F486857

General Info

Members Datasets Scaffolds Average Seq Length
961 355 907 161

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10010694|Ga0075364_100106944
Length 162
Sequence MRRSLFPAPLLSAALFVLWLLLSESLAAGQLLLGAVIAIAAPWLSAPLRPVPVRVRRPWVALRLFARVVQDVVVSNVEVAWRIVARRAEPRAAFVAVPLELRDPNALAALAIITTITPGTAWSELALDRSVLLLHVFDVEDEPAFIADFKARYEEPLREIFE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231019 Pseudomonas sp. GM67 Isolate Nodule
7 2511231021 Pseudomonas sp. GM78 Isolate Nodule
8 2511231022 Pseudomonas sp. GM79 Isolate Nodule
9 2511231023 Pseudomonas sp. GM80 Isolate Nodule
10 2547132374 Acidovorax radicis N35 Isolate Unclassified
11 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
12 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
13 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
14 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
15 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
16 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
17 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
18 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
19 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
20 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
21 2643221717 Acidovorax sp. Root267 Isolate Unclassified
22 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
23 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
24 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
25 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
26 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
27 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
28 2773857673 Pseudomonas sp. 443 Isolate Unclassified
29 2784132063 Pseudomonas sp. 424 Isolate Unclassified
30 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
31 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
32 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
33 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
34 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
35 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
36 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
37 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
38 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
39 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
40 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
41 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
42 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
43 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
44 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
45 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
46 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
47 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
48 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
49 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
50 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
51 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
52 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
53 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
54 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
192 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
212 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
215 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
216 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
217 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
218 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
219 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
220 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
221 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
222 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
226 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
348 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
349 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
352 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
353 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
354 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
355 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 0
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0.94
Rhizoplane 3.02
Rhizosphere 83.04
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_11 2124908027 Bacteria 54720
2 SwRhRL2b_contig_2158200 2162886007 Bacteria 2084
3 Ga0055538_1000072 3300003751 Bacteria 91545
4 Ga0055539_1000107 3300003752 Bacteria 91545
5 Ga0055533_1000116 3300003756 Bacteria 91545
6 Ga0055532_1000103 3300003758 Bacteria 91541
7 Ga0055525_1000160 3300003759 Bacteria 87810
8 Ga0055530_10003531 3300003791 Bacteria 8820
9 Ga0055530_10004968 3300003791 Bacteria 6577
10 Ga0055540_1000025 3300003792 Bacteria 197801
11 Ga0055531_10000908 3300003794 Bacteria 24082
12 Ga0055541_1000073 3300003841 Bacteria 91545
13 Ga0065714_10081418 3300005288 Bacteria 2376
14 Ga0065714_10115291 3300005288 Bacteria 1415
15 Ga0065714_10281302 3300005288 Bacteria 716
16 Ga0065704_10071148 3300005289 Bacteria 12850
17 Ga0065704_10191821 3300005289 Bacteria 1186
18 Ga0065712_10068170 3300005290 Bacteria 13533
19 Ga0070670_100587528 3300005331 Unclassified 996
20 Ga0070661_100000036 3300005344 Bacteria 108531
21 Ga0070669_100426162 3300005353 Bacteria 1090
22 Ga0070675_100572588 3300005354 Unclassified 1023
23 Ga0070671_100000637 3300005355 Bacteria 25074
24 Ga0070673_100339593 3300005364 Bacteria 1331
25 Ga0070667_100060190 3300005367 Bacteria 3213
26 Ga0070678_100121698 3300005456 Bacteria 2059
27 Ga0070662_100468413 3300005457 Bacteria 1048
28 Ga0070662_101179763 3300005457 Unclassified 658
29 Ga0070679_100021582 3300005530 Bacteria 6288
30 Ga0070672_100499828 3300005543 Bacteria 1052
31 Ga0070665_100046745 3300005548 Bacteria 4346
32 Ga0070664_100000196 3300005564 Bacteria 42862
33 Ga0070664_100049387 3300005564 Bacteria 3558
34 Ga0068857_100048691 3300005577 Bacteria 3762
35 Ga0068856_100057620 3300005614 Bacteria 3836
36 Ga0068864_100002319 3300005618 Bacteria 15745
37 Ga0068864_100010339 3300005618 Bacteria 7707
38 Ga0068851_10061353 3300005834 Bacteria 1927
39 Ga0068870_10455556 3300005840 Bacteria 844
40 Ga0068863_100114679 3300005841 Bacteria 2567
41 Ga0068863_100130895 3300005841 Bacteria 2396
42 Ga0068863_101686091 3300005841 Unclassified 643
43 Ga0068858_100615286 3300005842 Bacteria 1054
44 Ga0075364_10010694 3300006051 Bacteria 5550
45 Ga0075364_10116734 3300006051 Bacteria 1784
46 Ga0075432_10000641 3300006058 Bacteria 10704
47 Ga0075432_10002583 3300006058 Bacteria 6043
48 Ga0075432_10048254 3300006058 Bacteria 1498
49 Ga0075369_10033998 3300006186 Bacteria 2162
50 Ga0075366_10008074 3300006195 Bacteria 5834
51 Ga0075366_10357139 3300006195 Bacteria 897
52 Ga0097621_100001820 3300006237 Bacteria 14645
53 Ga0097621_100275102 3300006237 Bacteria 1481
54 Ga0075370_10517856 3300006353 Bacteria 720
55 Ga0068871_100001548 3300006358 Bacteria 15436
56 Ga0068865_100284987 3300006881 Bacteria 1317
57 Ga0079104_1005372 3300006946 Bacteria 5138
58 Ga0105251_10000215 3300009011 Bacteria 58675
59 Ga0105251_10004389 3300009011 Bacteria 9612
60 Ga0105251_10008785 3300009011 Bacteria 6057
61 Ga0105251_10095965 3300009011 Bacteria 1359
62 Ga0105251_10161519 3300009011 Bacteria 1010
63 Ga0105251_10252590 3300009011 Bacteria 795
64 Ga0105244_10001409 3300009036 Bacteria 19467
65 Ga0105244_10004151 3300009036 Bacteria 10089
66 Ga0105244_10006184 3300009036 Bacteria 7809
67 Ga0105244_10015485 3300009036 Bacteria 4372
68 Ga0105244_10024227 3300009036 Bacteria 3314
69 Ga0105244_10038525 3300009036 Bacteria 2493
70 Ga0105250_10000220 3300009092 Bacteria 47586
71 Ga0105250_10000779 3300009092 Bacteria 19273
72 Ga0105250_10028423 3300009092 Bacteria 2252
73 Ga0105250_10055243 3300009092 Bacteria 1593
74 Ga0105250_10069872 3300009092 Bacteria 1418
75 Ga0105250_10137324 3300009092 Bacteria 1012
76 Ga0105250_10190343 3300009092 Bacteria 863
77 Ga0105243_10003857 3300009148 Bacteria 11975
78 Ga0105242_10002467 3300009176 Bacteria 14516
79 Ga0105242_10007649 3300009176 Bacteria 8316
80 Ga0105242_10088625 3300009176 Bacteria 2600
81 Ga0105242_10805057 3300009176 Bacteria 930
82 Ga0105248_10000754 3300009177 Bacteria 36253
83 Ga0105237_10002958 3300009545 Bacteria 20557
84 Ga0105238_10116250 3300009551 Bacteria 2654
85 Ga0105246_10000047 3300011119 Bacteria 47128
86 Ga0105246_10044852 3300011119 Bacteria 3007
87 Ga0157345_1000005 3300012498 Bacteria 78097
88 Ga0157373_10003922 3300013100 Bacteria 11230
89 Ga0157373_10008225 3300013100 Bacteria 7755
90 Ga0157373_10045419 3300013100 Bacteria 3135
91 Ga0157373_10147272 3300013100 Bacteria 1656
92 Ga0157371_10000495 3300013102 Bacteria 47755
93 Ga0157371_10001153 3300013102 Bacteria 28454
94 Ga0157371_10012726 3300013102 Bacteria 6414
95 Ga0157371_10666519 3300013102 Bacteria 777
96 Ga0157370_10021932 3300013104 Bacteria 6360
97 Ga0157370_10024292 3300013104 Bacteria 6003
98 Ga0157370_10039597 3300013104 Bacteria 4555
99 Ga0157370_10355208 3300013104 Bacteria 1351
100 Ga0157370_10438809 3300013104 Bacteria 1201
101 Ga0157370_10569620 3300013104 Bacteria 1038
102 Ga0157369_10002276 3300013105 Bacteria 23093
103 Ga0157369_10005515 3300013105 Bacteria 14694
104 Ga0157369_10052478 3300013105 Bacteria 4411
105 Ga0157369_10091110 3300013105 Bacteria 3255
106 Ga0157374_10041915 3300013296 Bacteria 4221
107 Ga0157374_11009310 3300013296 Unclassified 851
108 Ga0163162_10000053 3300013306 Bacteria 112503
109 Ga0163162_10030067 3300013306 Bacteria 5380
110 Ga0163162_10278181 3300013306 Bacteria 1806
111 Ga0163162_10930956 3300013306 Bacteria 981
112 Ga0157372_10004202 3300013307 Bacteria 15413
113 Ga0157372_10012947 3300013307 Bacteria 8894
114 Ga0157372_10089783 3300013307 Bacteria 3492
115 Ga0157372_10301429 3300013307 Bacteria 1864
116 Ga0157375_10269831 3300013308 Bacteria 1863
117 Ga0157375_10381566 3300013308 Bacteria 1576
118 Ga0157375_10511266 3300013308 Bacteria 1365
119 Ga0157375_10547528 3300013308 Bacteria 1319
120 Ga0157375_11203134 3300013308 Bacteria 889
121 Ga0163163_10048001 3300014325 Bacteria 4197
122 Ga0182008_10001113 3300014497 Bacteria 18484
123 Ga0182008_10005448 3300014497 Bacteria 7244
124 Ga0182008_10012173 3300014497 Bacteria 4548
125 Ga0182008_10289953 3300014497 Bacteria 854
126 Ga0157379_10452086 3300014968 Bacteria 1186
127 Ga0157376_11417709 3300014969 Bacteria 726
128 Ga0182006_1000439 3300015261 Bacteria 32981
129 Ga0182006_1005254 3300015261 Bacteria 6198
130 Ga0182006_1028381 3300015261 Bacteria 2275
131 Ga0182006_1074142 3300015261 Bacteria 1255
132 Ga0182006_1258529 3300015261 Bacteria 571
133 Ga0182007_10000321 3300015262 Bacteria 30433
134 Ga0182005_1001170 3300015265 Bacteria 10844
135 Ga0182005_1024901 3300015265 Bacteria 1634
136 Ga0182005_1025671 3300015265 Bacteria 1608
137 Ga0182005_1052170 3300015265 Bacteria 1113
138 Ga0182005_1093520 3300015265 Bacteria 837
139 Ga0182005_1093578 3300015265 Bacteria 837
140 Ga0163161_10000236 3300017792 Bacteria 50548
141 Ga0163161_10010044 3300017792 Bacteria 6554
142 Ga0163161_10016114 3300017792 Bacteria 5218
143 Ga0163161_10056946 3300017792 Bacteria 2840
144 Ga0163161_10069629 3300017792 Bacteria 2572
145 Ga0163161_10107217 3300017792 Bacteria 2085
146 Ga0163161_10123272 3300017792 Bacteria 1949
147 Ga0163161_10159182 3300017792 Bacteria 1721
148 Ga0163161_10228072 3300017792 Bacteria 1445
149 Ga0163161_10784088 3300017792 Bacteria 800
150 Ga0209435_100636 3300025206 Bacteria 6312
151 Ga0209784_100110 3300025224 Bacteria 91931
152 Ga0209566_100131 3300025225 Bacteria 91931
153 Ga0209674_100154 3300025226 Bacteria 91931
154 Ga0209147_100158 3300025229 Bacteria 91931
155 Ga0209563_100133 3300025230 Bacteria 91931
156 Ga0209563_102729 3300025230 Bacteria 3873
157 Ga0209258_100260 3300025242 Bacteria 91919
158 Ga0209646_1000482 3300025246 Bacteria 19765
159 Ga0209677_100100 3300025253 Bacteria 91931
160 Ga0209759_1036057 3300025256 Bacteria 905
161 Ga0209676_1000002 3300025292 Bacteria 1732948
162 Ga0209676_1000050 3300025292 Bacteria 398350
163 Ga0209050_1000006 3300025298 Bacteria 1359702
164 Ga0209051_1000001 3300025303 Bacteria 1732974
165 Ga0209257_1000056 3300025304 Bacteria 403132
166 Ga0207696_1000002 3300025711 Bacteria 1098043
167 Ga0207696_1000011 3300025711 Bacteria 530614
168 Ga0207696_1000609 3300025711 Bacteria 26679
169 Ga0207696_1003010 3300025711 Bacteria 7872
170 Ga0207696_1109631 3300025711 Bacteria 748
171 Ga0207655_1000006 3300025728 Bacteria 861092
172 Ga0207655_1000141 3300025728 Bacteria 138956
173 Ga0207655_1000173 3300025728 Bacteria 118589
174 Ga0207655_1011012 3300025728 Bacteria 5427
175 Ga0207655_1013266 3300025728 Bacteria 4743
176 Ga0207655_1023717 3300025728 Bacteria 3032
177 Ga0207655_1044190 3300025728 Bacteria 1875
178 Ga0207713_1000162 3300025735 Bacteria 98630
179 Ga0207713_1001533 3300025735 Bacteria 18186
180 Ga0207713_1004739 3300025735 Bacteria 8749
181 Ga0207713_1015743 3300025735 Bacteria 3865
182 Ga0207713_1018973 3300025735 Bacteria 3385
183 Ga0207713_1040568 3300025735 Bacteria 1952
184 Ga0207713_1046500 3300025735 Bacteria 1764
185 Ga0207713_1119943 3300025735 Bacteria 883
186 Ga0207713_1167256 3300025735 Bacteria 696
187 Ga0207682_10006506 3300025893 Bacteria 4700
188 Ga0207688_10347145 3300025901 Bacteria 914
189 Ga0207680_10039990 3300025903 Bacteria 2725
190 Ga0207671_10000196 3300025914 Bacteria 94054
191 Ga0207649_10000042 3300025920 Bacteria 117456
192 Ga0207652_10071782 3300025921 Bacteria 3009
193 Ga0207681_10046130 3300025923 Bacteria 2930
194 Ga0207681_10190807 3300025923 Bacteria 1568
195 Ga0207650_10387855 3300025925 Bacteria 1154
196 Ga0207644_10000239 3300025931 Bacteria 37746
197 Ga0207644_10322173 3300025931 Bacteria 1250
198 Ga0207644_10763242 3300025931 Unclassified 808
199 Ga0207690_10147328 3300025932 Bacteria 1741
200 Ga0207686_10001247 3300025934 Bacteria 14704
201 Ga0207686_10019041 3300025934 Bacteria 3897
202 Ga0207709_10000014 3300025935 Bacteria 526302
203 Ga0207709_10183021 3300025935 Bacteria 1481
204 Ga0207691_10085330 3300025940 Bacteria 2834
205 Ga0207691_10149243 3300025940 Bacteria 2056
206 Ga0207711_10001648 3300025941 Bacteria 20599
207 Ga0207679_10000044 3300025945 Bacteria 122251
208 Ga0207651_10009955 3300025960 Bacteria 5240
209 Ga0207651_10345229 3300025960 Bacteria 1252
210 Ga0207640_10785137 3300025981 Bacteria 824
211 Ga0207658_10079652 3300025986 Bacteria 2507
212 Ga0207658_10654339 3300025986 Bacteria 947
213 Ga0207703_10336113 3300026035 Bacteria 1387
214 Ga0207702_10020021 3300026078 Bacteria 5544
215 Ga0207641_10097955 3300026088 Bacteria 2578
216 Ga0207641_10205383 3300026088 Bacteria 1819
217 Ga0207641_10811228 3300026088 Bacteria 926
218 Ga0207648_10027124 3300026089 Bacteria 5087
219 Ga0207648_10820201 3300026089 Bacteria 867
220 Ga0207676_10010197 3300026095 Bacteria 6685
221 Ga0207676_10401827 3300026095 Bacteria 1280
222 Ga0207674_10131926 3300026116 Bacteria 2461
223 Ga0207683_10011601 3300026121 Bacteria 7524
224 Ga0207683_10218777 3300026121 Bacteria 1735
225 Ga0209281_1005517 3300027111 Bacteria 3496
226 Ga0209982_1019906 3300027552 Bacteria 1029
227 Ga0209983_1052314 3300027665 Bacteria 895
228 Ga0209971_1003630 3300027682 Bacteria 3654
229 Ga0207428_10067991 3300027907 Bacteria 2804
230 Ga0207428_10094143 3300027907 Bacteria 2323
231 Ga0207428_10228314 3300027907 Bacteria 1394
232 Ga0268266_10119144 3300028379 Bacteria 2347
233 Ga0268266_11500151 3300028379 Bacteria 650
234 Ga0268266_11577658 3300028379 Bacteria 632
235 Ga0265334_10033239 3300028573 Bacteria 2054
236 Ga0307517_10073118 3300028786 Bacteria 3044
237 Ga0307515_10008027 3300028794 Bacteria 20692
238 Ga0307511_10209695 3300030521 Bacteria 997
239 Ga0307511_10377852 3300030521 Bacteria 594
240 Ga0265330_10000254 3300031235 Bacteria 39821
241 Ga0265332_10000001 3300031238 Bacteria 863783
242 Ga0265320_10024395 3300031240 Bacteria 3199
243 Ga0265325_10004203 3300031241 Bacteria 9145
244 Ga0265340_10015534 3300031247 Bacteria 3954
245 Ga0265327_10020866 3300031251 Bacteria 3974
246 Ga0307513_10015575 3300031456 Bacteria 9211
247 Ga0307408_100000213 3300031548 Bacteria 61855
248 Ga0307408_100015639 3300031548 Bacteria 5055
249 Ga0307408_100143359 3300031548 Bacteria 1877
250 Ga0307514_10004601 3300031649 Bacteria 12653
251 Ga0265314_10000013 3300031711 Bacteria 403405
252 Ga0307516_10002395 3300031730 Bacteria 25122
253 Ga0307405_10708085 3300031731 Bacteria 834
254 Ga0307413_10086102 3300031824 Bacteria 2031
255 Ga0307407_10567439 3300031903 Bacteria 841
256 Ga0307412_10007330 3300031911 Bacteria 6255
257 Ga0307412_10012389 3300031911 Bacteria 4970
258 Ga0307409_100121100 3300031995 Bacteria 2216
259 Ga0307414_10006300 3300032004 Bacteria 6603
260 Ga0307411_10134266 3300032005 Bacteria 1814
261 Ga0307510_10016826 3300033180 Bacteria 8627
262 Ga0307510_10085330 3300033180 Bacteria 3035
263 Ga0307510_10517635 3300033180 Bacteria 637
264 Ga0373943_0355845 3300035170 Unclassified 840
265 Ga0237819_01372 3300038705 Bacteria 6377
266 Ga0439438_000551 3300041405 Bacteria 17062
267 Ga0439438_003481 3300041405 Bacteria 6357
268 Ga0439438_007475 3300041405 Bacteria 3730
269 Ga0439438_010898 3300041405 Bacteria 2854
270 Ga0439438_011432 3300041405 Bacteria 2764
271 Ga0439438_025059 3300041405 Bacteria 1628
272 Ga0439447_000541 3300041407 Bacteria 13950
273 Ga0439447_003917 3300041407 Bacteria 5217
274 Ga0439466_0003602 3300041411 Bacteria 5985
275 Ga0439466_0005834 3300041411 Bacteria 4690
276 Ga0439466_0010124 3300041411 Bacteria 3506
277 Ga0439466_0039877 3300041411 Bacteria 1572
278 Ga0439466_0118519 3300041411 Bacteria 818
279 Ga0439465_0028172 3300041413 Bacteria 1780
280 Ga0451793_1290228 3300041452 Bacteria 1968
281 Ga0451797_0000881 3300041453 Bacteria 848
282 Ga0451795_0889389 3300041456 Bacteria 2315
283 Ga0451800_0078036 3300041459 Bacteria 1532
284 Ga0451800_1611696 3300041459 Bacteria 1790
285 Ga0451802_1759861 3300041460 Bacteria 1456
286 Ga0451804_0864686 3300041463 Bacteria 854
287 Ga0451807_2596559 3300041486 Bacteria 1283
288 Ga0451841_0510840 3300041498 Bacteria 1408
289 Ga0451845_0948365 3300041501 Bacteria 719
290 Ga0451853_1348293 3300041512 Bacteria 1530
291 Ga0439431_0021943 3300041997 Bacteria 1535
292 Ga0439445_0014895 3300042004 Bacteria 1899
293 Ga0439445_0057191 3300042004 Bacteria 1061
294 Ga0439432_003851 3300042006 Bacteria 5532
295 Ga0439432_023851 3300042006 Bacteria 2012
296 Ga0439432_085282 3300042006 Bacteria 953
297 Ga0439451_005607 3300042009 Bacteria 2564
298 Ga0439451_007192 3300042009 Bacteria 2273
299 Ga0439451_033099 3300042009 Bacteria 1039
300 Ga0439451_057446 3300042009 Bacteria 778
301 Ga0439452_000035 3300042010 Bacteria 160387
302 Ga0439452_000075 3300042010 Bacteria 88291
303 Ga0439452_004210 3300042010 Bacteria 4874
304 Ga0439452_021959 3300042010 Bacteria 1656
305 Ga0439456_000108 3300042013 Bacteria 27091
306 Ga0439456_015788 3300042013 Bacteria 1578
307 Ga0439463_001617 3300042016 Bacteria 5930
308 Ga0439463_016736 3300042016 Bacteria 1814
309 Ga0439463_049075 3300042016 Bacteria 1076
310 Ga0450911_000034 3300042115 Bacteria 65281
311 Ga0450911_006186 3300042115 Bacteria 1795
312 Ga0450919_001824 3300042121 Bacteria 2768
313 Ga0450890_002566 3300042127 Bacteria 2485
314 Ga0450900_004387 3300042136 Bacteria 1618
315 Ga0450900_055522 3300042136 Bacteria 612
316 Ga0450902_000140 3300042137 Bacteria 7981
317 Ga0450902_005221 3300042137 Bacteria 1954
318 Ga0450902_017110 3300042137 Bacteria 1183
319 Ga0450902_039295 3300042137 Bacteria 804
320 Ga0450903_004086 3300042138 Bacteria 2502
321 Ga0450903_004464 3300042138 Bacteria 2384
322 Ga0450904_003476 3300042139 Bacteria 1702
323 Ga0450905_003019 3300042142 Bacteria 2197
324 Ga0450906_000228 3300042145 Bacteria 10737
325 Ga0450906_000505 3300042145 Bacteria 8215
326 Ga0450907_000691 3300042146 Bacteria 8691
327 Ga0450910_007432 3300042147 Bacteria 1527
328 Ga0450910_021594 3300042147 Bacteria 975
329 Ga0439446_0006401 3300042156 Bacteria 3068
330 Ga0450908_004070 3300042184 Bacteria 2827
331 Ga0450909_000076 3300042185 Bacteria 8966
332 Ga0439460_0002893 3300042461 Bacteria 4135
333 Ga0439460_0002897 3300042461 Bacteria 4134
334 Ga0450893_0011468 3300042532 Bacteria 1464
335 Ga0495617_000054 3300046452 Bacteria 102256
336 Ga0495617_006783 3300046452 Bacteria 4002
337 Ga0495617_007353 3300046452 Bacteria 3823
338 Ga0495617_018172 3300046452 Bacteria 2377
339 Ga0495617_021585 3300046452 Bacteria 2174
340 Ga0495617_022371 3300046452 Bacteria 2136
341 Ga0495617_038088 3300046452 Bacteria 1609
342 Ga0495617_049342 3300046452 Bacteria 1401
343 Ga0495617_062949 3300046452 Bacteria 1225
344 Ga0495617_067108 3300046452 Bacteria 1181
345 Ga0495617_172593 3300046452 Bacteria 682
346 Ga0495627_000308 3300046453 Bacteria 48367
347 Ga0495627_000469 3300046453 Bacteria 34703
348 Ga0495627_014835 3300046453 Bacteria 2705
349 Ga0495627_038019 3300046453 Bacteria 1490
350 Ga0495627_057710 3300046453 Bacteria 1154
351 Ga0495592_0221575 3300046454 Bacteria 1264
352 Ga0495603_0006812 3300046455 Bacteria 6852
353 Ga0495603_0011087 3300046455 Bacteria 5464
354 Ga0495590_0000565 3300046457 Bacteria 17565
355 Ga0495590_0031117 3300046457 Bacteria 1869
356 Ga0495590_0068272 3300046457 Bacteria 1246
357 Ga0495590_0119125 3300046457 Bacteria 945
358 Ga0495590_0275563 3300046457 Bacteria 629
359 Ga0495591_000049 3300046458 Bacteria 138951
360 Ga0495591_000315 3300046458 Bacteria 43798
361 Ga0495591_005393 3300046458 Bacteria 5933
362 Ga0495591_007577 3300046458 Bacteria 4589
363 Ga0495591_008339 3300046458 Bacteria 4260
364 Ga0495591_017155 3300046458 Bacteria 2495
365 Ga0495591_018455 3300046458 Bacteria 2365
366 Ga0495591_026248 3300046458 Bacteria 1813
367 Ga0495591_028710 3300046458 Bacteria 1699
368 Ga0495591_039981 3300046458 Bacteria 1339
369 Ga0495591_053299 3300046458 Bacteria 1097
370 Ga0495629_0212783 3300046459 Bacteria 1335
371 Ga0495638_0003397 3300046460 Bacteria 12552
372 Ga0495638_0015069 3300046460 Bacteria 5201
373 Ga0495638_0019698 3300046460 Bacteria 4461
374 Ga0495638_0033041 3300046460 Bacteria 3310
375 Ga0495638_0070714 3300046460 Bacteria 2136
376 Ga0495638_0076058 3300046460 Bacteria 2045
377 Ga0495638_0243176 3300046460 Bacteria 995
378 Ga0495653_0000623 3300046463 Bacteria 27119
379 Ga0495653_0025566 3300046463 Bacteria 4740
380 Ga0495653_0189647 3300046463 Bacteria 1403
381 Ga0495650_0005012 3300046471 Bacteria 8801
382 Ga0495650_0013279 3300046471 Bacteria 4366
383 Ga0495650_0017298 3300046471 Bacteria 3618
384 Ga0495650_0024143 3300046471 Bacteria 2876
385 Ga0495650_0029136 3300046471 Bacteria 2521
386 Ga0495650_0044093 3300046471 Bacteria 1887
387 Ga0495650_0044170 3300046471 Bacteria 1885
388 Ga0495650_0080924 3300046471 Bacteria 1252
389 Ga0495650_0091493 3300046471 Bacteria 1156
390 Ga0495650_0224344 3300046471 Bacteria 646
391 Ga0495605_0000129 3300046474 Bacteria 99505
392 Ga0495605_0000243 3300046474 Bacteria 64914
393 Ga0495605_0004248 3300046474 Bacteria 8440
394 Ga0495605_0010592 3300046474 Bacteria 5157
395 Ga0495605_0010933 3300046474 Bacteria 5070
396 Ga0495605_0012037 3300046474 Bacteria 4809
397 Ga0495605_0012458 3300046474 Bacteria 4717
398 Ga0495605_0020212 3300046474 Bacteria 3541
399 Ga0495605_0023649 3300046474 Bacteria 3227
400 Ga0495605_0056566 3300046474 Bacteria 1891
401 Ga0495605_0083352 3300046474 Bacteria 1492
402 Ga0495605_0096424 3300046474 Bacteria 1364
403 Ga0495605_0098098 3300046474 Bacteria 1350
404 Ga0495639_0008167 3300046475 Bacteria 4495
405 Ga0495639_0012639 3300046475 Bacteria 3643
406 Ga0495584_0000675 3300046491 Bacteria 22690
407 Ga0495584_0002008 3300046491 Bacteria 11694
408 Ga0495584_0002098 3300046491 Bacteria 11430
409 Ga0495584_0010335 3300046491 Bacteria 4797
410 Ga0495584_0013964 3300046491 Bacteria 4092
411 Ga0495584_0021168 3300046491 Bacteria 3302
412 Ga0495584_0027513 3300046491 Bacteria 2881
413 Ga0495584_0030859 3300046491 Bacteria 2714
414 Ga0495584_0037793 3300046491 Bacteria 2440
415 Ga0495584_0078035 3300046491 Bacteria 1666
416 Ga0495584_0201965 3300046491 Bacteria 1010
417 Ga0495585_0002571 3300046492 Bacteria 12840
418 Ga0495585_0002808 3300046492 Bacteria 12141
419 Ga0495585_0012477 3300046492 Bacteria 5005
420 Ga0495585_0016514 3300046492 Bacteria 4277
421 Ga0495585_0022313 3300046492 Bacteria 3633
422 Ga0495585_0026534 3300046492 Bacteria 3309
423 Ga0495585_0048627 3300046492 Bacteria 2357
424 Ga0495585_0049820 3300046492 Bacteria 2324
425 Ga0495585_0051256 3300046492 Bacteria 2288
426 Ga0495585_0062634 3300046492 Bacteria 2043
427 Ga0495585_0090288 3300046492 Bacteria 1651
428 Ga0495585_0115901 3300046492 Bacteria 1421
429 Ga0495594_0015766 3300046499 Bacteria 3974
430 Ga0495594_0032815 3300046499 Bacteria 2820
431 Ga0495594_0080166 3300046499 Bacteria 1822
432 Ga0495594_0093486 3300046499 Bacteria 1686
433 Ga0495594_0193298 3300046499 Bacteria 1159
434 Ga0495594_0453106 3300046499 Bacteria 729
435 Ga0495596_0000052 3300046500 Bacteria 85298
436 Ga0495596_0032449 3300046500 Bacteria 2081
437 Ga0495607_0000185 3300046501 Bacteria 66759
438 Ga0495607_0001905 3300046501 Bacteria 17679
439 Ga0495607_0006290 3300046501 Bacteria 8372
440 Ga0495607_0013159 3300046501 Bacteria 5432
441 Ga0495607_0014321 3300046501 Bacteria 5169
442 Ga0495607_0014331 3300046501 Bacteria 5166
443 Ga0495607_0015128 3300046501 Bacteria 5010
444 Ga0495607_0036677 3300046501 Bacteria 2951
445 Ga0495607_0051014 3300046501 Bacteria 2405
446 Ga0495607_0051789 3300046501 Bacteria 2381
447 Ga0495607_0085063 3300046501 Bacteria 1728
448 Ga0495607_0110938 3300046501 Bacteria 1454
449 Ga0495607_0118292 3300046501 Bacteria 1395
450 Ga0495607_0131675 3300046501 Bacteria 1300
451 Ga0495607_0146425 3300046501 Bacteria 1213
452 Ga0495607_0206928 3300046501 Bacteria 967
453 Ga0495607_0428251 3300046501 Bacteria 597
454 Ga0495583_0000036 3300046506 Bacteria 246077
455 Ga0495583_0001087 3300046506 Bacteria 30092
456 Ga0495583_0007063 3300046506 Bacteria 7177
457 Ga0495583_0092676 3300046506 Bacteria 1298
458 Ga0495583_0235926 3300046506 Bacteria 736
459 Ga0495606_0001230 3300046507 Bacteria 35839
460 Ga0495606_0009204 3300046507 Bacteria 8394
461 Ga0495606_0020717 3300046507 Bacteria 4838
462 Ga0495606_0076339 3300046507 Bacteria 2094
463 Ga0495606_0095799 3300046507 Bacteria 1816
464 Ga0495606_0271554 3300046507 Bacteria 931
465 Ga0495606_0273406 3300046507 Bacteria 927
466 Ga0495606_0334019 3300046507 Bacteria 810
467 Ga0495610_0003605 3300046512 Bacteria 11960
468 Ga0495610_0007583 3300046512 Bacteria 7185
469 Ga0495610_0008023 3300046512 Bacteria 6910
470 Ga0495610_0011549 3300046512 Bacteria 5390
471 Ga0495610_0011734 3300046512 Bacteria 5324
472 Ga0495610_0030690 3300046512 Bacteria 2812
473 Ga0495610_0036005 3300046512 Bacteria 2534
474 Ga0495610_0047622 3300046512 Bacteria 2108
475 Ga0495610_0060847 3300046512 Bacteria 1796
476 Ga0495610_0068247 3300046512 Bacteria 1667
477 Ga0495610_0126056 3300046512 Bacteria 1116
478 Ga0495610_0238728 3300046512 Bacteria 725
479 Ga0495616_0000226 3300046513 Bacteria 46396
480 Ga0495616_0000871 3300046513 Bacteria 21924
481 Ga0495616_0009438 3300046513 Bacteria 5707
482 Ga0495616_0012775 3300046513 Bacteria 4753
483 Ga0495616_0018241 3300046513 Bacteria 3855
484 Ga0495616_0019518 3300046513 Bacteria 3698
485 Ga0495616_0028009 3300046513 Bacteria 2986
486 Ga0495616_0077732 3300046513 Bacteria 1592
487 Ga0495620_0000022 3300046515 Bacteria 136531
488 Ga0495620_0000064 3300046515 Bacteria 90865
489 Ga0495620_0000991 3300046515 Bacteria 17537
490 Ga0495620_0028418 3300046515 Bacteria 2600
491 Ga0495620_0055133 3300046515 Bacteria 1676
492 Ga0495620_0061925 3300046515 Bacteria 1555
493 Ga0495630_0141330 3300046517 Bacteria 1830
494 Ga0495630_0168244 3300046517 Bacteria 1669
495 Ga0495631_0000002 3300046518 Bacteria 178694
496 Ga0495631_0000255 3300046518 Bacteria 36934
497 Ga0495631_0015271 3300046518 Bacteria 3683
498 Ga0495631_0049137 3300046518 Bacteria 1847
499 Ga0495631_0109743 3300046518 Bacteria 1186
500 Ga0495631_0116836 3300046518 Bacteria 1147
501 Ga0495631_0126828 3300046518 Bacteria 1097
502 Ga0495632_0000590 3300046519 Bacteria 33717
503 Ga0495632_0013345 3300046519 Bacteria 4693
504 Ga0495632_0013582 3300046519 Bacteria 4640
505 Ga0495632_0016234 3300046519 Bacteria 4149
506 Ga0495632_0018402 3300046519 Bacteria 3835
507 Ga0495632_0018438 3300046519 Bacteria 3831
508 Ga0495632_0024589 3300046519 Bacteria 3196
509 Ga0495632_0030717 3300046519 Bacteria 2785
510 Ga0495632_0031654 3300046519 Bacteria 2731
511 Ga0495632_0035282 3300046519 Bacteria 2553
512 Ga0495632_0087446 3300046519 Bacteria 1481
513 Ga0495632_0143830 3300046519 Bacteria 1105
514 Ga0495637_0002284 3300046520 Bacteria 10617
515 Ga0495637_0002303 3300046520 Bacteria 10581
516 Ga0495637_0003391 3300046520 Bacteria 8458
517 Ga0495637_0003870 3300046520 Bacteria 7857
518 Ga0495637_0011454 3300046520 Bacteria 4262
519 Ga0495637_0012508 3300046520 Bacteria 4057
520 Ga0495637_0019970 3300046520 Bacteria 3089
521 Ga0495637_0021643 3300046520 Bacteria 2945
522 Ga0495637_0023890 3300046520 Bacteria 2768
523 Ga0495637_0027125 3300046520 Bacteria 2565
524 Ga0495637_0029094 3300046520 Bacteria 2461
525 Ga0495637_0032107 3300046520 Bacteria 2315
526 Ga0495637_0049899 3300046520 Bacteria 1756
527 Ga0495637_0069590 3300046520 Bacteria 1423
528 Ga0495643_0004554 3300046522 Bacteria 9654
529 Ga0495643_0017426 3300046522 Bacteria 4198
530 Ga0495643_0018751 3300046522 Bacteria 4010
531 Ga0495643_0041987 3300046522 Bacteria 2492
532 Ga0495643_0060763 3300046522 Bacteria 2005
533 Ga0495643_0076015 3300046522 Bacteria 1756
534 Ga0495643_0104461 3300046522 Bacteria 1448
535 Ga0495643_0114800 3300046522 Bacteria 1366
536 Ga0495643_0129310 3300046522 Bacteria 1269
537 Ga0495643_0130560 3300046522 Bacteria 1262
538 Ga0495643_0139108 3300046522 Bacteria 1212
539 Ga0495643_0226303 3300046522 Bacteria 884
540 Ga0495644_0001171 3300046523 Bacteria 10762
541 Ga0495644_0001342 3300046523 Bacteria 10066
542 Ga0495644_0004995 3300046523 Bacteria 5194
543 Ga0495644_0026639 3300046523 Bacteria 2192
544 Ga0495644_0182257 3300046523 Bacteria 807
545 Ga0495644_0391979 3300046523 Bacteria 549
546 Ga0495648_0010309 3300046524 Bacteria 7129
547 Ga0495648_0015656 3300046524 Bacteria 5493
548 Ga0495648_0022193 3300046524 Bacteria 4376
549 Ga0495648_0023262 3300046524 Bacteria 4248
550 Ga0495648_0036028 3300046524 Bacteria 3199
551 Ga0495648_0038919 3300046524 Bacteria 3033
552 Ga0495648_0041449 3300046524 Bacteria 2907
553 Ga0495648_0043288 3300046524 Bacteria 2824
554 Ga0495648_0045831 3300046524 Bacteria 2716
555 Ga0495648_0070517 3300046524 Bacteria 2030
556 Ga0495648_0134006 3300046524 Bacteria 1313
557 Ga0495666_0000945 3300046526 Bacteria 13660
558 Ga0495666_0015083 3300046526 Bacteria 3846
559 Ga0495666_0021971 3300046526 Bacteria 3158
560 Ga0495666_0098256 3300046526 Bacteria 1380
561 Ga0495666_0139444 3300046526 Bacteria 1131
562 Ga0495642_0000452 3300046528 Bacteria 21635
563 Ga0495642_0001151 3300046528 Bacteria 12167
564 Ga0495642_0045546 3300046528 Bacteria 1793
565 Ga0495654_0000306 3300046530 Bacteria 43427
566 Ga0495654_0001228 3300046530 Bacteria 18110
567 Ga0495654_0002904 3300046530 Bacteria 10744
568 Ga0495654_0004438 3300046530 Bacteria 8323
569 Ga0495654_0029564 3300046530 Bacteria 2793
570 Ga0495654_0040179 3300046530 Bacteria 2332
571 Ga0495654_0073790 3300046530 Bacteria 1613
572 Ga0495654_0233582 3300046530 Bacteria 772
573 Ga0495587_0008755 3300046536 Bacteria 6490
574 Ga0495587_0119958 3300046536 Bacteria 1507
575 Ga0495587_0392092 3300046536 Bacteria 772
576 Ga0495609_0000029 3300046538 Bacteria 217067
577 Ga0495609_0001135 3300046538 Bacteria 18421
578 Ga0495609_0002166 3300046538 Bacteria 12333
579 Ga0495609_0005538 3300046538 Bacteria 6596
580 Ga0495609_0008670 3300046538 Bacteria 4961
581 Ga0495609_0009098 3300046538 Bacteria 4822
582 Ga0495609_0072539 3300046538 Bacteria 1511
583 Ga0495609_0092988 3300046538 Bacteria 1310
584 Ga0495609_0291862 3300046538 Bacteria 665
585 Ga0495609_0339242 3300046538 Bacteria 607
586 Ga0495597_0000446 3300046542 Bacteria 35360
587 Ga0495597_0001165 3300046542 Bacteria 19749
588 Ga0495597_0005117 3300046542 Bacteria 6999
589 Ga0495597_0006368 3300046542 Bacteria 6112
590 Ga0495597_0006973 3300046542 Bacteria 5790
591 Ga0495597_0010889 3300046542 Bacteria 4424
592 Ga0495597_0013051 3300046542 Bacteria 3988
593 Ga0495597_0022017 3300046542 Bacteria 2958
594 Ga0495597_0040214 3300046542 Bacteria 2090
595 Ga0495597_0044504 3300046542 Bacteria 1973
596 Ga0495597_0077602 3300046542 Bacteria 1423
597 Ga0495597_0078375 3300046542 Bacteria 1415
598 Ga0495597_0094309 3300046542 Bacteria 1267
599 Ga0495597_0104688 3300046542 Bacteria 1190
600 Ga0495645_0339805 3300046543 Bacteria 970
601 Ga0495645_0570407 3300046543 Bacteria 699
602 Ga0495622_0002416 3300046557 Bacteria 9076
603 Ga0495622_0021544 3300046557 Bacteria 2999
604 Ga0495622_0024166 3300046557 Bacteria 2837
605 Ga0495622_0136695 3300046557 Bacteria 1114
606 Ga0495633_0000656 3300046558 Bacteria 31916
607 Ga0495633_0001085 3300046558 Bacteria 21975
608 Ga0495633_0014912 3300046558 Bacteria 4042
609 Ga0495656_0009253 3300046615 Bacteria 3539
610 Ga0495656_0015752 3300046615 Bacteria 2860
611 Ga0495656_0152956 3300046615 Bacteria 1115
612 Ga0495668_0002469 3300046616 Bacteria 15217
613 Ga0495668_0017097 3300046616 Bacteria 4211
614 Ga0495668_0175498 3300046616 Bacteria 1174
615 Ga0495668_0504944 3300046616 Bacteria 667
616 Ga0495634_0000025 3300046642 Bacteria 115964
617 Ga0495611_0000016 3300046648 Bacteria 129593
618 Ga0495611_0015950 3300046648 Bacteria 3211
619 Ga0495611_0019649 3300046648 Bacteria 2902
620 Ga0495611_0083476 3300046648 Bacteria 1472
621 Ga0495611_0275959 3300046648 Bacteria 777
622 Ga0495625_0000847 3300046660 Bacteria 41784
623 Ga0495625_0002783 3300046660 Bacteria 18441
624 Ga0495625_0007378 3300046660 Bacteria 9580
625 Ga0495625_0018805 3300046660 Bacteria 5381
626 Ga0495625_0038509 3300046660 Bacteria 3499
627 Ga0495625_0040842 3300046660 Bacteria 3380
628 Ga0495625_0074176 3300046660 Bacteria 2383
629 Ga0495625_0093248 3300046660 Bacteria 2079
630 Ga0495625_0099490 3300046660 Bacteria 1999
631 Ga0495625_0259505 3300046660 Bacteria 1125
632 Ga0495625_0278399 3300046660 Bacteria 1077
633 Ga0495625_0280775 3300046660 Bacteria 1071
634 Ga0495625_0514002 3300046660 Bacteria 730
635 Ga0495635_0024897 3300046663 Bacteria 4170
636 Ga0495659_0000585 3300046664 Bacteria 13421
637 Ga0495659_0029007 3300046664 Bacteria 1918
638 Ga0495659_0094680 3300046664 Bacteria 1150
639 Ga0495661_0008496 3300046665 Bacteria 7102
640 Ga0495661_0043632 3300046665 Bacteria 2755
641 Ga0495661_0069205 3300046665 Bacteria 2068
642 Ga0495661_0074003 3300046665 Bacteria 1983
643 Ga0495661_0074447 3300046665 Bacteria 1976
644 Ga0495588_0198646 3300046674 Bacteria 1059
645 Ga0495623_0017131 3300046679 Bacteria 4679
646 Ga0495623_0033682 3300046679 Bacteria 3287
647 Ga0495646_0013790 3300046680 Bacteria 5139
648 Ga0495646_0043466 3300046680 Bacteria 2750
649 Ga0495669_0001360 3300046684 Bacteria 10086
650 Ga0495613_0205392 3300046689 Bacteria 1387
651 Ga0495624_0000112 3300046690 Bacteria 56084
652 Ga0495670_0001525 3300046691 Bacteria 11315
653 Ga0495670_0001801 3300046691 Bacteria 10529
654 Ga0495670_0005371 3300046691 Bacteria 6297
655 Ga0495670_0007595 3300046691 Bacteria 5331
656 Ga0495670_0019900 3300046691 Bacteria 3307
657 Ga0495670_0090640 3300046691 Bacteria 1564
658 Ga0495671_0000295 3300046692 Bacteria 41756
659 Ga0495671_0010549 3300046692 Bacteria 5110
660 Ga0495671_0014212 3300046692 Bacteria 4290
661 Ga0495671_0014491 3300046692 Bacteria 4241
662 Ga0495671_0017741 3300046692 Bacteria 3785
663 Ga0495671_0018492 3300046692 Bacteria 3697
664 Ga0495671_0033821 3300046692 Bacteria 2602
665 Ga0495671_0034850 3300046692 Bacteria 2557
666 Ga0495671_0036773 3300046692 Bacteria 2479
667 Ga0495671_0053911 3300046692 Bacteria 1994
668 Ga0495671_0080835 3300046692 Bacteria 1592
669 Ga0495671_0120939 3300046692 Bacteria 1277
670 Ga0495671_0233799 3300046692 Bacteria 888
671 Ga0495671_0331955 3300046692 Bacteria 730
672 Ga0495649_0000013 3300046694 Bacteria 316013
673 Ga0495649_0008874 3300046694 Bacteria 6018
674 Ga0495649_0010929 3300046694 Bacteria 5347
675 Ga0495649_0024715 3300046694 Bacteria 3349
676 Ga0495649_0035923 3300046694 Bacteria 2724
677 Ga0495649_0122342 3300046694 Bacteria 1375
678 Ga0495649_0158651 3300046694 Bacteria 1186
679 Ga0495649_0162532 3300046694 Bacteria 1170
680 Ga0495649_0164780 3300046694 Bacteria 1161
681 Ga0495649_0261699 3300046694 Bacteria 886
682 Ga0495649_0267825 3300046694 Bacteria 874
683 Ga0495589_0000662 3300046794 Bacteria 22575
684 Ga0495589_0001215 3300046794 Bacteria 15319
685 Ga0495589_0005374 3300046794 Bacteria 6759
686 Ga0495589_0011783 3300046794 Bacteria 4537
687 Ga0495589_0046039 3300046794 Bacteria 2165
688 Ga0495589_0163845 3300046794 Bacteria 1058
689 Ga0495600_0104185 3300046809 Bacteria 1848
690 Ga0495660_0000440 3300046810 Bacteria 34710
691 Ga0495660_0000546 3300046810 Bacteria 30868
692 Ga0495660_0002137 3300046810 Bacteria 12751
693 Ga0495660_0009893 3300046810 Bacteria 5548
694 Ga0495660_0015516 3300046810 Bacteria 4400
695 Ga0495660_0025305 3300046810 Bacteria 3372
696 Ga0495660_0030209 3300046810 Bacteria 3053
697 Ga0495660_0037562 3300046810 Bacteria 2696
698 Ga0495660_0037801 3300046810 Bacteria 2688
699 Ga0495660_0043560 3300046810 Bacteria 2474
700 Ga0495660_0067922 3300046810 Bacteria 1897
701 Ga0495660_0078401 3300046810 Bacteria 1736
702 Ga0495660_0126442 3300046810 Bacteria 1287
703 Ga0495660_0145240 3300046810 Bacteria 1176
704 Ga0495660_0150565 3300046810 Bacteria 1149
705 Ga0495660_0155154 3300046810 Bacteria 1127
706 Ga0495660_0182256 3300046810 Bacteria 1015
707 Ga0495660_0260680 3300046810 Bacteria 800
708 Ga0495581_0140655 3300047315 Bacteria 1408
709 Ga0495604_0045194 3300047317 Bacteria 3437
710 Ga0495604_0722112 3300047317 Bacteria 631
711 Ga0495636_0000685 3300047318 Bacteria 12434
712 Ga0495636_0045708 3300047318 Bacteria 1826
713 Ga0495674_0007823 3300047319 Bacteria 10208
714 Ga0495672_0001135 3300047320 Bacteria 26957
715 Ga0495672_0002589 3300047320 Bacteria 16397
716 Ga0495672_0004163 3300047320 Bacteria 12008
717 Ga0495672_0005494 3300047320 Bacteria 10046
718 Ga0495672_0005592 3300047320 Bacteria 9925
719 Ga0495672_0006155 3300047320 Bacteria 9361
720 Ga0495672_0012521 3300047320 Bacteria 5914
721 Ga0495672_0014704 3300047320 Bacteria 5344
722 Ga0495672_0030096 3300047320 Bacteria 3411
723 Ga0495672_0075739 3300047320 Bacteria 1891
724 Ga0495672_0107707 3300047320 Bacteria 1500
725 Ga0495672_0114900 3300047320 Bacteria 1439
726 Ga0495672_0132089 3300047320 Bacteria 1312
727 Ga0495676_0005239 3300047321 Bacteria 11863
728 Ga0495676_0202770 3300047321 Bacteria 1377
729 Ga0495680_0003983 3300047322 Bacteria 14264
730 Ga0495680_0034099 3300047322 Bacteria 4116
731 Ga0495680_0046725 3300047322 Bacteria 3411
732 Ga0495680_0472042 3300047322 Bacteria 855
733 Ga0495683_0000037 3300047323 Bacteria 140632
734 Ga0495683_0000045 3300047323 Bacteria 131634
735 Ga0495683_0013304 3300047323 Bacteria 4307
736 Ga0495683_0040976 3300047323 Bacteria 2338
737 Ga0495683_0062381 3300047323 Bacteria 1844
738 Ga0495683_0066092 3300047323 Bacteria 1782
739 Ga0495683_0079216 3300047323 Bacteria 1604
740 Ga0495683_0094780 3300047323 Bacteria 1442
741 Ga0495683_0122388 3300047323 Bacteria 1233
742 Ga0495687_002708 3300047443 Bacteria 13751
743 Ga0495687_026015 3300047443 Bacteria 2758
744 Ga0495675_0103772 3300047444 Bacteria 1777
745 Ga0495677_0021698 3300047445 Bacteria 2327
746 Ga0495679_001891 3300047446 Bacteria 11241
747 Ga0495679_004379 3300047446 Bacteria 6536
748 Ga0495679_004932 3300047446 Bacteria 6021
749 Ga0495679_006644 3300047446 Bacteria 4947
750 Ga0495679_008868 3300047446 Bacteria 4059
751 Ga0495679_008932 3300047446 Bacteria 4040
752 Ga0495679_035154 3300047446 Bacteria 1590
753 Ga0495685_008953 3300047447 Bacteria 3337
754 Ga0495673_0000093 3300047469 Bacteria 185841
755 Ga0495673_0000308 3300047469 Bacteria 64598
756 Ga0495673_0002211 3300047469 Bacteria 14014
757 Ga0495673_0003379 3300047469 Bacteria 10551
758 Ga0495673_0005219 3300047469 Bacteria 7898
759 Ga0495673_0006345 3300047469 Bacteria 6964
760 Ga0495673_0013949 3300047469 Bacteria 4197
761 Ga0495673_0017603 3300047469 Bacteria 3621
762 Ga0495673_0024537 3300047469 Bacteria 2912
763 Ga0495673_0025248 3300047469 Bacteria 2856
764 Ga0495673_0039600 3300047469 Bacteria 2136
765 Ga0495673_0043916 3300047469 Bacteria 1996
766 Ga0495673_0047675 3300047469 Bacteria 1892
767 Ga0495673_0047784 3300047469 Bacteria 1889
768 Ga0495681_0000237 3300047470 Bacteria 45823
769 Ga0495681_0001053 3300047470 Bacteria 21048
770 Ga0495681_0001249 3300047470 Bacteria 19297
771 Ga0495681_0003182 3300047470 Bacteria 11465
772 Ga0495681_0010169 3300047470 Bacteria 5717
773 Ga0495681_0012349 3300047470 Bacteria 5023
774 Ga0495681_0015495 3300047470 Bacteria 4309
775 Ga0495681_0052419 3300047470 Bacteria 1914
776 Ga0495681_0067197 3300047470 Bacteria 1634
777 Ga0495681_0113034 3300047470 Bacteria 1173
778 Ga0495681_0134354 3300047470 Bacteria 1050
779 Ga0495681_0137427 3300047470 Bacteria 1035
780 Ga0495681_0174954 3300047470 Bacteria 885
781 Ga0495681_0209888 3300047470 Bacteria 785
782 Ga0495681_0267399 3300047470 Bacteria 670
783 Ga0495681_0297718 3300047470 Bacteria 625
784 Ga0495684_0031905 3300047471 Bacteria 4045
785 Ga0495686_0005414 3300047472 Bacteria 10080
786 Ga0495686_0016927 3300047472 Bacteria 4925
787 Ga0495686_0037142 3300047472 Bacteria 3122
788 Ga0495593_0017232 3300047673 Bacteria 4064
789 Ga0495593_0018905 3300047673 Bacteria 3865
790 Ga0495602_0003606 3300048088 Bacteria 16040
791 Ga0495614_0187775 3300048089 Bacteria 932
792 Ga0495626_0000057 3300048091 Bacteria 148288
793 Ga0495626_0000065 3300048091 Bacteria 141689
794 Ga0495626_0000352 3300048091 Bacteria 48007
795 Ga0495626_0000672 3300048091 Bacteria 32925
796 Ga0495626_0000814 3300048091 Bacteria 28095
797 Ga0495626_0014939 3300048091 Bacteria 3984
798 Ga0495626_0019122 3300048091 Bacteria 3428
799 Ga0495626_0035296 3300048091 Bacteria 2387
800 Ga0495626_0075449 3300048091 Bacteria 1507
801 Ga0495626_0084752 3300048091 Bacteria 1402
802 Ga0495626_0377306 3300048091 Bacteria 550
803 Ga0496100_0001162 3300048903 Bacteria 12807
804 Ga0496100_0763085 3300048903 Bacteria 757
805 Ga0496101_0046761 3300048904 Bacteria 3104
806 Ga0496102_0000038 3300048905 Bacteria 198844
807 Ga0496102_0031392 3300048905 Bacteria 4765
808 Ga0496102_0557006 3300048905 Bacteria 1069
809 Ga0496103_0004289 3300048906 Bacteria 8664
810 Ga0496103_0020811 3300048906 Bacteria 3944
811 Ga0496104_0029910 3300048907 Bacteria 5058
812 Ga0496105_0007175 3300048908 Bacteria 8600
813 Ga0496106_0560583 3300048909 Bacteria 916
814 Ga0496108_0436234 3300048911 Unclassified 1144
815 Ga0496109_0570533 3300048912 Unclassified 1067
816 Ga0496110_0062933 3300048913 Bacteria 3278
817 Ga0496110_0192397 3300048913 Bacteria 1852
818 Ga0496113_0501664 3300048916 Bacteria 974
819 Ga0496115_0778962 3300048918 Bacteria 746
820 Ga0496116_0000697 3300048919 Bacteria 43533
821 Ga0496116_0000984 3300048919 Bacteria 34981
822 Ga0496116_0026080 3300048919 Bacteria 4281
823 Ga0496116_0061342 3300048919 Bacteria 2434
824 Ga0496116_0353659 3300048919 Bacteria 671
825 Ga0496117_0015585 3300048920 Bacteria 6467
826 Ga0496117_0020617 3300048920 Bacteria 5367
827 Ga0496117_0020699 3300048920 Bacteria 5355
828 Ga0496117_0090234 3300048920 Bacteria 1975
829 Ga0496118_0014321 3300048921 Bacteria 7432
830 Ga0496118_0034456 3300048921 Bacteria 4130
831 Ga0496118_0061394 3300048921 Bacteria 2783
832 Ga0496118_0077938 3300048921 Bacteria 2348
833 Ga0496119_0002931 3300048922 Bacteria 18168
834 Ga0496119_0046580 3300048922 Bacteria 2706
835 Ga0496119_0115889 3300048922 Bacteria 1479
836 Ga0496120_0002634 3300048923 Bacteria 17775
837 Ga0496120_0014492 3300048923 Bacteria 5252
838 Ga0496121_0009654 3300048924 Bacteria 11052
839 Ga0496121_0027656 3300048924 Bacteria 5301
840 Ga0496121_0087004 3300048924 Bacteria 2454
841 Ga0496121_0168908 3300048924 Bacteria 1591
842 Ga0496121_0221102 3300048924 Bacteria 1334
843 Ga0496122_0012213 3300048925 Bacteria 8587
844 Ga0496122_0020618 3300048925 Bacteria 5943
845 Ga0496122_0075881 3300048925 Bacteria 2368
846 Ga0496122_0094975 3300048925 Bacteria 2016
847 Ga0496122_0359624 3300048925 Bacteria 756
848 Ga0496122_0390376 3300048925 Bacteria 710
849 Ga0496123_0017505 3300048926 Bacteria 5761
850 Ga0496123_0058600 3300048926 Bacteria 2496
851 Ga0496123_0065210 3300048926 Bacteria 2316
852 Ga0496123_0078774 3300048926 Bacteria 2016
853 Ga0496123_0158014 3300048926 Bacteria 1212
854 Ga0496124_0000280 3300048927 Bacteria 97221
855 Ga0496124_0005884 3300048927 Bacteria 13577
856 Ga0496124_0123398 3300048927 Bacteria 2066
857 Ga0496124_0170499 3300048927 Bacteria 1686
858 Ga0496124_0339664 3300048927 Bacteria 1067
859 Ga0496125_0073594 3300048928 Bacteria 2655
860 Ga0496125_0123829 3300048928 Bacteria 1837
861 Ga0496125_0168797 3300048928 Bacteria 1474
862 Ga0496126_0131501 3300048929 Bacteria 2162
863 Ga0496126_0541146 3300048929 Bacteria 925
864 Ga0495678_000037 3300049459 Bacteria 197851
865 Ga0495678_000724 3300049459 Bacteria 29966
866 Ga0495678_003450 3300049459 Bacteria 9791
867 Ga0495678_003588 3300049459 Bacteria 9477
868 Ga0495678_005730 3300049459 Bacteria 6753
869 Ga0495678_009065 3300049459 Bacteria 4964
870 Ga0495678_011439 3300049459 Bacteria 4248
871 Ga0495678_014198 3300049459 Bacteria 3711
872 Ga0495678_020150 3300049459 Bacteria 2959
873 Ga0495678_029485 3300049459 Bacteria 2303
874 Ga0495678_032474 3300049459 Bacteria 2164
875 Ga0495678_055919 3300049459 Bacteria 1503
876 Ga0495678_058489 3300049459 Bacteria 1456
877 Ga0495678_092348 3300049459 Bacteria 1063
878 Ga0495678_223437 3300049459 Bacteria 570
879 Ga0495682_0000018 3300049460 Bacteria 229211
880 Ga0495682_0010022 3300049460 Bacteria 3683
881 Ga0495682_0014102 3300049460 Bacteria 3033
882 Ga0495682_0043506 3300049460 Bacteria 1644
883 Ga0495682_0066134 3300049460 Bacteria 1303
884 Ga0495682_0082466 3300049460 Bacteria 1156
885 Ga0501032_0213572 3300049569 Bacteria 1257
886 Ga0501034_0194349 3300049571 Bacteria 1990
887 Ga0501034_0766518 3300049571 Bacteria 859
888 Ga0501037_0098741 3300049573 Bacteria 2109
889 Ga0501042_0277521 3300049578 Bacteria 1210
890 Ga0501043_0000573 3300049579 Bacteria 32893
891 Ga0501046_0000752 3300049580 Bacteria 31319
892 Ga0501047_0000298 3300049581 Bacteria 57038
893 Ga0501048_0008752 3300049582 Bacteria 7627
894 Ga0501070_0316704 3300049586 Bacteria 1269
895 Ga0501241_000058 3300049758 Bacteria 29035
896 Ga0501044_0149670 3300049823 Bacteria 2317
897 Ga0501044_0354073 3300049823 Bacteria 1387
898 Ga0501045_0001157 3300049824 Bacteria 17488
899 nmdc:mga00v17_165526_c1 3300050491 Bacteria 1425
900 nmdc:mga00v17_756254_c1 3300050491 Bacteria 621
901 nmdc:mga00v17_775155_c1 3300050491 Bacteria 612
902 nmdc:mga0sz30_30610_c1 3300050516 Bacteria 1633
903 Ga0500572_000098 3300053111 Bacteria 28591
904 Ga0500618_087567 3300053125 Bacteria 699
905 Ga0500588_0259659 3300053146 Bacteria 653
906 Ga0500634_0008406 3300053161 Bacteria 5161
907 Ga0500634_0014043 3300053161 Bacteria 4219

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0570533 Ga0496109_0570533_36_431 131
2 3300005564 Ga0070664_100049387 Ga0070664_1000493873 134
3 3300005577 Ga0068857_100048691 Ga0068857_1000486913 134
4 3300005834 Ga0068851_10061353 Ga0068851_100613532 134
5 3300013307 Ga0157372_10301429 Ga0157372_103014292 134
6 3300025932 Ga0207690_10147328 Ga0207690_101473283 134
7 3300025981 Ga0207640_10785137 Ga0207640_107851371 134
8 3300026116 Ga0207674_10131926 Ga0207674_101319262 134
9 3300048916 Ga0496113_0501664 Ga0496113_0501664_92_580 134
10 3300041512 Ga0451853_1348293 Ga0451853_1348293_890_1378 145
11 3300046523 Ga0495644_0391979 Ga0495644_0391979_74_514 146
12 3300035170 Ga0373943_0355845 Ga0373943_0355845_325_813 149
13 3300046538 Ga0495609_0339242 Ga0495609_0339242_126_590 154
14 iso_pu_bacteria 2585428062 2587757594 154
15 3300005355 Ga0070671_100000637 Ga0070671_10000063713 155
16 3300005456 Ga0070678_100121698 Ga0070678_1001216984 155
17 3300005543 Ga0070672_100499828 Ga0070672_1004998282 155
18 3300005618 Ga0068864_100010339 Ga0068864_1000103394 155
19 3300005841 Ga0068863_100114679 Ga0068863_1001146793 155
20 3300006237 Ga0097621_100001820 Ga0097621_1000018204 155
21 3300006358 Ga0068871_100001548 Ga0068871_1000015482 155
22 3300006881 Ga0068865_100284987 Ga0068865_1002849872 155
23 3300009177 Ga0105248_10000754 Ga0105248_1000075418 155
24 3300013296 Ga0157374_10041915 Ga0157374_100419154 155
25 3300014325 Ga0163163_10048001 Ga0163163_100480014 155
26 3300014968 Ga0157379_10452086 Ga0157379_104520862 155
27 3300025931 Ga0207644_10000239 Ga0207644_1000023920 155
28 3300025940 Ga0207691_10149243 Ga0207691_101492432 155
29 3300025941 Ga0207711_10001648 Ga0207711_1000164811 155
30 3300026088 Ga0207641_10097955 Ga0207641_100979553 155
31 3300026095 Ga0207676_10010197 Ga0207676_100101974 155
32 3300026121 Ga0207683_10218777 Ga0207683_102187774 155
33 3300041452 Ga0451793_1290228 Ga0451793_1290228_565_1032 155
34 3300041453 Ga0451797_0000881 Ga0451797_0000881_290_757 155
35 3300041456 Ga0451795_0889389 Ga0451795_0889389_943_1410 155
36 3300041459 Ga0451800_0078036 Ga0451800_0078036_561_1028 155
37 3300041460 Ga0451802_1759861 Ga0451802_1759861_940_1407 155
38 3300041486 Ga0451807_2596559 Ga0451807_2596559_706_1173 155
39 3300041498 Ga0451841_0510840 Ga0451841_0510840_238_705 155
40 3300046512 Ga0495610_0068247 Ga0495610_0068247_646_1113 155
41 3300046660 Ga0495625_0002783 Ga0495625_0002783_7899_8366 155
42 3300048911 Ga0496108_0436234 Ga0496108_0436234_146_634 155
43 iso_pu_bacteria 2511231004 2511252977 158
44 iso_pu_bacteria 2511231008 2511276924 158
45 iso_pu_bacteria 2511231011 2511297146 158
46 iso_pu_bacteria 2511231019 2511346871 158
47 iso_pu_bacteria 2511231021 2511358564 158
48 iso_pu_bacteria 2511231022 2511360707 158
49 iso_pu_bacteria 2511231023 2511371261 158
50 iso_pu_bacteria 2554235231 2555248419 158
51 iso_pu_bacteria 2597489888 2597864584 158
52 iso_pu_bacteria 2599185188 2599501517 158
53 iso_pu_bacteria 2599185300 2599931564 158
54 iso_pu_bacteria 2599185318 2600034142 158
55 iso_pu_bacteria 2600255296 2601690119 158
56 iso_pu_bacteria 2619619299 2621298901 158
57 iso_pu_bacteria 2643221633 2644189206 158
58 iso_pu_bacteria 2643221713 2644622710 158
59 iso_pu_bacteria 2713897148 2715753406 158
60 iso_pu_bacteria 2718217725 2718633702 158
61 iso_pu_bacteria 2738541265 2738672148 158
62 iso_pu_bacteria 2738541282 2738750541 158
63 iso_pu_bacteria 2738541303 2738859582 158
64 iso_pu_bacteria 2738543025 2739315301 158
65 iso_pu_bacteria 2773857673 2774134262 158
66 iso_pu_bacteria 2784132063 2784263952 158
67 iso_pu_bacteria 2791355520 2794596945 158
68 iso_pu_bacteria 2808606445 2809215192 158
69 iso_pu_bacteria 2816332298 2817491937 158
70 iso_pu_bacteria 2818991456 2819657856 158
71 iso_pu_bacteria 2842826826 2842828278 158
72 iso_pu_bacteria 2842837860 2842841114 158
73 iso_pu_bacteria 2842843487 2842844030 158
74 iso_pu_bacteria 2844665904 2844670119 158
75 iso_pu_bacteria 2904518522 2904523163 158
76 iso_pu_bacteria 2919385768 2919387413 158
77 iso_pu_bacteria 2919456309 2919460271 158
78 iso_pu_bacteria 2919487758 2919492125 158
79 iso_pu_bacteria 2931396565 2931402577 158
80 iso_pu_bacteria 2946006987 2946009097 158
81 iso_pu_bacteria 2969304461 2969306852 158
82 iso_pu_bacteria 2974289157 2974290524 158
83 iso_pu_bacteria 3007419365 3007422366 158
84 iso_pu_bacteria 3007614139 3007615561 158
85 iso_pu_bacteria 3007855910 3007857450 158
86 iso_pu_bacteria 3007861166 3007862411 158
87 iso_pu_bacteria 8054347763 8054348999 158
88 iso_pu_bacteria 8054503363 8054506938 158
89 iso_pu_bacteria 8056120720 8056124211 158
90 iso_pu_bacteria 8056155041 8056156929 158
91 iso_pu_bacteria 8056177738 8056184036 158
92 iso_pu_bacteria 2842718218 2842719656 159
93 iso_pu_bacteria 2974320154 2974323724 159
94 3300006051 Ga0075364_10010694 Ga0075364_100106944 161
95 3300006186 Ga0075369_10033998 Ga0075369_100339984 161
96 3300006195 Ga0075366_10008074 Ga0075366_100080742 161
97 3300006195 Ga0075366_10357139 Ga0075366_103571392 161
98 3300006353 Ga0075370_10517856 Ga0075370_105178562 161
99 3300031730 Ga0307516_10002395 Ga0307516_100023959 161
100 3300041459 Ga0451800_1611696 Ga0451800_1611696_380_865 161
101 3300041463 Ga0451804_0864686 Ga0451804_0864686_151_636 161
102 3300050491 nmdc:mga00v17_165526_c1 nmdc:mga00v17_165526_c1_274_762 161
103 3300050516 nmdc:mga0sz30_30610_c1 nmdc:mga0sz30_30610_c1_301_789 161
104 2124908027 MRS2a_Contig_11 MRS2a_00012060 162
105 2162886007 SwRhRL2b_contig_2158200 SwRhRL2b_0805.00005140 162
106 3300003751 Ga0055538_1000072 Ga0055538_100007267 162
107 3300003752 Ga0055539_1000107 Ga0055539_100010767 162
108 3300003756 Ga0055533_1000116 Ga0055533_100011667 162
109 3300003758 Ga0055532_1000103 Ga0055532_100010314 162
110 3300003759 Ga0055525_1000160 Ga0055525_100016064 162
111 3300003791 Ga0055530_10003531 Ga0055530_100035317 162
112 3300003791 Ga0055530_10004968 Ga0055530_100049684 162
113 3300003792 Ga0055540_1000025 Ga0055540_1000025109 162
114 3300003794 Ga0055531_10000908 Ga0055531_1000090830 162
115 3300003841 Ga0055541_1000073 Ga0055541_100007367 162
116 3300005288 Ga0065714_10081418 Ga0065714_100814182 162
117 3300005288 Ga0065714_10115291 Ga0065714_101152912 162
118 3300005288 Ga0065714_10281302 Ga0065714_102813021 162
119 3300005289 Ga0065704_10071148 Ga0065704_100711485 162
120 3300005289 Ga0065704_10191821 Ga0065704_101918211 162
121 3300005290 Ga0065712_10068170 Ga0065712_1006817012 162
122 3300005331 Ga0070670_100587528 Ga0070670_1005875282 162
123 3300005344 Ga0070661_100000036 Ga0070661_10000003693 162
124 3300005353 Ga0070669_100426162 Ga0070669_1004261622 162
125 3300005354 Ga0070675_100572588 Ga0070675_1005725882 162
126 3300005364 Ga0070673_100339593 Ga0070673_1003395932 162
127 3300005367 Ga0070667_100060190 Ga0070667_1000601903 162
128 3300005457 Ga0070662_100468413 Ga0070662_1004684132 162
129 3300005457 Ga0070662_101179763 Ga0070662_1011797631 162
130 3300005530 Ga0070679_100021582 Ga0070679_1000215825 162
131 3300005548 Ga0070665_100046745 Ga0070665_1000467456 162
132 3300005564 Ga0070664_100000196 Ga0070664_1000001965 162
133 3300005614 Ga0068856_100057620 Ga0068856_1000576205 162
134 3300005618 Ga0068864_100002319 Ga0068864_10000231918 162
135 3300005840 Ga0068870_10455556 Ga0068870_104555562 162
136 3300005841 Ga0068863_100130895 Ga0068863_1001308952 162
137 3300005841 Ga0068863_101686091 Ga0068863_1016860912 162
138 3300005842 Ga0068858_100615286 Ga0068858_1006152862 162
139 3300006051 Ga0075364_10116734 Ga0075364_101167343 162
140 3300006058 Ga0075432_10000641 Ga0075432_100006414 162
141 3300006058 Ga0075432_10002583 Ga0075432_1000258310 162
142 3300006058 Ga0075432_10048254 Ga0075432_100482542 162
143 3300006237 Ga0097621_100275102 Ga0097621_1002751023 162
144 3300006946 Ga0079104_1005372 Ga0079104_10053724 162
145 3300009011 Ga0105251_10000215 Ga0105251_1000021529 162
146 3300009011 Ga0105251_10004389 Ga0105251_1000438913 162
147 3300009011 Ga0105251_10008785 Ga0105251_100087852 162
148 3300009011 Ga0105251_10095965 Ga0105251_100959652 162
149 3300009011 Ga0105251_10161519 Ga0105251_101615192 162
150 3300009011 Ga0105251_10252590 Ga0105251_102525902 162
151 3300009036 Ga0105244_10001409 Ga0105244_1000140915 162
152 3300009036 Ga0105244_10004151 Ga0105244_100041512 162
153 3300009036 Ga0105244_10006184 Ga0105244_1000618413 162
154 3300009036 Ga0105244_10015485 Ga0105244_100154852 162
155 3300009036 Ga0105244_10024227 Ga0105244_100242274 162
156 3300009036 Ga0105244_10038525 Ga0105244_100385252 162
157 3300009092 Ga0105250_10000220 Ga0105250_1000022021 162
158 3300009092 Ga0105250_10000779 Ga0105250_1000077915 162
159 3300009092 Ga0105250_10028423 Ga0105250_100284231 162
160 3300009092 Ga0105250_10055243 Ga0105250_100552433 162
161 3300009092 Ga0105250_10069872 Ga0105250_100698722 162
162 3300009092 Ga0105250_10137324 Ga0105250_101373243 162
163 3300009092 Ga0105250_10190343 Ga0105250_101903432 162
164 3300009148 Ga0105243_10003857 Ga0105243_100038573 162
165 3300009176 Ga0105242_10002467 Ga0105242_100024678 162
166 3300009176 Ga0105242_10007649 Ga0105242_100076494 162
167 3300009176 Ga0105242_10088625 Ga0105242_100886252 162
168 3300009176 Ga0105242_10805057 Ga0105242_108050572 162
169 3300009545 Ga0105237_10002958 Ga0105237_100029584 162
170 3300009551 Ga0105238_10116250 Ga0105238_101162504 162
171 3300011119 Ga0105246_10000047 Ga0105246_1000004710 162
172 3300011119 Ga0105246_10044852 Ga0105246_100448521 162
173 3300012498 Ga0157345_1000005 Ga0157345_100000549 162
174 3300013100 Ga0157373_10003922 Ga0157373_100039224 162
175 3300013100 Ga0157373_10008225 Ga0157373_100082257 162
176 3300013100 Ga0157373_10045419 Ga0157373_100454191 162
177 3300013100 Ga0157373_10147272 Ga0157373_101472722 162
178 3300013102 Ga0157371_10000495 Ga0157371_1000049542 162
179 3300013102 Ga0157371_10001153 Ga0157371_1000115320 162
180 3300013102 Ga0157371_10012726 Ga0157371_100127263 162
181 3300013102 Ga0157371_10666519 Ga0157371_106665191 162
182 3300013104 Ga0157370_10021932 Ga0157370_100219329 162
183 3300013104 Ga0157370_10024292 Ga0157370_1002429211 162
184 3300013104 Ga0157370_10039597 Ga0157370_100395972 162
185 3300013104 Ga0157370_10355208 Ga0157370_103552083 162
186 3300013104 Ga0157370_10438809 Ga0157370_104388092 162
187 3300013104 Ga0157370_10569620 Ga0157370_105696202 162
188 3300013105 Ga0157369_10002276 Ga0157369_1000227630 162
189 3300013105 Ga0157369_10005515 Ga0157369_100055157 162
190 3300013105 Ga0157369_10052478 Ga0157369_100524784 162
191 3300013105 Ga0157369_10091110 Ga0157369_100911103 162
192 3300013296 Ga0157374_11009310 Ga0157374_110093102 162
193 3300013306 Ga0163162_10000053 Ga0163162_1000005357 162
194 3300013306 Ga0163162_10030067 Ga0163162_100300678 162
195 3300013306 Ga0163162_10278181 Ga0163162_102781813 162
196 3300013306 Ga0163162_10930956 Ga0163162_109309562 162
197 3300013307 Ga0157372_10004202 Ga0157372_1000420217 162
198 3300013307 Ga0157372_10012947 Ga0157372_100129475 162
199 3300013307 Ga0157372_10089783 Ga0157372_100897834 162
200 3300013308 Ga0157375_10269831 Ga0157375_102698312 162
201 3300013308 Ga0157375_10381566 Ga0157375_103815662 162
202 3300013308 Ga0157375_10511266 Ga0157375_105112663 162
203 3300013308 Ga0157375_10547528 Ga0157375_105475282 162
204 3300013308 Ga0157375_11203134 Ga0157375_112031342 162
205 3300014497 Ga0182008_10001113 Ga0182008_1000111314 162
206 3300014497 Ga0182008_10005448 Ga0182008_100054484 162
207 3300014497 Ga0182008_10012173 Ga0182008_100121736 162
208 3300014497 Ga0182008_10289953 Ga0182008_102899531 162
209 3300014969 Ga0157376_11417709 Ga0157376_114177092 162
210 3300015261 Ga0182006_1000439 Ga0182006_100043926 162
211 3300015261 Ga0182006_1005254 Ga0182006_100525413 162
212 3300015261 Ga0182006_1028381 Ga0182006_10283811 162
213 3300015261 Ga0182006_1074142 Ga0182006_10741422 162
214 3300015261 Ga0182006_1258529 Ga0182006_12585291 162
215 3300015262 Ga0182007_10000321 Ga0182007_1000032131 162
216 3300015265 Ga0182005_1001170 Ga0182005_10011704 162
217 3300015265 Ga0182005_1024901 Ga0182005_10249012 162
218 3300015265 Ga0182005_1025671 Ga0182005_10256712 162
219 3300015265 Ga0182005_1052170 Ga0182005_10521702 162
220 3300015265 Ga0182005_1093520 Ga0182005_10935201 162
221 3300015265 Ga0182005_1093578 Ga0182005_10935781 162
222 3300017792 Ga0163161_10000236 Ga0163161_1000023653 162
223 3300017792 Ga0163161_10010044 Ga0163161_100100442 162
224 3300017792 Ga0163161_10016114 Ga0163161_100161142 162
225 3300017792 Ga0163161_10056946 Ga0163161_100569462 162
226 3300017792 Ga0163161_10069629 Ga0163161_100696295 162
227 3300017792 Ga0163161_10107217 Ga0163161_101072172 162
228 3300017792 Ga0163161_10123272 Ga0163161_101232724 162
229 3300017792 Ga0163161_10159182 Ga0163161_101591822 162
230 3300017792 Ga0163161_10228072 Ga0163161_102280721 162
231 3300017792 Ga0163161_10784088 Ga0163161_107840882 162
232 3300025206 Ga0209435_100636 Ga0209435_1006363 162
233 3300025224 Ga0209784_100110 Ga0209784_10011014 162
234 3300025225 Ga0209566_100131 Ga0209566_10013114 162
235 3300025226 Ga0209674_100154 Ga0209674_10015414 162
236 3300025229 Ga0209147_100158 Ga0209147_10015814 162
237 3300025230 Ga0209563_100133 Ga0209563_10013314 162
238 3300025230 Ga0209563_102729 Ga0209563_1027296 162
239 3300025242 Ga0209258_100260 Ga0209258_10026068 162
240 3300025246 Ga0209646_1000482 Ga0209646_100048214 162
241 3300025253 Ga0209677_100100 Ga0209677_10010014 162
242 3300025256 Ga0209759_1036057 Ga0209759_10360571 162
243 3300025292 Ga0209676_1000002 Ga0209676_1000002602 162
244 3300025292 Ga0209676_1000050 Ga0209676_1000050302 162
245 3300025298 Ga0209050_1000006 Ga0209050_1000006968 162
246 3300025303 Ga0209051_1000001 Ga0209051_1000001602 162
247 3300025304 Ga0209257_1000056 Ga0209257_1000056271 162
248 3300025711 Ga0207696_1000002 Ga0207696_1000002274 162
249 3300025711 Ga0207696_1000011 Ga0207696_1000011257 162
250 3300025711 Ga0207696_1000609 Ga0207696_10006092 162
251 3300025711 Ga0207696_1003010 Ga0207696_10030104 162
252 3300025711 Ga0207696_1109631 Ga0207696_11096311 162
253 3300025728 Ga0207655_1000006 Ga0207655_1000006279 162
254 3300025728 Ga0207655_1000141 Ga0207655_100014180 162
255 3300025728 Ga0207655_1000173 Ga0207655_10001736 162
256 3300025728 Ga0207655_1011012 Ga0207655_10110127 162
257 3300025728 Ga0207655_1013266 Ga0207655_10132664 162
258 3300025728 Ga0207655_1023717 Ga0207655_10237174 162
259 3300025728 Ga0207655_1044190 Ga0207655_10441903 162
260 3300025735 Ga0207713_1000162 Ga0207713_100016266 162
261 3300025735 Ga0207713_1001533 Ga0207713_10015339 162
262 3300025735 Ga0207713_1004739 Ga0207713_100473912 162
263 3300025735 Ga0207713_1015743 Ga0207713_10157436 162
264 3300025735 Ga0207713_1018973 Ga0207713_10189735 162
265 3300025735 Ga0207713_1040568 Ga0207713_10405683 162
266 3300025735 Ga0207713_1046500 Ga0207713_10465002 162
267 3300025735 Ga0207713_1119943 Ga0207713_11199432 162
268 3300025735 Ga0207713_1167256 Ga0207713_11672561 162
269 3300025893 Ga0207682_10006506 Ga0207682_100065065 162
270 3300025901 Ga0207688_10347145 Ga0207688_103471452 162
271 3300025903 Ga0207680_10039990 Ga0207680_100399903 162
272 3300025914 Ga0207671_10000196 Ga0207671_1000019618 162
273 3300025920 Ga0207649_10000042 Ga0207649_10000042101 162
274 3300025921 Ga0207652_10071782 Ga0207652_100717824 162
275 3300025923 Ga0207681_10046130 Ga0207681_100461302 162
276 3300025923 Ga0207681_10190807 Ga0207681_101908072 162
277 3300025925 Ga0207650_10387855 Ga0207650_103878552 162
278 3300025931 Ga0207644_10322173 Ga0207644_103221733 162
279 3300025931 Ga0207644_10763242 Ga0207644_107632422 162
280 3300025934 Ga0207686_10001247 Ga0207686_100012472 162
281 3300025934 Ga0207686_10019041 Ga0207686_100190414 162
282 3300025935 Ga0207709_10000014 Ga0207709_10000014125 162
283 3300025935 Ga0207709_10183021 Ga0207709_101830212 162
284 3300025940 Ga0207691_10085330 Ga0207691_100853302 162
285 3300025945 Ga0207679_10000044 Ga0207679_1000004417 162
286 3300025960 Ga0207651_10009955 Ga0207651_100099555 162
287 3300025960 Ga0207651_10345229 Ga0207651_103452291 162
288 3300025986 Ga0207658_10079652 Ga0207658_100796523 162
289 3300025986 Ga0207658_10654339 Ga0207658_106543392 162
290 3300026035 Ga0207703_10336113 Ga0207703_103361133 162
291 3300026078 Ga0207702_10020021 Ga0207702_100200214 162
292 3300026088 Ga0207641_10205383 Ga0207641_102053832 162
293 3300026088 Ga0207641_10811228 Ga0207641_108112282 162
294 3300026089 Ga0207648_10027124 Ga0207648_100271244 162
295 3300026089 Ga0207648_10820201 Ga0207648_108202012 162
296 3300026095 Ga0207676_10401827 Ga0207676_104018272 162
297 3300026121 Ga0207683_10011601 Ga0207683_100116015 162
298 3300027111 Ga0209281_1005517 Ga0209281_10055174 162
299 3300027552 Ga0209982_1019906 Ga0209982_10199062 162
300 3300027665 Ga0209983_1052314 Ga0209983_10523141 162
301 3300027682 Ga0209971_1003630 Ga0209971_10036304 162
302 3300027907 Ga0207428_10067991 Ga0207428_100679912 162
303 3300027907 Ga0207428_10094143 Ga0207428_100941432 162
304 3300027907 Ga0207428_10228314 Ga0207428_102283143 162
305 3300028379 Ga0268266_10119144 Ga0268266_101191442 162
306 3300028379 Ga0268266_11500151 Ga0268266_115001511 162
307 3300028379 Ga0268266_11577658 Ga0268266_115776582 162
308 3300028573 Ga0265334_10033239 Ga0265334_100332392 162
309 3300028786 Ga0307517_10073118 Ga0307517_100731184 162
310 3300028794 Ga0307515_10008027 Ga0307515_100080274 162
311 3300030521 Ga0307511_10209695 Ga0307511_102096952 162
312 3300030521 Ga0307511_10377852 Ga0307511_103778521 162
313 3300031235 Ga0265330_10000254 Ga0265330_1000025433 162
314 3300031238 Ga0265332_10000001 Ga0265332_10000001447 162
315 3300031240 Ga0265320_10024395 Ga0265320_100243953 162
316 3300031241 Ga0265325_10004203 Ga0265325_100042037 162
317 3300031247 Ga0265340_10015534 Ga0265340_100155344 162
318 3300031251 Ga0265327_10020866 Ga0265327_100208666 162
319 3300031456 Ga0307513_10015575 Ga0307513_100155754 162
320 3300031548 Ga0307408_100000213 Ga0307408_10000021359 162
321 3300031548 Ga0307408_100015639 Ga0307408_1000156394 162
322 3300031548 Ga0307408_100143359 Ga0307408_1001433592 162
323 3300031649 Ga0307514_10004601 Ga0307514_100046015 162
324 3300031711 Ga0265314_10000013 Ga0265314_10000013372 162
325 3300031731 Ga0307405_10708085 Ga0307405_107080852 162
326 3300031824 Ga0307413_10086102 Ga0307413_100861022 162
327 3300031903 Ga0307407_10567439 Ga0307407_105674391 162
328 3300031911 Ga0307412_10007330 Ga0307412_1000733012 162
329 3300031911 Ga0307412_10012389 Ga0307412_100123894 162
330 3300031995 Ga0307409_100121100 Ga0307409_1001211003 162
331 3300032004 Ga0307414_10006300 Ga0307414_100063004 162
332 3300032005 Ga0307411_10134266 Ga0307411_101342664 162
333 3300033180 Ga0307510_10016826 Ga0307510_100168264 162
334 3300033180 Ga0307510_10085330 Ga0307510_100853302 162
335 3300033180 Ga0307510_10517635 Ga0307510_105176351 162
336 3300038705 Ga0237819_01372 Ga0237819_01372_3644_4132 162
337 3300041405 Ga0439438_000551 Ga0439438_000551_10111_10599 162
338 3300041405 Ga0439438_003481 Ga0439438_003481_3554_4042 162
339 3300041405 Ga0439438_007475 Ga0439438_007475_918_1406 162
340 3300041405 Ga0439438_010898 Ga0439438_010898_1658_2146 162
341 3300041405 Ga0439438_011432 Ga0439438_011432_1794_2282 162
342 3300041405 Ga0439438_025059 Ga0439438_025059_490_978 162
343 3300041407 Ga0439447_000541 Ga0439447_000541_3993_4481 162
344 3300041407 Ga0439447_003917 Ga0439447_003917_4021_4509 162
345 3300041411 Ga0439466_0003602 Ga0439466_0003602_1147_1635 162
346 3300041411 Ga0439466_0005834 Ga0439466_0005834_2280_2768 162
347 3300041411 Ga0439466_0010124 Ga0439466_0010124_1693_2181 162
348 3300041411 Ga0439466_0039877 Ga0439466_0039877_1018_1506 162
349 3300041411 Ga0439466_0118519 Ga0439466_0118519_35_523 162
350 3300041413 Ga0439465_0028172 Ga0439465_0028172_915_1403 162
351 3300041501 Ga0451845_0948365 Ga0451845_0948365_127_615 162
352 3300041997 Ga0439431_0021943 Ga0439431_0021943_931_1419 162
353 3300042004 Ga0439445_0014895 Ga0439445_0014895_761_1249 162
354 3300042004 Ga0439445_0057191 Ga0439445_0057191_138_626 162
355 3300042006 Ga0439432_003851 Ga0439432_003851_3629_4117 162
356 3300042006 Ga0439432_023851 Ga0439432_023851_98_586 162
357 3300042006 Ga0439432_085282 Ga0439432_085282_266_754 162
358 3300042009 Ga0439451_005607 Ga0439451_005607_1541_2029 162
359 3300042009 Ga0439451_007192 Ga0439451_007192_1739_2227 162
360 3300042009 Ga0439451_033099 Ga0439451_033099_328_816 162
361 3300042009 Ga0439451_057446 Ga0439451_057446_67_555 162
362 3300042010 Ga0439452_000035 Ga0439452_000035_155768_156256 162
363 3300042010 Ga0439452_000075 Ga0439452_000075_70229_70717 162
364 3300042010 Ga0439452_004210 Ga0439452_004210_367_855 162
365 3300042010 Ga0439452_021959 Ga0439452_021959_1057_1545 162
366 3300042013 Ga0439456_000108 Ga0439456_000108_8871_9359 162
367 3300042013 Ga0439456_015788 Ga0439456_015788_403_891 162
368 3300042016 Ga0439463_001617 Ga0439463_001617_5130_5618 162
369 3300042016 Ga0439463_016736 Ga0439463_016736_357_845 162
370 3300042016 Ga0439463_049075 Ga0439463_049075_407_895 162
371 3300042115 Ga0450911_000034 Ga0450911_000034_33937_34425 162
372 3300042115 Ga0450911_006186 Ga0450911_006186_481_969 162
373 3300042121 Ga0450919_001824 Ga0450919_001824_1329_1817 162
374 3300042127 Ga0450890_002566 Ga0450890_002566_677_1165 162
375 3300042136 Ga0450900_004387 Ga0450900_004387_670_1158 162
376 3300042136 Ga0450900_055522 Ga0450900_055522_11_499 162
377 3300042137 Ga0450902_000140 Ga0450902_000140_6480_6968 162
378 3300042137 Ga0450902_005221 Ga0450902_005221_769_1257 162
379 3300042137 Ga0450902_017110 Ga0450902_017110_432_920 162
380 3300042137 Ga0450902_039295 Ga0450902_039295_129_617 162
381 3300042138 Ga0450903_004086 Ga0450903_004086_969_1457 162
382 3300042138 Ga0450903_004464 Ga0450903_004464_763_1251 162
383 3300042139 Ga0450904_003476 Ga0450904_003476_1149_1637 162
384 3300042142 Ga0450905_003019 Ga0450905_003019_1212_1700 162
385 3300042145 Ga0450906_000228 Ga0450906_000228_4013_4501 162
386 3300042145 Ga0450906_000505 Ga0450906_000505_1209_1697 162
387 3300042146 Ga0450907_000691 Ga0450907_000691_2388_2876 162
388 3300042147 Ga0450910_007432 Ga0450910_007432_817_1305 162
389 3300042147 Ga0450910_021594 Ga0450910_021594_452_940 162
390 3300042156 Ga0439446_0006401 Ga0439446_0006401_789_1277 162
391 3300042184 Ga0450908_004070 Ga0450908_004070_967_1455 162
392 3300042185 Ga0450909_000076 Ga0450909_000076_1168_1656 162
393 3300042461 Ga0439460_0002893 Ga0439460_0002893_723_1211 162
394 3300042461 Ga0439460_0002897 Ga0439460_0002897_2367_2855 162
395 3300042532 Ga0450893_0011468 Ga0450893_0011468_867_1355 162
396 3300046452 Ga0495617_000054 Ga0495617_000054_26366_26854 162
397 3300046452 Ga0495617_006783 Ga0495617_006783_1990_2478 162
398 3300046452 Ga0495617_007353 Ga0495617_007353_1997_2485 162
399 3300046452 Ga0495617_018172 Ga0495617_018172_1461_1949 162
400 3300046452 Ga0495617_021585 Ga0495617_021585_1558_2046 162
401 3300046452 Ga0495617_022371 Ga0495617_022371_492_980 162
402 3300046452 Ga0495617_038088 Ga0495617_038088_827_1315 162
403 3300046452 Ga0495617_049342 Ga0495617_049342_725_1213 162
404 3300046452 Ga0495617_062949 Ga0495617_062949_648_1136 162
405 3300046452 Ga0495617_067108 Ga0495617_067108_641_1129 162
406 3300046452 Ga0495617_172593 Ga0495617_172593_32_520 162
407 3300046453 Ga0495627_000308 Ga0495627_000308_21044_21532 162
408 3300046453 Ga0495627_000469 Ga0495627_000469_24489_24977 162
409 3300046453 Ga0495627_014835 Ga0495627_014835_1251_1739 162
410 3300046453 Ga0495627_038019 Ga0495627_038019_102_590 162
411 3300046453 Ga0495627_057710 Ga0495627_057710_585_1073 162
412 3300046454 Ga0495592_0221575 Ga0495592_0221575_692_1180 162
413 3300046455 Ga0495603_0006812 Ga0495603_0006812_5997_6485 162
414 3300046455 Ga0495603_0011087 Ga0495603_0011087_4159_4647 162
415 3300046457 Ga0495590_0000565 Ga0495590_0000565_10488_10976 162
416 3300046457 Ga0495590_0031117 Ga0495590_0031117_721_1209 162
417 3300046457 Ga0495590_0068272 Ga0495590_0068272_14_502 162
418 3300046457 Ga0495590_0119125 Ga0495590_0119125_121_609 162
419 3300046457 Ga0495590_0275563 Ga0495590_0275563_107_595 162
420 3300046458 Ga0495591_000049 Ga0495591_000049_110597_111085 162
421 3300046458 Ga0495591_000315 Ga0495591_000315_2421_2909 162
422 3300046458 Ga0495591_005393 Ga0495591_005393_2710_3198 162
423 3300046458 Ga0495591_007577 Ga0495591_007577_2417_2905 162
424 3300046458 Ga0495591_008339 Ga0495591_008339_420_908 162
425 3300046458 Ga0495591_017155 Ga0495591_017155_763_1251 162
426 3300046458 Ga0495591_018455 Ga0495591_018455_1266_1754 162
427 3300046458 Ga0495591_026248 Ga0495591_026248_1300_1788 162
428 3300046458 Ga0495591_028710 Ga0495591_028710_74_562 162
429 3300046458 Ga0495591_039981 Ga0495591_039981_795_1283 162
430 3300046458 Ga0495591_053299 Ga0495591_053299_40_528 162
431 3300046459 Ga0495629_0212783 Ga0495629_0212783_650_1138 162
432 3300046460 Ga0495638_0003397 Ga0495638_0003397_4396_4884 162
433 3300046460 Ga0495638_0015069 Ga0495638_0015069_2372_2860 162
434 3300046460 Ga0495638_0019698 Ga0495638_0019698_3178_3666 162
435 3300046460 Ga0495638_0033041 Ga0495638_0033041_2589_3077 162
436 3300046460 Ga0495638_0070714 Ga0495638_0070714_1212_1700 162
437 3300046460 Ga0495638_0076058 Ga0495638_0076058_1374_1862 162
438 3300046460 Ga0495638_0243176 Ga0495638_0243176_352_840 162
439 3300046463 Ga0495653_0000623 Ga0495653_0000623_7415_7903 162
440 3300046463 Ga0495653_0025566 Ga0495653_0025566_2695_3183 162
441 3300046463 Ga0495653_0189647 Ga0495653_0189647_51_539 162
442 3300046471 Ga0495650_0005012 Ga0495650_0005012_8104_8592 162
443 3300046471 Ga0495650_0013279 Ga0495650_0013279_1211_1699 162
444 3300046471 Ga0495650_0017298 Ga0495650_0017298_1264_1752 162
445 3300046471 Ga0495650_0024143 Ga0495650_0024143_960_1448 162
446 3300046471 Ga0495650_0029136 Ga0495650_0029136_1164_1652 162
447 3300046471 Ga0495650_0044093 Ga0495650_0044093_206_694 162
448 3300046471 Ga0495650_0044170 Ga0495650_0044170_316_804 162
449 3300046471 Ga0495650_0080924 Ga0495650_0080924_11_499 162
450 3300046471 Ga0495650_0091493 Ga0495650_0091493_621_1109 162
451 3300046471 Ga0495650_0224344 Ga0495650_0224344_26_514 162
452 3300046474 Ga0495605_0000129 Ga0495605_0000129_11225_11713 162
453 3300046474 Ga0495605_0000243 Ga0495605_0000243_29668_30156 162
454 3300046474 Ga0495605_0004248 Ga0495605_0004248_6289_6777 162
455 3300046474 Ga0495605_0010592 Ga0495605_0010592_2268_2756 162
456 3300046474 Ga0495605_0010933 Ga0495605_0010933_1341_1829 162
457 3300046474 Ga0495605_0012037 Ga0495605_0012037_1822_2310 162
458 3300046474 Ga0495605_0012458 Ga0495605_0012458_2002_2490 162
459 3300046474 Ga0495605_0020212 Ga0495605_0020212_1884_2372 162
460 3300046474 Ga0495605_0023649 Ga0495605_0023649_1767_2255 162
461 3300046474 Ga0495605_0056566 Ga0495605_0056566_140_628 162
462 3300046474 Ga0495605_0083352 Ga0495605_0083352_797_1285 162
463 3300046474 Ga0495605_0096424 Ga0495605_0096424_722_1210 162
464 3300046474 Ga0495605_0098098 Ga0495605_0098098_698_1186 162
465 3300046475 Ga0495639_0008167 Ga0495639_0008167_2475_2969 162
466 3300046475 Ga0495639_0012639 Ga0495639_0012639_2326_2814 162
467 3300046491 Ga0495584_0000675 Ga0495584_0000675_8020_8508 162
468 3300046491 Ga0495584_0002008 Ga0495584_0002008_10412_10900 162
469 3300046491 Ga0495584_0002098 Ga0495584_0002098_4007_4495 162
470 3300046491 Ga0495584_0010335 Ga0495584_0010335_2012_2500 162
471 3300046491 Ga0495584_0013964 Ga0495584_0013964_1321_1809 162
472 3300046491 Ga0495584_0021168 Ga0495584_0021168_1266_1754 162
473 3300046491 Ga0495584_0027513 Ga0495584_0027513_104_592 162
474 3300046491 Ga0495584_0030859 Ga0495584_0030859_666_1154 162
475 3300046491 Ga0495584_0037793 Ga0495584_0037793_1525_2013 162
476 3300046491 Ga0495584_0078035 Ga0495584_0078035_388_876 162
477 3300046491 Ga0495584_0201965 Ga0495584_0201965_45_533 162
478 3300046492 Ga0495585_0002571 Ga0495585_0002571_9934_10422 162
479 3300046492 Ga0495585_0002808 Ga0495585_0002808_2416_2904 162
480 3300046492 Ga0495585_0012477 Ga0495585_0012477_2924_3412 162
481 3300046492 Ga0495585_0016514 Ga0495585_0016514_2379_2867 162
482 3300046492 Ga0495585_0022313 Ga0495585_0022313_2162_2650 162
483 3300046492 Ga0495585_0026534 Ga0495585_0026534_1976_2464 162
484 3300046492 Ga0495585_0048627 Ga0495585_0048627_101_589 162
485 3300046492 Ga0495585_0049820 Ga0495585_0049820_888_1376 162
486 3300046492 Ga0495585_0051256 Ga0495585_0051256_726_1214 162
487 3300046492 Ga0495585_0062634 Ga0495585_0062634_1027_1515 162
488 3300046492 Ga0495585_0090288 Ga0495585_0090288_186_674 162
489 3300046492 Ga0495585_0115901 Ga0495585_0115901_643_1131 162
490 3300046499 Ga0495594_0015766 Ga0495594_0015766_2828_3316 162
491 3300046499 Ga0495594_0032815 Ga0495594_0032815_1943_2431 162
492 3300046499 Ga0495594_0080166 Ga0495594_0080166_814_1302 162
493 3300046499 Ga0495594_0093486 Ga0495594_0093486_755_1243 162
494 3300046499 Ga0495594_0193298 Ga0495594_0193298_659_1147 162
495 3300046499 Ga0495594_0453106 Ga0495594_0453106_107_595 162
496 3300046500 Ga0495596_0000052 Ga0495596_0000052_14299_14787 162
497 3300046500 Ga0495596_0032449 Ga0495596_0032449_1099_1587 162
498 3300046501 Ga0495607_0000185 Ga0495607_0000185_63917_64405 162
499 3300046501 Ga0495607_0001905 Ga0495607_0001905_7771_8259 162
500 3300046501 Ga0495607_0006290 Ga0495607_0006290_831_1319 162
501 3300046501 Ga0495607_0013159 Ga0495607_0013159_3538_4026 162
502 3300046501 Ga0495607_0014321 Ga0495607_0014321_2362_2850 162
503 3300046501 Ga0495607_0014331 Ga0495607_0014331_3059_3547 162
504 3300046501 Ga0495607_0015128 Ga0495607_0015128_2068_2556 162
505 3300046501 Ga0495607_0036677 Ga0495607_0036677_825_1313 162
506 3300046501 Ga0495607_0051014 Ga0495607_0051014_1205_1693 162
507 3300046501 Ga0495607_0051789 Ga0495607_0051789_1774_2262 162
508 3300046501 Ga0495607_0085063 Ga0495607_0085063_1151_1639 162
509 3300046501 Ga0495607_0110938 Ga0495607_0110938_673_1161 162
510 3300046501 Ga0495607_0118292 Ga0495607_0118292_580_1068 162
511 3300046501 Ga0495607_0131675 Ga0495607_0131675_10_498 162
512 3300046501 Ga0495607_0146425 Ga0495607_0146425_166_654 162
513 3300046501 Ga0495607_0206928 Ga0495607_0206928_326_814 162
514 3300046501 Ga0495607_0428251 Ga0495607_0428251_85_573 162
515 3300046506 Ga0495583_0000036 Ga0495583_0000036_139356_139844 162
516 3300046506 Ga0495583_0001087 Ga0495583_0001087_26902_27390 162
517 3300046506 Ga0495583_0007063 Ga0495583_0007063_1881_2369 162
518 3300046506 Ga0495583_0092676 Ga0495583_0092676_486_974 162
519 3300046506 Ga0495583_0235926 Ga0495583_0235926_28_516 162
520 3300046507 Ga0495606_0001230 Ga0495606_0001230_32902_33390 162
521 3300046507 Ga0495606_0009204 Ga0495606_0009204_2816_3304 162
522 3300046507 Ga0495606_0020717 Ga0495606_0020717_2283_2771 162
523 3300046507 Ga0495606_0076339 Ga0495606_0076339_882_1370 162
524 3300046507 Ga0495606_0095799 Ga0495606_0095799_1260_1748 162
525 3300046507 Ga0495606_0271554 Ga0495606_0271554_418_906 162
526 3300046507 Ga0495606_0273406 Ga0495606_0273406_90_578 162
527 3300046507 Ga0495606_0334019 Ga0495606_0334019_194_682 162
528 3300046512 Ga0495610_0003605 Ga0495610_0003605_7642_8130 162
529 3300046512 Ga0495610_0007583 Ga0495610_0007583_3577_4065 162
530 3300046512 Ga0495610_0008023 Ga0495610_0008023_6278_6766 162
531 3300046512 Ga0495610_0011549 Ga0495610_0011549_2413_2901 162
532 3300046512 Ga0495610_0011734 Ga0495610_0011734_1336_1824 162
533 3300046512 Ga0495610_0030690 Ga0495610_0030690_311_799 162
534 3300046512 Ga0495610_0036005 Ga0495610_0036005_124_612 162
535 3300046512 Ga0495610_0047622 Ga0495610_0047622_1160_1648 162
536 3300046512 Ga0495610_0060847 Ga0495610_0060847_829_1317 162
537 3300046512 Ga0495610_0126056 Ga0495610_0126056_503_991 162
538 3300046512 Ga0495610_0238728 Ga0495610_0238728_90_578 162
539 3300046513 Ga0495616_0000226 Ga0495616_0000226_2420_2908 162
540 3300046513 Ga0495616_0000871 Ga0495616_0000871_7973_8461 162
541 3300046513 Ga0495616_0009438 Ga0495616_0009438_4351_4839 162
542 3300046513 Ga0495616_0012775 Ga0495616_0012775_1914_2402 162
543 3300046513 Ga0495616_0018241 Ga0495616_0018241_1304_1792 162
544 3300046513 Ga0495616_0019518 Ga0495616_0019518_437_925 162
545 3300046513 Ga0495616_0028009 Ga0495616_0028009_308_796 162
546 3300046513 Ga0495616_0077732 Ga0495616_0077732_209_697 162
547 3300046515 Ga0495620_0000022 Ga0495620_0000022_29574_30062 162
548 3300046515 Ga0495620_0000064 Ga0495620_0000064_23570_24058 162
549 3300046515 Ga0495620_0000991 Ga0495620_0000991_14925_15413 162
550 3300046515 Ga0495620_0028418 Ga0495620_0028418_1286_1774 162
551 3300046515 Ga0495620_0055133 Ga0495620_0055133_214_702 162
552 3300046515 Ga0495620_0061925 Ga0495620_0061925_723_1211 162
553 3300046517 Ga0495630_0141330 Ga0495630_0141330_700_1188 162
554 3300046517 Ga0495630_0168244 Ga0495630_0168244_1012_1500 162
555 3300046518 Ga0495631_0000002 Ga0495631_0000002_68669_69157 162
556 3300046518 Ga0495631_0000255 Ga0495631_0000255_35388_35876 162
557 3300046518 Ga0495631_0015271 Ga0495631_0015271_2064_2552 162
558 3300046518 Ga0495631_0049137 Ga0495631_0049137_1023_1511 162
559 3300046518 Ga0495631_0109743 Ga0495631_0109743_69_557 162
560 3300046518 Ga0495631_0116836 Ga0495631_0116836_295_783 162
561 3300046518 Ga0495631_0126828 Ga0495631_0126828_180_668 162
562 3300046519 Ga0495632_0000590 Ga0495632_0000590_8453_8941 162
563 3300046519 Ga0495632_0013345 Ga0495632_0013345_1471_1959 162
564 3300046519 Ga0495632_0013582 Ga0495632_0013582_1614_2102 162
565 3300046519 Ga0495632_0016234 Ga0495632_0016234_1255_1743 162
566 3300046519 Ga0495632_0018402 Ga0495632_0018402_2900_3388 162
567 3300046519 Ga0495632_0018438 Ga0495632_0018438_1443_1931 162
568 3300046519 Ga0495632_0024589 Ga0495632_0024589_856_1344 162
569 3300046519 Ga0495632_0030717 Ga0495632_0030717_404_892 162
570 3300046519 Ga0495632_0031654 Ga0495632_0031654_928_1416 162
571 3300046519 Ga0495632_0035282 Ga0495632_0035282_774_1262 162
572 3300046519 Ga0495632_0087446 Ga0495632_0087446_836_1324 162
573 3300046519 Ga0495632_0143830 Ga0495632_0143830_523_1011 162
574 3300046520 Ga0495637_0002284 Ga0495637_0002284_17_505 162
575 3300046520 Ga0495637_0002303 Ga0495637_0002303_6893_7381 162
576 3300046520 Ga0495637_0003391 Ga0495637_0003391_6589_7077 162
577 3300046520 Ga0495637_0003870 Ga0495637_0003870_1206_1694 162
578 3300046520 Ga0495637_0011454 Ga0495637_0011454_2405_2893 162
579 3300046520 Ga0495637_0012508 Ga0495637_0012508_2425_2913 162
580 3300046520 Ga0495637_0019970 Ga0495637_0019970_2069_2557 162
581 3300046520 Ga0495637_0021643 Ga0495637_0021643_1180_1668 162
582 3300046520 Ga0495637_0023890 Ga0495637_0023890_1085_1573 162
583 3300046520 Ga0495637_0027125 Ga0495637_0027125_1466_1954 162
584 3300046520 Ga0495637_0029094 Ga0495637_0029094_641_1129 162
585 3300046520 Ga0495637_0032107 Ga0495637_0032107_1181_1669 162
586 3300046520 Ga0495637_0049899 Ga0495637_0049899_1163_1651 162
587 3300046520 Ga0495637_0069590 Ga0495637_0069590_48_536 162
588 3300046522 Ga0495643_0004554 Ga0495643_0004554_8330_8818 162
589 3300046522 Ga0495643_0017426 Ga0495643_0017426_1211_1699 162
590 3300046522 Ga0495643_0018751 Ga0495643_0018751_1247_1735 162
591 3300046522 Ga0495643_0041987 Ga0495643_0041987_428_916 162
592 3300046522 Ga0495643_0060763 Ga0495643_0060763_654_1142 162
593 3300046522 Ga0495643_0076015 Ga0495643_0076015_105_593 162
594 3300046522 Ga0495643_0104461 Ga0495643_0104461_135_623 162
595 3300046522 Ga0495643_0114800 Ga0495643_0114800_569_1063 162
596 3300046522 Ga0495643_0129310 Ga0495643_0129310_61_549 162
597 3300046522 Ga0495643_0130560 Ga0495643_0130560_38_526 162
598 3300046522 Ga0495643_0139108 Ga0495643_0139108_215_703 162
599 3300046522 Ga0495643_0226303 Ga0495643_0226303_238_726 162
600 3300046523 Ga0495644_0001171 Ga0495644_0001171_3855_4343 162
601 3300046523 Ga0495644_0001342 Ga0495644_0001342_7160_7648 162
602 3300046523 Ga0495644_0004995 Ga0495644_0004995_3304_3792 162
603 3300046523 Ga0495644_0026639 Ga0495644_0026639_38_526 162
604 3300046523 Ga0495644_0182257 Ga0495644_0182257_116_604 162
605 3300046524 Ga0495648_0010309 Ga0495648_0010309_4004_4492 162
606 3300046524 Ga0495648_0015656 Ga0495648_0015656_947_1435 162
607 3300046524 Ga0495648_0022193 Ga0495648_0022193_1405_1893 162
608 3300046524 Ga0495648_0023262 Ga0495648_0023262_1344_1832 162
609 3300046524 Ga0495648_0036028 Ga0495648_0036028_1083_1571 162
610 3300046524 Ga0495648_0038919 Ga0495648_0038919_1564_2052 162
611 3300046524 Ga0495648_0041449 Ga0495648_0041449_1415_1903 162
612 3300046524 Ga0495648_0043288 Ga0495648_0043288_1070_1558 162
613 3300046524 Ga0495648_0045831 Ga0495648_0045831_1087_1575 162
614 3300046524 Ga0495648_0070517 Ga0495648_0070517_723_1211 162
615 3300046524 Ga0495648_0134006 Ga0495648_0134006_226_714 162
616 3300046526 Ga0495666_0000945 Ga0495666_0000945_10837_11325 162
617 3300046526 Ga0495666_0015083 Ga0495666_0015083_768_1256 162
618 3300046526 Ga0495666_0021971 Ga0495666_0021971_753_1241 162
619 3300046526 Ga0495666_0098256 Ga0495666_0098256_664_1152 162
620 3300046526 Ga0495666_0139444 Ga0495666_0139444_483_971 162
621 3300046528 Ga0495642_0000452 Ga0495642_0000452_18690_19178 162
622 3300046528 Ga0495642_0001151 Ga0495642_0001151_8124_8612 162
623 3300046528 Ga0495642_0045546 Ga0495642_0045546_1076_1570 162
624 3300046530 Ga0495654_0000306 Ga0495654_0000306_40522_41010 162
625 3300046530 Ga0495654_0001228 Ga0495654_0001228_10649_11137 162
626 3300046530 Ga0495654_0002904 Ga0495654_0002904_4799_5287 162
627 3300046530 Ga0495654_0004438 Ga0495654_0004438_1695_2183 162
628 3300046530 Ga0495654_0029564 Ga0495654_0029564_893_1381 162
629 3300046530 Ga0495654_0040179 Ga0495654_0040179_1226_1714 162
630 3300046530 Ga0495654_0073790 Ga0495654_0073790_397_885 162
631 3300046530 Ga0495654_0233582 Ga0495654_0233582_66_554 162
632 3300046536 Ga0495587_0008755 Ga0495587_0008755_5406_5894 162
633 3300046536 Ga0495587_0119958 Ga0495587_0119958_114_602 162
634 3300046536 Ga0495587_0392092 Ga0495587_0392092_185_673 162
635 3300046538 Ga0495609_0000029 Ga0495609_0000029_138241_138729 162
636 3300046538 Ga0495609_0001135 Ga0495609_0001135_3871_4359 162
637 3300046538 Ga0495609_0002166 Ga0495609_0002166_9385_9873 162
638 3300046538 Ga0495609_0005538 Ga0495609_0005538_5058_5546 162
639 3300046538 Ga0495609_0008670 Ga0495609_0008670_2396_2884 162
640 3300046538 Ga0495609_0009098 Ga0495609_0009098_3771_4259 162
641 3300046538 Ga0495609_0072539 Ga0495609_0072539_769_1257 162
642 3300046538 Ga0495609_0092988 Ga0495609_0092988_200_688 162
643 3300046538 Ga0495609_0291862 Ga0495609_0291862_21_509 162
644 3300046542 Ga0495597_0000446 Ga0495597_0000446_4141_4629 162
645 3300046542 Ga0495597_0001165 Ga0495597_0001165_1164_1652 162
646 3300046542 Ga0495597_0005117 Ga0495597_0005117_2431_2919 162
647 3300046542 Ga0495597_0006368 Ga0495597_0006368_5574_6062 162
648 3300046542 Ga0495597_0006973 Ga0495597_0006973_825_1313 162
649 3300046542 Ga0495597_0010889 Ga0495597_0010889_2848_3336 162
650 3300046542 Ga0495597_0013051 Ga0495597_0013051_1086_1574 162
651 3300046542 Ga0495597_0022017 Ga0495597_0022017_352_840 162
652 3300046542 Ga0495597_0040214 Ga0495597_0040214_1233_1721 162
653 3300046542 Ga0495597_0044504 Ga0495597_0044504_1403_1891 162
654 3300046542 Ga0495597_0077602 Ga0495597_0077602_412_900 162
655 3300046542 Ga0495597_0078375 Ga0495597_0078375_840_1328 162
656 3300046542 Ga0495597_0094309 Ga0495597_0094309_91_579 162
657 3300046542 Ga0495597_0104688 Ga0495597_0104688_33_521 162
658 3300046543 Ga0495645_0339805 Ga0495645_0339805_225_719 162
659 3300046543 Ga0495645_0570407 Ga0495645_0570407_132_620 162
660 3300046557 Ga0495622_0002416 Ga0495622_0002416_6894_7382 162
661 3300046557 Ga0495622_0021544 Ga0495622_0021544_2416_2904 162
662 3300046557 Ga0495622_0024166 Ga0495622_0024166_298_786 162
663 3300046557 Ga0495622_0136695 Ga0495622_0136695_404_892 162
664 3300046558 Ga0495633_0000656 Ga0495633_0000656_4283_4771 162
665 3300046558 Ga0495633_0001085 Ga0495633_0001085_11998_12486 162
666 3300046558 Ga0495633_0014912 Ga0495633_0014912_939_1427 162
667 3300046615 Ga0495656_0009253 Ga0495656_0009253_460_948 162
668 3300046615 Ga0495656_0015752 Ga0495656_0015752_1923_2411 162
669 3300046615 Ga0495656_0152956 Ga0495656_0152956_354_842 162
670 3300046616 Ga0495668_0002469 Ga0495668_0002469_428_916 162
671 3300046616 Ga0495668_0017097 Ga0495668_0017097_1231_1719 162
672 3300046616 Ga0495668_0175498 Ga0495668_0175498_153_641 162
673 3300046616 Ga0495668_0504944 Ga0495668_0504944_123_611 162
674 3300046642 Ga0495634_0000025 Ga0495634_0000025_112721_113209 162
675 3300046648 Ga0495611_0000016 Ga0495611_0000016_45414_45902 162
676 3300046648 Ga0495611_0015950 Ga0495611_0015950_825_1313 162
677 3300046648 Ga0495611_0019649 Ga0495611_0019649_1866_2354 162
678 3300046648 Ga0495611_0083476 Ga0495611_0083476_904_1392 162
679 3300046648 Ga0495611_0275959 Ga0495611_0275959_93_581 162
680 3300046660 Ga0495625_0000847 Ga0495625_0000847_38887_39375 162
681 3300046660 Ga0495625_0007378 Ga0495625_0007378_5161_5649 162
682 3300046660 Ga0495625_0018805 Ga0495625_0018805_2481_2969 162
683 3300046660 Ga0495625_0038509 Ga0495625_0038509_1822_2310 162
684 3300046660 Ga0495625_0040842 Ga0495625_0040842_2218_2706 162
685 3300046660 Ga0495625_0074176 Ga0495625_0074176_1430_1918 162
686 3300046660 Ga0495625_0093248 Ga0495625_0093248_185_673 162
687 3300046660 Ga0495625_0099490 Ga0495625_0099490_690_1178 162
688 3300046660 Ga0495625_0259505 Ga0495625_0259505_216_704 162
689 3300046660 Ga0495625_0278399 Ga0495625_0278399_46_534 162
690 3300046660 Ga0495625_0280775 Ga0495625_0280775_443_931 162
691 3300046660 Ga0495625_0514002 Ga0495625_0514002_186_674 162
692 3300046663 Ga0495635_0024897 Ga0495635_0024897_2942_3430 162
693 3300046664 Ga0495659_0000585 Ga0495659_0000585_5676_6164 162
694 3300046664 Ga0495659_0029007 Ga0495659_0029007_518_1006 162
695 3300046664 Ga0495659_0094680 Ga0495659_0094680_509_997 162
696 3300046665 Ga0495661_0008496 Ga0495661_0008496_1795_2283 162
697 3300046665 Ga0495661_0043632 Ga0495661_0043632_1283_1771 162
698 3300046665 Ga0495661_0069205 Ga0495661_0069205_958_1446 162
699 3300046665 Ga0495661_0074003 Ga0495661_0074003_633_1121 162
700 3300046665 Ga0495661_0074447 Ga0495661_0074447_171_659 162
701 3300046674 Ga0495588_0198646 Ga0495588_0198646_325_819 162
702 3300046679 Ga0495623_0017131 Ga0495623_0017131_1170_1658 162
703 3300046679 Ga0495623_0033682 Ga0495623_0033682_1971_2459 162
704 3300046680 Ga0495646_0013790 Ga0495646_0013790_3213_3701 162
705 3300046680 Ga0495646_0043466 Ga0495646_0043466_825_1313 162
706 3300046684 Ga0495669_0001360 Ga0495669_0001360_6871_7359 162
707 3300046689 Ga0495613_0205392 Ga0495613_0205392_139_627 162
708 3300046690 Ga0495624_0000112 Ga0495624_0000112_33791_34279 162
709 3300046691 Ga0495670_0001525 Ga0495670_0001525_1439_1927 162
710 3300046691 Ga0495670_0001801 Ga0495670_0001801_6141_6629 162
711 3300046691 Ga0495670_0005371 Ga0495670_0005371_516_1004 162
712 3300046691 Ga0495670_0007595 Ga0495670_0007595_2447_2935 162
713 3300046691 Ga0495670_0019900 Ga0495670_0019900_2381_2869 162
714 3300046691 Ga0495670_0090640 Ga0495670_0090640_697_1185 162
715 3300046692 Ga0495671_0000295 Ga0495671_0000295_37233_37721 162
716 3300046692 Ga0495671_0010549 Ga0495671_0010549_2163_2651 162
717 3300046692 Ga0495671_0014212 Ga0495671_0014212_1345_1833 162
718 3300046692 Ga0495671_0014491 Ga0495671_0014491_955_1443 162
719 3300046692 Ga0495671_0017741 Ga0495671_0017741_408_896 162
720 3300046692 Ga0495671_0018492 Ga0495671_0018492_2650_3138 162
721 3300046692 Ga0495671_0033821 Ga0495671_0033821_1442_1930 162
722 3300046692 Ga0495671_0034850 Ga0495671_0034850_240_728 162
723 3300046692 Ga0495671_0036773 Ga0495671_0036773_105_593 162
724 3300046692 Ga0495671_0053911 Ga0495671_0053911_572_1060 162
725 3300046692 Ga0495671_0080835 Ga0495671_0080835_249_737 162
726 3300046692 Ga0495671_0120939 Ga0495671_0120939_773_1261 162
727 3300046692 Ga0495671_0233799 Ga0495671_0233799_164_652 162
728 3300046692 Ga0495671_0331955 Ga0495671_0331955_36_524 162
729 3300046694 Ga0495649_0000013 Ga0495649_0000013_158249_158737 162
730 3300046694 Ga0495649_0008874 Ga0495649_0008874_2353_2841 162
731 3300046694 Ga0495649_0010929 Ga0495649_0010929_2395_2883 162
732 3300046694 Ga0495649_0024715 Ga0495649_0024715_856_1344 162
733 3300046694 Ga0495649_0035923 Ga0495649_0035923_1998_2486 162
734 3300046694 Ga0495649_0122342 Ga0495649_0122342_219_707 162
735 3300046694 Ga0495649_0158651 Ga0495649_0158651_681_1169 162
736 3300046694 Ga0495649_0162532 Ga0495649_0162532_340_828 162
737 3300046694 Ga0495649_0164780 Ga0495649_0164780_638_1126 162
738 3300046694 Ga0495649_0261699 Ga0495649_0261699_108_596 162
739 3300046694 Ga0495649_0267825 Ga0495649_0267825_24_512 162
740 3300046794 Ga0495589_0000662 Ga0495589_0000662_11983_12471 162
741 3300046794 Ga0495589_0001215 Ga0495589_0001215_11129_11617 162
742 3300046794 Ga0495589_0005374 Ga0495589_0005374_4985_5473 162
743 3300046794 Ga0495589_0011783 Ga0495589_0011783_1381_1869 162
744 3300046794 Ga0495589_0046039 Ga0495589_0046039_1105_1593 162
745 3300046794 Ga0495589_0163845 Ga0495589_0163845_27_515 162
746 3300046809 Ga0495600_0104185 Ga0495600_0104185_704_1192 162
747 3300046810 Ga0495660_0000440 Ga0495660_0000440_9594_10082 162
748 3300046810 Ga0495660_0000546 Ga0495660_0000546_28408_28896 162
749 3300046810 Ga0495660_0002137 Ga0495660_0002137_10902_11390 162
750 3300046810 Ga0495660_0009893 Ga0495660_0009893_2323_2811 162
751 3300046810 Ga0495660_0015516 Ga0495660_0015516_988_1476 162
752 3300046810 Ga0495660_0025305 Ga0495660_0025305_2489_2977 162
753 3300046810 Ga0495660_0030209 Ga0495660_0030209_1181_1669 162
754 3300046810 Ga0495660_0037562 Ga0495660_0037562_1108_1596 162
755 3300046810 Ga0495660_0037801 Ga0495660_0037801_972_1460 162
756 3300046810 Ga0495660_0043560 Ga0495660_0043560_692_1180 162
757 3300046810 Ga0495660_0067922 Ga0495660_0067922_1240_1728 162
758 3300046810 Ga0495660_0078401 Ga0495660_0078401_96_584 162
759 3300046810 Ga0495660_0126442 Ga0495660_0126442_687_1175 162
760 3300046810 Ga0495660_0145240 Ga0495660_0145240_534_1022 162
761 3300046810 Ga0495660_0150565 Ga0495660_0150565_16_504 162
762 3300046810 Ga0495660_0155154 Ga0495660_0155154_89_577 162
763 3300046810 Ga0495660_0182256 Ga0495660_0182256_497_985 162
764 3300046810 Ga0495660_0260680 Ga0495660_0260680_97_585 162
765 3300047315 Ga0495581_0140655 Ga0495581_0140655_881_1375 162
766 3300047317 Ga0495604_0045194 Ga0495604_0045194_2181_2669 162
767 3300047317 Ga0495604_0722112 Ga0495604_0722112_51_539 162
768 3300047318 Ga0495636_0000685 Ga0495636_0000685_6590_7078 162
769 3300047318 Ga0495636_0045708 Ga0495636_0045708_536_1024 162
770 3300047319 Ga0495674_0007823 Ga0495674_0007823_7841_8329 162
771 3300047320 Ga0495672_0001135 Ga0495672_0001135_791_1279 162
772 3300047320 Ga0495672_0002589 Ga0495672_0002589_12547_13035 162
773 3300047320 Ga0495672_0004163 Ga0495672_0004163_3297_3785 162
774 3300047320 Ga0495672_0005494 Ga0495672_0005494_2083_2571 162
775 3300047320 Ga0495672_0005592 Ga0495672_0005592_2293_2781 162
776 3300047320 Ga0495672_0006155 Ga0495672_0006155_6791_7279 162
777 3300047320 Ga0495672_0012521 Ga0495672_0012521_948_1436 162
778 3300047320 Ga0495672_0014704 Ga0495672_0014704_4783_5271 162
779 3300047320 Ga0495672_0030096 Ga0495672_0030096_556_1044 162
780 3300047320 Ga0495672_0075739 Ga0495672_0075739_300_788 162
781 3300047320 Ga0495672_0107707 Ga0495672_0107707_873_1361 162
782 3300047320 Ga0495672_0114900 Ga0495672_0114900_750_1238 162
783 3300047320 Ga0495672_0132089 Ga0495672_0132089_179_667 162
784 3300047321 Ga0495676_0005239 Ga0495676_0005239_2383_2871 162
785 3300047321 Ga0495676_0202770 Ga0495676_0202770_231_719 162
786 3300047322 Ga0495680_0003983 Ga0495680_0003983_1091_1579 162
787 3300047322 Ga0495680_0034099 Ga0495680_0034099_3043_3531 162
788 3300047322 Ga0495680_0046725 Ga0495680_0046725_2527_3015 162
789 3300047322 Ga0495680_0472042 Ga0495680_0472042_313_801 162
790 3300047323 Ga0495683_0000037 Ga0495683_0000037_69001_69489 162
791 3300047323 Ga0495683_0000045 Ga0495683_0000045_106457_106945 162
792 3300047323 Ga0495683_0013304 Ga0495683_0013304_2630_3118 162
793 3300047323 Ga0495683_0040976 Ga0495683_0040976_1742_2230 162
794 3300047323 Ga0495683_0062381 Ga0495683_0062381_1061_1549 162
795 3300047323 Ga0495683_0066092 Ga0495683_0066092_717_1205 162
796 3300047323 Ga0495683_0079216 Ga0495683_0079216_854_1342 162
797 3300047323 Ga0495683_0094780 Ga0495683_0094780_853_1341 162
798 3300047323 Ga0495683_0122388 Ga0495683_0122388_89_577 162
799 3300047443 Ga0495687_002708 Ga0495687_002708_6529_7017 162
800 3300047443 Ga0495687_026015 Ga0495687_026015_1413_1901 162
801 3300047444 Ga0495675_0103772 Ga0495675_0103772_846_1334 162
802 3300047445 Ga0495677_0021698 Ga0495677_0021698_1303_1791 162
803 3300047446 Ga0495679_001891 Ga0495679_001891_2816_3304 162
804 3300047446 Ga0495679_004379 Ga0495679_004379_4930_5418 162
805 3300047446 Ga0495679_004932 Ga0495679_004932_4885_5373 162
806 3300047446 Ga0495679_006644 Ga0495679_006644_2421_2909 162
807 3300047446 Ga0495679_008868 Ga0495679_008868_1181_1669 162
808 3300047446 Ga0495679_008932 Ga0495679_008932_1239_1727 162
809 3300047446 Ga0495679_035154 Ga0495679_035154_369_857 162
810 3300047447 Ga0495685_008953 Ga0495685_008953_1081_1569 162
811 3300047469 Ga0495673_0000093 Ga0495673_0000093_120974_121462 162
812 3300047469 Ga0495673_0000308 Ga0495673_0000308_21829_22317 162
813 3300047469 Ga0495673_0002211 Ga0495673_0002211_11716_12204 162
814 3300047469 Ga0495673_0003379 Ga0495673_0003379_7168_7656 162
815 3300047469 Ga0495673_0005219 Ga0495673_0005219_2516_3004 162
816 3300047469 Ga0495673_0006345 Ga0495673_0006345_3660_4148 162
817 3300047469 Ga0495673_0013949 Ga0495673_0013949_1086_1574 162
818 3300047469 Ga0495673_0017603 Ga0495673_0017603_2105_2593 162
819 3300047469 Ga0495673_0024537 Ga0495673_0024537_1239_1727 162
820 3300047469 Ga0495673_0025248 Ga0495673_0025248_2270_2758 162
821 3300047469 Ga0495673_0039600 Ga0495673_0039600_249_737 162
822 3300047469 Ga0495673_0043916 Ga0495673_0043916_184_672 162
823 3300047469 Ga0495673_0047675 Ga0495673_0047675_881_1369 162
824 3300047469 Ga0495673_0047784 Ga0495673_0047784_338_826 162
825 3300047470 Ga0495681_0000237 Ga0495681_0000237_40060_40548 162
826 3300047470 Ga0495681_0001053 Ga0495681_0001053_280_768 162
827 3300047470 Ga0495681_0001249 Ga0495681_0001249_3599_4087 162
828 3300047470 Ga0495681_0003182 Ga0495681_0003182_1242_1730 162
829 3300047470 Ga0495681_0010169 Ga0495681_0010169_2180_2668 162
830 3300047470 Ga0495681_0012349 Ga0495681_0012349_1664_2152 162
831 3300047470 Ga0495681_0015495 Ga0495681_0015495_225_713 162
832 3300047470 Ga0495681_0052419 Ga0495681_0052419_1166_1654 162
833 3300047470 Ga0495681_0067197 Ga0495681_0067197_450_938 162
834 3300047470 Ga0495681_0113034 Ga0495681_0113034_623_1111 162
835 3300047470 Ga0495681_0134354 Ga0495681_0134354_233_721 162
836 3300047470 Ga0495681_0137427 Ga0495681_0137427_471_959 162
837 3300047470 Ga0495681_0174954 Ga0495681_0174954_152_640 162
838 3300047470 Ga0495681_0209888 Ga0495681_0209888_121_609 162
839 3300047470 Ga0495681_0267399 Ga0495681_0267399_77_565 162
840 3300047470 Ga0495681_0297718 Ga0495681_0297718_37_525 162
841 3300047471 Ga0495684_0031905 Ga0495684_0031905_2543_3031 162
842 3300047472 Ga0495686_0005414 Ga0495686_0005414_7236_7724 162
843 3300047472 Ga0495686_0016927 Ga0495686_0016927_2392_2880 162
844 3300047472 Ga0495686_0037142 Ga0495686_0037142_1226_1714 162
845 3300047673 Ga0495593_0017232 Ga0495593_0017232_2583_3071 162
846 3300047673 Ga0495593_0018905 Ga0495593_0018905_2730_3218 162
847 3300048088 Ga0495602_0003606 Ga0495602_0003606_13189_13677 162
848 3300048089 Ga0495614_0187775 Ga0495614_0187775_166_654 162
849 3300048091 Ga0495626_0000057 Ga0495626_0000057_105091_105579 162
850 3300048091 Ga0495626_0000065 Ga0495626_0000065_8598_9086 162
851 3300048091 Ga0495626_0000352 Ga0495626_0000352_1724_2212 162
852 3300048091 Ga0495626_0000672 Ga0495626_0000672_8261_8749 162
853 3300048091 Ga0495626_0000814 Ga0495626_0000814_20410_20898 162
854 3300048091 Ga0495626_0014939 Ga0495626_0014939_980_1468 162
855 3300048091 Ga0495626_0019122 Ga0495626_0019122_1217_1705 162
856 3300048091 Ga0495626_0035296 Ga0495626_0035296_143_631 162
857 3300048091 Ga0495626_0075449 Ga0495626_0075449_951_1439 162
858 3300048091 Ga0495626_0084752 Ga0495626_0084752_635_1123 162
859 3300048091 Ga0495626_0377306 Ga0495626_0377306_27_515 162
860 3300048903 Ga0496100_0001162 Ga0496100_0001162_10939_11433 162
861 3300048903 Ga0496100_0763085 Ga0496100_0763085_40_528 162
862 3300048904 Ga0496101_0046761 Ga0496101_0046761_1725_2219 162
863 3300048905 Ga0496102_0000038 Ga0496102_0000038_183277_183765 162
864 3300048905 Ga0496102_0031392 Ga0496102_0031392_2049_2543 162
865 3300048905 Ga0496102_0557006 Ga0496102_0557006_525_1013 162
866 3300048906 Ga0496103_0004289 Ga0496103_0004289_7208_7696 162
867 3300048906 Ga0496103_0020811 Ga0496103_0020811_1500_1994 162
868 3300048907 Ga0496104_0029910 Ga0496104_0029910_799_1293 162
869 3300048908 Ga0496105_0007175 Ga0496105_0007175_4807_5301 162
870 3300048909 Ga0496106_0560583 Ga0496106_0560583_24_512 162
871 3300048913 Ga0496110_0062933 Ga0496110_0062933_486_974 162
872 3300048913 Ga0496110_0192397 Ga0496110_0192397_14_508 162
873 3300048918 Ga0496115_0778962 Ga0496115_0778962_137_625 162
874 3300048919 Ga0496116_0000697 Ga0496116_0000697_40630_41118 162
875 3300048919 Ga0496116_0000984 Ga0496116_0000984_24221_24709 162
876 3300048919 Ga0496116_0026080 Ga0496116_0026080_1296_1784 162
877 3300048919 Ga0496116_0061342 Ga0496116_0061342_249_737 162
878 3300048919 Ga0496116_0353659 Ga0496116_0353659_126_614 162
879 3300048920 Ga0496117_0015585 Ga0496117_0015585_3375_3863 162
880 3300048920 Ga0496117_0020617 Ga0496117_0020617_2366_2854 162
881 3300048920 Ga0496117_0020699 Ga0496117_0020699_3648_4136 162
882 3300048920 Ga0496117_0090234 Ga0496117_0090234_1363_1851 162
883 3300048921 Ga0496118_0014321 Ga0496118_0014321_5057_5545 162
884 3300048921 Ga0496118_0034456 Ga0496118_0034456_2470_2958 162
885 3300048921 Ga0496118_0061394 Ga0496118_0061394_2092_2580 162
886 3300048921 Ga0496118_0077938 Ga0496118_0077938_1212_1700 162
887 3300048922 Ga0496119_0002931 Ga0496119_0002931_14444_14932 162
888 3300048922 Ga0496119_0046580 Ga0496119_0046580_667_1155 162
889 3300048922 Ga0496119_0115889 Ga0496119_0115889_45_533 162
890 3300048923 Ga0496120_0002634 Ga0496120_0002634_14450_14938 162
891 3300048923 Ga0496120_0014492 Ga0496120_0014492_2462_2950 162
892 3300048924 Ga0496121_0009654 Ga0496121_0009654_9180_9668 162
893 3300048924 Ga0496121_0027656 Ga0496121_0027656_2414_2902 162
894 3300048924 Ga0496121_0087004 Ga0496121_0087004_669_1157 162
895 3300048924 Ga0496121_0168908 Ga0496121_0168908_984_1472 162
896 3300048924 Ga0496121_0221102 Ga0496121_0221102_629_1117 162
897 3300048925 Ga0496122_0012213 Ga0496122_0012213_685_1173 162
898 3300048925 Ga0496122_0020618 Ga0496122_0020618_4187_4675 162
899 3300048925 Ga0496122_0075881 Ga0496122_0075881_45_533 162
900 3300048925 Ga0496122_0094975 Ga0496122_0094975_692_1180 162
901 3300048925 Ga0496122_0359624 Ga0496122_0359624_131_622 162
902 3300048925 Ga0496122_0390376 Ga0496122_0390376_72_560 162
903 3300048926 Ga0496123_0017505 Ga0496123_0017505_5256_5744 162
904 3300048926 Ga0496123_0058600 Ga0496123_0058600_1803_2291 162
905 3300048926 Ga0496123_0065210 Ga0496123_0065210_155_643 162
906 3300048926 Ga0496123_0078774 Ga0496123_0078774_837_1325 162
907 3300048926 Ga0496123_0158014 Ga0496123_0158014_33_521 162
908 3300048927 Ga0496124_0000280 Ga0496124_0000280_45287_45775 162
909 3300048927 Ga0496124_0005884 Ga0496124_0005884_2910_3398 162
910 3300048927 Ga0496124_0123398 Ga0496124_0123398_870_1358 162
911 3300048927 Ga0496124_0170499 Ga0496124_0170499_920_1408 162
912 3300048927 Ga0496124_0339664 Ga0496124_0339664_80_568 162
913 3300048928 Ga0496125_0073594 Ga0496125_0073594_1897_2385 162
914 3300048928 Ga0496125_0123829 Ga0496125_0123829_1255_1743 162
915 3300048928 Ga0496125_0168797 Ga0496125_0168797_412_900 162
916 3300048929 Ga0496126_0131501 Ga0496126_0131501_903_1391 162
917 3300048929 Ga0496126_0541146 Ga0496126_0541146_58_546 162
918 3300049459 Ga0495678_000037 Ga0495678_000037_106062_106550 162
919 3300049459 Ga0495678_000724 Ga0495678_000724_27075_27563 162
920 3300049459 Ga0495678_003450 Ga0495678_003450_1289_1777 162
921 3300049459 Ga0495678_003588 Ga0495678_003588_2279_2767 162
922 3300049459 Ga0495678_005730 Ga0495678_005730_1267_1755 162
923 3300049459 Ga0495678_009065 Ga0495678_009065_2676_3164 162
924 3300049459 Ga0495678_011439 Ga0495678_011439_1319_1807 162
925 3300049459 Ga0495678_014198 Ga0495678_014198_2085_2573 162
926 3300049459 Ga0495678_020150 Ga0495678_020150_1006_1494 162
927 3300049459 Ga0495678_029485 Ga0495678_029485_886_1374 162
928 3300049459 Ga0495678_032474 Ga0495678_032474_1096_1584 162
929 3300049459 Ga0495678_055919 Ga0495678_055919_849_1337 162
930 3300049459 Ga0495678_058489 Ga0495678_058489_811_1299 162
931 3300049459 Ga0495678_092348 Ga0495678_092348_152_640 162
932 3300049459 Ga0495678_223437 Ga0495678_223437_55_543 162
933 3300049460 Ga0495682_0000018 Ga0495682_0000018_86785_87273 162
934 3300049460 Ga0495682_0010022 Ga0495682_0010022_2186_2674 162
935 3300049460 Ga0495682_0014102 Ga0495682_0014102_1407_1895 162
936 3300049460 Ga0495682_0043506 Ga0495682_0043506_54_542 162
937 3300049460 Ga0495682_0066134 Ga0495682_0066134_520_1008 162
938 3300049460 Ga0495682_0082466 Ga0495682_0082466_78_566 162
939 3300049569 Ga0501032_0213572 Ga0501032_0213572_63_551 162
940 3300049571 Ga0501034_0194349 Ga0501034_0194349_32_523 162
941 3300049571 Ga0501034_0766518 Ga0501034_0766518_101_589 162
942 3300049573 Ga0501037_0098741 Ga0501037_0098741_110_598 162
943 3300049578 Ga0501042_0277521 Ga0501042_0277521_566_1054 162
944 3300049579 Ga0501043_0000573 Ga0501043_0000573_23287_23775 162
945 3300049580 Ga0501046_0000752 Ga0501046_0000752_23335_23823 162
946 3300049581 Ga0501047_0000298 Ga0501047_0000298_23234_23722 162
947 3300049582 Ga0501048_0008752 Ga0501048_0008752_1162_1650 162
948 3300049586 Ga0501070_0316704 Ga0501070_0316704_282_821 162
949 3300049758 Ga0501241_000058 Ga0501241_000058_979_1467 162
950 3300049823 Ga0501044_0149670 Ga0501044_0149670_1151_1639 162
951 3300049823 Ga0501044_0354073 Ga0501044_0354073_375_863 162
952 3300049824 Ga0501045_0001157 Ga0501045_0001157_8014_8502 162
953 3300050491 nmdc:mga00v17_756254_c1 nmdc:mga00v17_756254_c1_48_536 162
954 3300050491 nmdc:mga00v17_775155_c1 nmdc:mga00v17_775155_c1_86_574 162
955 3300053111 Ga0500572_000098 Ga0500572_000098_27303_27791 162
956 3300053125 Ga0500618_087567 Ga0500618_087567_120_608 162
957 3300053146 Ga0500588_0259659 Ga0500588_0259659_106_594 162
958 3300053161 Ga0500634_0008406 Ga0500634_0008406_1769_2257 162
959 3300053161 Ga0500634_0014043 Ga0500634_0014043_965_1456 162
960 iso_pu_bacteria 2547132374 2548501082 162
961 iso_pu_bacteria 2643221717 2644645824 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

12

160

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aw0-assembly1.cif.gz_A fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures 0.8068 91 136
6fp6-assembly1.cif.gz_B complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7842 92 153
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.782 1 47
6fp6-assembly7.cif.gz_N complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7699 92 154
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.7672 91 156
ID Description Score Start End Superfamily
af_A0A1D6MTC1_251_315_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7903 91 154 3.30.70.100
af_A0A0R0FWJ2_12_66_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7818 91 140 3.30.70.100
af_G5EE14_42_116_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7759 92 148 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7732 93 150 3.30.70.100
af_Q9SHQ8_11_77_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.769 89 155 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q5U9K9-F1-model_v4 deleted 0.9398 72 162
AF-A0A2N5ZWE4-F1-model_v4 Na+/H+ antiporter subunit E 0.9357 59 161 GO:0005886
GO:0008324
AF-A0A6I7QKZ5-F1-model_v4 Na+/H+ antiporter subunit E 0.9275 59 162 GO:0005886
GO:0008324
AF-A0A1G0HJN3-F1-model_v4 Sodium:proton antiporter 0.922 59 159 GO:0005886
GO:0008324
AF-A0A0W0VSQ4-F1-model_v4 Na(+)/H(+) antiporter subunit E 0.9212 59 158 GO:0005886
GO:0008324

Feature Viewer

pLDDT pTM Quality
84.85 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map