 3300005616 Bacteria 2964
113 Ga0068859_100488406 3300005617 Bacteria 1327
114 Ga0068864_100070632 3300005618 Bacteria 3039
115 Ga0068866_10125952 3300005718 Bacteria 1450
116 Ga0068861_100007739 3300005719 Bacteria 7381
117 Ga0068861_100094875 3300005719 Bacteria 2362
118 Ga0068861_100097859 3300005719 Bacteria 2328
119 Ga0068861_100184110 3300005719 Bacteria 1741
120 Ga0068851_10008024 3300005834 Bacteria 4870
121 Ga0068870_10097759 3300005840 Bacteria 1653
122 Ga0068863_100172157 3300005841 Unclassified 2077
123 Ga0068858_100432309 3300005842 Bacteria 1267
124 Ga0068862_100278360 3300005844 Bacteria 1533
125 Ga0081455_10004421 3300005937 Bacteria 15777
126 Ga0081455_10018767 3300005937 Bacteria 6563
127 Ga0081538_10000053 3300005981 Bacteria 109213
128 Ga0081538_10000094 3300005981 Bacteria 86715
129 Ga0081538_10000100 3300005981 Bacteria 83917
130 Ga0081538_10024011 3300005981 Bacteria 4359
131 Ga0081538_10034170 3300005981 Bacteria 3367
132 Ga0081538_10082099 3300005981 Bacteria 1711
133 Ga0081540_1017275 3300005983 Bacteria 4473
134 Ga0070717_10005467 3300006028 Bacteria 9275
135 Ga0070717_10007849 3300006028 Bacteria 7943
136 Ga0070717_10034859 3300006028 Bacteria 4070
137 Ga0070717_10205975 3300006028 Bacteria 1725
138 Ga0070717_10363118 3300006028 Bacteria 1296
139 Ga0075365_10210969 3300006038 Bacteria 1361
140 Ga0075364_10254025 3300006051 Bacteria 1195
141 Ga0075432_10008519 3300006058 Bacteria 3497
142 Ga0070715_10011394 3300006163 Bacteria 3201
143 Ga0070715_10038124 3300006163 Bacteria 1993
144 Ga0070716_100001457 3300006173 Bacteria 10535
145 Ga0070716_100008190 3300006173 Bacteria 5181
146 Ga0070716_100143012 3300006173 Bacteria 1528
147 Ga0070712_100211865 3300006175 Bacteria 1528
148 Ga0075367_10225184 3300006178 Bacteria 1174
149 Ga0097621_100281031 3300006237 Bacteria 1465
150 Ga0075428_100002460 3300006844 Bacteria 20102
151 Ga0075428_100005053 3300006844 Bacteria 14668
152 Ga0075428_100012212 3300006844 Bacteria 9550
153 Ga0075428_100379218 3300006844 Bacteria 1516
154 Ga0075431_100002910 3300006847 Bacteria 16568
155 Ga0075431_100033329 3300006847 Bacteria 5309
156 Ga0075431_100070213 3300006847 Bacteria 3614
157 Ga0075431_100134492 3300006847 Unclassified 2549
158 Ga0075431_100363473 3300006847 Bacteria 1453
159 Ga0075433_10002265 3300006852 Bacteria 14625
160 Ga0075433_10024118 3300006852 Bacteria 5129
161 Ga0075433_10071464 3300006852 Bacteria 3050
162 Ga0075433_10086955 3300006852 Bacteria 2761
163 Ga0075433_10113133 3300006852 Bacteria 2408
164 Ga0075434_100001294 3300006871 Bacteria 20866
165 Ga0075434_100003374 3300006871 Bacteria 14296
166 Ga0075434_100009463 3300006871 Bacteria 9085
167 Ga0075434_100033764 3300006871 Bacteria 5051
168 Ga0075434_100145869 3300006871 Bacteria 2387
169 Ga0075429_100008378 3300006880 Bacteria 9000
170 Ga0068865_100018192 3300006881 Bacteria 4532
171 Ga0075436_100000915 3300006914 Bacteria 19663
172 Ga0075436_100006395 3300006914 Bacteria 8074
173 Ga0075436_100008390 3300006914 Bacteria 7065
174 Ga0075436_100020398 3300006914 Bacteria 4549
175 Ga0075436_100272928 3300006914 Bacteria 1208
176 Ga0097620_100488357 3300006931 Bacteria 1327
177 Ga0075435_100001243 3300007076 Bacteria 16320
178 Ga0075435_100028080 3300007076 Bacteria 4410
179 Ga0075435_100103033 3300007076 Bacteria 2366
180 Ga0075435_100120794 3300007076 Bacteria 2186
181 Ga0075435_100331419 3300007076 Archaea 1303
182 Ga0105240_10040117 3300009093 Bacteria 5992
183 Ga0105240_10073540 3300009093 Bacteria 4220
184 Ga0105240_10119265 3300009093 Bacteria 3178
185 Ga0105240_10251425 3300009093 Bacteria 2044
186 Ga0111539_10003095 3300009094 Bacteria 22053
187 Ga0111539_10035714 3300009094 Bacteria 6017
188 Ga0105245_10006126 3300009098 Bacteria 10579
189 Ga0105245_10047671 3300009098 Bacteria 3830
190 Ga0105245_10186618 3300009098 Bacteria 1984
191 Ga0105245_10684038 3300009098 Bacteria 1058
192 Ga0114129_10000141 3300009147 Bacteria 75420
193 Ga0114129_10003813 3300009147 Bacteria 21253
194 Ga0114129_10142466 3300009147 Bacteria 3285
195 Ga0114129_10788334 3300009147 Bacteria 1213
196 Ga0105243_10100630 3300009148 Bacteria 2398
197 Ga0105243_10129849 3300009148 Bacteria 2136
198 Ga0105243_10136046 3300009148 Bacteria 2091
199 Ga0105243_10143766 3300009148 Bacteria 2039
200 Ga0105242_10024082 3300009176 Bacteria 4805
201 Ga0105242_10066229 3300009176 Bacteria 2982
202 Ga0105242_10121783 3300009176 Bacteria 2240
203 Ga0105242_10258774 3300009176 Unclassified 1571
204 Ga0105248_10212958 3300009177 Bacteria 2177
205 Ga0105248_10593259 3300009177 Bacteria 1250
206 Ga0105238_10053645 3300009551 Bacteria 4051
207 Ga0105249_10009086 3300009553 Bacteria 8690
208 Ga0105249_10026677 3300009553 Bacteria 5209
209 Ga0105239_10095749 3300010375 Bacteria 3279
210 Ga0105246_10338207 3300011119 Unclassified 1229
211 Ga0157371_10116002 3300013102 Bacteria 1902
212 Ga0157370_10033132 3300013104 Bacteria 5037
213 Ga0157370_10068805 3300013104 Bacteria 3345
214 Ga0157369_10089572 3300013105 Bacteria 3285
215 Ga0157374_10008652 3300013296 Bacteria 8712
216 Ga0157378_10396830 3300013297 Unclassified 1358
217 Ga0163162_10316400 3300013306 Bacteria 1693
218 Ga0157372_10100565 3300013307 Bacteria 3299
219 Ga0157372_10284795 3300013307 Bacteria 1922
220 Ga0157375_10578672 3300013308 Unclassified 1283
221 Ga0157375_10785346 3300013308 Bacteria 1102
222 Ga0163163_10128882 3300014325 Bacteria 2569
223 Ga0157380_10005200 3300014326 Bacteria 9095
224 Ga0157380_10060201 3300014326 Bacteria 3033
225 Ga0182008_10009436 3300014497 Bacteria 5264
226 Ga0157377_10018073 3300014745 Bacteria 3660
227 Ga0157379_10107811 3300014968 Unclassified 2501
228 Ga0157376_10159817 3300014969 Bacteria 2041
229 Ga0157376_10320910 3300014969 Bacteria 1472
230 Ga0182007_10012200 3300015262 Bacteria 3315
231 Ga0163161_10008822 3300017792 Bacteria 6969
232 Ga0163161_10229610 3300017792 Bacteria 1440
233 Ga0197907_10972893 3300020069 Bacteria 1525
234 Ga0206356_10739625 3300020070 Bacteria 3248
235 Ga0206354_10143858 3300020081 Unclassified 1371
236 Ga0206354_10579909 3300020081 Bacteria 2543
237 Ga0206353_10543908 3300020082 Bacteria 1596
238 Ga0206353_11152913 3300020082 Bacteria 3899
239 Ga0206353_11689011 3300020082 Bacteria 14322
240 Ga0213875_10139329 3300021388 Bacteria 1135
241 Ga0213871_10002981 3300021441 Bacteria 3200
242 Ga0207656_10004008 3300025321 Bacteria 5107
243 Ga0207653_10004251 3300025885 Bacteria 4499
244 Ga0207692_10012508 3300025898 Bacteria 3647
245 Ga0207692_10017163 3300025898 Bacteria 3223
246 Ga0207688_10005694 3300025901 Bacteria 6773
247 Ga0207685_10008146 3300025905 Bacteria 2966
248 Ga0207685_10057699 3300025905 Bacteria 1524
249 Ga0207699_10002004 3300025906 Bacteria 9617
250 Ga0207699_10039861 3300025906 Bacteria 2702
251 Ga0207699_10179391 3300025906 Unclassified 1422
252 Ga0207643_10206819 3300025908 Bacteria 1197
253 Ga0207705_10044675 3300025909 Bacteria 3184
254 Ga0207705_10144245 3300025909 Bacteria 1780
255 Ga0207705_10219367 3300025909 Bacteria 1444
256 Ga0207684_10118109 3300025910 Bacteria 2272
257 Ga0207707_10008396 3300025912 Bacteria 8961
258 Ga0207707_10040872 3300025912 Bacteria 4049
259 Ga0207695_10085325 3300025913 Bacteria 3187
260 Ga0207695_10230599 3300025913 Bacteria 1756
261 Ga0207693_10000282 3300025915 Bacteria 47278
262 Ga0207693_10007638 3300025915 Bacteria 8877
263 Ga0207693_10035896 3300025915 Bacteria 3907
264 Ga0207663_10044668 3300025916 Bacteria 2721
265 Ga0207663_10118368 3300025916 Bacteria 1809
266 Ga0207660_10178611 3300025917 Bacteria 1647
267 Ga0207660_10263106 3300025917 Bacteria 1365
268 Ga0207660_10268093 3300025917 Bacteria 1352
269 Ga0207657_10000988 3300025919 Bacteria 30190
270 Ga0207657_10033885 3300025919 Bacteria 4598
271 Ga0207657_10077510 3300025919 Unclassified 2800
272 Ga0207657_10080178 3300025919 Bacteria 2744
273 Ga0207657_10201020 3300025919 Bacteria 1603
274 Ga0207657_10350582 3300025919 Bacteria 1164
275 Ga0207652_10087226 3300025921 Bacteria 2737
276 Ga0207646_10001768 3300025922 Bacteria 26172
277 Ga0207646_10120866 3300025922 Bacteria 2353
278 Ga0207646_10148490 3300025922 Bacteria 2113
279 Ga0207646_10355995 3300025922 Bacteria 1322
280 Ga0207646_10491985 3300025922 Bacteria 1105
281 Ga0207681_10278020 3300025923 Bacteria 1317
282 Ga0207687_10015169 3300025927 Bacteria 5049
283 Ga0207700_10000039 3300025928 Bacteria 102496
284 Ga0207700_10015530 3300025928 Bacteria 5027
285 Ga0207700_10069117 3300025928 Bacteria 2710
286 Ga0207664_10012931 3300025929 Bacteria 5980
287 Ga0207664_10032025 3300025929 Bacteria 4027
288 Ga0207664_10047082 3300025929 Bacteria 3387
289 Ga0207664_10063827 3300025929 Bacteria 2944
290 Ga0207664_10100754 3300025929 Bacteria 2385
291 Ga0207664_10111667 3300025929 Bacteria 2274
292 Ga0207664_10132587 3300025929 Bacteria 2099
293 Ga0207644_10123627 3300025931 Bacteria 1973
294 Ga0207690_10012589 3300025932 Bacteria 5064
295 Ga0207690_10039559 3300025932 Unclassified 3077
296 Ga0207690_10177336 3300025932 Bacteria 1602
297 Ga0207706_10010201 3300025933 Bacteria 8593
298 Ga0207706_10041071 3300025933 Bacteria 4101
299 Ga0207686_10010201 3300025934 Bacteria 5108
300 Ga0207686_10230059 3300025934 Bacteria 1343
301 Ga0207709_10094126 3300025935 Unclassified 1966
302 Ga0207709_10242955 3300025935 Bacteria 1311
303 Ga0207669_10231393 3300025937 Bacteria 1364
304 Ga0207704_10218237 3300025938 Bacteria 1409
305 Ga0207704_10313786 3300025938 Bacteria 1207
306 Ga0207665_10004972 3300025939 Bacteria 8869
307 Ga0207665_10027771 3300025939 Bacteria 3738
308 Ga0207711_10143958 3300025941 Bacteria 2146
309 Ga0207689_10082630 3300025942 Bacteria 2641
310 Ga0207661_10062637 3300025944 Bacteria 3010
311 Ga0207661_10090489 3300025944 Bacteria 2548
312 Ga0207661_10116265 3300025944 Bacteria 2270
313 Ga0207661_10318684 3300025944 Bacteria 1397
314 Ga0207679_10069445 3300025945 Unclassified 2651
315 Ga0207679_10220337 3300025945 Bacteria 1596
316 Ga0207667_10101806 3300025949 Bacteria 2963
317 Ga0207667_10138760 3300025949 Bacteria 2503
318 Ga0207667_10159659 3300025949 Bacteria 2319
319 Ga0207651_10528870 3300025960 Bacteria 1023
320 Ga0207668_10062865 3300025972 Bacteria 2616
321 Ga0207658_10002326 3300025986 Bacteria 13958
322 Ga0207677_10183427 3300026023 Bacteria 1648
323 Ga0207678_10296639 3300026067 Unclassified 1389
324 Ga0207708_10000684 3300026075 Bacteria 25753
325 Ga0207708_10040507 3300026075 Bacteria 3551
326 Ga0207702_10100980 3300026078 Bacteria 2546
327 Ga0207702_10381501 3300026078 Bacteria 1355
328 Ga0207702_10602393 3300026078 Bacteria 1078
329 Ga0207641_10153622 3300026088 Unclassified 2087
330 Ga0207641_10532558 3300026088 Bacteria 1144
331 Ga0207648_10011247 3300026089 Bacteria 8438
332 Ga0207648_10352013 3300026089 Bacteria 1328
333 Ga0207648_10443595 3300026089 Bacteria 1181
334 Ga0207676_10240663 3300026095 Bacteria 1623
335 Ga0207675_100000929 3300026118 Bacteria 29254
336 Ga0207675_100336280 3300026118 Bacteria 1477
337 Ga0207683_10034207 3300026121 Bacteria 4416
338 Ga0207683_10037498 3300026121 Bacteria 4221
339 Ga0207683_10063512 3300026121 Bacteria 3253
340 Ga0207683_10219356 3300026121 Bacteria 1733
341 Ga0207698_10767550 3300026142 Bacteria 964
342 Ga0207428_10000108 3300027907 Bacteria 115378
343 Ga0207428_10099829 3300027907 Bacteria 2244
344 Ga0207428_10321501 3300027907 Bacteria 1143
345 Ga0265319_1000635 3300028563 Bacteria 23180
346 Ga0265334_10002590 3300028573 Bacteria 8429
347 Ga0265318_10003761 3300028577 Bacteria 7549
348 Ga0265322_10001612 3300028654 Bacteria 7210
349 Ga0265322_10032636 3300028654 Bacteria 1485
350 Ga0265338_10005641 3300028800 Bacteria 16249
351 Ga0265338_10007196 3300028800 Bacteria 13912
352 Ga0265338_10075508 3300028800 Bacteria 2859
353 Ga0265338_10144941 3300028800 Bacteria 1854
354 Ga0265324_10022996 3300029957 Bacteria 2223
355 Ga0265324_10033318 3300029957 Bacteria 1798
356 Ga0265330_10000327 3300031235 Bacteria 34205
357 Ga0265330_10046743 3300031235 Bacteria 1906
358 Ga0265332_10003969 3300031238 Bacteria 7049
359 Ga0265332_10116072 3300031238 Bacteria 1126
360 Ga0265320_10092767 3300031240 Bacteria 1397
361 Ga0265329_10025187 3300031242 Bacteria 1971
362 Ga0265340_10002177 3300031247 Bacteria 11216
363 Ga0265331_10004733 3300031250 Bacteria 8414
364 Ga0265327_10017812 3300031251 Bacteria 4432
365 Ga0265316_10020939 3300031344 Bacteria 5552
366 Ga0265316_10159049 3300031344 Bacteria 1689
367 Ga0307408_100118146 3300031548 Bacteria 2050
368 Ga0265313_10005397 3300031595 Bacteria 9426
369 Ga0265314_10002591 3300031711 Bacteria 18287
370 Ga0265342_10011070 3300031712 Bacteria 6191
371 Ga0265342_10130077 3300031712 Bacteria 1411
372 Ga0307406_10009746 3300031901 Bacteria 5401
373 Ga0307409_100187828 3300031995 Bacteria 1836
374 Ga0307416_100019684 3300032002 Bacteria 4793
375 Ga0307416_100212948 3300032002 Unclassified 1845
376 Ga0307411_10410369 3300032005 Bacteria 1122
377 Ga0307415_100021919 3300032126 Bacteria 3935
378 Ga0307415_100050027 3300032126 Bacteria 2829
379 Ga0316583_10021232 3300032133 Bacteria 2328
380 Ga0373948_0012084 3300034817 Bacteria 1538
381 Ga0373928_0015661 3300035084 Bacteria 1545
382 Ga0373940_0004842 3300035088 Bacteria 2873
383 Ga0373940_0019686 3300035088 Bacteria 1708
384 Ga0373949_0005830 3300035090 Bacteria 2738
385 Ga0373952_0002137 3300035092 Bacteria 3553
386 Ga0373932_0075588 3300035112 Bacteria 1054
387 Ga0373960_0029407 3300035121 Unclassified 1523
388 Ga0373943_0000198 3300035170 Bacteria 24537
389 Ga0373943_0072902 3300035170 Unclassified 1743
390 Ga0373961_0008795 3300035241 Bacteria 2460
391 Ga0373962_0005248 3300035242 Bacteria 3133
392 Ga0373931_0097985 3300035691 Bacteria 1645
393 Ga0373935_0109936 3300035692 Bacteria 1828
394 Ga0373935_0494438 3300035692 Bacteria 887
395 Ga0373933_0172015 3300035724 Bacteria 1379
396 Ga0373933_0186160 3300035724 Bacteria 1325
397 Ga0373947_0000463 3300035725 Bacteria 23167
398 Ga0373937_0109487 3300036401 Bacteria 2569
399 Ga0373925_0024512 3300037068 Bacteria 4405
400 Ga0395899_0000862 3300037312 Bacteria 28881
401 Ga0395899_0002568 3300037312 Bacteria 14676
402 Ga0395899_0005918 3300037312 Bacteria 9496
403 Ga0395899_0008133 3300037312 Bacteria 8079
404 Ga0395899_0009554 3300037312 Bacteria 7445
405 Ga0395899_0037927 3300037312 Bacteria 3612
406 Ga0395899_0082410 3300037312 Bacteria 2340
407 Ga0395899_0085266 3300037312 Unclassified 2295
408 Ga0395899_0182321 3300037312 Bacteria 1473
409 Ga0395900_0001219 3300037418 Bacteria 31689
410 Ga0395900_0001266 3300037418 Bacteria 30887
411 Ga0395900_0001485 3300037418 Bacteria 27947
412 Ga0395900_0004452 3300037418 Bacteria 14842
413 Ga0395900_0005059 3300037418 Bacteria 13833
414 Ga0395900_0009112 3300037418 Bacteria 10167
415 Ga0395900_0019826 3300037418 Bacteria 6853
416 Ga0395900_0024066 3300037418 Bacteria 6233
417 Ga0395900_0046723 3300037418 Bacteria 4458
418 Ga0395900_0068678 3300037418 Bacteria 3642
419 Ga0395900_0068882 3300037418 Bacteria 3636
420 Ga0395900_0166180 3300037418 Bacteria 2248
421 Ga0395900_0171588 3300037418 Bacteria 2207
422 Ga0395900_0188797 3300037418 Bacteria 2091
423 Ga0395900_0351242 3300037418 Bacteria 1448
424 Ga0395900_0497844 3300037418 Bacteria 1169
425 Ga0395898_0012615 3300037466 Bacteria 8736
426 Ga0395898_0015047 3300037466 Bacteria 7942
427 Ga0395898_0016535 3300037466 Bacteria 7545
428 Ga0395898_0020108 3300037466 Bacteria 6783
429 Ga0395898_0022431 3300037466 Bacteria 6394
430 Ga0395898_0027937 3300037466 Bacteria 5658
431 Ga0395898_0036950 3300037466 Bacteria 4847
432 Ga0395898_0040672 3300037466 Bacteria 4595
433 Ga0395898_0041721 3300037466 Bacteria 4531
434 Ga0395898_0054574 3300037466 Bacteria 3899
435 Ga0395898_0068165 3300037466 Bacteria 3443
436 Ga0395898_0071572 3300037466 Bacteria 3350
437 Ga0395898_0085312 3300037466 Bacteria 3043
438 Ga0395898_0180539 3300037466 Unclassified 2017
439 Ga0395898_0220145 3300037466 Bacteria 1811
440 Ga0395898_0270203 3300037466 Bacteria 1622
441 Ga0395898_0489806 3300037466 Bacteria 1170
442 Ga0395905_0000640 3300037471 Bacteria 46768
443 Ga0395905_0001564 3300037471 Bacteria 27335
444 Ga0395905_0007797 3300037471 Bacteria 10619
445 Ga0395905_0008242 3300037471 Bacteria 10291
446 Ga0395905_0020747 3300037471 Bacteria 6221
447 Ga0395905_0063663 3300037471 Bacteria 3450
448 Ga0395905_0066894 3300037471 Bacteria 3365
449 Ga0395905_0093548 3300037471 Bacteria 2819
450 Ga0395905_0093695 3300037471 Bacteria 2817
451 Ga0395905_0160799 3300037471 Bacteria 2111
452 Ga0395905_0299866 3300037471 Bacteria 1494
453 Ga0395905_0500768 3300037471 Bacteria 1115
454 Ga0436364_0533197 3300037853 Bacteria 1358
455 Ga0395901_0000978 3300038443 Bacteria 30977
456 Ga0395901_0001883 3300038443 Bacteria 21647
457 Ga0395901_0002270 3300038443 Bacteria 19615
458 Ga0395901_0002692 3300038443 Bacteria 17910
459 Ga0395901_0011802 3300038443 Bacteria 8859
460 Ga0395901_0015905 3300038443 Bacteria 7667
461 Ga0395901_0016559 3300038443 Bacteria 7511
462 Ga0395901_0032992 3300038443 Bacteria 5342
463 Ga0395901_0035193 3300038443 Bacteria 5174
464 Ga0395901_0057609 3300038443 Bacteria 4041
465 Ga0395901_0114956 3300038443 Bacteria 2826
466 Ga0395901_0138285 3300038443 Bacteria 2560
467 Ga0395901_0143583 3300038443 Bacteria 2509
468 Ga0395901_0257143 3300038443 Bacteria 1818
469 Ga0395901_0341483 3300038443 Bacteria 1547
470 Ga0395901_0449267 3300038443 Bacteria 1318
471 Ga0436360_1292831 3300039438 Bacteria 2303
472 Ga0436363_1287539 3300039450 Bacteria 3055
473 Ga0439439_0044680 3300041406 Bacteria 1154
474 Ga0439461_0012809 3300041410 Bacteria 1575
475 Ga0451793_0979246 3300041452 Bacteria 1709
476 Ga0451853_3576152 3300041512 Bacteria 1629
477 Ga0451853_3629479 3300041512 Bacteria 1413
478 Ga0439448_0012082 3300042005 Bacteria 2579
479 Ga0439455_0016834 3300042012 Bacteria 1695
480 Ga0439456_031407 3300042013 Bacteria 1138
481 Ga0439446_0005591 3300042156 Bacteria 3238
482 Ga0466969_0003306 3300044656 Bacteria 8575
483 Ga0466969_0013131 3300044656 Bacteria 4364
484 Ga0466969_0085238 3300044656 Bacteria 1502
485 Ga0466972_0029041 3300044658 Bacteria 2724
486 Ga0466972_0070793 3300044658 Bacteria 1664
487 Ga0466965_0013693 3300044683 Unclassified 3830
488 Ga0466965_0049114 3300044683 Bacteria 2091
489 Ga0466965_0230224 3300044683 Unclassified 990
490 Ga0466966_0004938 3300044684 Bacteria 8765
491 Ga0466966_0008431 3300044684 Bacteria 6821
492 Ga0466966_0063700 3300044684 Bacteria 2323
493 Ga0466966_0202162 3300044684 Bacteria 1202
494 Ga0466961_0011545 3300044693 Bacteria 5649
495 Ga0466961_0026593 3300044693 Bacteria 3719
496 Ga0466961_0033324 3300044693 Bacteria 3310
497 Ga0466961_0049106 3300044693 Bacteria 2697
498 Ga0466961_0148650 3300044693 Bacteria 1464
499 Ga0466963_0000095 3300044694 Bacteria 31064
500 Ga0466963_0004541 3300044694 Bacteria 8082
501 Ga0466963_0004612 3300044694 Bacteria 8029
502 Ga0466963_0005966 3300044694 Bacteria 7176
503 Ga0466963_0015015 3300044694 Bacteria 4786
504 Ga0466963_0017054 3300044694 Bacteria 4523
505 Ga0466963_0017204 3300044694 Bacteria 4504
506 Ga0466963_0019732 3300044694 Bacteria 4233
507 Ga0466963_0021258 3300044694 Bacteria 4091
508 Ga0466963_0029166 3300044694 Bacteria 3549
509 Ga0466963_0030131 3300044694 Bacteria 3498
510 Ga0466963_0052948 3300044694 Bacteria 2694
511 Ga0466963_0116124 3300044694 Bacteria 1839
512 Ga0466963_0202221 3300044694 Bacteria 1389
513 Ga0466963_0246167 3300044694 Bacteria 1254
514 Ga0466963_0255268 3300044694 Bacteria 1230
515 Ga0466963_0346179 3300044694 Bacteria 1046
516 Ga0466964_0000465 3300044706 Bacteria 12455
517 Ga0466964_0007441 3300044706 Bacteria 4097
518 Ga0466964_0008767 3300044706 Bacteria 3802
519 Ga0466964_0024459 3300044706 Bacteria 2354
520 Ga0466964_0167302 3300044706 Bacteria 1032
521 Ga0466971_0001664 3300044719 Bacteria 9395
522 Ga0466971_0016536 3300044719 Unclassified 3257
523 Ga0466971_0053198 3300044719 Bacteria 1824
524 Ga0466971_0066685 3300044719 Bacteria 1631
525 Ga0466971_0091631 3300044719 Bacteria 1392
526 Ga0466968_0002238 3300044735 Bacteria 7071
527 Ga0466968_0006803 3300044735 Bacteria 4326
528 Ga0466968_0025288 3300044735 Bacteria 2431
529 Ga0466968_0031074 3300044735 Bacteria 2214
530 Ga0466968_0039968 3300044735 Bacteria 1976
531 Ga0466968_0080358 3300044735 Bacteria 1432
532 Ga0466968_0083542 3300044735 Bacteria 1407
533 Ga0466970_0004679 3300044765 Bacteria 6757
534 Ga0466970_0177079 3300044765 Bacteria 1183
535 Ga0466957_0001672 3300044842 Bacteria 11652
536 Ga0466957_0004210 3300044842 Bacteria 7978
537 Ga0466957_0015443 3300044842 Bacteria 4460
538 Ga0466957_0020943 3300044842 Bacteria 3848
539 Ga0466957_0025135 3300044842 Bacteria 3528
540 Ga0466957_0066648 3300044842 Bacteria 2220
541 Ga0466957_0070018 3300044842 Bacteria 2167
542 Ga0466957_0072128 3300044842 Bacteria 2137
543 Ga0466957_0073883 3300044842 Bacteria 2114
544 Ga0466957_0151095 3300044842 Bacteria 1502
545 Ga0466960_0001521 3300044901 Bacteria 8449
546 Ga0466960_0124262 3300044901 Bacteria 1355
547 Ga0466959_0002457 3300045049 Bacteria 11851
548 Ga0466959_0005583 3300045049 Bacteria 8642
549 Ga0466959_0011442 3300045049 Bacteria 6376
550 Ga0466959_0026369 3300045049 Bacteria 4307
551 Ga0466959_0109105 3300045049 Bacteria 1976
552 Ga0466959_0254129 3300045049 Bacteria 1212
553 Ga0466959_0417316 3300045049 Bacteria 911
554 Ga0451576_0408613 3300045051 Bacteria 1424
555 Ga0466958_0001908 3300045836 Bacteria 10200
556 Ga0466958_0002667 3300045836 Bacteria 9029
557 Ga0466958_0009659 3300045836 Bacteria 5382
558 Ga0466958_0011393 3300045836 Bacteria 5008
559 Ga0466958_0029313 3300045836 Bacteria 3266
560 Ga0466958_0089370 3300045836 Bacteria 1904
561 Ga0466958_0090580 3300045836 Bacteria 1892
562 Ga0466958_0117544 3300045836 Bacteria 1662
563 Ga0466958_0229725 3300045836 Bacteria 1185
564 Ga0466958_0258213 3300045836 Unclassified 1115
565 Ga0466958_0263946 3300045836 Bacteria 1102
566 Ga0466967_0000676 3300045976 Bacteria 17274
567 Ga0466967_0003281 3300045976 Bacteria 10494
568 Ga0466967_0004469 3300045976 Bacteria 9438
569 Ga0466967_0010011 3300045976 Bacteria 7082
570 Ga0466967_0011240 3300045976 Bacteria 6766
571 Ga0466967_0012377 3300045976 Bacteria 6521
572 Ga0466967_0019227 3300045976 Bacteria 5487
573 Ga0466967_0030709 3300045976 Bacteria 4511
574 Ga0466967_0040726 3300045976 Bacteria 4001
575 Ga0466967_0051313 3300045976 Bacteria 3614
576 Ga0466967_0058374 3300045976 Bacteria 3411
577 Ga0466967_0065864 3300045976 Bacteria 3226
578 Ga0466967_0068035 3300045976 Bacteria 3178
579 Ga0466967_0097862 3300045976 Bacteria 2678
580 Ga0466967_0112673 3300045976 Bacteria 2501
581 Ga0466967_0169802 3300045976 Bacteria 2051
582 Ga0466967_0177756 3300045976 Bacteria 2005
583 Ga0466967_0195313 3300045976 Bacteria 1914
584 Ga0466967_0204631 3300045976 Bacteria 1870
585 Ga0466967_0547148 3300045976 Unclassified 1139
586 Ga0466967_0607901 3300045976 Bacteria 1079
587 Ga0495627_076578 3300046453 Unclassified 973
588 Ga0495592_0042691 3300046454 Bacteria 3395
589 Ga0495592_0090270 3300046454 Bacteria 2198
590 Ga0495592_0175584 3300046454 Unclassified 1463
591 Ga0495603_0000081 3300046455 Bacteria 42501
592 Ga0495603_0165798 3300046455 Bacteria 1280
593 Ga0495629_0079661 3300046459 Bacteria 2287
594 Ga0495629_0141270 3300046459 Bacteria 1675
595 Ga0495629_0353297 3300046459 Bacteria 1002
596 Ga0495641_0002133 3300046461 Bacteria 15953
597 Ga0495641_0010605 3300046461 Bacteria 5322
598 Ga0495651_0209544 3300046462 Bacteria 1358
599 Ga0495651_0235532 3300046462 Bacteria 1258
600 Ga0495653_0051290 3300046463 Bacteria 3168
601 Ga0495653_0139181 3300046463 Bacteria 1709
602 Ga0495582_0027562 3300046473 Bacteria 3115
603 Ga0495582_0252168 3300046473 Bacteria 1012
604 Ga0495662_0052778 3300046476 Bacteria 1963
605 Ga0495662_0141439 3300046476 Bacteria 1184
606 Ga0495584_0014513 3300046491 Bacteria 4013
607 Ga0495584_0092599 3300046491 Bacteria 1525
608 Ga0495584_0224471 3300046491 Bacteria 955
609 Ga0495585_0077077 3300046492 Unclassified 1810
610 Ga0495594_0000536 3300046499 Bacteria 19443
611 Ga0495596_0061758 3300046500 Bacteria 1459
612 Ga0495596_0061914 3300046500 Unclassified 1457
613 Ga0495607_0070757 3300046501 Unclassified 1948
614 Ga0495608_0006235 3300046511 Bacteria 8464
615 Ga0495608_0106447 3300046511 Bacteria 1805
616 Ga0495608_0426257 3300046511 Unclassified 809
617 Ga0495630_0017298 3300046517 Bacteria 5281
618 Ga0495630_0130037 3300046517 Bacteria 1912
619 Ga0495631_0114062 3300046518 Unclassified 1162
620 Ga0495637_0128200 3300046520 Bacteria 971
621 Ga0495644_0008464 3300046523 Bacteria 3962
622 Ga0495663_0015710 3300046525 Unclassified 2135
623 Ga0495666_0019555 3300046526 Bacteria 3359
624 Ga0495666_0134563 3300046526 Bacteria 1154
625 Ga0495652_0120759 3300046529 Unclassified 2090
626 Ga0495586_0120846 3300046535 Bacteria 1463
627 Ga0495587_0011260 3300046536 Bacteria 5669
628 Ga0495609_0034225 3300046538 Unclassified 2304
629 Ga0495667_0025384 3300046559 Bacteria 3994
630 Ga0495667_0058443 3300046559 Bacteria 2534
631 Ga0495667_0059886 3300046559 Bacteria 2498
632 Ga0495667_0143913 3300046559 Bacteria 1536
633 Ga0495656_0069126 3300046615 Unclassified 1563
634 Ga0495656_0120245 3300046615 Bacteria 1239
635 Ga0495656_0206021 3300046615 Bacteria 978
636 Ga0495634_0064947 3300046642 Bacteria 2419
637 Ga0495634_0202561 3300046642 Bacteria 1232
638 Ga0495635_0131522 3300046663 Bacteria 1706
639 Ga0495659_0065526 3300046664 Bacteria 1351
640 Ga0495659_0137573 3300046664 Bacteria 973
641 Ga0495588_0002678 3300046674 Bacteria 7625
642 Ga0495588_0128966 3300046674 Bacteria 1334
643 Ga0495657_0073386 3300046675 Bacteria 2229
644 Ga0495657_0083062 3300046675 Unclassified 2068
645 Ga0495599_0050417 3300046678 Bacteria 2608
646 Ga0495599_0071124 3300046678 Bacteria 2171
647 Ga0495646_0034028 3300046680 Bacteria 3166
648 Ga0495646_0073986 3300046680 Bacteria 2001
649 Ga0495646_0125367 3300046680 Bacteria 1450
650 Ga0495647_0023856 3300046681 Bacteria 2222
651 Ga0495613_0025650 3300046689 Bacteria 4392
652 Ga0495613_0047146 3300046689 Unclassified 3183
653 Ga0495624_0210753 3300046690 Bacteria 1179
654 Ga0495670_0065767 3300046691 Bacteria 1828
655 Ga0495600_0014203 3300046809 Bacteria 5017
656 Ga0495581_0034383 3300047315 Bacteria 2933
657 Ga0495581_0071126 3300047315 Bacteria 2013
658 Ga0495604_0058379 3300047317 Bacteria 2963
659 Ga0495604_0219087 3300047317 Bacteria 1311
660 Ga0495674_0039772 3300047319 Bacteria 4212
661 Ga0495674_0082453 3300047319 Bacteria 2757
662 Ga0495676_0002817 3300047321 Bacteria 15665
663 Ga0495676_0204108 3300047321 Bacteria 1372
664 Ga0495680_0071197 3300047322 Bacteria 2648
665 Ga0495680_0120624 3300047322 Bacteria 1936
666 Ga0495680_0124632 3300047322 Bacteria 1899
667 Ga0495680_0143697 3300047322 Bacteria 1744
668 Ga0495675_0093888 3300047444 Bacteria 1882
669 Ga0495684_0029449 3300047471 Bacteria 4214
670 Ga0495684_0035091 3300047471 Bacteria 3848
671 Ga0495684_0350490 3300047471 Bacteria 1048
672 Ga0495602_0244232 3300048088 Bacteria 1341
673 Ga0496100_0012806 3300048903 Bacteria 4820
674 Ga0496100_0013565 3300048903 Bacteria 4705
675 Ga0496100_0128670 3300048903 Bacteria 1780
676 Ga0496101_0014642 3300048904 Bacteria 5274
677 Ga0496101_0048493 3300048904 Bacteria 3053
678 Ga0496101_0163765 3300048904 Bacteria 1707
679 Ga0496101_0212930 3300048904 Bacteria 1497
680 Ga0496101_0213762 3300048904 Bacteria 1495
681 Ga0496101_0340692 3300048904 Bacteria 1177
682 Ga0496101_0348559 3300048904 Unclassified 1163
683 Ga0496102_0016639 3300048905 Bacteria 6430
684 Ga0496102_0017600 3300048905 Bacteria 6262
685 Ga0496102_0048059 3300048905 Bacteria 3879
686 Ga0496102_0095778 3300048905 Bacteria 2751
687 Ga0496102_0422367 3300048905 Unclassified 1252
688 Ga0496103_0010103 3300048906 Bacteria 5580
689 Ga0496103_0015355 3300048906 Bacteria 4555
690 Ga0496103_0015863 3300048906 Bacteria 4492
691 Ga0496104_0000865 3300048907 Bacteria 26083
692 Ga0496104_0010631 3300048907 Bacteria 8224
693 Ga0496104_0016341 3300048907 Bacteria 6740
694 Ga0496104_0068058 3300048907 Bacteria 3383
695 Ga0496104_0235398 3300048907 Bacteria 1743
696 Ga0496104_0789962 3300048907 Bacteria 855
697 Ga0496105_0000775 3300048908 Bacteria 21608
698 Ga0496105_0004904 3300048908 Bacteria 10116
699 Ga0496105_0045676 3300048908 Bacteria 3614
700 Ga0496105_0063287 3300048908 Bacteria 3052
701 Ga0496105_0092357 3300048908 Bacteria 2499
702 Ga0496105_0191008 3300048908 Unclassified 1674
703 Ga0496105_0216472 3300048908 Bacteria 1560
704 Ga0496105_0296402 3300048908 Bacteria 1301
705 Ga0496106_0014470 3300048909 Bacteria 5829
706 Ga0496106_0058137 3300048909 Bacteria 2926
707 Ga0496106_0083654 3300048909 Bacteria 2454
708 Ga0496106_0141628 3300048909 Unclassified 1892
709 Ga0496106_0204146 3300048909 Bacteria 1573
710 Ga0496106_0362770 3300048909 Bacteria 1164
711 Ga0496107_0000242 3300048910 Bacteria 28631
712 Ga0496107_0006234 3300048910 Bacteria 8198
713 Ga0496107_0021016 3300048910 Bacteria 4612
714 Ga0496107_0041282 3300048910 Bacteria 3312
715 Ga0496107_0056304 3300048910 Bacteria 2841
716 Ga0496107_0307858 3300048910 Unclassified 1179
717 Ga0496107_0367837 3300048910 Bacteria 1069
718 Ga0496107_0369887 3300048910 Bacteria 1066
719 Ga0496108_0003137 3300048911 Bacteria 13288
720 Ga0496108_0005018 3300048911 Bacteria 10693
721 Ga0496108_0010715 3300048911 Bacteria 7439
722 Ga0496108_0022146 3300048911 Bacteria 5225
723 Ga0496108_0023428 3300048911 Bacteria 5081
724 Ga0496108_0033698 3300048911 Bacteria 4254
725 Ga0496108_0043433 3300048911 Bacteria 3754
726 Ga0496108_0196792 3300048911 Unclassified 1748
727 Ga0496109_0001239 3300048912 Bacteria 21163
728 Ga0496109_0008195 3300048912 Bacteria 8865
729 Ga0496109_0018833 3300048912 Bacteria 6073
730 Ga0496109_0041159 3300048912 Bacteria 4187
731 Ga0496109_0041213 3300048912 Bacteria 4183
732 Ga0496109_0062927 3300048912 Bacteria 3393
733 Ga0496109_0081032 3300048912 Bacteria 2991
734 Ga0496109_0233179 3300048912 Bacteria 1732
735 Ga0496109_0247179 3300048912 Bacteria 1679
736 Ga0496109_0304410 3300048912 Unclassified 1503
737 Ga0496109_0601108 3300048912 Bacteria 1036
738 Ga0496109_0618613 3300048912 Bacteria 1019
739 Ga0496110_0011919 3300048913 Bacteria 7142
740 Ga0496110_0029730 3300048913 Bacteria 4706
741 Ga0496110_0046702 3300048913 Unclassified 3789
742 Ga0496110_0048083 3300048913 Bacteria 3738
743 Ga0496110_0065457 3300048913 Bacteria 3213
744 Ga0496110_0149564 3300048913 Unclassified 2114
745 Ga0496111_0003372 3300048914 Bacteria 9877
746 Ga0496111_0024846 3300048914 Bacteria 4225
747 Ga0496111_0116049 3300048914 Bacteria 1974
748 Ga0496111_0116295 3300048914 Bacteria 1972
749 Ga0496111_0329855 3300048914 Bacteria 1130
750 Ga0496112_0003845 3300048915 Bacteria 12539
751 Ga0496112_0019694 3300048915 Bacteria 6376
752 Ga0496112_0093391 3300048915 Bacteria 2979
753 Ga0496112_0099657 3300048915 Bacteria 2875
754 Ga0496112_0116912 3300048915 Unclassified 2637
755 Ga0496112_0314375 3300048915 Bacteria 1511
756 Ga0496112_0578012 3300048915 Bacteria 1056
757 Ga0496113_0001165 3300048916 Bacteria 14346
758 Ga0496113_0001530 3300048916 Bacteria 12949
759 Ga0496113_0026871 3300048916 Bacteria 4119
760 Ga0496113_0069827 3300048916 Bacteria 2668
761 Ga0496113_0085219 3300048916 Unclassified 2427
762 Ga0496113_0299372 3300048916 Bacteria 1288
763 Ga0496114_0003362 3300048917 Bacteria 12289
764 Ga0496114_0015427 3300048917 Bacteria 6145
765 Ga0496114_0024732 3300048917 Bacteria 4902
766 Ga0496114_0026950 3300048917 Bacteria 4708
767 Ga0496114_0044143 3300048917 Bacteria 3698
768 Ga0496114_0178809 3300048917 Bacteria 1852
769 Ga0496114_0256222 3300048917 Unclassified 1540
770 Ga0496114_0279677 3300048917 Unclassified 1471
771 Ga0496115_0005818 3300048918 Bacteria 8984
772 Ga0496115_0034066 3300048918 Bacteria 4024
773 Ga0496115_0054854 3300048918 Bacteria 3200
774 Ga0496115_0226685 3300048918 Unclassified 1541
775 Ga0496115_0530921 3300048918 Bacteria 942
776 Ga0501031_0003333 3300049568 Bacteria 10307
777 Ga0501031_0021919 3300049568 Bacteria 4162
778 Ga0501032_0001554 3300049569 Bacteria 18314
779 Ga0501033_0000899 3300049570 Bacteria 27196
780 Ga0501033_0112125 3300049570 Unclassified 1984
781 Ga0501033_0160533 3300049570 Bacteria 1618
782 Ga0501034_0072921 3300049571 Bacteria 3442
783 Ga0501036_0005487 3300049572 Bacteria 10285
784 Ga0501036_0044330 3300049572 Bacteria 3767
785 Ga0501036_0053302 3300049572 Bacteria 3425
786 Ga0501037_0007386 3300049573 Bacteria 8039
787 Ga0501037_0122124 3300049573 Bacteria 1872
788 Ga0501038_0003802 3300049574 Bacteria 14046
789 Ga0501038_0040949 3300049574 Bacteria 4042
790 Ga0501039_0003976 3300049575 Bacteria 11110
791 Ga0501039_0009033 3300049575 Bacteria 7594
792 Ga0501040_0001387 3300049576 Bacteria 15298
793 Ga0501040_0002266 3300049576 Bacteria 12360
794 Ga0501040_0005466 3300049576 Bacteria 8221
795 Ga0501040_0141222 3300049576 Bacteria 1697
796 Ga0501041_0000474 3300049577 Bacteria 20418
797 Ga0501041_0000895 3300049577 Bacteria 16124
798 Ga0501042_0000930 3300049578 Bacteria 16501
799 Ga0501042_0068233 3300049578 Bacteria 2542
800 Ga0501043_0000693 3300049579 Bacteria 29791
801 Ga0501043_0086178 3300049579 Bacteria 2468
802 Ga0501043_0240756 3300049579 Bacteria 1395
803 Ga0501046_0001855 3300049580 Bacteria 20125
804 Ga0501046_0040284 3300049580 Bacteria 3734
805 Ga0501046_0328908 3300049580 Bacteria 1112
806 Ga0501047_0037685 3300049581 Bacteria 4676
807 Ga0501047_0061174 3300049581 Bacteria 3634
808 Ga0501047_0150034 3300049581 Bacteria 2208
809 Ga0501047_0231175 3300049581 Bacteria 1703
810 Ga0501048_0000867 3300049582 Bacteria 22328
811 Ga0501048_0008074 3300049582 Bacteria 7967
812 Ga0501048_0031868 3300049582 Bacteria 3812
813 Ga0501067_0020755 3300049583 Bacteria 3634
814 Ga0501067_0023040 3300049583 Bacteria 3449
815 Ga0501067_0031144 3300049583 Bacteria 2960
816 Ga0501067_0046875 3300049583 Bacteria 2399
817 Ga0501067_0121005 3300049583 Unclassified 1456
818 Ga0501067_0137929 3300049583 Bacteria 1358
819 Ga0501067_0139502 3300049583 Bacteria 1350
820 Ga0501067_0202908 3300049583 Bacteria 1104
821 Ga0501068_0001514 3300049584 Bacteria 12364
822 Ga0501068_0003100 3300049584 Bacteria 8878
823 Ga0501068_0015027 3300049584 Bacteria 4439
824 Ga0501068_0145475 3300049584 Unclassified 1487
825 Ga0501069_0000605 3300049585 Bacteria 16589
826 Ga0501069_0012648 3300049585 Bacteria 4490
827 Ga0501069_0030644 3300049585 Bacteria 2955
828 Ga0501069_0069892 3300049585 Bacteria 1966
829 Ga0501070_0001149 3300049586 Bacteria 23709
830 Ga0501070_0024878 3300049586 Bacteria 5021
831 Ga0501070_0042253 3300049586 Bacteria 3797
832 Ga0501070_0075545 3300049586 Bacteria 2790
833 Ga0501070_0333152 3300049586 Bacteria 1233
834 Ga0501070_0333798 3300049586 Bacteria 1232
835 Ga0501071_0000330 3300049587 Bacteria 22815
836 Ga0501071_0000677 3300049587 Bacteria 17791
837 Ga0501071_0030359 3300049587 Bacteria 3822
838 Ga0501072_0001627 3300049588 Bacteria 16809
839 Ga0501072_0003411 3300049588 Bacteria 11969
840 Ga0501072_0006557 3300049588 Bacteria 8862
841 Ga0501072_0007942 3300049588 Bacteria 8055
842 Ga0501072_0016896 3300049588 Bacteria 5606
843 Ga0501072_0023091 3300049588 Bacteria 4829
844 Ga0501072_0131910 3300049588 Bacteria 1991
845 Ga0501073_0003204 3300049589 Bacteria 12288
846 Ga0501073_0029285 3300049589 Bacteria 3935
847 Ga0501073_0031588 3300049589 Bacteria 3778
848 Ga0501073_0063173 3300049589 Bacteria 2583
849 Ga0501073_0269778 3300049589 Unclassified 1174
850 Ga0501074_0022586 3300049590 Bacteria 4572
851 Ga0501074_0030757 3300049590 Bacteria 3890
852 Ga0501074_0045687 3300049590 Bacteria 3167
853 Ga0501074_0153769 3300049590 Bacteria 1644
854 Ga0501075_0001209 3300049591 Bacteria 16714
855 Ga0501075_0017103 3300049591 Bacteria 5234
856 Ga0501075_0044640 3300049591 Unclassified 3325
857 Ga0501075_0108908 3300049591 Bacteria 2106
858 Ga0501075_0267954 3300049591 Bacteria 1301
859 Ga0501075_0332283 3300049591 Bacteria 1158
860 Ga0501076_0004029 3300049592 Bacteria 10380
861 Ga0501076_0006243 3300049592 Bacteria 8630
862 Ga0501076_0011459 3300049592 Bacteria 6606
863 Ga0501076_0035541 3300049592 Bacteria 3897
864 Ga0501076_0185501 3300049592 Bacteria 1696
865 Ga0501076_0219026 3300049592 Unclassified 1556
866 Ga0501077_0000576 3300049593 Bacteria 22271
867 Ga0501077_0008185 3300049593 Bacteria 6465
868 Ga0501077_0098818 3300049593 Bacteria 1850
869 Ga0501077_0103972 3300049593 Unclassified 1800
870 Ga0501079_0001513 3300049741 Bacteria 16457
871 Ga0501079_0009336 3300049741 Bacteria 7433
872 Ga0501079_0206946 3300049741 Bacteria 1533
873 Ga0501080_0001056 3300049742 Bacteria 22640
874 Ga0501080_0013393 3300049742 Bacteria 7543
875 Ga0501080_0043951 3300049742 Bacteria 4159
876 Ga0501080_0059685 3300049742 Bacteria 3549
877 Ga0501080_0074751 3300049742 Bacteria 3152
878 Ga0501080_0194526 3300049742 Bacteria 1863
879 Ga0501081_0000753 3300049743 Bacteria 18947
880 Ga0501081_0002176 3300049743 Bacteria 12311
881 Ga0501081_0005108 3300049743 Bacteria 8450
882 Ga0501083_0002444 3300049744 Bacteria 12712
883 Ga0501035_0001594 3300049822 Bacteria 22969
884 Ga0501035_0014199 3300049822 Bacteria 7351
885 Ga0501035_0108614 3300049822 Bacteria 2432
886 Ga0501044_0457884 3300049823 Unclassified 1181
887 Ga0501045_0001276 3300049824 Bacteria 16726
888 Ga0501045_0005255 3300049824 Bacteria 8957
889 Ga0501045_0038043 3300049824 Bacteria 3499
890 Ga0501045_0054993 3300049824 Bacteria 2911
891 Ga0501045_0095770 3300049824 Bacteria 2196
892 nmdc:mga03683_171769_c1 3300050489 Bacteria 985
893 nmdc:mga00v17_368682_c1 3300050491 Bacteria 934
894 nmdc:mga0yw44_181621_c1 3300050492 Bacteria 1385
895 nmdc:mga0yw44_51448_c1 3300050492 Bacteria 2494
896 nmdc:mga06z11_195294_c1 3300050494 Bacteria 1173
897 nmdc:mga05p37_1712_c1 3300050507 Bacteria 25565
898 nmdc:mga05p37_19624_c1 3300050507 Bacteria 8175
899 nmdc:mga05p37_301655_c1 3300050507 Unclassified 1903
900 nmdc:mga05p37_52672_c1 3300050507 Bacteria 5004
901 nmdc:mga05p37_606736_c1 3300050507 Bacteria 1234
902 nmdc:mga05p37_813115_c1 3300050507 Bacteria 1021
903 nmdc:mga05p37_8903_c1 3300050507 Bacteria 11860
904 nmdc:mga09592_118389_c1 3300050508 Unclassified 2273
905 nmdc:mga09592_5828_c1 3300050508 Bacteria 10047
906 nmdc:mga0qj67_291079_c1 3300050509 Bacteria 1323
907 nmdc:mga06r32_28868_c1 3300050510 Bacteria 5193
908 nmdc:mga06r32_49576_c1 3300050510 Bacteria 4015
909 nmdc:mga06r32_560576_c1 3300050510 Bacteria 1116
910 nmdc:mga06r32_66422_c1 3300050510 Bacteria 3480
911 nmdc:mga08y16_19493_c1 3300050511 Bacteria 7151
912 nmdc:mga08y16_580143_c1 3300050511 Bacteria 1132
913 nmdc:mga08y16_60613_c1 3300050511 Bacteria 3952
914 nmdc:mga08y16_786024_c1 3300050511 Bacteria 946
915 nmdc:mga0n895_12180_c1 3300050512 Bacteria 7702
916 nmdc:mga0n895_230390_c1 3300050512 Unclassified 1880
917 nmdc:mga0n895_234673_c1 3300050512 Bacteria 1862
918 nmdc:mga0n895_71764_c1 3300050512 Bacteria 3434
919 nmdc:mga0n895_88875_c1 3300050512 Bacteria 3090
920 nmdc:mga0rr50_157685_c1 3300050513 Bacteria 1840
921 nmdc:mga0rr50_201488_c1 3300050513 Bacteria 1635
922 nmdc:mga0rr50_33890_c1 3300050513 Bacteria 3652
923 nmdc:mga0rr50_372_c1 3300050513 Bacteria 24510
924 nmdc:mga0rr50_95152_c1 3300050513 Bacteria 2328
925 nmdc:mga08x19_177286_c1 3300050514 Bacteria 1454
926 nmdc:mga08x19_34795_c1 3300050514 Bacteria 3186
927 nmdc:mga08x19_45511_c1 3300050514 Bacteria 2805
928 nmdc:mga08x19_4620_c1 3300050514 Bacteria 8173
929 nmdc:mga08x19_5986_c1 3300050514 Bacteria 7191
930 nmdc:mga0a205_109138_c1 3300050515 Bacteria 2666
931 nmdc:mga0a205_15513_c1 3300050515 Bacteria 7120
932 nmdc:mga0a205_202628_c1 3300050515 Unclassified 1874
933 nmdc:mga0a205_28071_c1 3300050515 Bacteria 5378
934 nmdc:mga0a205_41740_c1 3300050515 Bacteria 4419
935 nmdc:mga0a205_503541_c1 3300050515 Unclassified 1068
936 Ga0495601_0006980 3300053077 Bacteria 6614
937 Ga0495612_0014817 3300053078 Bacteria 3128
938 Ga0495655_0107850 3300053083 Bacteria 833
939 Ga0495595_0010344 3300053084 Bacteria 3876
940 Ga0495595_0021019 3300053084 Bacteria 2847
941 Ga0495595_0030604 3300053084 Bacteria 2415
942 Ga0495619_0035292 3300053085 Bacteria 3252
943 Ga0495619_0052545 3300053085 Bacteria 2694
944 Ga0495619_0274774 3300053085 Bacteria 1167
945 Ga0501084_0000985 3300054114 Bacteria 22070
946 Ga0501084_0002974 3300054114 Bacteria 13727
947 Ga0501084_0038205 3300054114 Bacteria 4013
948 Ga0501084_0040964 3300054114 Bacteria 3875
949 Ga0501084_0076185 3300054114 Bacteria 2811
950 Ga0501082_0012784 3300060353 Bacteria 7215
951 Ga0501082_0016180 3300060353 Bacteria 6419
952 Ga0501082_0090400 3300060353 Bacteria 2643
953 Ga0501082_0121059 3300060353 Bacteria 2268
954 Ga0466962_0000096 3300061719 Bacteria 35253
955 Ga0466962_0003609 3300061719 Bacteria 7374
956 Ga0466962_0016261 3300061719 Bacteria 3588
957 Ga0530510_0002722 3300061734 Bacteria 12171
958 Ga0530510_0006950 3300061734 Bacteria 7888
959 Ga0530510_0011066 3300061734 Bacteria 6328
960 Ga0530510_0047359 3300061734 Bacteria 3106
961 Ga0530510_0172463 3300061734 Bacteria 1602
962 Ga0395898_0123418
963 JGI25407J50210_10001067
964 Ga0070658_10037764
965 Ga0070683_100037562
966 Ga0070683_100254295
967 Ga0070690_100080852
968 Ga0068869_100088418
969 Ga0070680_100020568
970 Ga0070680_100023083
971 Ga0070680_100049179
972 Ga0070680_100077430
973 Ga0070680_100296143
974 Ga0070682_100137262
975 Ga0070660_100008257
976 Ga0070660_100020167
977 Ga0070660_100045357
978 Ga0070660_100054065
979 Ga0070660_100078063
980 Ga0070660_100296139
981 Ga0070691_10031993
982 Ga0070691_10086887
983 Ga0070661_100056424
984 Ga0070692_10014373
985 Ga0070692_10018151
986 Ga0070668_100053143
987 Ga0070669_100340478
988 Ga0070671_100136151
989 Ga0070671_100164199
990 Ga0070671_100435585
991 Ga0070674_100005755
992 Ga0070674_100055508
993 Ga0070673_100109765
994 Ga0070688_100182657
995 Ga0070659_100004574
996 Ga0070659_100024028
997 Ga0070659_100037243
998 Ga0070659_100282099
999 Ga0070703_10029379
1000 Ga0070709_10006188
1001 Ga0070709_10038468
1002 Ga0070709_10068543
1003 Ga0070709_10132751
1004 Ga0070709_10327033
1005 Ga0070709_10351815
1006 Ga0070714_100004838
1007 Ga0070714_100008551
1008 Ga0070714_100026860
1009 Ga0070714_100052155
1010 Ga0070714_100061379
1011 Ga0070714_100070139
1012 Ga0070714_100083695
1013 Ga0070714_100231522
1014 Ga0070713_100001060
1015 Ga0070713_100008471
1016 Ga0070710_10003601
1017 Ga0070710_10008982
1018 Ga0070710_10105674
1019 Ga0070701_10065807
1020 Ga0070711_100009812
1021 Ga0070711_100016495
1022 Ga0070700_100156245
1023 Ga0070700_100189187
1024 Ga0070694_100047908
1025 Ga0070694_100086507
1026 Ga0070694_100408916
1027 Ga0070678_100129016
1028 Ga0070662_100032975
1029 Ga0070681_10039443
1030 Ga0070681_10071482
1031 Ga0070681_10245233
1032 Ga0068867_100022590
1033 Ga0068867_100084604
1034 Ga0070706_100058985
1035 Ga0070706_100122634
1036 Ga0070707_100051967
1037 Ga0070707_100064103
1038 Ga0070707_100421842
1039 Ga0070698_100015246
1040 Ga0070698_100016183
1041 Ga0070698_100022054
1042 Ga0070699_100082858
1043 Ga0070679_100022080
1044 Ga0070679_100033495
1045 Ga0070679_100036271
1046 Ga0070679_100052882
1047 Ga0070679_100082777
1048 Ga0070684_100020666
1049 Ga0070684_100071138
1050 Ga0070684_100126064
1051 Ga0070684_100542332
1052 Ga0070697_100158263
1053 Ga0070697_100188955
1054 Ga0068853_100325429
1055 Ga0070695_100029461
1056 Ga0070695_100140979
1057 Ga0070696_100015889
1058 Ga0070696_100061459
1059 Ga0070693_100023061
1060 Ga0070693_100248803
1061 Ga0070704_100015256
1062 Ga0070704_100017012
1063 Ga0070704_100158114
1064 Ga0070704_100162942
1065 Ga0068855_100052856
1066 Ga0068855_100061944
1067 Ga0068855_100152857
1068 Ga0068855_100208157
1069 Ga0070664_100091185
1070 Ga0068857_100038685
1071 Ga0068857_100604640
1072 Ga0068856_100083532
1073 Ga0068852_100076060
1074 Ga0068859_100488406
1075 Ga0068864_100070632
1076 Ga0068866_10125952
1077 Ga0068861_100007739
1078 Ga0068861_100094875
1079 Ga0068861_100097859
1080 Ga0068861_100184110
1081 Ga0068851_10008024
1082 Ga0068870_10097759
1083 Ga0068863_100172157
1084 Ga0068858_100432309
1085 Ga0068862_100278360
1086 Ga0081455_10004421
1087 Ga0081455_10018767
1088 Ga0081538_10000053
1089 Ga0081538_10000094
1090 Ga0081538_10000100
1091 Ga0081538_10024011
1092 Ga0081538_10034170
1093 Ga0081538_10082099
1094 Ga0081540_1017275
1095 Ga0070717_10005467
1096 Ga0070717_10007849
1097 Ga0070717_10034859
1098 Ga0070717_10205975
1099 Ga0070717_10363118
1100 Ga0075365_10210969
1101 Ga0075364_10254025
1102 Ga0075432_10008519
1103 Ga0070715_10011394
1104 Ga0070715_10038124
1105 Ga0070716_100001457
1106 Ga0070716_100008190
1107 Ga0070716_100143012
1108 Ga0070712_100211865
1109 Ga0075367_10225184
1110 Ga0097621_100281031
1111 Ga0075428_100002460
1112 Ga0075428_100005053
1113 Ga0075428_100012212
1114 Ga0075428_100379218
1115 Ga0075431_100002910
1116 Ga0075431_100033329
1117 Ga0075431_100070213
1118 Ga0075431_100134492
1119 Ga0075431_100363473
1120 Ga0075433_10002265
1121 Ga0075433_10024118
1122 Ga0075433_10071464
1123 Ga0075433_10086955
1124 Ga0075433_10113133
1125 Ga0075434_100001294
1126 Ga0075434_100003374
1127 Ga0075434_100009463
1128 Ga0075434_100033764
1129 Ga0075434_100145869
1130 Ga0075429_100008378
1131 Ga0068865_100018192
1132 Ga0075436_100000915
1133 Ga0075436_100006395
1134 Ga0075436_100008390
1135 Ga0075436_100020398
1136 Ga0075436_100272928
1137 Ga0097620_100488357
1138 Ga0075435_100001243
1139 Ga0075435_100028080
1140 Ga0075435_100103033
1141 Ga0075435_100120794
1142 Ga0075435_100331419
1143 Ga0105240_10040117
1144 Ga0105240_10073540
1145 Ga0105240_10119265
1146 Ga0105240_10251425
1147 Ga0111539_10003095
1148 Ga0111539_10035714
1149 Ga0105245_10006126
1150 Ga0105245_10047671
1151 Ga0105245_10186618
1152 Ga0105245_10684038
1153 Ga0114129_10000141
1154 Ga0114129_10003813
1155 Ga0114129_10142466
1156 Ga0114129_10788334
1157 Ga0105243_10100630
1158 Ga0105243_10129849
1159 Ga0105243_10136046
1160 Ga0105243_10143766
1161 Ga0105242_10024082
1162 Ga0105242_10066229
1163 Ga0105242_10121783
1164 Ga0105242_10258774
1165 Ga0105248_10212958
1166 Ga0105248_10593259
1167 Ga0105238_10053645
1168 Ga0105249_10009086
1169 Ga0105249_10026677
1170 Ga0105239_10095749
1171 Ga0105246_10338207
1172 Ga0157371_10116002
1173 Ga0157370_10033132
1174 Ga0157370_10068805
1175 Ga0157369_10089572
1176 Ga0157374_10008652
1177 Ga0157378_10396830
1178 Ga0163162_10316400
1179 Ga0157372_10100565
1180 Ga0157372_10284795
1181 Ga0157375_10578672
1182 Ga0157375_10785346
1183 Ga0163163_10128882
1184 Ga0157380_10005200
1185 Ga0157380_10060201
1186 Ga0182008_10009436
1187 Ga0157377_10018073
1188 Ga0157379_10107811
1189 Ga0157376_10159817
1190 Ga0157376_10320910
1191 Ga0182007_10012200
1192 Ga0163161_10008822
1193 Ga0163161_10229610
1194 Ga0197907_10972893
1195 Ga0206356_10739625
1196 Ga0206354_10143858
1197 Ga0206354_10579909
1198 Ga0206353_10543908
1199 Ga0206353_11152913
1200 Ga0206353_11689011
1201 Ga0213875_10139329
1202 Ga0213871_10002981
1203 Ga0207656_10004008
1204 Ga0207653_10004251
1205 Ga0207692_10012508
1206 Ga0207692_10017163
1207 Ga0207688_10005694
1208 Ga0207685_10008146
1209 Ga0207685_10057699
1210 Ga0207699_10002004
1211 Ga0207699_10039861
1212 Ga0207699_10179391
1213 Ga0207643_10206819
1214 Ga0207705_10044675
1215 Ga0207705_10144245
1216 Ga0207705_10219367
1217 Ga0207684_10118109
1218 Ga0207707_10008396
1219 Ga0207707_10040872
1220 Ga0207695_10085325
1221 Ga0207695_10230599
1222 Ga0207693_10000282
1223 Ga0207693_10007638
1224 Ga0207693_10035896
1225 Ga0207663_10044668
1226 Ga0207663_10118368
1227 Ga0207660_10178611
1228 Ga0207660_10263106
1229 Ga0207660_10268093
1230 Ga0207657_10000988
1231 Ga0207657_10033885
1232 Ga0207657_10077510
1233 Ga0207657_10080178
1234 Ga0207657_10201020
1235 Ga0207657_10350582
1236 Ga0207652_10087226
1237 Ga0207646_10001768
1238 Ga0207646_10120866
1239 Ga0207646_10148490
1240 Ga0207646_10355995
1241 Ga0207646_10491985
1242 Ga0207681_10278020
1243 Ga0207687_10015169
1244 Ga0207700_10000039
1245 Ga0207700_10015530
1246 Ga0207700_10069117
1247 Ga0207664_10012931
1248 Ga0207664_10032025
1249 Ga0207664_10047082
1250 Ga0207664_10063827
1251 Ga0207664_10100754
1252 Ga0207664_10111667
1253 Ga0207664_10132587
1254 Ga0207644_10123627
1255 Ga0207690_10012589
1256 Ga0207690_10039559
1257 Ga0207690_10177336
1258 Ga0207706_10010201
1259 Ga0207706_10041071
1260 Ga0207686_10010201
1261 Ga0207686_10230059
1262 Ga0207709_10094126
1263 Ga0207709_10242955
1264 Ga0207669_10231393
1265 Ga0207704_10218237
1266 Ga0207704_10313786
1267 Ga0207665_10004972
1268 Ga0207665_10027771
1269 Ga0207711_10143958
1270 Ga0207689_10082630
1271 Ga0207661_10062637
1272 Ga0207661_10090489
1273 Ga0207661_10116265
1274 Ga0207661_10318684
1275 Ga0207679_10069445
1276 Ga0207679_10220337
1277 Ga0207667_10101806
1278 Ga0207667_10138760
1279 Ga0207667_10159659
1280 Ga0207651_10528870
1281 Ga0207668_10062865
1282 Ga0207658_10002326
1283 Ga0207677_10183427
1284 Ga0207678_10296639
1285 Ga0207708_10000684
1286 Ga0207708_10040507
1287 Ga0207702_10100980
1288 Ga0207702_10381501
1289 Ga0207702_10602393
1290 Ga0207641_10153622
1291 Ga0207641_10532558
1292 Ga0207648_10011247
1293 Ga0207648_10352013
1294 Ga0207648_10443595
1295 Ga0207676_10240663
1296 Ga0207675_100000929
1297 Ga0207675_100336280
1298 Ga0207683_10034207
1299 Ga0207683_10037498
1300 Ga0207683_10063512
1301 Ga0207683_10219356
1302 Ga0207698_10767550
1303 Ga0207428_10000108
1304 Ga0207428_10099829
1305 Ga0207428_10321501
1306 Ga0265319_1000635
1307 Ga0265334_10002590
1308 Ga0265318_10003761
1309 Ga0265322_10001612
1310 Ga0265322_10032636
1311 Ga0265338_10005641
1312 Ga0265338_10007196
1313 Ga0265338_10075508
1314 Ga0265338_10144941
1315 Ga0265324_10022996
1316 Ga0265324_10033318
1317 Ga0265330_10000327
1318 Ga0265330_10046743
1319 Ga0265332_10003969
1320 Ga0265332_10116072
1321 Ga0265320_10092767
1322 Ga0265329_10025187
1323 Ga0265340_10002177
1324 Ga0265331_10004733
1325 Ga0265327_10017812
1326 Ga0265316_10020939
1327 Ga0265316_10159049
1328 Ga0307408_100118146
1329 Ga0265313_10005397
1330 Ga0265314_10002591
1331 Ga0265342_10011070
1332 Ga0265342_10130077
1333 Ga0307406_10009746
1334 Ga0307409_100187828
1335 Ga0307416_100019684
1336 Ga0307416_100212948
1337 Ga0307411_10410369
1338 Ga0307415_100021919
1339 Ga0307415_100050027
1340 Ga0316583_10021232
1341 Ga0373948_0012084
1342 Ga0373928_0015661
1343 Ga0373940_0004842
1344 Ga0373940_0019686
1345 Ga0373949_0005830
1346 Ga0373952_0002137
1347 Ga0373932_0075588
1348 Ga0373960_0029407
1349 Ga0373943_0000198
1350 Ga0373943_0072902
1351 Ga0373961_0008795
1352 Ga0373962_0005248
1353 Ga0373931_0097985
1354 Ga0373935_0109936
1355 Ga0373935_0494438
1356 Ga0373933_0172015
1357 Ga0373933_0186160
1358 Ga0373947_0000463
1359 Ga0373937_0109487
1360 Ga0373925_0024512
1361 Ga0395899_0000862
1362 Ga0395899_0002568
1363 Ga0395899_0005918
1364 Ga0395899_0008133
1365 Ga0395899_0009554
1366 Ga0395899_0037927
1367 Ga0395899_0082410
1368 Ga0395899_0085266
1369 Ga0395899_0182321
1370 Ga0395900_0001219
1371 Ga0395900_0001266
1372 Ga0395900_0001485
1373 Ga0395900_0004452
1374 Ga0395900_0005059
1375 Ga0395900_0009112
1376 Ga0395900_0019826
1377 Ga0395900_0024066
1378 Ga0395900_0046723
1379 Ga0395900_0068678
1380 Ga0395900_0068882
1381 Ga0395900_0166180
1382 Ga0395900_0171588
1383 Ga0395900_0188797
1384 Ga0395900_0351242
1385 Ga0395900_0497844
1386 Ga0395898_0012615
1387 Ga0395898_0015047
1388 Ga0395898_0016535
1389 Ga0395898_0020108
1390 Ga0395898_0022431
1391 Ga0395898_0027937
1392 Ga0395898_0036950
1393 Ga0395898_0040672
1394 Ga0395898_0041721
1395 Ga0395898_0054574
1396 Ga0395898_0068165
1397 Ga0395898_0071572
1398 Ga0395898_0085312
1399 Ga0395898_0180539
1400 Ga0395898_0220145
1401 Ga0395898_0270203
1402 Ga0395898_0489806
1403 Ga0395905_0000640
1404 Ga0395905_0001564
1405 Ga0395905_0007797
1406 Ga0395905_0008242
1407 Ga0395905_0020747
1408 Ga0395905_0063663
1409 Ga0395905_0066894
1410 Ga0395905_0093548
1411 Ga0395905_0093695
1412 Ga0395905_0160799
1413 Ga0395905_0299866
1414 Ga0395905_0500768
1415 Ga0436364_0533197
1416 Ga0395901_0000978
1417 Ga0395901_0001883
1418 Ga0395901_0002270
1419 Ga0395901_0002692
1420 Ga0395901_0011802
1421 Ga0395901_0015905
1422 Ga0395901_0016559
1423 Ga0395901_0032992
1424 Ga0395901_0035193
1425 Ga0395901_0057609
1426 Ga0395901_0114956
1427 Ga0395901_0138285
1428 Ga0395901_0143583
1429 Ga0395901_0257143
1430 Ga0395901_0341483
1431 Ga0395901_0449267
1432 Ga0436360_1292831
1433 Ga0436363_1287539
1434 Ga0439439_0044680
1435 Ga0439461_0012809
1436 Ga0451793_0979246
1437 Ga0451853_3576152
1438 Ga0451853_3629479
1439 Ga0439448_0012082
1440 Ga0439455_0016834
1441 Ga0439456_031407
1442 Ga0439446_0005591
1443 Ga0466969_0003306
1444 Ga0466969_0013131
1445 Ga0466969_0085238
1446 Ga0466972_0029041
1447 Ga0466972_0070793
1448 Ga0466965_0013693
1449 Ga0466965_0049114
1450 Ga0466965_0230224
1451 Ga0466966_0004938
1452 Ga0466966_0008431
1453 Ga0466966_0063700
1454 Ga0466966_0202162
1455 Ga0466961_0011545
1456 Ga0466961_0026593
1457 Ga0466961_0033324
1458 Ga0466961_0049106
1459 Ga0466961_0148650
1460 Ga0466963_0000095
1461 Ga0466963_0004541
1462 Ga0466963_0004612
1463 Ga0466963_0005966
1464 Ga0466963_0015015
1465 Ga0466963_0017054
1466 Ga0466963_0017204
1467 Ga0466963_0019732
1468 Ga0466963_0021258
1469 Ga0466963_0029166
1470 Ga0466963_0030131
1471 Ga0466963_0052948
1472 Ga0466963_0116124
1473 Ga0466963_0202221
1474 Ga0466963_0246167
1475 Ga0466963_0255268
1476 Ga0466963_0346179
1477 Ga0466964_0000465
1478 Ga0466964_0007441
1479 Ga0466964_0008767
1480 Ga0466964_0024459
1481 Ga0466964_0167302
1482 Ga0466971_0001664
1483 Ga0466971_0016536
1484 Ga0466971_0053198
1485 Ga0466971_0066685
1486 Ga0466971_0091631
1487 Ga0466968_0002238
1488 Ga0466968_0006803
1489 Ga0466968_0025288
1490 Ga0466968_0031074
1491 Ga0466968_0039968
1492 Ga0466968_0080358
1493 Ga0466968_0083542
1494 Ga0466970_0004679
1495 Ga0466970_0177079
1496 Ga0466957_0001672
1497 Ga0466957_0004210
1498 Ga0466957_0015443
1499 Ga0466957_0020943
1500 Ga0466957_0025135
1501 Ga0466957_0066648
1502 Ga0466957_0070018
1503 Ga0466957_0072128
1504 Ga0466957_0073883
1505 Ga0466957_0151095
1506 Ga0466960_0001521
1507 Ga0466960_0124262
1508 Ga0466959_0002457
1509 Ga0466959_0005583
1510 Ga0466959_0011442
1511 Ga0466959_0026369
1512 Ga0466959_0109105
1513 Ga0466959_0254129
1514 Ga0466959_0417316
1515 Ga0451576_0408613
1516 Ga0466958_0001908
1517 Ga0466958_0002667
1518 Ga0466958_0009659
1519 Ga0466958_0011393
1520 Ga0466958_0029313
1521 Ga0466958_0089370
1522 Ga0466958_0090580
1523 Ga0466958_0117544
1524 Ga0466958_0229725
1525 Ga0466958_0258213
1526 Ga0466958_0263946
1527 Ga0466967_0000676
1528 Ga0466967_0003281
1529 Ga0466967_0004469
1530 Ga0466967_0010011
1531 Ga0466967_0011240
1532 Ga0466967_0012377
1533 Ga0466967_0019227
1534 Ga0466967_0030709
1535 Ga0466967_0040726
1536 Ga0466967_0051313
1537 Ga0466967_0058374
1538 Ga0466967_0065864
1539 Ga0466967_0068035
1540 Ga0466967_0097862
1541 Ga0466967_0112673
1542 Ga0466967_0169802
1543 Ga0466967_0177756
1544 Ga0466967_0195313
1545 Ga0466967_0204631
1546 Ga0466967_0547148
1547 Ga0466967_0607901
1548 Ga0495627_076578
1549 Ga0495592_0042691
1550 Ga0495592_0090270
1551 Ga0495592_0175584
1552 Ga0495603_0000081
1553 Ga0495603_0165798
1554 Ga0495629_0079661
1555 Ga0495629_0141270
1556 Ga0495629_0353297
1557 Ga0495641_0002133
1558 Ga0495641_0010605
1559 Ga0495651_0209544
1560 Ga0495651_0235532
1561 Ga0495653_0051290
1562 Ga0495653_0139181
1563 Ga0495582_0027562
1564 Ga0495582_0252168
1565 Ga0495662_0052778
1566 Ga0495662_0141439
1567 Ga0495584_0014513
1568 Ga0495584_0092599
1569 Ga0495584_0224471
1570 Ga0495585_0077077
1571 Ga0495594_0000536
1572 Ga0495596_0061758
1573 Ga0495596_0061914
1574 Ga0495607_0070757
1575 Ga0495608_0006235
1576 Ga0495608_0106447
1577 Ga0495608_0426257
1578 Ga0495630_0017298
1579 Ga0495630_0130037
1580 Ga0495631_0114062
1581 Ga0495637_0128200
1582 Ga0495644_0008464
1583 Ga0495663_0015710
1584 Ga0495666_0019555
1585 Ga0495666_0134563
1586 Ga0495652_0120759
1587 Ga0495586_0120846
1588 Ga0495587_0011260
1589 Ga0495609_0034225
1590 Ga0495667_0025384
1591 Ga0495667_0058443
1592 Ga0495667_0059886
1593 Ga0495667_0143913
1594 Ga0495656_0069126
1595 Ga0495656_0120245
1596 Ga0495656_0206021
1597 Ga0495634_0064947
1598 Ga0495634_0202561
1599 Ga0495635_0131522
1600 Ga0495659_0065526
1601 Ga0495659_0137573
1602 Ga0495588_0002678
1603 Ga0495588_0128966
1604 Ga0495657_0073386
1605 Ga0495657_0083062
1606 Ga0495599_0050417
1607 Ga0495599_0071124
1608 Ga0495646_0034028
1609 Ga0495646_0073986
1610 Ga0495646_0125367
1611 Ga0495647_0023856
1612 Ga0495613_0025650
1613 Ga0495613_0047146
1614 Ga0495624_0210753
1615 Ga0495670_0065767
1616 Ga0495600_0014203
1617 Ga0495581_0034383
1618 Ga0495581_0071126
1619 Ga0495604_0058379
1620 Ga0495604_0219087
1621 Ga0495674_0039772
1622 Ga0495674_0082453
1623 Ga0495676_0002817
1624 Ga0495676_0204108
1625 Ga0495680_0071197
1626 Ga0495680_0120624
1627 Ga0495680_0124632
1628 Ga0495680_0143697
1629 Ga0495675_0093888
1630 Ga0495684_0029449
1631 Ga0495684_0035091
1632 Ga0495684_0350490
1633 Ga0495602_0244232
1634 Ga0496100_0012806
1635 Ga0496100_0013565
1636 Ga0496100_0128670
1637 Ga0496101_0014642
1638 Ga0496101_0048493
1639 Ga0496101_0163765
1640 Ga0496101_0212930
1641 Ga0496101_0213762
1642 Ga0496101_0340692
1643 Ga0496101_0348559
1644 Ga0496102_0016639
1645 Ga0496102_0017600
1646 Ga0496102_0048059
1647 Ga0496102_0095778
1648 Ga0496102_0422367
1649 Ga0496103_0010103
1650 Ga0496103_0015355
1651 Ga0496103_0015863
1652 Ga0496104_0000865
1653 Ga0496104_0010631
1654 Ga0496104_0016341
1655 Ga0496104_0068058
1656 Ga0496104_0235398
1657 Ga0496104_0789962
1658 Ga0496105_0000775
1659 Ga0496105_0004904
1660 Ga0496105_0045676
1661 Ga0496105_0063287
1662 Ga0496105_0092357
1663 Ga0496105_0191008
1664 Ga0496105_0216472
1665 Ga0496105_0296402
1666 Ga0496106_0014470
1667 Ga0496106_0058137
1668 Ga0496106_0083654
1669 Ga0496106_0141628
1670 Ga0496106_0204146
1671 Ga0496106_0362770
1672 Ga0496107_0000242
1673 Ga0496107_0006234
1674 Ga0496107_0021016
1675 Ga0496107_0041282
1676 Ga0496107_0056304
1677 Ga0496107_0307858
1678 Ga0496107_0367837
1679 Ga0496107_0369887
1680 Ga0496108_0003137
1681 Ga0496108_0005018
1682 Ga0496108_0010715
1683 Ga0496108_0022146
1684 Ga0496108_0023428
1685 Ga0496108_0033698
1686 Ga0496108_0043433
1687 Ga0496108_0196792
1688 Ga0496109_0001239
1689 Ga0496109_0008195
1690 Ga0496109_0018833
1691 Ga0496109_0041159
1692 Ga0496109_0041213
1693 Ga0496109_0062927
1694 Ga0496109_0081032
1695 Ga0496109_0233179
1696 Ga0496109_0247179
1697 Ga0496109_0304410
1698 Ga0496109_0601108
1699 Ga0496109_0618613
1700 Ga0496110_0011919
1701 Ga0496110_0029730
1702 Ga0496110_0046702
1703 Ga0496110_0048083
1704 Ga0496110_0065457
1705 Ga0496110_0149564
1706 Ga0496111_0003372
1707 Ga0496111_0024846
1708 Ga0496111_0116049
1709 Ga0496111_0116295
1710 Ga0496111_0329855
1711 Ga0496112_0003845
1712 Ga0496112_0019694
1713 Ga0496112_0093391
1714 Ga0496112_0099657
1715 Ga0496112_0116912
1716 Ga0496112_0314375
1717 Ga0496112_0578012
1718 Ga0496113_0001165
1719 Ga0496113_0001530
1720 Ga0496113_0026871
1721 Ga0496113_0069827
1722 Ga0496113_0085219
1723 Ga0496113_0299372
1724 Ga0496114_0003362
1725 Ga0496114_0015427
1726 Ga0496114_0024732
1727 Ga0496114_0026950
1728 Ga0496114_0044143
1729 Ga0496114_0178809
1730 Ga0496114_0256222
1731 Ga0496114_0279677
1732 Ga0496115_0005818
1733 Ga0496115_0034066
1734 Ga0496115_0054854
1735 Ga0496115_0226685
1736 Ga0496115_0530921
1737 Ga0501031_0003333
1738 Ga0501031_0021919
1739 Ga0501032_0001554
1740 Ga0501033_0000899
1741 Ga0501033_0112125
1742 Ga0501033_0160533
1743 Ga0501034_0072921
1744 Ga0501036_0005487
1745 Ga0501036_0044330
1746 Ga0501036_0053302
1747 Ga0501037_0007386
1748 Ga0501037_0122124
1749 Ga0501038_0003802
1750 Ga0501038_0040949
1751 Ga0501039_0003976
1752 Ga0501039_0009033
1753 Ga0501040_0001387
1754 Ga0501040_0002266
1755 Ga0501040_0005466
1756 Ga0501040_0141222
1757 Ga0501041_0000474
1758 Ga0501041_0000895
1759 Ga0501042_0000930
1760 Ga0501042_0068233
1761 Ga0501043_0000693
1762 Ga0501043_0086178
1763 Ga0501043_0240756
1764 Ga0501046_0001855
1765 Ga0501046_0040284
1766 Ga0501046_0328908
1767 Ga0501047_0037685
1768 Ga0501047_0061174
1769 Ga0501047_0150034
1770 Ga0501047_0231175
1771 Ga0501048_0000867
1772 Ga0501048_0008074
1773 Ga0501048_0031868
1774 Ga0501067_0020755
1775 Ga0501067_0023040
1776 Ga0501067_0031144
1777 Ga0501067_0046875
1778 Ga0501067_0121005
1779 Ga0501067_0137929
1780 Ga0501067_0139502
1781 Ga0501067_0202908
1782 Ga0501068_0001514
1783 Ga0501068_0003100
1784 Ga0501068_0015027
1785 Ga0501068_0145475
1786 Ga0501069_0000605
1787 Ga0501069_0012648
1788 Ga0501069_0030644
1789 Ga0501069_0069892
1790 Ga0501070_0001149
1791 Ga0501070_0024878
1792 Ga0501070_0042253
1793 Ga0501070_0075545
1794 Ga0501070_0333152
1795 Ga0501070_0333798
1796 Ga0501071_0000330
1797 Ga0501071_0000677
1798 Ga0501071_0030359
1799 Ga0501072_0001627
1800 Ga0501072_0003411
1801 Ga0501072_0006557
1802 Ga0501072_0007942
1803 Ga0501072_0016896
1804 Ga0501072_0023091
1805 Ga0501072_0131910
1806 Ga0501073_0003204
1807 Ga0501073_0029285
1808 Ga0501073_0031588
1809 Ga0501073_0063173
1810 Ga0501073_0269778
1811 Ga0501074_0022586
1812 Ga0501074_0030757
1813 Ga0501074_0045687
1814 Ga0501074_0153769
1815 Ga0501075_0001209
1816 Ga0501075_0017103
1817 Ga0501075_0044640
1818 Ga0501075_0108908
1819 Ga0501075_0267954
1820 Ga0501075_0332283
1821 Ga0501076_0004029
1822 Ga0501076_0006243
1823 Ga0501076_0011459
1824 Ga0501076_0035541
1825 Ga0501076_0185501
1826 Ga0501076_0219026
1827 Ga0501077_0000576
1828 Ga0501077_0008185
1829 Ga0501077_0098818
1830 Ga0501077_0103972
1831 Ga0501079_0001513
1832 Ga0501079_0009336
1833 Ga0501079_0206946
1834 Ga0501080_0001056
1835 Ga0501080_0013393
1836 Ga0501080_0043951
1837 Ga0501080_0059685
1838 Ga0501080_0074751
1839 Ga0501080_0194526
1840 Ga0501081_0000753
1841 Ga0501081_0002176
1842 Ga0501081_0005108
1843 Ga0501083_0002444
1844 Ga0501035_0001594
1845 Ga0501035_0014199
1846 Ga0501035_0108614
1847 Ga0501044_0457884
1848 Ga0501045_0001276
1849 Ga0501045_0005255
1850 Ga0501045_0038043
1851 Ga0501045_0054993
1852 Ga0501045_0095770
1853 nmdc:mga03683_171769_c1
1854 nmdc:mga00v17_368682_c1
1855 nmdc:mga0yw44_181621_c1
1856 nmdc:mga0yw44_51448_c1
1857 nmdc:mga06z11_195294_c1
1858 nmdc:mga05p37_1712_c1
1859 nmdc:mga05p37_19624_c1
1860 nmdc:mga05p37_301655_c1
1861 nmdc:mga05p37_52672_c1
1862 nmdc:mga05p37_606736_c1
1863 nmdc:mga05p37_813115_c1
1864 nmdc:mga05p37_8903_c1
1865 nmdc:mga09592_118389_c1
1866 nmdc:mga09592_5828_c1
1867 nmdc:mga0qj67_291079_c1
1868 nmdc:mga06r32_28868_c1
1869 nmdc:mga06r32_49576_c1
1870 nmdc:mga06r32_560576_c1
1871 nmdc:mga06r32_66422_c1
1872 nmdc:mga08y16_19493_c1
1873 nmdc:mga08y16_580143_c1
1874 nmdc:mga08y16_60613_c1
1875 nmdc:mga08y16_786024_c1
1876 nmdc:mga0n895_12180_c1
1877 nmdc:mga0n895_230390_c1
1878 nmdc:mga0n895_234673_c1
1879 nmdc:mga0n895_71764_c1
1880 nmdc:mga0n895_88875_c1
1881 nmdc:mga0rr50_157685_c1
1882 nmdc:mga0rr50_201488_c1
1883 nmdc:mga0rr50_33890_c1
1884 nmdc:mga0rr50_372_c1
1885 nmdc:mga0rr50_95152_c1
1886 nmdc:mga08x19_177286_c1
1887 nmdc:mga08x19_34795_c1
1888 nmdc:mga08x19_45511_c1
1889 nmdc:mga08x19_4620_c1
1890 nmdc:mga08x19_5986_c1
1891 nmdc:mga0a205_109138_c1
1892 nmdc:mga0a205_15513_c1
1893 nmdc:mga0a205_202628_c1
1894 nmdc:mga0a205_28071_c1
1895 nmdc:mga0a205_41740_c1
1896 nmdc:mga0a205_503541_c1
1897 Ga0495601_0006980
1898 Ga0495612_0014817
1899 Ga0495655_0107850
1900 Ga0495595_0010344
1901 Ga0495595_0021019
1902 Ga0495595_0030604
1903 Ga0495619_0035292
1904 Ga0495619_0052545
1905 Ga0495619_0274774
1906 Ga0501084_0000985
1907 Ga0501084_0002974
1908 Ga0501084_0038205
1909 Ga0501084_0040964
1910 Ga0501084_0076185
1911 Ga0501082_0012784
1912 Ga0501082_0016180
1913 Ga0501082_0090400
1914 Ga0501082_0121059
1915 Ga0466962_0000096
1916 Ga0466962_0003609
1917 Ga0466962_0016261
1918 Ga0530510_0002722
1919 Ga0530510_0006950
1920 Ga0530510_0011066
1921 Ga0530510_0047359
1922 Ga0530510_0172463

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

3

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m6r-assembly1.cif.gz_A human porphobilinogen deaminase in complex with reaction intermediate 0.8229 1 241
8pnd-assembly1.cif.gz_A the es3 intermediate of hydroxymethylbilane synthase r167q variant 0.7882 2 241
5m7f-assembly2.cif.gz_B human porphobilinogen deaminase in complex with dpm cofactor 0.7819 1 241
7ccx-assembly2.cif.gz_C crystal structure of the holo form of human hydroxymethylbilane synthase 0.7784 1 241
5m7f-assembly1.cif.gz_A human porphobilinogen deaminase in complex with dpm cofactor 0.7779 1 241
ID Description Score Start End Superfamily
4htgA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9077 94 183 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9021 94 187 3.40.190.10
5ov6A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8576 1 91 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8434 94 187 3.40.190.10
1ah5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8092 2 91 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A538MB32-F1-model_v4 hydroxymethylbilane synthase (EC 2.5.1.61) 0.8796 82 256 GO:0004418
GO:0005737
GO:0006783
AF-A0A377TL07-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.8658 91 203 GO:0004418
GO:0005737
GO:0006782
AF-A0A447SA06-F1-model_v4 deleted 0.8608 57 186
AF-A0A498ESC5-F1-model_v4 deleted 0.8594 57 197
AF-A0A353PDS2-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.8592 75 203 GO:0004418
GO:0005737
GO:0006782

Map