F486788

General Info

Members Datasets Scaffolds Average Seq Length
958 758 453 277

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1025531|Ga0006562J51391_10255311
Length 293
Sequence MNKAEETAACVIARSKVTLPAMEPGHVWLVGAGPGDPGLLTLHAVNALQQADVIVYDALVDDACLSLKNADAVLEYAGKRGGKPSPKQRDISLRLVELAKSGKKVLRLKGGDPFVFGRGAEEALTLVEHGIPFRIVPGVTAGIGGLAYAGIAATHRDINQSVTFLTGHDASGSMPDGINWTGIAKSAPIIVMYMAMKHIDLIARRLIEAGRSPDEPVAFVCNASLPNQIVLETTLARAAKDVEAAGLNPPAIVVVGEVVRLRAGLDWMGALNGKILSSDPLARRNQNEGVRSA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
25 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
29 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
30 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
31 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
32 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
33 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
34 2516143018 Ensifer sp. BR816 Isolate Nodule
35 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
42 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681786 Brucella suis 92/29 Isolate Unclassified
45 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
46 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
47 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
48 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
49 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
50 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
51 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
52 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
53 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
54 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
55 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
56 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
60 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
61 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
62 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
63 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
64 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
65 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
66 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
67 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
68 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
69 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
70 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
71 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
72 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
73 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
74 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
75 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
76 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
77 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
78 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
79 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
80 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
81 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
82 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
83 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
84 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
85 2643221557 Ensifer sp. Root558 Isolate Unclassified
86 2643221599 Rhizobium sp. Root708 Isolate Unclassified
87 2643221607 Rhizobium sp. Root73 Isolate Unclassified
88 2643221610 Ensifer sp. Root74 Isolate Unclassified
89 2643221618 Ensifer sp. Root231 Isolate Unclassified
90 2643221626 Ensifer sp. Root31 Isolate Unclassified
91 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
92 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
93 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
94 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
95 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
96 2643221655 Ensifer sp. Root1252 Isolate Unclassified
97 2643221659 Ensifer sp. Root127 Isolate Unclassified
98 2643221668 Ensifer sp. Root423 Isolate Unclassified
99 2643221675 Ensifer sp. Root1298 Isolate Unclassified
100 2643221680 Ensifer sp. Root1312 Isolate Unclassified
101 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
102 2643221688 Rhizobium sp. Root482 Isolate Unclassified
103 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
104 2643221698 Ensifer sp. Root142 Isolate Unclassified
105 2643221712 Ensifer sp. Root258 Isolate Unclassified
106 2643221718 Rhizobium sp. Root268 Isolate Unclassified
107 2643221719 Rhizobium sp. Root274 Isolate Unclassified
108 2643221723 Ensifer sp. Root278 Isolate Unclassified
109 2643221726 Ensifer sp. Root954 Isolate Unclassified
110 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
111 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
112 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
113 2718217882 Rhizobium sp. N741 Isolate Nodule
114 2718217927 Rhizobium sp. N324 Isolate Nodule
115 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
116 2718218009 Rhizobium sp. N561 Isolate Nodule
117 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
118 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
119 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
120 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
121 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
122 2718218363 Rhizobium sp. N113 Isolate Nodule
123 2718218365 Rhizobium sp. N731 Isolate Nodule
124 2718218366 Rhizobium sp. N621 Isolate Nodule
125 2718218423 Rhizobium sp. N941 Isolate Nodule
126 2721755514 Rhizobium sp. N6212 Isolate Nodule
127 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
128 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
129 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
130 2721755809 Rhizobium sp. N541 Isolate Nodule
131 2721755810 Rhizobium sp. N871 Isolate Nodule
132 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
133 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
134 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
135 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
136 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
137 2728369365 Rhizobium sp. N1341 Isolate Nodule
138 2728369397 Rhizobium sp. N1314 Isolate Nodule
139 2738541293 Rhizobium sp. GV031 Isolate Unclassified
140 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
141 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
142 2751185800 Brucella pituitosa AA2 Isolate Unclassified
143 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
144 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
145 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
146 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
147 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
148 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
149 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
150 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
151 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
152 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
153 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
154 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
155 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
156 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
157 2791355256 Rhizobium sp. M10 Isolate Nodule
158 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
159 2791355260 Rhizobium sp. L9 Isolate Nodule
160 2791355261 Rhizobium sp. J15 Isolate Nodule
161 2791355262 Rhizobium sp. M1 Isolate Nodule
162 2791355263 Rhizobium chutanense C5 Isolate Nodule
163 2791355264 Rhizobium sp. S9 Isolate Nodule
164 2791355265 Rhizobium sp. H4 Isolate Nodule
165 2791355266 Rhizobium sp. L43 Isolate Nodule
166 2791355267 Rhizobium sp. L18 Isolate Nodule
167 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
168 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
169 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
170 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
171 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
172 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
173 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
174 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
175 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
176 2802429633 Rhizobium anhuiense J3 Isolate Nodule
177 2802429634 Rhizobium anhuiense S10 Isolate Nodule
178 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
179 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
180 2802429637 Rhizobium anhuiense C15 Isolate Nodule
181 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
182 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
183 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
184 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
185 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
186 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
187 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
188 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
189 2838048938 Rhizobium pisi 27/80 Isolate Nodule
190 2838061910 Rhizobium phaseoli L15 Isolate Nodule
191 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
192 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
193 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
194 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
195 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
196 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
197 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
198 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
199 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
200 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
201 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
202 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
203 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
204 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
205 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
206 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
207 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
208 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
209 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
210 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
211 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
212 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
213 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
214 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
215 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
216 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
217 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
218 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
219 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
220 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
221 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
222 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
223 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
224 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
225 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
226 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
227 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
228 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
229 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
230 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
231 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
232 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
233 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
234 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
235 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
236 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
237 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
238 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
239 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
240 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
241 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
242 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
243 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
244 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
245 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
246 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
247 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
248 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
249 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
250 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
251 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
252 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
253 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
254 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
255 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
256 2844163670 Ensifer sp. 1H6 Isolate Unclassified
257 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
258 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
259 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
260 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
261 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
262 2854911287 Brucella lupini LUP21 Isolate Unclassified
263 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
264 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
265 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
266 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
267 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
268 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
269 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
270 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
271 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
272 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
273 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
274 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
275 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
276 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
277 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
278 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
279 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
280 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
281 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
282 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
283 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
284 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
285 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
286 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
287 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
288 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
289 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
290 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
291 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
292 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
293 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
294 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
295 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
296 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
297 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
298 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
299 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
300 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
301 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
302 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
303 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
304 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
305 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
306 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
307 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
308 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
309 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
310 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
311 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
312 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
313 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
314 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
315 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
316 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
317 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
318 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
319 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
320 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
321 2933599457 Rhizobium phaseoli M3 Isolate Nodule
322 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
323 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
324 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
325 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
326 2936381700 Rhizobium chutanense C16 Isolate Unclassified
327 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
328 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
329 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
330 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
331 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
332 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
333 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
334 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
335 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
336 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
337 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
338 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
339 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
340 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
341 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
342 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
343 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
344 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
345 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
346 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
347 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
348 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
349 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
350 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
351 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
352 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
353 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
354 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
355 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
356 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
357 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
358 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
359 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
360 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
361 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
362 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
363 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
364 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
365 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
366 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
367 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
368 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
369 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
370 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
371 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
372 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
373 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
374 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
375 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
376 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
377 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
378 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
379 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
380 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
381 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
382 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
383 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
384 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
385 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
386 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
387 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
388 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
389 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
390 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
391 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
392 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
393 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
394 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
395 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
396 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
397 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
398 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
399 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
400 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
401 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
402 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
403 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
404 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
405 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
406 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
407 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
408 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
409 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
410 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
411 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
412 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
413 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
414 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
415 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
416 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
417 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
418 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
419 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
420 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
421 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
422 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
423 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
424 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
425 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
426 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
427 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
428 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
429 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
430 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
431 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
432 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
433 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
434 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
435 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
436 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
437 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
438 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
439 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
440 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
441 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
442 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
443 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
444 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
445 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
446 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
447 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
448 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
449 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
450 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
451 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
452 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
453 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
454 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
455 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
456 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
457 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
458 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
459 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
460 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
461 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
462 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
463 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
464 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
465 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
466 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
467 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
468 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
469 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
470 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
471 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
472 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
473 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
474 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
475 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
476 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
477 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
478 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
479 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
480 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
481 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
482 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
483 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
484 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
485 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
486 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
487 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
488 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
489 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
490 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
491 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
492 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
493 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
494 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
495 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
496 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
497 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
498 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
499 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
500 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
501 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
502 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
503 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
504 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
505 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
506 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
507 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
508 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
509 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
510 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
511 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
512 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
513 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
514 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
515 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
516 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
517 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
518 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
519 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
520 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
521 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
522 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
523 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
524 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
525 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
526 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
527 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
528 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
529 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
530 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
531 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
532 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
533 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
534 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
535 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
536 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
537 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
539 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
540 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
541 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
542 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
543 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
544 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
545 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
546 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
547 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
548 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
549 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
550 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
551 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
552 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
567 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
569 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
570 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
571 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
573 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
574 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
575 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
576 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
577 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
578 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
579 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
580 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
581 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
582 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
583 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
584 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
585 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
586 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
587 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
588 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
589 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
590 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
591 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
592 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
593 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
594 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
595 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
596 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
597 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
598 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
599 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
600 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
601 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
602 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
603 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
604 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
605 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
606 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
607 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
608 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
609 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
610 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
611 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
612 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
613 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
614 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
615 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
616 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
617 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
618 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
619 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
620 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
621 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
622 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
623 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
624 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
625 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
626 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
627 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
628 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
629 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
630 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
631 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
632 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
633 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
634 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
635 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
636 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
637 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
638 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
639 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
640 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
641 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
642 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
643 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
644 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
645 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
646 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
647 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
648 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
649 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
650 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
651 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
652 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
653 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
654 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
655 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
656 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
657 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
658 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
659 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
660 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
661 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
662 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
663 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
664 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
665 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
666 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
667 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
668 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
669 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
670 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
671 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
672 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
673 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
674 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
675 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
676 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
677 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
678 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
679 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
680 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
681 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
682 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
683 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
684 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
685 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
686 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
689 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
691 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
692 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
693 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
694 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
695 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
696 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
697 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
698 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
699 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
700 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
701 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
702 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
703 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
704 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
705 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
706 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
707 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
708 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
709 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
710 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
711 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
712 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
713 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
714 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
715 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
716 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
717 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
718 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
719 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
720 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
721 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
722 8005275841 Rhizobium sp. N4311 Isolate Nodule
723 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
724 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
725 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
726 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
727 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
728 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
729 8005382845 Rhizobium sp. R634 Isolate Nodule
730 8005395548 Rhizobium sp. R339 Isolate Nodule
731 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
732 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
733 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
734 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
735 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
736 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
737 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
738 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
739 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
740 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
741 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
742 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
743 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
744 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
745 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
746 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
747 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
748 8018176218 Rhizobium sp. N122 Isolate Nodule
749 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
750 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
751 8024501048 Rhizobium sp. H4 Isolate Nodule
752 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
753 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
754 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
755 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
756 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
757 8056382006 Rhizobium croatiense 13T Isolate Nodule
758 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.18
Metatranscriptomes 0.1
Isolates 52.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.39
Nodule 41.34
Rhizoplane 1.88
Rhizosphere 23.8
Stem 0
Stem Tuber 0
Unclassified 16.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000001 3300002705 Bacteria 354557
2 JGI25162J39368_1000274 3300002737 Bacteria 49715
3 JGI25162J39368_1003049 3300002737 Bacteria 5429
4 JGI25154J39366_1000011 3300002738 Bacteria 296007
5 JGI25157J39369_1000030 3300002741 Bacteria 146112
6 JGI25152J39213_1003223 3300002773 Bacteria 5675
7 JGI25152J39213_1007081 3300002773 Bacteria 2947
8 JGI25150J39212_1000439 3300002774 Bacteria 18618
9 JGI25159J45721_1000020 3300002987 Bacteria 124791
10 JGI25159J45721_1000782 3300002987 Bacteria 13842
11 JGI25159J45721_1001080 3300002987 Bacteria 11636
12 JGI25151J46595_10000083 3300003187 Bacteria 130658
13 JGI25151J46595_10006484 3300003187 Bacteria 5879
14 JGI25151J46595_10012789 3300003187 Bacteria 3802
15 JGI25151J46595_10025737 3300003187 Bacteria 2388
16 JGI25165J46597_1000337 3300003214 Bacteria 55143
17 JGI25165J46597_1000696 3300003214 Bacteria 26810
18 JGI25153J46596_10000210 3300003215 Bacteria 52714
19 JGI25153J46596_10001886 3300003215 Bacteria 12426
20 JGI25153J46596_10007880 3300003215 Bacteria 5170
21 JGI25153J46596_10012130 3300003215 Bacteria 3750
22 JGI25153J46596_10012137 3300003215 Bacteria 3748
23 rootL2_10009459 3300003322 Bacteria 9458
24 JGI25160J50197_1000055 3300003354 Bacteria 124791
25 JGI25160J50197_1000087 3300003354 Bacteria 93379
26 JGI25160J50197_1000582 3300003354 Bacteria 20539
27 JGI25160J50197_1017356 3300003354 Bacteria 2283
28 JGI25161J50226_1000066 3300003374 Bacteria 94505
29 JGI25161J50226_1000138 3300003374 Bacteria 50562
30 JGI25161J50226_1000411 3300003374 Bacteria 20983
31 Ga0006562J51391_1025531 3300003578 Bacteria 1260
32 Ga0055526_1000508 3300003771 Bacteria 30971
33 Ga0055526_1001046 3300003771 Bacteria 20204
34 Ga0055526_1015057 3300003771 Bacteria 3129
35 Ga0055526_1028491 3300003771 Bacteria 1688
36 Ga0055524_1000319 3300003775 Bacteria 45208
37 Ga0055524_1043767 3300003775 Bacteria 1096
38 Ga0055528_1000240 3300003790 Bacteria 45988
39 Ga0055528_1000646 3300003790 Bacteria 25480
40 Ga0055528_1001280 3300003790 Bacteria 15817
41 Ga0055528_1005314 3300003790 Bacteria 6020
42 Ga0055528_1005677 3300003790 Bacteria 5755
43 Ga0055540_1006491 3300003792 Bacteria 4632
44 Ga0055531_10017314 3300003794 Bacteria 3050
45 Ga0058692_1014329 3300003856 Bacteria 1819
46 Ga0055543_1000053 3300004625 Bacteria 104589
47 Ga0055543_1000068 3300004625 Bacteria 94795
48 Ga0055543_1000240 3300004625 Bacteria 42475
49 Ga0055543_1000623 3300004625 Bacteria 19050
50 Ga0065165_1000839 3300005262 Bacteria 40355
51 Ga0065165_1001002 3300005262 Bacteria 34597
52 Ga0065165_1006285 3300005262 Bacteria 6299
53 Ga0065165_1027428 3300005262 Bacteria 1857
54 Ga0070683_100105238 3300005329 Bacteria 2660
55 Ga0070666_10017612 3300005335 Bacteria 4583
56 Ga0070682_100241363 3300005337 Bacteria 1297
57 Ga0070691_10000389 3300005341 Bacteria 15957
58 Ga0070671_100041567 3300005355 Bacteria 3821
59 Ga0070667_100004771 3300005367 Bacteria 11352
60 Ga0070667_100642758 3300005367 Bacteria 979
61 Ga0070709_10092495 3300005434 Bacteria 1998
62 Ga0070681_10135044 3300005458 Bacteria 2398
63 Ga0070706_100376136 3300005467 Bacteria 1323
64 Ga0070698_100064385 3300005471 Bacteria 3694
65 Ga0070684_100370140 3300005535 Bacteria 1319
66 Ga0068853_100009904 3300005539 Bacteria 7695
67 Ga0070696_100252058 3300005546 Bacteria 1335
68 Ga0068855_100035482 3300005563 Bacteria 5939
69 Ga0068855_100054628 3300005563 Bacteria 4694
70 Ga0068857_100000172 3300005577 Bacteria 40867
71 Ga0068856_100033134 3300005614 Bacteria 5059
72 Ga0068852_100167764 3300005616 Bacteria 2055
73 Ga0068858_100311112 3300005842 Bacteria 1504
74 Ga0081455_10001970 3300005937 Bacteria 24598
75 Ga0075365_10004193 3300006038 Bacteria 7592
76 Ga0075365_10042626 3300006038 Bacteria 2968
77 Ga0075368_10053301 3300006042 Bacteria 1610
78 Ga0075362_10001282 3300006177 Bacteria 7944
79 Ga0075367_10001089 3300006178 Bacteria 11211
80 Ga0075367_10054146 3300006178 Bacteria 2379
81 Ga0075369_10002276 3300006186 Bacteria 6815
82 Ga0075369_10022250 3300006186 Bacteria 2613
83 Ga0075369_10079707 3300006186 Bacteria 1451
84 Ga0075366_10102335 3300006195 Bacteria 1719
85 Ga0075436_100031012 3300006914 Bacteria 3679
86 Ga0079104_1002821 3300006946 Bacteria 8745
87 Ga0105251_10021359 3300009011 Bacteria 3382
88 Ga0105250_10023520 3300009092 Bacteria 2483
89 Ga0105240_10000005 3300009093 Bacteria 702630
90 Ga0105240_10006088 3300009093 Bacteria 17805
91 Ga0105248_10041541 3300009177 Bacteria 5156
92 Ga0105237_10000766 3300009545 Bacteria 44044
93 Ga0105237_10005759 3300009545 Bacteria 13923
94 Ga0105238_10002694 3300009551 Bacteria 17666
95 Ga0123342_1014483 3300009766 Bacteria 7502
96 Ga0123342_1022424 3300009766 Bacteria 4275
97 Ga0105239_10001069 3300010375 Bacteria 38061
98 Ga0105239_10047560 3300010375 Bacteria 4702
99 Ga0157373_10050213 3300013100 Bacteria 2971
100 Ga0157370_10000046 3300013104 Bacteria 125612
101 Ga0157370_10039972 3300013104 Bacteria 4531
102 Ga0157369_10008714 3300013105 Bacteria 11630
103 Ga0157369_10385871 3300013105 Bacteria 1454
104 Ga0171463_1003 3300013249 Bacteria 695693
105 Ga0157379_10218865 3300014968 Bacteria 1725
106 Ga0182007_10002120 3300015262 Bacteria 10148
107 Ga0182005_1004429 3300015265 Bacteria 4543
108 Ga0183363_1329 3300015690 Bacteria 6019
109 Ga0214544_1001350 3300021320 Bacteria 50577
110 Ga0214542_1002270 3300021321 Bacteria 39851
111 Ga0214542_1023610 3300021321 Bacteria 3643
112 Ga0214543_1000028 3300021327 Bacteria 214029
113 Ga0214543_1000078 3300021327 Bacteria 119775
114 Ga0228711_1000016 3300022739 Bacteria 126351
115 Ga0228710_1000013 3300022740 Bacteria 145976
116 Ga0209435_100012 3300025206 Bacteria 401621
117 Ga0209437_100047 3300025233 Bacteria 405163
118 Ga0209437_100165 3300025233 Bacteria 145009
119 Ga0207425_1000024 3300025245 Bacteria 328978
120 Ga0207425_1002614 3300025245 Bacteria 6230
121 Ga0207425_1003612 3300025245 Bacteria 4887
122 Ga0207425_1012443 3300025245 Bacteria 1997
123 Ga0209646_1000026 3300025246 Bacteria 401621
124 Ga0209646_1004329 3300025246 Bacteria 2603
125 Ga0209026_1000014 3300025250 Bacteria 401621
126 Ga0209677_100811 3300025253 Bacteria 15626
127 Ga0209759_1000012 3300025256 Bacteria 401621
128 Ga0209129_1000161 3300025258 Bacteria 102017
129 Ga0209129_1000167 3300025258 Bacteria 97701
130 Ga0209129_1000184 3300025258 Bacteria 87102
131 Ga0209129_1001218 3300025258 Bacteria 14786
132 Ga0209129_1003533 3300025258 Bacteria 6744
133 Ga0209129_1003776 3300025258 Bacteria 6368
134 Ga0209129_1004343 3300025258 Bacteria 5588
135 Ga0209233_1000048 3300025261 Bacteria 453669
136 Ga0209233_1000069 3300025261 Bacteria 367639
137 Ga0209233_1000257 3300025261 Bacteria 80366
138 Ga0209565_1019625 3300025263 Bacteria 1440
139 Ga0209673_1000010 3300025273 Bacteria 596656
140 Ga0209673_1000013 3300025273 Bacteria 571633
141 Ga0209673_1000296 3300025273 Bacteria 92350
142 Ga0209673_1001064 3300025273 Bacteria 31374
143 Ga0209673_1001836 3300025273 Bacteria 17369
144 Ga0209673_1006371 3300025273 Bacteria 5709
145 Ga0209673_1041716 3300025273 Bacteria 1299
146 Ga0209673_1044199 3300025273 Bacteria 1236
147 Ga0209130_1000021 3300025284 Bacteria 374278
148 Ga0209130_1000026 3300025284 Bacteria 334058
149 Ga0209130_1000081 3300025284 Bacteria 166440
150 Ga0209130_1004153 3300025284 Bacteria 5674
151 Ga0209130_1021928 3300025284 Bacteria 1433
152 Ga0209675_1013418 3300025291 Bacteria 2563
153 Ga0209676_1008398 3300025292 Bacteria 4610
154 Ga0209676_1014017 3300025292 Bacteria 3044
155 Ga0209676_1030238 3300025292 Bacteria 1659
156 Ga0209025_1000050 3300025294 Bacteria 331531
157 Ga0209025_1000119 3300025294 Bacteria 210606
158 Ga0209025_1000695 3300025294 Bacteria 57400
159 Ga0209025_1000767 3300025294 Bacteria 53337
160 Ga0209025_1003074 3300025294 Bacteria 16384
161 Ga0209025_1006218 3300025294 Bacteria 9368
162 Ga0209025_1015166 3300025294 Bacteria 4671
163 Ga0209025_1016503 3300025294 Bacteria 4346
164 Ga0209025_1088277 3300025294 Bacteria 1023
165 Ga0209564_1000208 3300025295 Bacteria 134794
166 Ga0209564_1000260 3300025295 Bacteria 112444
167 Ga0209564_1000525 3300025295 Bacteria 62651
168 Ga0209564_1000638 3300025295 Bacteria 53138
169 Ga0209564_1005895 3300025295 Bacteria 6793
170 Ga0209564_1010711 3300025295 Bacteria 4187
171 Ga0209564_1023695 3300025295 Bacteria 2122
172 Ga0209758_1000083 3300025297 Bacteria 257283
173 Ga0209758_1000598 3300025297 Bacteria 56164
174 Ga0209758_1000710 3300025297 Bacteria 49232
175 Ga0209758_1000961 3300025297 Bacteria 38873
176 Ga0209758_1003274 3300025297 Bacteria 15015
177 Ga0209758_1003835 3300025297 Bacteria 13193
178 Ga0209050_1010952 3300025298 Bacteria 4382
179 Ga0209050_1013563 3300025298 Bacteria 3605
180 Ga0209256_1000042 3300025299 Bacteria 341821
181 Ga0209256_1000383 3300025299 Bacteria 70773
182 Ga0209256_1000769 3300025299 Bacteria 41649
183 Ga0209256_1001954 3300025299 Bacteria 18688
184 Ga0209256_1002837 3300025299 Bacteria 13214
185 Ga0209256_1003038 3300025299 Bacteria 12376
186 Ga0209256_1018012 3300025299 Bacteria 2317
187 Ga0209256_1028230 3300025299 Bacteria 1586
188 Ga0207426_1000006 3300025302 Bacteria 1025969
189 Ga0207426_1000008 3300025302 Bacteria 848730
190 Ga0207426_1000010 3300025302 Bacteria 796003
191 Ga0207426_1000039 3300025302 Bacteria 439937
192 Ga0207426_1000697 3300025302 Bacteria 40196
193 Ga0209051_1000253 3300025303 Bacteria 90622
194 Ga0209051_1001954 3300025303 Bacteria 15848
195 Ga0209051_1007263 3300025303 Bacteria 6089
196 Ga0209051_1020188 3300025303 Bacteria 2879
197 Ga0209257_1005407 3300025304 Bacteria 8985
198 Ga0209257_1007329 3300025304 Bacteria 6695
199 Ga0209257_1025688 3300025304 Bacteria 2006
200 Ga0207680_10005594 3300025903 Bacteria 6013
201 Ga0207684_10075386 3300025910 Bacteria 2867
202 Ga0207695_10000011 3300025913 Bacteria 910221
203 Ga0207671_10000241 3300025914 Bacteria 81847
204 Ga0207671_10011527 3300025914 Bacteria 7183
205 Ga0207694_10096375 3300025924 Bacteria 2339
206 Ga0207700_10187094 3300025928 Bacteria 1738
207 Ga0207644_10034481 3300025931 Bacteria 3542
208 Ga0207661_10076473 3300025944 Bacteria 2750
209 Ga0207668_10010333 3300025972 Bacteria 5640
210 Ga0207658_10018317 3300025986 Bacteria 4835
211 Ga0207702_10009015 3300026078 Bacteria 8400
212 Ga0207641_10755740 3300026088 Bacteria 960
213 Ga0207674_10000952 3300026116 Bacteria 37804
214 Ga0207698_10372802 3300026142 Bacteria 1355
215 Ga0209281_1000221 3300027111 Bacteria 122380
216 Ga0209281_1000453 3300027111 Bacteria 58584
217 Ga0209371_1004493 3300027312 Bacteria 6025
218 Ga0209282_1000041 3300027666 Bacteria 122268
219 Ga0268266_10132689 3300028379 Bacteria 2229
220 Ga0268266_10313698 3300028379 Bacteria 1466
221 Ga0307515_10000023 3300028794 Bacteria 400846
222 Ga0307515_10002518 3300028794 Bacteria 39631
223 Ga0307515_10033971 3300028794 Bacteria 8372
224 Ga0307515_10045603 3300028794 Bacteria 6728
225 Ga0265338_10088641 3300028800 Bacteria 2566
226 Ga0268256_1004316 3300030500 Bacteria 5942
227 Ga0265325_10000060 3300031241 Bacteria 75733
228 Ga0265339_10000925 3300031249 Bacteria 22542
229 Ga0265331_10020463 3300031250 Bacteria 3396
230 Ga0265316_10070737 3300031344 Bacteria 2690
231 Ga0307513_10013160 3300031456 Bacteria 10165
232 Ga0307513_10017501 3300031456 Bacteria 8594
233 Ga0307408_100029521 3300031548 Bacteria 3801
234 Ga0265313_10003035 3300031595 Bacteria 13955
235 Ga0265314_10002209 3300031711 Bacteria 20295
236 Ga0265342_10056505 3300031712 Bacteria 2326
237 Ga0307405_10050711 3300031731 Bacteria 2571
238 Ga0307406_10053226 3300031901 Bacteria 2577
239 Ga0307412_10015488 3300031911 Bacteria 4524
240 Ga0307412_10224122 3300031911 Bacteria 1443
241 Ga0315914_1000030 3300031967 Bacteria 102599
242 Ga0307416_100121986 3300032002 Bacteria 2325
243 Ga0316583_10038243 3300032133 Bacteria 1702
244 Ga0315913_1000017 3300033430 Bacteria 102835
245 Ga0315915_1000017 3300033464 Bacteria 148111
246 Ga0373955_0055765 3300035172 Bacteria 2166
247 Ga0316574_0233395 3300035398 Bacteria 1177
248 Ga0373935_0005207 3300035692 Bacteria 7659
249 Ga0373927_0000556 3300035695 Bacteria 28426
250 Ga0316582_0181328 3300036647 Bacteria 1433
251 Ga0373925_0002597 3300037068 Bacteria 14361
252 Ga0439436_0009228 3300041404 Bacteria 3026
253 Ga0439447_051615 3300041407 Bacteria 981
254 Ga0439465_0019336 3300041413 Bacteria 2129
255 Ga0451787_547467 3300041441 Bacteria 1920
256 Ga0451835_0182672 3300041492 Bacteria 1735
257 Ga0451837_1006229 3300041494 Bacteria 891
258 Ga0451837_1707933 3300041494 Bacteria 1068
259 Ga0451839_0446078 3300041496 Bacteria 1826
260 Ga0451845_0273193 3300041501 Bacteria 1365
261 Ga0451847_0827233 3300041503 Bacteria 2966
262 Ga0451849_0988520 3300041505 Bacteria 1302
263 Ga0451851_1044136 3300041507 Bacteria 1688
264 Ga0439449_0006695 3300042007 Bacteria 4398
265 Ga0439462_0006428 3300042015 Bacteria 2921
266 Ga0450920_012072 3300042122 Bacteria 1616
267 Ga0439435_0000469 3300042436 Bacteria 6391
268 Ga0466960_0033385 3300044901 Bacteria 2391
269 Ga0466967_0521347 3300045976 Bacteria 1168
270 Ga0495627_067670 3300046453 Bacteria 1047
271 Ga0495592_0028499 3300046454 Bacteria 4229
272 Ga0495629_0066519 3300046459 Bacteria 2515
273 Ga0495638_0000638 3300046460 Bacteria 38456
274 Ga0495638_0047437 3300046460 Bacteria 2692
275 Ga0495638_0126441 3300046460 Bacteria 1506
276 Ga0495651_0251845 3300046462 Bacteria 1206
277 Ga0495650_0021715 3300046471 Bacteria 3092
278 Ga0495605_0002606 3300046474 Bacteria 11082
279 Ga0495605_0011032 3300046474 Bacteria 5048
280 Ga0495662_0008737 3300046476 Bacteria 4982
281 Ga0495585_0006116 3300046492 Bacteria 7518
282 Ga0495585_0012321 3300046492 Bacteria 5038
283 Ga0495596_0035987 3300046500 Bacteria 1962
284 Ga0495607_0007805 3300046501 Bacteria 7367
285 Ga0495607_0074920 3300046501 Bacteria 1877
286 Ga0495583_0002711 3300046506 Bacteria 14673
287 Ga0495583_0016652 3300046506 Bacteria 3941
288 Ga0495606_0001089 3300046507 Bacteria 38890
289 Ga0495606_0007913 3300046507 Bacteria 9373
290 Ga0495606_0036604 3300046507 Bacteria 3341
291 Ga0495606_0071160 3300046507 Bacteria 2191
292 Ga0495610_0002729 3300046512 Bacteria 14510
293 Ga0495616_0006597 3300046513 Bacteria 7013
294 Ga0495616_0034968 3300046513 Bacteria 2604
295 Ga0495620_0014593 3300046515 Bacteria 3990
296 Ga0495630_0005038 3300046517 Bacteria 9294
297 Ga0495631_0002125 3300046518 Bacteria 11474
298 Ga0495631_0014589 3300046518 Bacteria 3786
299 Ga0495632_0004409 3300046519 Bacteria 9566
300 Ga0495632_0004862 3300046519 Bacteria 9014
301 Ga0495632_0004881 3300046519 Bacteria 8995
302 Ga0495632_0072670 3300046519 Bacteria 1650
303 Ga0495643_0005952 3300046522 Bacteria 8136
304 Ga0495644_0090904 3300046523 Bacteria 1152
305 Ga0495663_0039079 3300046525 Bacteria 1437
306 Ga0495586_0060886 3300046535 Bacteria 2054
307 Ga0495609_0007260 3300046538 Bacteria 5552
308 Ga0495622_0004239 3300046557 Bacteria 6683
309 Ga0495633_0102106 3300046558 Bacteria 1331
310 Ga0495668_0048638 3300046616 Bacteria 2352
311 Ga0495625_0001863 3300046660 Bacteria 23982
312 Ga0495625_0015058 3300046660 Bacteria 6141
313 Ga0495625_0116683 3300046660 Bacteria 1821
314 Ga0495625_0117278 3300046660 Bacteria 1815
315 Ga0495625_0169887 3300046660 Bacteria 1456
316 Ga0495625_0170796 3300046660 Bacteria 1452
317 Ga0495625_0309993 3300046660 Bacteria 1008
318 Ga0495635_0056234 3300046663 Bacteria 2709
319 Ga0495635_0235611 3300046663 Bacteria 1236
320 Ga0495588_0038172 3300046674 Bacteria 2443
321 Ga0495649_0100101 3300046694 Bacteria 1541
322 Ga0495589_0045844 3300046794 Bacteria 2171
323 Ga0495589_0202998 3300046794 Bacteria 935
324 Ga0495600_0031813 3300046809 Bacteria 3420
325 Ga0495660_0012720 3300046810 Bacteria 4882
326 Ga0495660_0020342 3300046810 Bacteria 3803
327 Ga0495604_0322288 3300047317 Bacteria 1032
328 Ga0495636_0001864 3300047318 Bacteria 8057
329 Ga0495674_0261849 3300047319 Bacteria 1421
330 Ga0495683_0019656 3300047323 Bacteria 3485
331 Ga0495687_010735 3300047443 Bacteria 4995
332 Ga0495684_0233587 3300047471 Bacteria 1344
333 Ga0495686_0000796 3300047472 Bacteria 41000
334 Ga0495686_0006004 3300047472 Bacteria 9442
335 Ga0495686_0009754 3300047472 Bacteria 6891
336 Ga0495686_0031084 3300047472 Bacteria 3465
337 Ga0495602_0294564 3300048088 Bacteria 1190
338 Ga0495615_0038972 3300048090 Bacteria 1177
339 Ga0495615_0053191 3300048090 Bacteria 1048
340 Ga0496100_0142905 3300048903 Bacteria 1698
341 Ga0496100_0203515 3300048903 Bacteria 1444
342 Ga0496101_0018868 3300048904 Bacteria 4697
343 Ga0496102_0006068 3300048905 Bacteria 10302
344 Ga0496103_0008717 3300048906 Bacteria 6018
345 Ga0496104_0261715 3300048907 Bacteria 1642
346 Ga0496105_0210137 3300048908 Bacteria 1586
347 Ga0496106_0000658 3300048909 Bacteria 24761
348 Ga0496108_0659317 3300048911 Bacteria 909
349 Ga0496110_0025054 3300048913 Bacteria 5093
350 Ga0496111_0022201 3300048914 Bacteria 4439
351 Ga0496114_0262734 3300048917 Bacteria 1520
352 Ga0496116_0001006 3300048919 Bacteria 34404
353 Ga0496116_0021891 3300048919 Bacteria 4807
354 Ga0496116_0089363 3300048919 Bacteria 1879
355 Ga0496116_0115852 3300048919 Bacteria 1563
356 Ga0496117_0000353 3300048920 Bacteria 81061
357 Ga0496117_0005327 3300048920 Bacteria 13581
358 Ga0496118_0000204 3300048921 Bacteria 104260
359 Ga0496118_0005459 3300048921 Bacteria 14454
360 Ga0496118_0009796 3300048921 Bacteria 9604
361 Ga0496118_0047464 3300048921 Bacteria 3327
362 Ga0496119_0013782 3300048922 Bacteria 6398
363 Ga0496119_0015557 3300048922 Bacteria 5845
364 Ga0496119_0020529 3300048922 Bacteria 4817
365 Ga0496119_0066011 3300048922 Bacteria 2140
366 Ga0496119_0157567 3300048922 Bacteria 1211
367 Ga0496120_0037801 3300048923 Bacteria 2861
368 Ga0496120_0048116 3300048923 Bacteria 2455
369 Ga0496121_0000378 3300048924 Bacteria 91381
370 Ga0496121_0024989 3300048924 Bacteria 5689
371 Ga0496121_0029249 3300048924 Bacteria 5102
372 Ga0496121_0038184 3300048924 Bacteria 4257
373 Ga0496121_0100735 3300048924 Bacteria 2229
374 Ga0496121_0136605 3300048924 Bacteria 1825
375 Ga0496121_0151991 3300048924 Bacteria 1702
376 Ga0496121_0201167 3300048924 Bacteria 1420
377 Ga0496121_0204151 3300048924 Bacteria 1406
378 Ga0496121_0306743 3300048924 Bacteria 1075
379 Ga0496122_0001317 3300048925 Bacteria 40726
380 Ga0496122_0003507 3300048925 Bacteria 20601
381 Ga0496122_0014776 3300048925 Bacteria 7523
382 Ga0496122_0020665 3300048925 Bacteria 5933
383 Ga0496122_0028477 3300048925 Bacteria 4738
384 Ga0496122_0050724 3300048925 Bacteria 3161
385 Ga0496122_0098445 3300048925 Bacteria 1964
386 Ga0496123_0000448 3300048926 Bacteria 73842
387 Ga0496123_0007623 3300048926 Bacteria 10131
388 Ga0496123_0013544 3300048926 Bacteria 6830
389 Ga0496123_0024065 3300048926 Bacteria 4640
390 Ga0496123_0059051 3300048926 Bacteria 2483
391 Ga0496124_0000687 3300048927 Bacteria 55709
392 Ga0496124_0002515 3300048927 Bacteria 23851
393 Ga0496124_0005688 3300048927 Bacteria 13894
394 Ga0496124_0027025 3300048927 Bacteria 5162
395 Ga0496124_0040458 3300048927 Bacteria 4031
396 Ga0496124_0116439 3300048927 Bacteria 2142
397 Ga0496124_0150157 3300048927 Bacteria 1829
398 Ga0496125_0001127 3300048928 Bacteria 40785
399 Ga0496125_0018120 3300048928 Bacteria 6692
400 Ga0496125_0019265 3300048928 Bacteria 6444
401 Ga0496125_0027274 3300048928 Bacteria 5182
402 Ga0496125_0061679 3300048928 Bacteria 3005
403 Ga0496126_0002636 3300048929 Bacteria 23833
404 Ga0496126_0032771 3300048929 Bacteria 4892
405 Ga0496126_0057510 3300048929 Bacteria 3510
406 Ga0496126_0063346 3300048929 Bacteria 3314
407 Ga0496126_0076645 3300048929 Bacteria 2966
408 Ga0496126_0125110 3300048929 Bacteria 2226
409 Ga0495678_003522 3300049459 Bacteria 9623
410 Ga0495678_010175 3300049459 Bacteria 4585
411 Ga0495678_089111 3300049459 Bacteria 1090
412 Ga0495682_0046054 3300049460 Bacteria 1593
413 Ga0501031_0108159 3300049568 Bacteria 1815
414 Ga0501033_0012045 3300049570 Bacteria 6603
415 Ga0501034_0104034 3300049571 Bacteria 2833
416 Ga0501036_0111674 3300049572 Bacteria 2310
417 Ga0501038_0106498 3300049574 Bacteria 2327
418 Ga0501039_0202771 3300049575 Bacteria 1560
419 Ga0501043_0110335 3300049579 Bacteria 2160
420 Ga0501047_0190379 3300049581 Bacteria 1915
421 Ga0501068_0031640 3300049584 Bacteria 3143
422 Ga0501069_0157026 3300049585 Bacteria 1309
423 Ga0501073_0077193 3300049589 Bacteria 2318
424 Ga0501073_0135613 3300049589 Bacteria 1706
425 Ga0501080_0063665 3300049742 Bacteria 3432
426 Ga0501083_0118133 3300049744 Bacteria 1740
427 Ga0501280_004692 3300049776 Bacteria 1991
428 Ga0501035_0000927 3300049822 Bacteria 31062
429 Ga0501035_0048895 3300049822 Bacteria 3791
430 Ga0501035_0071198 3300049822 Bacteria 3079
431 Ga0501044_0023860 3300049823 Bacteria 6501
432 Ga0501044_0081759 3300049823 Bacteria 3269
433 nmdc:mga03683_47598_c1 3300050489 Bacteria 1780
434 nmdc:mga0yw44_127769_c1 3300050492 Bacteria 1643
435 nmdc:mga0k408_26375_c1 3300050493 Bacteria 3294
436 nmdc:mga07m45_45410_c1 3300050496 Bacteria 2467
437 Ga0500578_0047074 3300053086 Bacteria 2767
438 Ga0500651_0031083 3300053093 Bacteria 3362
439 Ga0500650_0016254 3300053098 Bacteria 3189
440 Ga0500569_001435 3300053109 Bacteria 4494
441 Ga0500618_002874 3300053125 Bacteria 6177
442 Ga0500658_0000720 3300053134 Bacteria 13662
443 Ga0500658_0007741 3300053134 Bacteria 3968
444 Ga0500568_0015244 3300053139 Bacteria 3445
445 Ga0500573_0003989 3300053140 Bacteria 7709
446 Ga0500590_002326 3300053148 Bacteria 8366
447 Ga0500604_0078927 3300053151 Bacteria 1060
448 Ga0500616_0001219 3300053153 Bacteria 25876
449 Ga0500616_0033208 3300053153 Bacteria 2816
450 Ga0500622_0006163 3300053156 Bacteria 7032
451 Ga0500627_0002349 3300053158 Bacteria 5591
452 Ga0500627_0164150 3300053158 Bacteria 1002
453 Ga0500636_0043214 3300053177 Bacteria 2661

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0202998 Ga0495589_0202998_131_865 241
2 iso_pu_bacteria 2957422303 2957427850 246
3 3300049579 Ga0501043_0110335 Ga0501043_0110335_349_1164 247
4 3300049570 Ga0501033_0012045 Ga0501033_0012045_2270_3055 248
5 3300049571 Ga0501034_0104034 Ga0501034_0104034_972_1757 248
6 3300049574 Ga0501038_0106498 Ga0501038_0106498_1145_1930 248
7 3300049581 Ga0501047_0190379 Ga0501047_0190379_190_975 248
8 3300049822 Ga0501035_0048895 Ga0501035_0048895_710_1495 248
9 3300049823 Ga0501044_0081759 Ga0501044_0081759_1140_1925 248
10 3300046523 Ga0495644_0090904 Ga0495644_0090904_23_775 250
11 3300048924 Ga0496121_0204151 Ga0496121_0204151_21_776 250
12 3300053151 Ga0500604_0078927 Ga0500604_0078927_26_781 251
13 iso_pu_bacteria 2757320392 2757569590 254
14 3300028800 Ga0265338_10088641 Ga0265338_100886412 256
15 3300031712 Ga0265342_10056505 Ga0265342_100565051 261
16 3300031250 Ga0265331_10020463 Ga0265331_100204635 265
17 3300031711 Ga0265314_10002209 Ga0265314_1000220915 265
18 3300005329 Ga0070683_100105238 Ga0070683_1001052382 267
19 3300005337 Ga0070682_100241363 Ga0070682_1002413631 267
20 3300005539 Ga0068853_100009904 Ga0068853_1000099049 267
21 3300005563 Ga0068855_100035482 Ga0068855_1000354821 267
22 3300005577 Ga0068857_100000172 Ga0068857_10000017217 267
23 3300005614 Ga0068856_100033134 Ga0068856_1000331342 267
24 3300005616 Ga0068852_100167764 Ga0068852_1001677642 267
25 3300009093 Ga0105240_10006088 Ga0105240_100060882 267
26 3300009545 Ga0105237_10005759 Ga0105237_100057592 267
27 3300009551 Ga0105238_10002694 Ga0105238_1000269411 267
28 3300013100 Ga0157373_10050213 Ga0157373_100502135 267
29 3300025914 Ga0207671_10011527 Ga0207671_100115273 267
30 3300026078 Ga0207702_10009015 Ga0207702_100090156 267
31 3300026088 Ga0207641_10755740 Ga0207641_107557401 267
32 3300026116 Ga0207674_10000952 Ga0207674_1000095218 267
33 3300026142 Ga0207698_10372802 Ga0207698_103728021 267
34 3300003790 Ga0055528_1000240 Ga0055528_100024041 268
35 3300005341 Ga0070691_10000389 Ga0070691_100003891 268
36 3300005434 Ga0070709_10092495 Ga0070709_100924951 268
37 3300005458 Ga0070681_10135044 Ga0070681_101350441 268
38 3300005535 Ga0070684_100370140 Ga0070684_1003701402 268
39 3300006914 Ga0075436_100031012 Ga0075436_1000310122 268
40 3300010375 Ga0105239_10047560 Ga0105239_100475607 268
41 3300013104 Ga0157370_10039972 Ga0157370_100399721 268
42 3300013105 Ga0157369_10008714 Ga0157369_1000871410 268
43 3300025273 Ga0209673_1000013 Ga0209673_1000013279 268
44 3300025295 Ga0209564_1000525 Ga0209564_100052542 268
45 3300025299 Ga0209256_1000769 Ga0209256_10007692 268
46 3300025944 Ga0207661_10076473 Ga0207661_100764732 268
47 3300002773 JGI25152J39213_1003223 JGI25152J39213_10032232 269
48 3300048919 Ga0496116_0001006 Ga0496116_0001006_10142_10951 269
49 3300048921 Ga0496118_0009796 Ga0496118_0009796_1734_2543 269
50 3300048924 Ga0496121_0024989 Ga0496121_0024989_522_1331 269
51 3300048924 Ga0496121_0151991 Ga0496121_0151991_288_1097 269
52 3300048925 Ga0496122_0003507 Ga0496122_0003507_4067_4876 269
53 3300048927 Ga0496124_0002515 Ga0496124_0002515_18684_19493 269
54 iso_pu_bacteria 2599185156 2599331606 269
55 3300048922 Ga0496119_0066011 Ga0496119_0066011_244_1119 270
56 3300048925 Ga0496122_0050724 Ga0496122_0050724_534_1409 270
57 3300048926 Ga0496123_0059051 Ga0496123_0059051_194_1069 270
58 3300048928 Ga0496125_0061679 Ga0496125_0061679_31_906 270
59 iso_pu_bacteria 2751185800 2753359644 270
60 3300049823 Ga0501044_0023860 Ga0501044_0023860_5393_6220 271
61 iso_pu_bacteria 2842205361 2842205882 271
62 iso_pu_bacteria 2842278818 2842279339 271
63 iso_pu_bacteria 2842922631 2842924005 271
64 iso_pu_bacteria 2758568016 2758641903 272
65 iso_pu_bacteria 2840764183 2840767584 272
66 3300031241 Ga0265325_10000060 Ga0265325_1000006041 273
67 3300031249 Ga0265339_10000925 Ga0265339_1000092522 273
68 3300031344 Ga0265316_10070737 Ga0265316_100707372 273
69 3300031595 Ga0265313_10003035 Ga0265313_100030355 273
70 3300046517 Ga0495630_0005038 Ga0495630_0005038_4585_5460 273
71 iso_pu_bacteria 2534681786 2535485007 273
72 iso_pu_bacteria 2791355091 2792620195 273
73 iso_pu_bacteria 2791355092 2792626385 273
74 3300003578 Ga0006562J51391_1025531 Ga0006562J51391_10255311 274
75 3300005335 Ga0070666_10017612 Ga0070666_100176124 274
76 3300005367 Ga0070667_100004771 Ga0070667_10000477112 274
77 3300005563 Ga0068855_100054628 Ga0068855_1000546285 274
78 3300025903 Ga0207680_10005594 Ga0207680_1000559411 274
79 3300025986 Ga0207658_10018317 Ga0207658_100183173 274
80 3300028379 Ga0268266_10132689 Ga0268266_101326893 274
81 3300044901 Ga0466960_0033385 Ga0466960_0033385_1236_2117 274
82 3300047472 Ga0495686_0031084 Ga0495686_0031084_562_1404 274
83 iso_pu_bacteria 2738541317 2738946095 274
84 iso_pu_bacteria 2854911287 2854912263 274
85 iso_pu_bacteria 2913308742 2913311322 274
86 iso_pu_bacteria 2915650412 2915653034 274
87 3300035692 Ga0373935_0005207 Ga0373935_0005207_6511_7374 275
88 3300046462 Ga0495651_0251845 Ga0495651_0251845_304_1182 275
89 3300046535 Ga0495586_0060886 Ga0495586_0060886_935_1813 275
90 3300047471 Ga0495684_0233587 Ga0495684_0233587_373_1251 275
91 iso_pu_bacteria 2509276021 2509392498 275
92 iso_pu_bacteria 2509276033 2509446586 275
93 iso_pu_bacteria 2510065019 2510133484 275
94 iso_pu_bacteria 2510065057 2510303268 275
95 iso_pu_bacteria 2510461076 2510894866 275
96 iso_pu_bacteria 2511231027 2511389683 275
97 iso_pu_bacteria 2511231052 2511501994 275
98 iso_pu_bacteria 2512047086 2512533364 275
99 iso_pu_bacteria 2512875026 2512971069 275
100 iso_pu_bacteria 2513237084 2513573424 275
101 iso_pu_bacteria 2513237085 2513577453 275
102 iso_pu_bacteria 2513237086 2513582609 275
103 iso_pu_bacteria 2513237089 2513604574 275
104 iso_pu_bacteria 2513237091 2513615489 275
105 iso_pu_bacteria 2513237093 2513629911 275
106 iso_pu_bacteria 2513237140 2513881278 275
107 iso_pu_bacteria 2513237143 2513902409 275
108 iso_pu_bacteria 2513237156 2513984570 275
109 iso_pu_bacteria 2513237160 2514007627 275
110 iso_pu_bacteria 2513237162 2514021991 275
111 iso_pu_bacteria 2515075009 2515112452 275
112 iso_pu_bacteria 2515154107 2515608787 275
113 iso_pu_bacteria 2515154113 2515632792 275
114 iso_pu_bacteria 2515154114 2515639940 275
115 iso_pu_bacteria 2515154116 2515655854 275
116 iso_pu_bacteria 2515154134 2515740289 275
117 iso_pu_bacteria 2516653046 2516893290 275
118 iso_pu_bacteria 2516653085 2517076566 275
119 iso_pu_bacteria 2517093000 2517095334 275
120 iso_pu_bacteria 2517287029 2517406936 275
121 iso_pu_bacteria 2517487022 2517570047 275
122 iso_pu_bacteria 2519899620 2520378598 275
123 iso_pu_bacteria 2524023207 2524448808 275
124 iso_pu_bacteria 2529292951 2530645681 275
125 iso_pu_bacteria 2551306084 2551675132 275
126 iso_pu_bacteria 2551306084 2551680542 275
127 iso_pu_bacteria 2551306085 2551688075 275
128 iso_pu_bacteria 2551306086 2551691115 275
129 iso_pu_bacteria 2551306087 2551704441 275
130 iso_pu_bacteria 2551306089 2551709578 275
131 iso_pu_bacteria 2551306090 2551722487 275
132 iso_pu_bacteria 2551306091 2551727351 275
133 iso_pu_bacteria 2551306092 2551735318 275
134 iso_pu_bacteria 2551306093 2551741804 275
135 iso_pu_bacteria 2585427526 2585527805 275
136 iso_pu_bacteria 2615840624 2616292313 275
137 iso_pu_bacteria 2643221637 2644210202 275
138 iso_pu_bacteria 2643221718 2644653754 275
139 iso_pu_bacteria 2718217882 2719181332 275
140 iso_pu_bacteria 2718217927 2719385941 275
141 iso_pu_bacteria 2718217997 2719665755 275
142 iso_pu_bacteria 2718218009 2719732081 275
143 iso_pu_bacteria 2718218199 2720492175 275
144 iso_pu_bacteria 2718218232 2720613438 275
145 iso_pu_bacteria 2718218233 2720620316 275
146 iso_pu_bacteria 2718218235 2720631740 275
147 iso_pu_bacteria 2718218269 2720775468 275
148 iso_pu_bacteria 2718218363 2721147426 275
149 iso_pu_bacteria 2718218365 2721158959 275
150 iso_pu_bacteria 2718218366 2721164344 275
151 iso_pu_bacteria 2718218423 2721399721 275
152 iso_pu_bacteria 2721755514 2722840514 275
153 iso_pu_bacteria 2721755556 2723027086 275
154 iso_pu_bacteria 2721755684 2723560698 275
155 iso_pu_bacteria 2721755685 2723567287 275
156 iso_pu_bacteria 2721755809 2724038534 275
157 iso_pu_bacteria 2721755810 2724044837 275
158 iso_pu_bacteria 2721755819 2724090075 275
159 iso_pu_bacteria 2721755822 2724104552 275
160 iso_pu_bacteria 2721755823 2724110348 275
161 iso_pu_bacteria 2724679232 2725948628 275
162 iso_pu_bacteria 2728369352 2730108022 275
163 iso_pu_bacteria 2728369365 2730164569 275
164 iso_pu_bacteria 2728369397 2730298591 275
165 iso_pu_bacteria 2738541333 2739036672 275
166 iso_pu_bacteria 2765235802 2765464804 275
167 iso_pu_bacteria 2765235942 2766067387 275
168 iso_pu_bacteria 2775506904 2776280396 275
169 iso_pu_bacteria 2791355082 2792581698 275
170 iso_pu_bacteria 2791355256 2793294834 275
171 iso_pu_bacteria 2791355259 2793312412 275
172 iso_pu_bacteria 2791355260 2793322949 275
173 iso_pu_bacteria 2791355261 2793330980 275
174 iso_pu_bacteria 2791355262 2793335900 275
175 iso_pu_bacteria 2791355263 2793341677 275
176 iso_pu_bacteria 2791355264 2793349964 275
177 iso_pu_bacteria 2791355265 2793352919 275
178 iso_pu_bacteria 2791355266 2793360789 275
179 iso_pu_bacteria 2791355267 2793366893 275
180 iso_pu_bacteria 2802428858 2802719542 275
181 iso_pu_bacteria 2802428859 2802726865 275
182 iso_pu_bacteria 2802428860 2802732276 275
183 iso_pu_bacteria 2802428861 2802739879 275
184 iso_pu_bacteria 2802428862 2802745385 275
185 iso_pu_bacteria 2802428863 2802752777 275
186 iso_pu_bacteria 2802429268 2804752446 275
187 iso_pu_bacteria 2802429605 2805925853 275
188 iso_pu_bacteria 2802429606 2805933426 275
189 iso_pu_bacteria 2802429634 2806050737 275
190 iso_pu_bacteria 2802429635 2806057554 275
191 iso_pu_bacteria 2838016132 2838018059 275
192 iso_pu_bacteria 2838022645 2838026262 275
193 iso_pu_bacteria 2838042994 2838043600 275
194 iso_pu_bacteria 2838048938 2838053513 275
195 iso_pu_bacteria 2838061910 2838065657 275
196 iso_pu_bacteria 2838068647 2838074372 275
197 iso_pu_bacteria 2838668709 2838673769 275
198 iso_pu_bacteria 2838680041 2838682056 275
199 iso_pu_bacteria 2838686498 2838691951 275
200 iso_pu_bacteria 2838694306 2838696628 275
201 iso_pu_bacteria 2838701080 2838706213 275
202 iso_pu_bacteria 2838707686 2838710133 275
203 iso_pu_bacteria 2838729681 2838732902 275
204 iso_pu_bacteria 2838742623 2838745780 275
205 iso_pu_bacteria 2839993093 2839994726 275
206 iso_pu_bacteria 2841851746 2841855762 275
207 iso_pu_bacteria 2841864319 2841864379 275
208 iso_pu_bacteria 2842077413 2842078306 275
209 iso_pu_bacteria 2842110456 2842114239 275
210 iso_pu_bacteria 2842118031 2842119185 275
211 iso_pu_bacteria 2842146304 2842150967 275
212 iso_pu_bacteria 2842156927 2842157247 275
213 iso_pu_bacteria 2842163707 2842167905 275
214 iso_pu_bacteria 2842180545 2842181169 275
215 iso_pu_bacteria 2842192696 2842194366 275
216 iso_pu_bacteria 2842198810 2842201805 275
217 iso_pu_bacteria 2842217011 2842217411 275
218 iso_pu_bacteria 2842229732 2842230773 275
219 iso_pu_bacteria 2842237096 2842239545 275
220 iso_pu_bacteria 2842243621 2842245121 275
221 iso_pu_bacteria 2842250916 2842255887 275
222 iso_pu_bacteria 2842257432 2842258934 275
223 iso_pu_bacteria 2842264693 2842265893 275
224 iso_pu_bacteria 2842271015 2842276396 275
225 iso_pu_bacteria 2842285085 2842285988 275
226 iso_pu_bacteria 2842291075 2842291968 275
227 iso_pu_bacteria 2842304105 2842304464 275
228 iso_pu_bacteria 2842311132 2842314388 275
229 iso_pu_bacteria 2842317721 2842317761 275
230 iso_pu_bacteria 2842341865 2842345272 275
231 iso_pu_bacteria 2842363717 2842364719 275
232 iso_pu_bacteria 2842370503 2842372623 275
233 iso_pu_bacteria 2842377471 2842378364 275
234 iso_pu_bacteria 2842384541 2842385695 275
235 iso_pu_bacteria 2842395702 2842398840 275
236 iso_pu_bacteria 2842402390 2842403348 275
237 iso_pu_bacteria 2842409023 2842409279 275
238 iso_pu_bacteria 2842415677 2842415933 275
239 iso_pu_bacteria 2842422224 2842427512 275
240 iso_pu_bacteria 2842428310 2842429470 275
241 iso_pu_bacteria 2842434925 2842436083 275
242 iso_pu_bacteria 2842441272 2842442430 275
243 iso_pu_bacteria 2842447887 2842450722 275
244 iso_pu_bacteria 2842462802 2842463891 275
245 iso_pu_bacteria 2842469257 2842470412 275
246 iso_pu_bacteria 2842489311 2842490171 275
247 iso_pu_bacteria 2842495871 2842496032 275
248 iso_pu_bacteria 2842871566 2842871778 275
249 iso_pu_bacteria 2844454524 2844458993 275
250 iso_pu_bacteria 2855825444 2855826013 275
251 iso_pu_bacteria 2855839649 2855841358 275
252 iso_pu_bacteria 2857516855 2857519875 275
253 iso_pu_bacteria 2858800743 2858802345 275
254 iso_pu_bacteria 2891373044 2891373190 275
255 iso_pu_bacteria 2894652903 2894656155 275
256 iso_pu_bacteria 2913295892 2913300812 275
257 iso_pu_bacteria 2915980308 2915981864 275
258 iso_pu_bacteria 2915986958 2915990058 275
259 iso_pu_bacteria 2915993759 2915994340 275
260 iso_pu_bacteria 2916000859 2916004361 275
261 iso_pu_bacteria 2916007675 2916008213 275
262 iso_pu_bacteria 2916014648 2916017719 275
263 iso_pu_bacteria 2916021584 2916024210 275
264 iso_pu_bacteria 2916028427 2916031743 275
265 iso_pu_bacteria 2916035215 2916041295 275
266 iso_pu_bacteria 2916041962 2916045229 275
267 iso_pu_bacteria 2916048683 2916052301 275
268 iso_pu_bacteria 2916055098 2916056412 275
269 iso_pu_bacteria 2916061851 2916067550 275
270 iso_pu_bacteria 2916068649 2916073238 275
271 iso_pu_bacteria 2916076590 2916077400 275
272 iso_pu_bacteria 2921201388 2921202966 275
273 iso_pu_bacteria 2921208531 2921210435 275
274 iso_pu_bacteria 2921237296 2921240748 275
275 iso_pu_bacteria 2921244191 2921244659 275
276 iso_pu_bacteria 2921250672 2921251147 275
277 iso_pu_bacteria 2921257292 2921259544 275
278 iso_pu_bacteria 2921263974 2921265091 275
279 iso_pu_bacteria 2921282425 2921283520 275
280 iso_pu_bacteria 2921289301 2921293672 275
281 iso_pu_bacteria 2921296804 2921297853 275
282 iso_pu_bacteria 2924144063 2924147123 275
283 iso_pu_bacteria 2924150972 2924155233 275
284 iso_pu_bacteria 2924158325 2924160788 275
285 iso_pu_bacteria 2924165586 2924167366 275
286 iso_pu_bacteria 2924172951 2924179007 275
287 iso_pu_bacteria 2924179722 2924184095 275
288 iso_pu_bacteria 2924186466 2924189044 275
289 iso_pu_bacteria 2924193448 2924194771 275
290 iso_pu_bacteria 2924200457 2924203381 275
291 iso_pu_bacteria 2924207177 2924208856 275
292 iso_pu_bacteria 2924214083 2924215560 275
293 iso_pu_bacteria 2924221636 2924226533 275
294 iso_pu_bacteria 2924228884 2924229925 275
295 iso_pu_bacteria 2933570622 2933571738 275
296 iso_pu_bacteria 2933586486 2933590334 275
297 iso_pu_bacteria 2933599457 2933604828 275
298 iso_pu_bacteria 2935894831 2935897517 275
299 iso_pu_bacteria 2935901341 2935905514 275
300 iso_pu_bacteria 2936367885 2936372533 275
301 iso_pu_bacteria 2936375103 2936376476 275
302 iso_pu_bacteria 2936381700 2936387261 275
303 iso_pu_bacteria 2936996657 2936998098 275
304 iso_pu_bacteria 2937002841 2937005089 275
305 iso_pu_bacteria 2937009748 2937012183 275
306 iso_pu_bacteria 2937016420 2937018658 275
307 iso_pu_bacteria 2937023124 2937028997 275
308 iso_pu_bacteria 2937029754 2937031302 275
309 iso_pu_bacteria 2937036028 2937038557 275
310 iso_pu_bacteria 2937042894 2937047329 275
311 iso_pu_bacteria 2937049772 2937050924 275
312 iso_pu_bacteria 2937056579 2937061519 275
313 iso_pu_bacteria 2937063883 2937065204 275
314 iso_pu_bacteria 2937071275 2937073073 275
315 iso_pu_bacteria 2937078374 2937079823 275
316 iso_pu_bacteria 2937084907 2937086796 275
317 iso_pu_bacteria 2937091812 2937096235 275
318 iso_pu_bacteria 2937098957 2937099560 275
319 iso_pu_bacteria 2937106411 2937110033 275
320 iso_pu_bacteria 2937113482 2937116244 275
321 iso_pu_bacteria 2937119839 2937123054 275
322 iso_pu_bacteria 2937126314 2937128733 275
323 iso_pu_bacteria 2957375807 2957376610 275
324 iso_pu_bacteria 2957382221 2957384827 275
325 iso_pu_bacteria 2957388812 2957394870 275
326 iso_pu_bacteria 2957395598 2957398245 275
327 iso_pu_bacteria 2957402308 2957403181 275
328 iso_pu_bacteria 2957408893 2957411574 275
329 iso_pu_bacteria 2957415311 2957418298 275
330 iso_pu_bacteria 2957430029 2957432824 275
331 iso_pu_bacteria 2957437181 2957439190 275
332 iso_pu_bacteria 2957443900 2957445013 275
333 iso_pu_bacteria 2957450854 2957455994 275
334 iso_pu_bacteria 2957457609 2957459895 275
335 iso_pu_bacteria 2957464669 2957466017 275
336 iso_pu_bacteria 2957471148 2957477112 275
337 iso_pu_bacteria 2957478035 2957479194 275
338 iso_pu_bacteria 2957484790 2957486281 275
339 iso_pu_bacteria 2957491536 2957498014 275
340 iso_pu_bacteria 2957498199 2957503653 275
341 iso_pu_bacteria 2957505466 2957507632 275
342 iso_pu_bacteria 2960591022 2960592691 275
343 iso_pu_bacteria 2960597568 2960602662 275
344 iso_pu_bacteria 2960603979 2960605959 275
345 iso_pu_bacteria 2960610863 2960612445 275
346 iso_pu_bacteria 2960617483 2960619989 275
347 iso_pu_bacteria 2960624210 2960630899 275
348 iso_pu_bacteria 2960631154 2960632808 275
349 iso_pu_bacteria 2960637947 2960639176 275
350 iso_pu_bacteria 2960645483 2960650530 275
351 iso_pu_bacteria 2960652885 2960660014 275
352 iso_pu_bacteria 2960660292 2960660825 275
353 iso_pu_bacteria 2960667422 2960670991 275
354 iso_pu_bacteria 2960674078 2960679026 275
355 iso_pu_bacteria 2960680706 2960681885 275
356 iso_pu_bacteria 2960687367 2960689975 275
357 iso_pu_bacteria 2960693952 2960694258 275
358 iso_pu_bacteria 2964607997 2964608461 275
359 iso_pu_bacteria 2964615318 2964616601 275
360 iso_pu_bacteria 2964621998 2964622557 275
361 iso_pu_bacteria 2964628898 2964635778 275
362 iso_pu_bacteria 2964636051 2964640972 275
363 iso_pu_bacteria 2964643177 2964643986 275
364 iso_pu_bacteria 2964649959 2964651761 275
365 iso_pu_bacteria 2964656573 2964660986 275
366 iso_pu_bacteria 2964663802 2964667069 275
367 iso_pu_bacteria 2964670856 2964672555 275
368 iso_pu_bacteria 2964678106 2964684116 275
369 iso_pu_bacteria 2964685014 2964686471 275
370 iso_pu_bacteria 2964691889 2964698115 275
371 iso_pu_bacteria 2964698721 2964702297 275
372 iso_pu_bacteria 2964705432 2964711869 275
373 iso_pu_bacteria 2964712639 2964716746 275
374 iso_pu_bacteria 2964719344 2964723915 275
375 iso_pu_bacteria 2967664464 2967664702 275
376 iso_pu_bacteria 2967671571 2967674464 275
377 iso_pu_bacteria 2967678726 2967681832 275
378 iso_pu_bacteria 2967686174 2967690801 275
379 iso_pu_bacteria 2967693043 2967695229 275
380 iso_pu_bacteria 2967699805 2967703895 275
381 iso_pu_bacteria 2967706974 2967713308 275
382 iso_pu_bacteria 2967714385 2967716686 275
383 iso_pu_bacteria 2967721400 2967721687 275
384 iso_pu_bacteria 2967728569 2967735009 275
385 iso_pu_bacteria 2967735183 2967736885 275
386 iso_pu_bacteria 2967742019 2967746126 275
387 iso_pu_bacteria 2967748971 2967755506 275
388 iso_pu_bacteria 2967755722 2967758774 275
389 iso_pu_bacteria 2967762386 2967765404 275
390 iso_pu_bacteria 2967769361 2967775682 275
391 iso_pu_bacteria 2967775926 2967777016 275
392 iso_pu_bacteria 2970019648 2970026494 275
393 iso_pu_bacteria 2970026789 2970030774 275
394 iso_pu_bacteria 2970033650 2970039746 275
395 iso_pu_bacteria 2970040964 2970046737 275
396 iso_pu_bacteria 2970047711 2970051514 275
397 iso_pu_bacteria 2970054988 2970057787 275
398 iso_pu_bacteria 2970061556 2970066722 275
399 iso_pu_bacteria 2970068827 2970072975 275
400 iso_pu_bacteria 2970076120 2970077483 275
401 iso_pu_bacteria 2970088815 2970091148 275
402 iso_pu_bacteria 2970095765 2970100659 275
403 iso_pu_bacteria 2970102677 2970107524 275
404 iso_pu_bacteria 2970109326 2970110841 275
405 iso_pu_bacteria 2970116247 2970122140 275
406 iso_pu_bacteria 2970122695 2970123006 275
407 iso_pu_bacteria 2970129317 2970131709 275
408 iso_pu_bacteria 2970136068 2970142504 275
409 iso_pu_bacteria 2970143518 2970144074 275
410 iso_pu_bacteria 2970149975 2970154231 275
411 iso_pu_bacteria 2970156795 2970160192 275
412 iso_pu_bacteria 2970164137 2970167147 275
413 iso_pu_bacteria 2970170962 2970173259 275
414 iso_pu_bacteria 2970177841 2970180296 275
415 iso_pu_bacteria 2970184632 2970187604 275
416 iso_pu_bacteria 2970191845 2970193361 275
417 iso_pu_bacteria 2977516862 2977517715 275
418 iso_pu_bacteria 2977523885 2977529018 275
419 iso_pu_bacteria 2977530762 2977531695 275
420 iso_pu_bacteria 2977537788 2977540539 275
421 iso_pu_bacteria 2977544691 2977548510 275
422 iso_pu_bacteria 2977551784 2977554393 275
423 iso_pu_bacteria 2977558990 2977559734 275
424 iso_pu_bacteria 2977565890 2977572235 275
425 iso_pu_bacteria 2977572785 2977575314 275
426 iso_pu_bacteria 2977579622 2977580199 275
427 iso_pu_bacteria 2989349275 2989349450 275
428 iso_pu_bacteria 2989771324 2989774971 275
429 iso_pu_bacteria 639633055 639648702 275
430 iso_pu_bacteria 648276728 648739582 275
431 iso_pu_bacteria 8003992118 8003993873 275
432 iso_pu_bacteria 8003999396 8004001419 275
433 iso_pu_bacteria 8005275841 8005280722 275
434 iso_pu_bacteria 8005282627 8005285340 275
435 iso_pu_bacteria 8005289223 8005293243 275
436 iso_pu_bacteria 8005301065 8005302707 275
437 iso_pu_bacteria 8005307578 8005309893 275
438 iso_pu_bacteria 8005376324 8005379389 275
439 iso_pu_bacteria 8005382845 8005385393 275
440 iso_pu_bacteria 8005395548 8005396614 275
441 iso_pu_bacteria 8005430974 8005436411 275
442 iso_pu_bacteria 8005460587 8005463125 275
443 iso_pu_bacteria 8005497431 8005500486 275
444 iso_pu_bacteria 8005556819 8005557543 275
445 iso_pu_bacteria 8005563573 8005568713 275
446 iso_pu_bacteria 8005619151 8005621862 275
447 iso_pu_bacteria 8005626139 8005627104 275
448 iso_pu_bacteria 8005658619 8005659498 275
449 iso_pu_bacteria 8005688590 8005694723 275
450 iso_pu_bacteria 8005695170 8005699853 275
451 iso_pu_bacteria 8018127388 8018130065 275
452 iso_pu_bacteria 8018163183 8018166630 275
453 iso_pu_bacteria 8018176218 8018179682 275
454 iso_pu_bacteria 8023680758 8023685217 275
455 iso_pu_bacteria 8024479707 8024483371 275
456 iso_pu_bacteria 8024501048 8024501494 275
457 iso_pu_bacteria 8054558443 8054561204 275
458 iso_pu_bacteria 8056375014 8056376778 275
459 iso_pu_bacteria 8056382006 8056387986 275
460 3300046519 Ga0495632_0004881 Ga0495632_0004881_7685_8515 276
461 3300050492 nmdc:mga0yw44_127769_c1 nmdc:mga0yw44_127769_c1_185_1015 276
462 iso_pu_bacteria 2508501122 2509111418 276
463 iso_pu_bacteria 2509276019 2509375642 276
464 iso_pu_bacteria 2513237138 2513864785 276
465 iso_pu_bacteria 2513237159 2513997040 276
466 iso_pu_bacteria 2516143018 2516209732 276
467 iso_pu_bacteria 2558860100 2558867957 276
468 iso_pu_bacteria 2582581283 2585166161 276
469 iso_pu_bacteria 2582581299 2585229871 276
470 iso_pu_bacteria 2582581306 2585267636 276
471 iso_pu_bacteria 2582581865 2585386695 276
472 iso_pu_bacteria 2582581866 2585393073 276
473 iso_pu_bacteria 2582581867 2585404369 276
474 iso_pu_bacteria 2585427528 2585537699 276
475 iso_pu_bacteria 2585427590 2585821931 276
476 iso_pu_bacteria 2585427593 2585835649 276
477 iso_pu_bacteria 2585427594 2585843003 276
478 iso_pu_bacteria 2599185352 2600195665 276
479 iso_pu_bacteria 2643221557 2643803549 276
480 iso_pu_bacteria 2643221599 2644003899 276
481 iso_pu_bacteria 2643221607 2644050706 276
482 iso_pu_bacteria 2643221610 2644067516 276
483 iso_pu_bacteria 2643221618 2644107665 276
484 iso_pu_bacteria 2643221626 2644148664 276
485 iso_pu_bacteria 2643221634 2644192576 276
486 iso_pu_bacteria 2643221636 2644205180 276
487 iso_pu_bacteria 2643221643 2644239704 276
488 iso_pu_bacteria 2643221655 2644309059 276
489 iso_pu_bacteria 2643221659 2644332887 276
490 iso_pu_bacteria 2643221668 2644375196 276
491 iso_pu_bacteria 2643221675 2644418569 276
492 iso_pu_bacteria 2643221680 2644451936 276
493 iso_pu_bacteria 2643221686 2644483624 276
494 iso_pu_bacteria 2643221688 2644491821 276
495 iso_pu_bacteria 2643221689 2644501374 276
496 iso_pu_bacteria 2643221698 2644545941 276
497 iso_pu_bacteria 2643221712 2644615001 276
498 iso_pu_bacteria 2643221723 2644676537 276
499 iso_pu_bacteria 2643221726 2644690698 276
500 iso_pu_bacteria 2690316117 2692315812 276
501 iso_pu_bacteria 2738541293 2738804184 276
502 iso_pu_bacteria 2751185821 2753461896 276
503 iso_pu_bacteria 2767802442 2770195273 276
504 iso_pu_bacteria 2775507049 2776913575 276
505 iso_pu_bacteria 2791355094 2792639332 276
506 iso_pu_bacteria 2791355253 2793279957 276
507 iso_pu_bacteria 2802429633 2806046222 276
508 iso_pu_bacteria 2802429636 2806064936 276
509 iso_pu_bacteria 2802429637 2806072204 276
510 iso_pu_bacteria 2838074704 2838079555 276
511 iso_pu_bacteria 2842521101 2842522718 276
512 iso_pu_bacteria 2844163670 2844167790 276
513 iso_pu_bacteria 2847417321 2847419124 276
514 iso_pu_bacteria 2848992105 2848994153 276
515 iso_pu_bacteria 2850079185 2850081183 276
516 iso_pu_bacteria 2855872281 2855876796 276
517 iso_pu_bacteria 2896384573 2896384887 276
518 iso_pu_bacteria 2899803654 2899809044 276
519 iso_pu_bacteria 2920760137 2920765760 276
520 iso_pu_bacteria 2920822456 2920824761 276
521 iso_pu_bacteria 2923556063 2923558065 276
522 iso_pu_bacteria 2928521798 2928523715 276
523 iso_pu_bacteria 2941499720 2941504934 276
524 iso_pu_bacteria 2954011201 2954015998 276
525 iso_pu_bacteria 3003930520 3003933810 276
526 iso_pu_bacteria 3005409236 3005414957 276
527 iso_pu_bacteria 3005452660 3005454381 276
528 iso_pu_bacteria 643692032 643826015 276
529 iso_pu_bacteria 8005570704 8005574409 276
530 iso_pu_bacteria 8049293176 8049295019 276
531 iso_pu_bacteria 8055431914 8055435798 276
532 3300032133 Ga0316583_10038243 Ga0316583_100382432 277
533 3300005937 Ga0081455_10001970 Ga0081455_100019706 278
534 3300035398 Ga0316574_0233395 Ga0316574_0233395_312_1151 278
535 iso_pu_bacteria 2510917022 2511135236 278
536 iso_pu_bacteria 2510917028 2511181681 278
537 iso_pu_bacteria 2524023209 2524459394 278
538 iso_pu_bacteria 2582581294 2585200310 278
539 iso_pu_bacteria 2582581298 2585222665 278
540 iso_pu_bacteria 2582581307 2585270973 278
541 iso_pu_bacteria 2582581308 2585277322 278
542 iso_pu_bacteria 2582581315 2585323505 278
543 iso_pu_bacteria 2582581316 2585331640 278
544 iso_pu_bacteria 2585427527 2585533942 278
545 iso_pu_bacteria 2585427529 2585545248 278
546 iso_pu_bacteria 2585427530 2585552207 278
547 iso_pu_bacteria 2585427531 2585558697 278
548 iso_pu_bacteria 2585427608 2585898062 278
549 iso_pu_bacteria 2585427609 2585904333 278
550 iso_pu_bacteria 2585428125 2587980550 278
551 iso_pu_bacteria 2615840626 2616308702 278
552 iso_pu_bacteria 2615840698 2616556995 278
553 iso_pu_bacteria 2617270742 2617385798 278
554 iso_pu_bacteria 2667528174 2671111601 278
555 iso_pu_bacteria 2775507266 2778174136 278
556 iso_pu_bacteria 2818991448 2819608982 278
557 iso_pu_bacteria 2818991453 2819637789 278
558 iso_pu_bacteria 2838029111 2838029972 278
559 iso_pu_bacteria 2842298080 2842301915 278
560 iso_pu_bacteria 2842357229 2842357619 278
561 iso_pu_bacteria 2842475841 2842476743 278
562 iso_pu_bacteria 2842482326 2842484718 278
563 iso_pu_bacteria 2842502639 2842503500 278
564 iso_pu_bacteria 2842509118 2842511307 278
565 iso_pu_bacteria 2852387548 2852390026 278
566 iso_pu_bacteria 2919100787 2919106549 278
567 iso_pu_bacteria 2919408235 2919411572 278
568 iso_pu_bacteria 3005416602 3005419985 278
569 iso_pu_bacteria 3005445848 3005448281 278
570 iso_pu_bacteria 8005314921 8005316936 278
571 iso_pu_bacteria 8005484373 8005485266 278
572 iso_pu_bacteria 8005542996 8005545287 278
573 iso_pu_bacteria 8005645114 8005649749 278
574 iso_pu_bacteria 8005682033 8005683065 278
575 iso_pu_bacteria 8046767195 8046770413 278
576 iso_pu_bacteria 8057575449 8057575918 278
577 3300003187 JGI25151J46595_10006484 JGI25151J46595_100064845 279
578 3300003215 JGI25153J46596_10007880 JGI25153J46596_100078804 279
579 3300003354 JGI25160J50197_1000582 JGI25160J50197_100058214 279
580 3300003771 Ga0055526_1001046 Ga0055526_100104613 279
581 3300003790 Ga0055528_1000646 Ga0055528_100064625 279
582 3300003790 Ga0055528_1001280 Ga0055528_100128010 279
583 3300004625 Ga0055543_1000623 Ga0055543_100062314 279
584 3300005262 Ga0065165_1027428 Ga0065165_10274281 279
585 3300005467 Ga0070706_100376136 Ga0070706_1003761362 279
586 3300005471 Ga0070698_100064385 Ga0070698_1000643852 279
587 3300005842 Ga0068858_100311112 Ga0068858_1003111122 279
588 3300006038 Ga0075365_10004193 Ga0075365_100041932 279
589 3300006042 Ga0075368_10053301 Ga0075368_100533012 279
590 3300006177 Ga0075362_10001282 Ga0075362_1000128210 279
591 3300006178 Ga0075367_10001089 Ga0075367_1000108911 279
592 3300006186 Ga0075369_10002276 Ga0075369_100022767 279
593 3300006186 Ga0075369_10079707 Ga0075369_100797071 279
594 3300006195 Ga0075366_10102335 Ga0075366_101023352 279
595 3300006946 Ga0079104_1002821 Ga0079104_10028215 279
596 3300009766 Ga0123342_1022424 Ga0123342_10224244 279
597 3300014968 Ga0157379_10218865 Ga0157379_102188652 279
598 3300021320 Ga0214544_1001350 Ga0214544_10013505 279
599 3300021321 Ga0214542_1002270 Ga0214542_10022704 279
600 3300021327 Ga0214543_1000028 Ga0214543_1000028194 279
601 3300022739 Ga0228711_1000016 Ga0228711_100001662 279
602 3300022740 Ga0228710_1000013 Ga0228710_100001372 279
603 3300025245 Ga0207425_1003612 Ga0207425_10036122 279
604 3300025258 Ga0209129_1000161 Ga0209129_100016120 279
605 3300025258 Ga0209129_1000167 Ga0209129_100016788 279
606 3300025273 Ga0209673_1000010 Ga0209673_100001040 279
607 3300025273 Ga0209673_1000296 Ga0209673_100029685 279
608 3300025273 Ga0209673_1001064 Ga0209673_10010647 279
609 3300025273 Ga0209673_1041716 Ga0209673_10417162 279
610 3300025284 Ga0209130_1004153 Ga0209130_10041532 279
611 3300025284 Ga0209130_1021928 Ga0209130_10219282 279
612 3300025291 Ga0209675_1013418 Ga0209675_10134183 279
613 3300025292 Ga0209676_1014017 Ga0209676_10140174 279
614 3300025292 Ga0209676_1030238 Ga0209676_10302382 279
615 3300025294 Ga0209025_1000119 Ga0209025_100011958 279
616 3300025294 Ga0209025_1000695 Ga0209025_100069519 279
617 3300025294 Ga0209025_1003074 Ga0209025_10030744 279
618 3300025294 Ga0209025_1006218 Ga0209025_10062184 279
619 3300025294 Ga0209025_1088277 Ga0209025_10882771 279
620 3300025295 Ga0209564_1000638 Ga0209564_100063837 279
621 3300025295 Ga0209564_1005895 Ga0209564_10058957 279
622 3300025295 Ga0209564_1023695 Ga0209564_10236952 279
623 3300025297 Ga0209758_1000598 Ga0209758_100059847 279
624 3300025297 Ga0209758_1000710 Ga0209758_100071024 279
625 3300025298 Ga0209050_1013563 Ga0209050_10135634 279
626 3300025299 Ga0209256_1000383 Ga0209256_100038311 279
627 3300025299 Ga0209256_1001954 Ga0209256_100195414 279
628 3300025299 Ga0209256_1028230 Ga0209256_10282302 279
629 3300025302 Ga0207426_1000039 Ga0207426_1000039278 279
630 3300025303 Ga0209051_1000253 Ga0209051_100025392 279
631 3300025303 Ga0209051_1001954 Ga0209051_100195410 279
632 3300025303 Ga0209051_1007263 Ga0209051_10072636 279
633 3300025303 Ga0209051_1020188 Ga0209051_10201883 279
634 3300025304 Ga0209257_1005407 Ga0209257_10054074 279
635 3300025910 Ga0207684_10075386 Ga0207684_100753862 279
636 3300025924 Ga0207694_10096375 Ga0207694_100963752 279
637 3300025928 Ga0207700_10187094 Ga0207700_101870942 279
638 3300027111 Ga0209281_1000221 Ga0209281_100022158 279
639 3300027111 Ga0209281_1000453 Ga0209281_100045328 279
640 3300027666 Ga0209282_1000041 Ga0209282_100004158 279
641 3300028794 Ga0307515_10000023 Ga0307515_10000023266 279
642 3300028794 Ga0307515_10045603 Ga0307515_100456033 279
643 3300031456 Ga0307513_10013160 Ga0307513_1001316015 279
644 3300031456 Ga0307513_10017501 Ga0307513_100175012 279
645 3300031548 Ga0307408_100029521 Ga0307408_1000295213 279
646 3300031911 Ga0307412_10224122 Ga0307412_102241222 279
647 3300031967 Ga0315914_1000030 Ga0315914_100003073 279
648 3300032002 Ga0307416_100121986 Ga0307416_1001219863 279
649 3300033430 Ga0315913_1000017 Ga0315913_100001771 279
650 3300033464 Ga0315915_1000017 Ga0315915_100001794 279
651 3300035172 Ga0373955_0055765 Ga0373955_0055765_1116_1955 279
652 3300035695 Ga0373927_0000556 Ga0373927_0000556_25706_26545 279
653 3300037068 Ga0373925_0002597 Ga0373925_0002597_8663_9502 279
654 3300041441 Ga0451787_547467 Ga0451787_547467_13_852 279
655 3300041492 Ga0451835_0182672 Ga0451835_0182672_727_1566 279
656 3300041494 Ga0451837_1006229 Ga0451837_1006229_27_869 279
657 3300041494 Ga0451837_1707933 Ga0451837_1707933_90_929 279
658 3300041496 Ga0451839_0446078 Ga0451839_0446078_331_1170 279
659 3300041501 Ga0451845_0273193 Ga0451845_0273193_67_906 279
660 3300041503 Ga0451847_0827233 Ga0451847_0827233_705_1544 279
661 3300041505 Ga0451849_0988520 Ga0451849_0988520_164_1003 279
662 3300041507 Ga0451851_1044136 Ga0451851_1044136_376_1215 279
663 3300042007 Ga0439449_0006695 Ga0439449_0006695_1608_2447 279
664 3300046460 Ga0495638_0000638 Ga0495638_0000638_22174_23013 279
665 3300046460 Ga0495638_0047437 Ga0495638_0047437_121_960 279
666 3300046460 Ga0495638_0126441 Ga0495638_0126441_512_1351 279
667 3300046471 Ga0495650_0021715 Ga0495650_0021715_121_960 279
668 3300046474 Ga0495605_0002606 Ga0495605_0002606_448_1287 279
669 3300046474 Ga0495605_0011032 Ga0495605_0011032_3055_3894 279
670 3300046492 Ga0495585_0012321 Ga0495585_0012321_106_945 279
671 3300046500 Ga0495596_0035987 Ga0495596_0035987_947_1786 279
672 3300046501 Ga0495607_0007805 Ga0495607_0007805_2371_3210 279
673 3300046501 Ga0495607_0074920 Ga0495607_0074920_659_1498 279
674 3300046507 Ga0495606_0007913 Ga0495606_0007913_4170_5009 279
675 3300046507 Ga0495606_0036604 Ga0495606_0036604_751_1590 279
676 3300046513 Ga0495616_0006597 Ga0495616_0006597_3643_4482 279
677 3300046513 Ga0495616_0034968 Ga0495616_0034968_791_1630 279
678 3300046518 Ga0495631_0002125 Ga0495631_0002125_7562_8401 279
679 3300046518 Ga0495631_0014589 Ga0495631_0014589_2282_3121 279
680 3300046519 Ga0495632_0004409 Ga0495632_0004409_4285_5124 279
681 3300046519 Ga0495632_0004862 Ga0495632_0004862_1593_2432 279
682 3300046522 Ga0495643_0005952 Ga0495643_0005952_512_1351 279
683 3300046525 Ga0495663_0039079 Ga0495663_0039079_89_928 279
684 3300046538 Ga0495609_0007260 Ga0495609_0007260_2290_3129 279
685 3300046616 Ga0495668_0048638 Ga0495668_0048638_1203_2042 279
686 3300046660 Ga0495625_0001863 Ga0495625_0001863_18185_19024 279
687 3300046660 Ga0495625_0015058 Ga0495625_0015058_2669_3508 279
688 3300046660 Ga0495625_0169887 Ga0495625_0169887_541_1380 279
689 3300046663 Ga0495635_0235611 Ga0495635_0235611_138_977 279
690 3300046810 Ga0495660_0012720 Ga0495660_0012720_1028_1867 279
691 3300046810 Ga0495660_0020342 Ga0495660_0020342_413_1252 279
692 3300047318 Ga0495636_0001864 Ga0495636_0001864_3083_3922 279
693 3300047323 Ga0495683_0019656 Ga0495683_0019656_1993_2832 279
694 3300047443 Ga0495687_010735 Ga0495687_010735_524_1363 279
695 3300048090 Ga0495615_0038972 Ga0495615_0038972_46_885 279
696 3300048919 Ga0496116_0089363 Ga0496116_0089363_495_1334 279
697 3300048919 Ga0496116_0115852 Ga0496116_0115852_49_888 279
698 3300048920 Ga0496117_0005327 Ga0496117_0005327_1962_2804 279
699 3300048921 Ga0496118_0005459 Ga0496118_0005459_6071_6910 279
700 3300048922 Ga0496119_0157567 Ga0496119_0157567_125_964 279
701 3300048924 Ga0496121_0100735 Ga0496121_0100735_796_1635 279
702 3300048924 Ga0496121_0136605 Ga0496121_0136605_713_1552 279
703 3300048925 Ga0496122_0001317 Ga0496122_0001317_11097_11939 279
704 3300048925 Ga0496122_0098445 Ga0496122_0098445_666_1505 279
705 3300048926 Ga0496123_0000448 Ga0496123_0000448_34518_35360 279
706 3300048927 Ga0496124_0005688 Ga0496124_0005688_11048_11890 279
707 3300048927 Ga0496124_0040458 Ga0496124_0040458_242_1081 279
708 3300048928 Ga0496125_0001127 Ga0496125_0001127_14111_14953 279
709 3300048929 Ga0496126_0032771 Ga0496126_0032771_303_1145 279
710 3300048929 Ga0496126_0076645 Ga0496126_0076645_1186_2025 279
711 3300048929 Ga0496126_0125110 Ga0496126_0125110_208_1047 279
712 3300049459 Ga0495678_003522 Ga0495678_003522_7593_8432 279
713 3300049459 Ga0495678_089111 Ga0495678_089111_154_993 279
714 3300049460 Ga0495682_0046054 Ga0495682_0046054_13_852 279
715 3300049568 Ga0501031_0108159 Ga0501031_0108159_396_1238 279
716 3300049572 Ga0501036_0111674 Ga0501036_0111674_673_1512 279
717 3300049575 Ga0501039_0202771 Ga0501039_0202771_592_1431 279
718 3300049589 Ga0501073_0077193 Ga0501073_0077193_166_1005 279
719 3300049742 Ga0501080_0063665 Ga0501080_0063665_1532_2371 279
720 3300049744 Ga0501083_0118133 Ga0501083_0118133_660_1499 279
721 3300049776 Ga0501280_004692 Ga0501280_004692_248_1099 279
722 3300049822 Ga0501035_0071198 Ga0501035_0071198_1423_2265 279
723 3300050489 nmdc:mga03683_47598_c1 nmdc:mga03683_47598_c1_626_1468 279
724 3300050493 nmdc:mga0k408_26375_c1 nmdc:mga0k408_26375_c1_637_1479 279
725 3300050496 nmdc:mga07m45_45410_c1 nmdc:mga07m45_45410_c1_393_1235 279
726 3300053086 Ga0500578_0047074 Ga0500578_0047074_571_1410 279
727 3300053098 Ga0500650_0016254 Ga0500650_0016254_1220_2059 279
728 3300053109 Ga0500569_001435 Ga0500569_001435_3581_4420 279
729 3300053134 Ga0500658_0000720 Ga0500658_0000720_3601_4440 279
730 3300053140 Ga0500573_0003989 Ga0500573_0003989_3347_4186 279
731 3300053153 Ga0500616_0001219 Ga0500616_0001219_12168_13007 279
732 3300053153 Ga0500616_0033208 Ga0500616_0033208_512_1351 279
733 3300053158 Ga0500627_0002349 Ga0500627_0002349_2513_3352 279
734 iso_pu_bacteria 2513237088 2513594714 279
735 iso_pu_bacteria 2643221653 2644298431 279
736 iso_pu_bacteria 2643221719 2644656660 279
737 iso_pu_bacteria 2818991272 2819241708 279
738 iso_pu_bacteria 2837651117 2837653336 279
739 iso_pu_bacteria 2989776772 2989778959 279
740 iso_pu_bacteria 8005246636 8005248512 279
741 3300002774 JGI25150J39212_1000439 JGI25150J39212_10004397 280
742 3300002987 JGI25159J45721_1000020 JGI25159J45721_100002028 280
743 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008351 280
744 3300003187 JGI25151J46595_10012789 JGI25151J46595_100127891 280
745 3300003215 JGI25153J46596_10000210 JGI25153J46596_1000021015 280
746 3300003354 JGI25160J50197_1000055 JGI25160J50197_100005528 280
747 3300003354 JGI25160J50197_1017356 JGI25160J50197_10173562 280
748 3300003374 JGI25161J50226_1000411 JGI25161J50226_100041113 280
749 3300003771 Ga0055526_1000508 Ga0055526_100050831 280
750 3300003771 Ga0055526_1028491 Ga0055526_10284912 280
751 3300003775 Ga0055524_1000319 Ga0055524_100031919 280
752 3300003775 Ga0055524_1043767 Ga0055524_10437672 280
753 3300003790 Ga0055528_1005677 Ga0055528_10056773 280
754 3300003794 Ga0055531_10017314 Ga0055531_100173143 280
755 3300004625 Ga0055543_1000240 Ga0055543_100024016 280
756 3300005262 Ga0065165_1001002 Ga0065165_100100210 280
757 3300005355 Ga0070671_100041567 Ga0070671_1000415671 280
758 3300006038 Ga0075365_10042626 Ga0075365_100426262 280
759 3300006178 Ga0075367_10054146 Ga0075367_100541462 280
760 3300006186 Ga0075369_10022250 Ga0075369_100222502 280
761 3300009011 Ga0105251_10021359 Ga0105251_100213594 280
762 3300009092 Ga0105250_10023520 Ga0105250_100235203 280
763 3300009177 Ga0105248_10041541 Ga0105248_100415414 280
764 3300009766 Ga0123342_1014483 Ga0123342_10144832 280
765 3300013249 Ga0171463_1003 Ga0171463_1003596 280
766 3300015690 Ga0183363_1329 Ga0183363_13292 280
767 3300021321 Ga0214542_1023610 Ga0214542_10236101 280
768 3300021327 Ga0214543_1000078 Ga0214543_100007850 280
769 3300025245 Ga0207425_1000024 Ga0207425_1000024199 280
770 3300025258 Ga0209129_1000184 Ga0209129_100018487 280
771 3300025258 Ga0209129_1001218 Ga0209129_100121812 280
772 3300025263 Ga0209565_1019625 Ga0209565_10196252 280
773 3300025273 Ga0209673_1001836 Ga0209673_10018369 280
774 3300025273 Ga0209673_1044199 Ga0209673_10441991 280
775 3300025284 Ga0209130_1000026 Ga0209130_1000026330 280
776 3300025292 Ga0209676_1008398 Ga0209676_10083984 280
777 3300025294 Ga0209025_1000050 Ga0209025_1000050128 280
778 3300025294 Ga0209025_1000767 Ga0209025_100076718 280
779 3300025294 Ga0209025_1015166 Ga0209025_10151664 280
780 3300025295 Ga0209564_1000208 Ga0209564_100020828 280
781 3300025295 Ga0209564_1010711 Ga0209564_10107116 280
782 3300025297 Ga0209758_1000083 Ga0209758_1000083129 280
783 3300025298 Ga0209050_1010952 Ga0209050_10109522 280
784 3300025299 Ga0209256_1000042 Ga0209256_100004267 280
785 3300025299 Ga0209256_1002837 Ga0209256_10028373 280
786 3300025299 Ga0209256_1018012 Ga0209256_10180122 280
787 3300025302 Ga0207426_1000006 Ga0207426_1000006993 280
788 3300025302 Ga0207426_1000697 Ga0207426_100069732 280
789 3300025304 Ga0209257_1007329 Ga0209257_10073294 280
790 3300025931 Ga0207644_10034481 Ga0207644_100344812 280
791 3300025972 Ga0207668_10010333 Ga0207668_100103331 280
792 3300028794 Ga0307515_10002518 Ga0307515_1000251821 280
793 3300028794 Ga0307515_10033971 Ga0307515_100339718 280
794 3300031731 Ga0307405_10050711 Ga0307405_100507112 280
795 3300031901 Ga0307406_10053226 Ga0307406_100532262 280
796 3300031911 Ga0307412_10015488 Ga0307412_100154883 280
797 3300041404 Ga0439436_0009228 Ga0439436_0009228_214_1056 280
798 3300041407 Ga0439447_051615 Ga0439447_051615_52_894 280
799 3300042015 Ga0439462_0006428 Ga0439462_0006428_2046_2888 280
800 3300042122 Ga0450920_012072 Ga0450920_012072_490_1332 280
801 3300046453 Ga0495627_067670 Ga0495627_067670_104_946 280
802 3300046454 Ga0495592_0028499 Ga0495592_0028499_432_1274 280
803 3300046459 Ga0495629_0066519 Ga0495629_0066519_1580_2422 280
804 3300046476 Ga0495662_0008737 Ga0495662_0008737_3351_4193 280
805 3300046492 Ga0495585_0006116 Ga0495585_0006116_6495_7337 280
806 3300046506 Ga0495583_0002711 Ga0495583_0002711_3825_4667 280
807 3300046507 Ga0495606_0001089 Ga0495606_0001089_30009_30851 280
808 3300046507 Ga0495606_0071160 Ga0495606_0071160_964_1806 280
809 3300046512 Ga0495610_0002729 Ga0495610_0002729_5791_6633 280
810 3300046515 Ga0495620_0014593 Ga0495620_0014593_1524_2366 280
811 3300046519 Ga0495632_0072670 Ga0495632_0072670_408_1250 280
812 3300046557 Ga0495622_0004239 Ga0495622_0004239_1238_2080 280
813 3300046558 Ga0495633_0102106 Ga0495633_0102106_198_1040 280
814 3300046660 Ga0495625_0116683 Ga0495625_0116683_923_1765 280
815 3300046660 Ga0495625_0117278 Ga0495625_0117278_113_955 280
816 3300046660 Ga0495625_0170796 Ga0495625_0170796_422_1264 280
817 3300046660 Ga0495625_0309993 Ga0495625_0309993_23_865 280
818 3300046663 Ga0495635_0056234 Ga0495635_0056234_832_1674 280
819 3300046674 Ga0495588_0038172 Ga0495588_0038172_1405_2247 280
820 3300046794 Ga0495589_0045844 Ga0495589_0045844_631_1473 280
821 3300046809 Ga0495600_0031813 Ga0495600_0031813_114_956 280
822 3300047317 Ga0495604_0322288 Ga0495604_0322288_114_956 280
823 3300047319 Ga0495674_0261849 Ga0495674_0261849_257_1099 280
824 3300047472 Ga0495686_0000796 Ga0495686_0000796_18176_19018 280
825 3300047472 Ga0495686_0006004 Ga0495686_0006004_3800_4642 280
826 3300047472 Ga0495686_0009754 Ga0495686_0009754_5830_6672 280
827 3300048088 Ga0495602_0294564 Ga0495602_0294564_27_869 280
828 3300048090 Ga0495615_0053191 Ga0495615_0053191_164_1006 280
829 3300048903 Ga0496100_0203515 Ga0496100_0203515_83_925 280
830 3300048904 Ga0496101_0018868 Ga0496101_0018868_842_1684 280
831 3300048907 Ga0496104_0261715 Ga0496104_0261715_227_1069 280
832 3300048908 Ga0496105_0210137 Ga0496105_0210137_553_1395 280
833 3300048911 Ga0496108_0659317 Ga0496108_0659317_19_861 280
834 3300048913 Ga0496110_0025054 Ga0496110_0025054_3977_4819 280
835 3300048914 Ga0496111_0022201 Ga0496111_0022201_402_1244 280
836 3300048917 Ga0496114_0262734 Ga0496114_0262734_103_945 280
837 3300048919 Ga0496116_0021891 Ga0496116_0021891_3415_4257 280
838 3300048922 Ga0496119_0020529 Ga0496119_0020529_3392_4234 280
839 3300048924 Ga0496121_0029249 Ga0496121_0029249_1901_2743 280
840 3300048924 Ga0496121_0201167 Ga0496121_0201167_515_1357 280
841 3300048925 Ga0496122_0028477 Ga0496122_0028477_3494_4336 280
842 3300048926 Ga0496123_0024065 Ga0496123_0024065_441_1283 280
843 3300048927 Ga0496124_0000687 Ga0496124_0000687_43412_44254 280
844 3300048927 Ga0496124_0150157 Ga0496124_0150157_198_1040 280
845 3300048928 Ga0496125_0027274 Ga0496125_0027274_834_1676 280
846 3300048929 Ga0496126_0002636 Ga0496126_0002636_15517_16362 280
847 3300048929 Ga0496126_0057510 Ga0496126_0057510_2092_2934 280
848 3300049459 Ga0495678_010175 Ga0495678_010175_574_1416 280
849 3300049584 Ga0501068_0031640 Ga0501068_0031640_653_1498 280
850 3300049585 Ga0501069_0157026 Ga0501069_0157026_62_907 280
851 3300049589 Ga0501073_0135613 Ga0501073_0135613_422_1267 280
852 3300049822 Ga0501035_0000927 Ga0501035_0000927_6434_7279 280
853 3300053148 Ga0500590_002326 Ga0500590_002326_4256_5098 280
854 3300053158 Ga0500627_0164150 Ga0500627_0164150_55_903 280
855 3300053177 Ga0500636_0043214 Ga0500636_0043214_869_1711 280
856 3300005546 Ga0070696_100252058 Ga0070696_1002520582 281
857 3300036647 Ga0316582_0181328 Ga0316582_0181328_449_1300 281
858 3300042436 Ga0439435_0000469 Ga0439435_0000469_2112_2972 281
859 iso_pu_bacteria 2671180139 2671694834 281
860 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001201 282
861 3300002737 JGI25162J39368_1000274 JGI25162J39368_10002746 282
862 3300002737 JGI25162J39368_1003049 JGI25162J39368_10030493 282
863 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011182 282
864 3300002741 JGI25157J39369_1000030 JGI25157J39369_10000303 282
865 3300002773 JGI25152J39213_1007081 JGI25152J39213_10070813 282
866 3300002987 JGI25159J45721_1000782 JGI25159J45721_100078212 282
867 3300002987 JGI25159J45721_1001080 JGI25159J45721_100108011 282
868 3300003187 JGI25151J46595_10025737 JGI25151J46595_100257372 282
869 3300003214 JGI25165J46597_1000337 JGI25165J46597_10003375 282
870 3300003214 JGI25165J46597_1000696 JGI25165J46597_10006965 282
871 3300003215 JGI25153J46596_10001886 JGI25153J46596_1000188610 282
872 3300003215 JGI25153J46596_10012130 JGI25153J46596_100121303 282
873 3300003215 JGI25153J46596_10012137 JGI25153J46596_100121373 282
874 3300003322 rootL2_10009459 rootL2_100094599 282
875 3300003354 JGI25160J50197_1000087 JGI25160J50197_100008764 282
876 3300003374 JGI25161J50226_1000066 JGI25161J50226_100006632 282
877 3300003374 JGI25161J50226_1000138 JGI25161J50226_100013849 282
878 3300003771 Ga0055526_1015057 Ga0055526_10150574 282
879 3300003790 Ga0055528_1005314 Ga0055528_10053149 282
880 3300003792 Ga0055540_1006491 Ga0055540_10064914 282
881 3300003856 Ga0058692_1014329 Ga0058692_10143291 282
882 3300004625 Ga0055543_1000053 Ga0055543_100005380 282
883 3300004625 Ga0055543_1000068 Ga0055543_100006864 282
884 3300005262 Ga0065165_1000839 Ga0065165_100083932 282
885 3300005262 Ga0065165_1006285 Ga0065165_10062853 282
886 3300005367 Ga0070667_100642758 Ga0070667_1006427581 282
887 3300009093 Ga0105240_10000005 Ga0105240_10000005715 282
888 3300009545 Ga0105237_10000766 Ga0105237_1000076622 282
889 3300010375 Ga0105239_10001069 Ga0105239_100010696 282
890 3300013104 Ga0157370_10000046 Ga0157370_1000004661 282
891 3300013105 Ga0157369_10385871 Ga0157369_103858712 282
892 3300015262 Ga0182007_10002120 Ga0182007_100021205 282
893 3300015265 Ga0182005_1004429 Ga0182005_10044292 282
894 3300025206 Ga0209435_100012 Ga0209435_100012181 282
895 3300025233 Ga0209437_100047 Ga0209437_100047111 282
896 3300025233 Ga0209437_100165 Ga0209437_1001659 282
897 3300025245 Ga0207425_1002614 Ga0207425_10026143 282
898 3300025245 Ga0207425_1012443 Ga0207425_10124432 282
899 3300025246 Ga0209646_1000026 Ga0209646_1000026181 282
900 3300025246 Ga0209646_1004329 Ga0209646_10043292 282
901 3300025250 Ga0209026_1000014 Ga0209026_1000014181 282
902 3300025253 Ga0209677_100811 Ga0209677_1008112 282
903 3300025256 Ga0209759_1000012 Ga0209759_1000012181 282
904 3300025258 Ga0209129_1003533 Ga0209129_10035334 282
905 3300025258 Ga0209129_1003776 Ga0209129_10037769 282
906 3300025258 Ga0209129_1004343 Ga0209129_10043436 282
907 3300025261 Ga0209233_1000048 Ga0209233_1000048291 282
908 3300025261 Ga0209233_1000069 Ga0209233_1000069139 282
909 3300025261 Ga0209233_1000257 Ga0209233_100025763 282
910 3300025273 Ga0209673_1006371 Ga0209673_10063716 282
911 3300025284 Ga0209130_1000021 Ga0209130_1000021293 282
912 3300025284 Ga0209130_1000081 Ga0209130_100008110 282
913 3300025294 Ga0209025_1016503 Ga0209025_10165034 282
914 3300025295 Ga0209564_1000260 Ga0209564_100026031 282
915 3300025297 Ga0209758_1000961 Ga0209758_100096110 282
916 3300025297 Ga0209758_1003274 Ga0209758_10032745 282
917 3300025297 Ga0209758_1003835 Ga0209758_10038356 282
918 3300025299 Ga0209256_1003038 Ga0209256_100303810 282
919 3300025302 Ga0207426_1000008 Ga0207426_1000008490 282
920 3300025302 Ga0207426_1000010 Ga0207426_100001065 282
921 3300025304 Ga0209257_1025688 Ga0209257_10256883 282
922 3300025913 Ga0207695_10000011 Ga0207695_10000011202 282
923 3300025914 Ga0207671_10000241 Ga0207671_100002419 282
924 3300027312 Ga0209371_1004493 Ga0209371_10044932 282
925 3300028379 Ga0268266_10313698 Ga0268266_103136981 282
926 3300030500 Ga0268256_1004316 Ga0268256_10043162 282
927 3300041413 Ga0439465_0019336 Ga0439465_0019336_999_1847 282
928 3300045976 Ga0466967_0521347 Ga0466967_0521347_148_996 282
929 3300046506 Ga0495583_0016652 Ga0495583_0016652_412_1260 282
930 3300046694 Ga0495649_0100101 Ga0495649_0100101_15_863 282
931 3300048903 Ga0496100_0142905 Ga0496100_0142905_316_1164 282
932 3300048905 Ga0496102_0006068 Ga0496102_0006068_4635_5483 282
933 3300048906 Ga0496103_0008717 Ga0496103_0008717_4548_5396 282
934 3300048909 Ga0496106_0000658 Ga0496106_0000658_12878_13726 282
935 3300048920 Ga0496117_0000353 Ga0496117_0000353_8091_8939 282
936 3300048921 Ga0496118_0000204 Ga0496118_0000204_33443_34291 282
937 3300048921 Ga0496118_0047464 Ga0496118_0047464_307_1155 282
938 3300048922 Ga0496119_0013782 Ga0496119_0013782_727_1575 282
939 3300048922 Ga0496119_0015557 Ga0496119_0015557_726_1574 282
940 3300048923 Ga0496120_0037801 Ga0496120_0037801_1854_2702 282
941 3300048923 Ga0496120_0048116 Ga0496120_0048116_255_1103 282
942 3300048924 Ga0496121_0000378 Ga0496121_0000378_81014_81862 282
943 3300048924 Ga0496121_0038184 Ga0496121_0038184_2639_3487 282
944 3300048924 Ga0496121_0306743 Ga0496121_0306743_40_888 282
945 3300048925 Ga0496122_0014776 Ga0496122_0014776_1269_2117 282
946 3300048925 Ga0496122_0020665 Ga0496122_0020665_744_1592 282
947 3300048926 Ga0496123_0007623 Ga0496123_0007623_8707_9555 282
948 3300048926 Ga0496123_0013544 Ga0496123_0013544_4961_5809 282
949 3300048927 Ga0496124_0027025 Ga0496124_0027025_293_1141 282
950 3300048927 Ga0496124_0116439 Ga0496124_0116439_515_1363 282
951 3300048928 Ga0496125_0018120 Ga0496125_0018120_4535_5383 282
952 3300048928 Ga0496125_0019265 Ga0496125_0019265_908_1756 282
953 3300048929 Ga0496126_0063346 Ga0496126_0063346_483_1331 282
954 3300053093 Ga0500651_0031083 Ga0500651_0031083_771_1619 282
955 3300053125 Ga0500618_002874 Ga0500618_002874_1883_2731 282
956 3300053134 Ga0500658_0007741 Ga0500658_0007741_2030_2878 282
957 3300053139 Ga0500568_0015244 Ga0500568_0015244_1368_2216 282
958 3300053156 Ga0500622_0006163 Ga0500622_0006163_753_1601 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

26

239

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4d-assembly1.cif.gz_A crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9669 8 268
1s4d-assembly4.cif.gz_H crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9668 8 270
1s4d-assembly6.cif.gz_M crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9656 10 268
1s4d-assembly5.cif.gz_J crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9636 8 268
1s4d-assembly3.cif.gz_F crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9626 8 268
ID Description Score Start End Superfamily
1s4dH02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9925 130 270 3.30.950.10
1s4dH02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9779 130 270 3.30.950.10
1s4dE01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9521 6 129 3.40.1010.10
af_I6X5I7_276_403_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9303 132 251 3.30.950.10
1s4dE01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.93 6 129 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A7J4N8S3-F1-model_v4 Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) 0.9803 165 252 GO:0004851
GO:0019354
GO:0032259
AF-A0A7K4NN19-F1-model_v4 Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) 0.9757 169 257 GO:0004851
GO:0019354
GO:0032259
AF-A0A3D5JMN9-F1-model_v4 deleted 0.9735 179 262
AF-A0A256GSE8-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9668 9 267 GO:0004851
GO:0019354
GO:0032259
AF-B1HRE5-F1-model_v4 Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9663 168 262 GO:0004851
GO:0016020
GO:0019354
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.18 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map