F486788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 958 | 758 | 453 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300003578|Ga0006562J51391_1025531|Ga0006562J51391_10255311 |
| Length | 293 |
| Sequence | MNKAEETAACVIARSKVTLPAMEPGHVWLVGAGPGDPGLLTLHAVNALQQADVIVYDALVDDACLSLKNADAVLEYAGKRGGKPSPKQRDISLRLVELAKSGKKVLRLKGGDPFVFGRGAEEALTLVEHGIPFRIVPGVTAGIGGLAYAGIAATHRDINQSVTFLTGHDASGSMPDGINWTGIAKSAPIIVMYMAMKHIDLIARRLIEAGRSPDEPVAFVCNASLPNQIVLETTLARAAKDVEAAGLNPPAIVVVGEVVRLRAGLDWMGALNGKILSSDPLARRNQNEGVRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 22 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 23 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 24 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 25 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 29 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 30 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 31 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 32 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 33 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 34 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 35 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 36 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 37 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 41 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 42 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 43 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 44 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 45 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 46 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 47 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 48 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 49 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 50 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 51 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 52 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 53 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 54 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 55 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 56 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 57 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 58 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 59 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 60 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 61 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 62 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 63 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 64 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 65 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 66 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 67 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 68 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 69 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 70 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 71 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 72 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 73 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 74 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 75 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 76 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 77 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 78 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 79 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 80 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 81 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 82 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 83 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 84 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 85 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 86 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 87 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 88 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 89 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 90 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 91 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 92 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 93 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 94 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 95 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 96 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 97 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 98 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 99 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 100 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 101 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 102 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 103 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 104 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 105 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 106 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 107 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 108 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 109 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 110 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 111 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 112 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 113 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 114 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 115 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 116 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 117 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 118 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 119 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 120 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 121 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 122 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 123 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 124 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 125 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 126 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 127 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 128 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 129 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 130 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 131 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 132 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 133 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 134 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 135 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 136 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 137 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 138 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 139 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 140 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 141 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 142 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 143 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 144 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 145 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 146 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 147 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 148 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 149 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 150 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 151 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 152 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 153 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 154 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 155 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 156 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 157 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 158 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 159 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 160 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 161 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 162 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 163 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 164 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 165 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 166 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 167 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 168 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 169 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 170 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 171 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 172 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 173 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 174 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 175 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 176 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 177 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 178 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 179 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 180 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 181 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 182 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 183 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 184 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 185 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 186 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 187 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 188 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 189 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 190 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 191 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 192 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 193 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 194 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 195 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 196 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 197 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 198 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 199 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 200 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 201 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 202 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 203 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 204 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 205 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 206 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 207 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 208 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 209 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 210 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 211 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 212 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 213 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 214 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 215 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 216 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 217 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 218 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 219 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 220 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 221 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 222 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 223 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 224 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 225 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 226 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 227 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 228 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 229 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 230 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 231 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 232 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 233 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 234 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 235 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 236 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 237 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 238 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 239 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 240 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 241 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 242 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 243 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 244 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 245 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 246 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 247 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 248 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 249 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 250 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 251 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 252 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 253 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 254 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 255 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 256 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 257 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 258 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 259 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 260 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 261 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 262 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 263 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 264 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 265 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 266 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 267 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 268 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 269 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 270 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 271 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 272 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 273 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 274 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 275 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 276 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 277 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 278 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 279 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 280 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 281 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 282 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 283 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 284 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 285 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 286 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 287 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 288 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 289 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 290 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 291 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 292 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 293 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 294 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 295 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 296 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 297 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 298 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 299 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 300 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 301 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 302 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 303 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 304 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 305 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 306 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 307 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 308 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 309 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 310 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 311 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 312 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 313 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 314 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 315 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 316 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 317 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 318 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 319 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 320 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 321 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 322 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 323 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 324 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 325 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 326 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 327 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 328 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 329 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 330 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 331 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 332 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 333 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 334 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 335 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 336 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 337 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 338 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 339 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 340 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 341 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 342 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 343 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 344 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 345 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 346 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 347 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 348 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 349 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 350 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 351 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 352 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 353 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 354 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 355 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 356 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 357 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 358 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 359 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 360 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 361 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 362 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 363 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 364 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 365 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 366 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 367 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 368 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 369 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 370 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 371 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 372 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 373 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 374 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 375 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 376 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 377 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 378 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 379 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 380 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 381 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 382 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 383 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 384 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 385 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 386 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 387 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 388 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 389 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 390 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 391 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 392 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 393 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 394 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 395 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 396 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 397 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 398 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 399 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 400 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 401 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 402 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 403 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 404 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 405 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 406 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 407 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 408 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 409 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 410 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 411 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 412 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 413 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 414 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 415 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 416 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 417 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 418 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 419 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 420 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 421 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 422 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 423 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 424 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 425 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 426 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 427 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 428 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 429 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 430 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 431 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 432 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 433 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 434 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 435 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 436 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 437 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 438 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 439 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 440 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 441 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 442 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 443 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 444 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 445 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 446 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 447 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 448 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 449 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 450 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 451 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 452 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 453 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 454 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 455 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 456 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 457 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 458 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 459 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 460 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 461 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 462 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 463 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 464 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 465 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 466 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 467 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 468 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 469 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 470 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 471 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 472 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 473 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 474 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 475 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 476 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 477 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 478 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 479 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 480 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 481 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 482 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 483 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 484 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 485 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 487 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 488 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 489 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 490 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 491 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 492 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 493 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 494 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 495 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 496 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 498 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 499 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 500 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 501 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 502 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 503 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 504 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 505 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 506 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 507 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 508 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 509 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 510 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 511 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 512 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 513 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 514 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 515 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 516 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 517 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 518 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 520 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 521 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 522 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 523 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 524 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 525 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 526 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 527 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 528 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 529 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 530 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 531 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 532 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 533 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 534 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 535 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 536 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 537 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 538 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 539 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 540 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 541 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 542 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 543 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 545 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 548 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 549 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 551 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 569 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 571 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 573 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 574 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 575 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 576 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 577 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 578 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 579 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 580 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 581 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 582 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 583 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 584 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 585 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 586 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 587 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 588 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 589 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 590 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 591 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 592 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 593 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 594 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 595 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 596 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 597 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 598 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 599 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 600 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 601 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 602 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 603 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 604 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 605 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 606 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 607 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 608 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 609 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 610 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 611 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 612 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 613 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 614 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 615 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 659 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 660 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 661 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 662 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 663 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 664 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 665 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 666 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 667 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 668 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 669 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 670 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 671 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 672 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 673 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 674 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 675 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 676 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 677 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 678 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 679 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 680 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 683 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 686 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 688 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 696 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 697 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 699 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 700 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 701 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 702 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 703 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 704 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 705 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 706 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 707 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 708 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 709 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 710 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 711 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 712 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 713 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 714 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 715 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 716 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 717 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 718 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 719 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 720 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 721 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 722 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 723 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 724 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 725 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 726 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 727 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 728 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 729 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 730 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 731 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 732 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 733 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 734 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 735 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 736 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 737 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 738 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 739 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 740 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 741 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 742 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 743 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 744 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 745 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 746 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 747 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 748 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 749 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 750 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 751 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 752 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 753 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 754 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 755 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 756 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 757 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 758 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.18 |
| Metatranscriptomes | 0.1 |
| Isolates | 52.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.39 |
| Nodule | 41.34 |
| Rhizoplane | 1.88 |
| Rhizosphere | 23.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 2 | JGI25162J39368_1000274 | 3300002737 | Bacteria | 49715 |
| 3 | JGI25162J39368_1003049 | 3300002737 | Bacteria | 5429 |
| 4 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 5 | JGI25157J39369_1000030 | 3300002741 | Bacteria | 146112 |
| 6 | JGI25152J39213_1003223 | 3300002773 | Bacteria | 5675 |
| 7 | JGI25152J39213_1007081 | 3300002773 | Bacteria | 2947 |
| 8 | JGI25150J39212_1000439 | 3300002774 | Bacteria | 18618 |
| 9 | JGI25159J45721_1000020 | 3300002987 | Bacteria | 124791 |
| 10 | JGI25159J45721_1000782 | 3300002987 | Bacteria | 13842 |
| 11 | JGI25159J45721_1001080 | 3300002987 | Bacteria | 11636 |
| 12 | JGI25151J46595_10000083 | 3300003187 | Bacteria | 130658 |
| 13 | JGI25151J46595_10006484 | 3300003187 | Bacteria | 5879 |
| 14 | JGI25151J46595_10012789 | 3300003187 | Bacteria | 3802 |
| 15 | JGI25151J46595_10025737 | 3300003187 | Bacteria | 2388 |
| 16 | JGI25165J46597_1000337 | 3300003214 | Bacteria | 55143 |
| 17 | JGI25165J46597_1000696 | 3300003214 | Bacteria | 26810 |
| 18 | JGI25153J46596_10000210 | 3300003215 | Bacteria | 52714 |
| 19 | JGI25153J46596_10001886 | 3300003215 | Bacteria | 12426 |
| 20 | JGI25153J46596_10007880 | 3300003215 | Bacteria | 5170 |
| 21 | JGI25153J46596_10012130 | 3300003215 | Bacteria | 3750 |
| 22 | JGI25153J46596_10012137 | 3300003215 | Bacteria | 3748 |
| 23 | rootL2_10009459 | 3300003322 | Bacteria | 9458 |
| 24 | JGI25160J50197_1000055 | 3300003354 | Bacteria | 124791 |
| 25 | JGI25160J50197_1000087 | 3300003354 | Bacteria | 93379 |
| 26 | JGI25160J50197_1000582 | 3300003354 | Bacteria | 20539 |
| 27 | JGI25160J50197_1017356 | 3300003354 | Bacteria | 2283 |
| 28 | JGI25161J50226_1000066 | 3300003374 | Bacteria | 94505 |
| 29 | JGI25161J50226_1000138 | 3300003374 | Bacteria | 50562 |
| 30 | JGI25161J50226_1000411 | 3300003374 | Bacteria | 20983 |
| 31 | Ga0006562J51391_1025531 | 3300003578 | Bacteria | 1260 |
| 32 | Ga0055526_1000508 | 3300003771 | Bacteria | 30971 |
| 33 | Ga0055526_1001046 | 3300003771 | Bacteria | 20204 |
| 34 | Ga0055526_1015057 | 3300003771 | Bacteria | 3129 |
| 35 | Ga0055526_1028491 | 3300003771 | Bacteria | 1688 |
| 36 | Ga0055524_1000319 | 3300003775 | Bacteria | 45208 |
| 37 | Ga0055524_1043767 | 3300003775 | Bacteria | 1096 |
| 38 | Ga0055528_1000240 | 3300003790 | Bacteria | 45988 |
| 39 | Ga0055528_1000646 | 3300003790 | Bacteria | 25480 |
| 40 | Ga0055528_1001280 | 3300003790 | Bacteria | 15817 |
| 41 | Ga0055528_1005314 | 3300003790 | Bacteria | 6020 |
| 42 | Ga0055528_1005677 | 3300003790 | Bacteria | 5755 |
| 43 | Ga0055540_1006491 | 3300003792 | Bacteria | 4632 |
| 44 | Ga0055531_10017314 | 3300003794 | Bacteria | 3050 |
| 45 | Ga0058692_1014329 | 3300003856 | Bacteria | 1819 |
| 46 | Ga0055543_1000053 | 3300004625 | Bacteria | 104589 |
| 47 | Ga0055543_1000068 | 3300004625 | Bacteria | 94795 |
| 48 | Ga0055543_1000240 | 3300004625 | Bacteria | 42475 |
| 49 | Ga0055543_1000623 | 3300004625 | Bacteria | 19050 |
| 50 | Ga0065165_1000839 | 3300005262 | Bacteria | 40355 |
| 51 | Ga0065165_1001002 | 3300005262 | Bacteria | 34597 |
| 52 | Ga0065165_1006285 | 3300005262 | Bacteria | 6299 |
| 53 | Ga0065165_1027428 | 3300005262 | Bacteria | 1857 |
| 54 | Ga0070683_100105238 | 3300005329 | Bacteria | 2660 |
| 55 | Ga0070666_10017612 | 3300005335 | Bacteria | 4583 |
| 56 | Ga0070682_100241363 | 3300005337 | Bacteria | 1297 |
| 57 | Ga0070691_10000389 | 3300005341 | Bacteria | 15957 |
| 58 | Ga0070671_100041567 | 3300005355 | Bacteria | 3821 |
| 59 | Ga0070667_100004771 | 3300005367 | Bacteria | 11352 |
| 60 | Ga0070667_100642758 | 3300005367 | Bacteria | 979 |
| 61 | Ga0070709_10092495 | 3300005434 | Bacteria | 1998 |
| 62 | Ga0070681_10135044 | 3300005458 | Bacteria | 2398 |
| 63 | Ga0070706_100376136 | 3300005467 | Bacteria | 1323 |
| 64 | Ga0070698_100064385 | 3300005471 | Bacteria | 3694 |
| 65 | Ga0070684_100370140 | 3300005535 | Bacteria | 1319 |
| 66 | Ga0068853_100009904 | 3300005539 | Bacteria | 7695 |
| 67 | Ga0070696_100252058 | 3300005546 | Bacteria | 1335 |
| 68 | Ga0068855_100035482 | 3300005563 | Bacteria | 5939 |
| 69 | Ga0068855_100054628 | 3300005563 | Bacteria | 4694 |
| 70 | Ga0068857_100000172 | 3300005577 | Bacteria | 40867 |
| 71 | Ga0068856_100033134 | 3300005614 | Bacteria | 5059 |
| 72 | Ga0068852_100167764 | 3300005616 | Bacteria | 2055 |
| 73 | Ga0068858_100311112 | 3300005842 | Bacteria | 1504 |
| 74 | Ga0081455_10001970 | 3300005937 | Bacteria | 24598 |
| 75 | Ga0075365_10004193 | 3300006038 | Bacteria | 7592 |
| 76 | Ga0075365_10042626 | 3300006038 | Bacteria | 2968 |
| 77 | Ga0075368_10053301 | 3300006042 | Bacteria | 1610 |
| 78 | Ga0075362_10001282 | 3300006177 | Bacteria | 7944 |
| 79 | Ga0075367_10001089 | 3300006178 | Bacteria | 11211 |
| 80 | Ga0075367_10054146 | 3300006178 | Bacteria | 2379 |
| 81 | Ga0075369_10002276 | 3300006186 | Bacteria | 6815 |
| 82 | Ga0075369_10022250 | 3300006186 | Bacteria | 2613 |
| 83 | Ga0075369_10079707 | 3300006186 | Bacteria | 1451 |
| 84 | Ga0075366_10102335 | 3300006195 | Bacteria | 1719 |
| 85 | Ga0075436_100031012 | 3300006914 | Bacteria | 3679 |
| 86 | Ga0079104_1002821 | 3300006946 | Bacteria | 8745 |
| 87 | Ga0105251_10021359 | 3300009011 | Bacteria | 3382 |
| 88 | Ga0105250_10023520 | 3300009092 | Bacteria | 2483 |
| 89 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 90 | Ga0105240_10006088 | 3300009093 | Bacteria | 17805 |
| 91 | Ga0105248_10041541 | 3300009177 | Bacteria | 5156 |
| 92 | Ga0105237_10000766 | 3300009545 | Bacteria | 44044 |
| 93 | Ga0105237_10005759 | 3300009545 | Bacteria | 13923 |
| 94 | Ga0105238_10002694 | 3300009551 | Bacteria | 17666 |
| 95 | Ga0123342_1014483 | 3300009766 | Bacteria | 7502 |
| 96 | Ga0123342_1022424 | 3300009766 | Bacteria | 4275 |
| 97 | Ga0105239_10001069 | 3300010375 | Bacteria | 38061 |
| 98 | Ga0105239_10047560 | 3300010375 | Bacteria | 4702 |
| 99 | Ga0157373_10050213 | 3300013100 | Bacteria | 2971 |
| 100 | Ga0157370_10000046 | 3300013104 | Bacteria | 125612 |
| 101 | Ga0157370_10039972 | 3300013104 | Bacteria | 4531 |
| 102 | Ga0157369_10008714 | 3300013105 | Bacteria | 11630 |
| 103 | Ga0157369_10385871 | 3300013105 | Bacteria | 1454 |
| 104 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 105 | Ga0157379_10218865 | 3300014968 | Bacteria | 1725 |
| 106 | Ga0182007_10002120 | 3300015262 | Bacteria | 10148 |
| 107 | Ga0182005_1004429 | 3300015265 | Bacteria | 4543 |
| 108 | Ga0183363_1329 | 3300015690 | Bacteria | 6019 |
| 109 | Ga0214544_1001350 | 3300021320 | Bacteria | 50577 |
| 110 | Ga0214542_1002270 | 3300021321 | Bacteria | 39851 |
| 111 | Ga0214542_1023610 | 3300021321 | Bacteria | 3643 |
| 112 | Ga0214543_1000028 | 3300021327 | Bacteria | 214029 |
| 113 | Ga0214543_1000078 | 3300021327 | Bacteria | 119775 |
| 114 | Ga0228711_1000016 | 3300022739 | Bacteria | 126351 |
| 115 | Ga0228710_1000013 | 3300022740 | Bacteria | 145976 |
| 116 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 117 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 118 | Ga0209437_100165 | 3300025233 | Bacteria | 145009 |
| 119 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 120 | Ga0207425_1002614 | 3300025245 | Bacteria | 6230 |
| 121 | Ga0207425_1003612 | 3300025245 | Bacteria | 4887 |
| 122 | Ga0207425_1012443 | 3300025245 | Bacteria | 1997 |
| 123 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 124 | Ga0209646_1004329 | 3300025246 | Bacteria | 2603 |
| 125 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 126 | Ga0209677_100811 | 3300025253 | Bacteria | 15626 |
| 127 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 128 | Ga0209129_1000161 | 3300025258 | Bacteria | 102017 |
| 129 | Ga0209129_1000167 | 3300025258 | Bacteria | 97701 |
| 130 | Ga0209129_1000184 | 3300025258 | Bacteria | 87102 |
| 131 | Ga0209129_1001218 | 3300025258 | Bacteria | 14786 |
| 132 | Ga0209129_1003533 | 3300025258 | Bacteria | 6744 |
| 133 | Ga0209129_1003776 | 3300025258 | Bacteria | 6368 |
| 134 | Ga0209129_1004343 | 3300025258 | Bacteria | 5588 |
| 135 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 136 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 137 | Ga0209233_1000257 | 3300025261 | Bacteria | 80366 |
| 138 | Ga0209565_1019625 | 3300025263 | Bacteria | 1440 |
| 139 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 140 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 141 | Ga0209673_1000296 | 3300025273 | Bacteria | 92350 |
| 142 | Ga0209673_1001064 | 3300025273 | Bacteria | 31374 |
| 143 | Ga0209673_1001836 | 3300025273 | Bacteria | 17369 |
| 144 | Ga0209673_1006371 | 3300025273 | Bacteria | 5709 |
| 145 | Ga0209673_1041716 | 3300025273 | Bacteria | 1299 |
| 146 | Ga0209673_1044199 | 3300025273 | Bacteria | 1236 |
| 147 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 148 | Ga0209130_1000026 | 3300025284 | Bacteria | 334058 |
| 149 | Ga0209130_1000081 | 3300025284 | Bacteria | 166440 |
| 150 | Ga0209130_1004153 | 3300025284 | Bacteria | 5674 |
| 151 | Ga0209130_1021928 | 3300025284 | Bacteria | 1433 |
| 152 | Ga0209675_1013418 | 3300025291 | Bacteria | 2563 |
| 153 | Ga0209676_1008398 | 3300025292 | Bacteria | 4610 |
| 154 | Ga0209676_1014017 | 3300025292 | Bacteria | 3044 |
| 155 | Ga0209676_1030238 | 3300025292 | Bacteria | 1659 |
| 156 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 157 | Ga0209025_1000119 | 3300025294 | Bacteria | 210606 |
| 158 | Ga0209025_1000695 | 3300025294 | Bacteria | 57400 |
| 159 | Ga0209025_1000767 | 3300025294 | Bacteria | 53337 |
| 160 | Ga0209025_1003074 | 3300025294 | Bacteria | 16384 |
| 161 | Ga0209025_1006218 | 3300025294 | Bacteria | 9368 |
| 162 | Ga0209025_1015166 | 3300025294 | Bacteria | 4671 |
| 163 | Ga0209025_1016503 | 3300025294 | Bacteria | 4346 |
| 164 | Ga0209025_1088277 | 3300025294 | Bacteria | 1023 |
| 165 | Ga0209564_1000208 | 3300025295 | Bacteria | 134794 |
| 166 | Ga0209564_1000260 | 3300025295 | Bacteria | 112444 |
| 167 | Ga0209564_1000525 | 3300025295 | Bacteria | 62651 |
| 168 | Ga0209564_1000638 | 3300025295 | Bacteria | 53138 |
| 169 | Ga0209564_1005895 | 3300025295 | Bacteria | 6793 |
| 170 | Ga0209564_1010711 | 3300025295 | Bacteria | 4187 |
| 171 | Ga0209564_1023695 | 3300025295 | Bacteria | 2122 |
| 172 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 173 | Ga0209758_1000598 | 3300025297 | Bacteria | 56164 |
| 174 | Ga0209758_1000710 | 3300025297 | Bacteria | 49232 |
| 175 | Ga0209758_1000961 | 3300025297 | Bacteria | 38873 |
| 176 | Ga0209758_1003274 | 3300025297 | Bacteria | 15015 |
| 177 | Ga0209758_1003835 | 3300025297 | Bacteria | 13193 |
| 178 | Ga0209050_1010952 | 3300025298 | Bacteria | 4382 |
| 179 | Ga0209050_1013563 | 3300025298 | Bacteria | 3605 |
| 180 | Ga0209256_1000042 | 3300025299 | Bacteria | 341821 |
| 181 | Ga0209256_1000383 | 3300025299 | Bacteria | 70773 |
| 182 | Ga0209256_1000769 | 3300025299 | Bacteria | 41649 |
| 183 | Ga0209256_1001954 | 3300025299 | Bacteria | 18688 |
| 184 | Ga0209256_1002837 | 3300025299 | Bacteria | 13214 |
| 185 | Ga0209256_1003038 | 3300025299 | Bacteria | 12376 |
| 186 | Ga0209256_1018012 | 3300025299 | Bacteria | 2317 |
| 187 | Ga0209256_1028230 | 3300025299 | Bacteria | 1586 |
| 188 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 189 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 190 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 191 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 192 | Ga0207426_1000697 | 3300025302 | Bacteria | 40196 |
| 193 | Ga0209051_1000253 | 3300025303 | Bacteria | 90622 |
| 194 | Ga0209051_1001954 | 3300025303 | Bacteria | 15848 |
| 195 | Ga0209051_1007263 | 3300025303 | Bacteria | 6089 |
| 196 | Ga0209051_1020188 | 3300025303 | Bacteria | 2879 |
| 197 | Ga0209257_1005407 | 3300025304 | Bacteria | 8985 |
| 198 | Ga0209257_1007329 | 3300025304 | Bacteria | 6695 |
| 199 | Ga0209257_1025688 | 3300025304 | Bacteria | 2006 |
| 200 | Ga0207680_10005594 | 3300025903 | Bacteria | 6013 |
| 201 | Ga0207684_10075386 | 3300025910 | Bacteria | 2867 |
| 202 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 203 | Ga0207671_10000241 | 3300025914 | Bacteria | 81847 |
| 204 | Ga0207671_10011527 | 3300025914 | Bacteria | 7183 |
| 205 | Ga0207694_10096375 | 3300025924 | Bacteria | 2339 |
| 206 | Ga0207700_10187094 | 3300025928 | Bacteria | 1738 |
| 207 | Ga0207644_10034481 | 3300025931 | Bacteria | 3542 |
| 208 | Ga0207661_10076473 | 3300025944 | Bacteria | 2750 |
| 209 | Ga0207668_10010333 | 3300025972 | Bacteria | 5640 |
| 210 | Ga0207658_10018317 | 3300025986 | Bacteria | 4835 |
| 211 | Ga0207702_10009015 | 3300026078 | Bacteria | 8400 |
| 212 | Ga0207641_10755740 | 3300026088 | Bacteria | 960 |
| 213 | Ga0207674_10000952 | 3300026116 | Bacteria | 37804 |
| 214 | Ga0207698_10372802 | 3300026142 | Bacteria | 1355 |
| 215 | Ga0209281_1000221 | 3300027111 | Bacteria | 122380 |
| 216 | Ga0209281_1000453 | 3300027111 | Bacteria | 58584 |
| 217 | Ga0209371_1004493 | 3300027312 | Bacteria | 6025 |
| 218 | Ga0209282_1000041 | 3300027666 | Bacteria | 122268 |
| 219 | Ga0268266_10132689 | 3300028379 | Bacteria | 2229 |
| 220 | Ga0268266_10313698 | 3300028379 | Bacteria | 1466 |
| 221 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 222 | Ga0307515_10002518 | 3300028794 | Bacteria | 39631 |
| 223 | Ga0307515_10033971 | 3300028794 | Bacteria | 8372 |
| 224 | Ga0307515_10045603 | 3300028794 | Bacteria | 6728 |
| 225 | Ga0265338_10088641 | 3300028800 | Bacteria | 2566 |
| 226 | Ga0268256_1004316 | 3300030500 | Bacteria | 5942 |
| 227 | Ga0265325_10000060 | 3300031241 | Bacteria | 75733 |
| 228 | Ga0265339_10000925 | 3300031249 | Bacteria | 22542 |
| 229 | Ga0265331_10020463 | 3300031250 | Bacteria | 3396 |
| 230 | Ga0265316_10070737 | 3300031344 | Bacteria | 2690 |
| 231 | Ga0307513_10013160 | 3300031456 | Bacteria | 10165 |
| 232 | Ga0307513_10017501 | 3300031456 | Bacteria | 8594 |
| 233 | Ga0307408_100029521 | 3300031548 | Bacteria | 3801 |
| 234 | Ga0265313_10003035 | 3300031595 | Bacteria | 13955 |
| 235 | Ga0265314_10002209 | 3300031711 | Bacteria | 20295 |
| 236 | Ga0265342_10056505 | 3300031712 | Bacteria | 2326 |
| 237 | Ga0307405_10050711 | 3300031731 | Bacteria | 2571 |
| 238 | Ga0307406_10053226 | 3300031901 | Bacteria | 2577 |
| 239 | Ga0307412_10015488 | 3300031911 | Bacteria | 4524 |
| 240 | Ga0307412_10224122 | 3300031911 | Bacteria | 1443 |
| 241 | Ga0315914_1000030 | 3300031967 | Bacteria | 102599 |
| 242 | Ga0307416_100121986 | 3300032002 | Bacteria | 2325 |
| 243 | Ga0316583_10038243 | 3300032133 | Bacteria | 1702 |
| 244 | Ga0315913_1000017 | 3300033430 | Bacteria | 102835 |
| 245 | Ga0315915_1000017 | 3300033464 | Bacteria | 148111 |
| 246 | Ga0373955_0055765 | 3300035172 | Bacteria | 2166 |
| 247 | Ga0316574_0233395 | 3300035398 | Bacteria | 1177 |
| 248 | Ga0373935_0005207 | 3300035692 | Bacteria | 7659 |
| 249 | Ga0373927_0000556 | 3300035695 | Bacteria | 28426 |
| 250 | Ga0316582_0181328 | 3300036647 | Bacteria | 1433 |
| 251 | Ga0373925_0002597 | 3300037068 | Bacteria | 14361 |
| 252 | Ga0439436_0009228 | 3300041404 | Bacteria | 3026 |
| 253 | Ga0439447_051615 | 3300041407 | Bacteria | 981 |
| 254 | Ga0439465_0019336 | 3300041413 | Bacteria | 2129 |
| 255 | Ga0451787_547467 | 3300041441 | Bacteria | 1920 |
| 256 | Ga0451835_0182672 | 3300041492 | Bacteria | 1735 |
| 257 | Ga0451837_1006229 | 3300041494 | Bacteria | 891 |
| 258 | Ga0451837_1707933 | 3300041494 | Bacteria | 1068 |
| 259 | Ga0451839_0446078 | 3300041496 | Bacteria | 1826 |
| 260 | Ga0451845_0273193 | 3300041501 | Bacteria | 1365 |
| 261 | Ga0451847_0827233 | 3300041503 | Bacteria | 2966 |
| 262 | Ga0451849_0988520 | 3300041505 | Bacteria | 1302 |
| 263 | Ga0451851_1044136 | 3300041507 | Bacteria | 1688 |
| 264 | Ga0439449_0006695 | 3300042007 | Bacteria | 4398 |
| 265 | Ga0439462_0006428 | 3300042015 | Bacteria | 2921 |
| 266 | Ga0450920_012072 | 3300042122 | Bacteria | 1616 |
| 267 | Ga0439435_0000469 | 3300042436 | Bacteria | 6391 |
| 268 | Ga0466960_0033385 | 3300044901 | Bacteria | 2391 |
| 269 | Ga0466967_0521347 | 3300045976 | Bacteria | 1168 |
| 270 | Ga0495627_067670 | 3300046453 | Bacteria | 1047 |
| 271 | Ga0495592_0028499 | 3300046454 | Bacteria | 4229 |
| 272 | Ga0495629_0066519 | 3300046459 | Bacteria | 2515 |
| 273 | Ga0495638_0000638 | 3300046460 | Bacteria | 38456 |
| 274 | Ga0495638_0047437 | 3300046460 | Bacteria | 2692 |
| 275 | Ga0495638_0126441 | 3300046460 | Bacteria | 1506 |
| 276 | Ga0495651_0251845 | 3300046462 | Bacteria | 1206 |
| 277 | Ga0495650_0021715 | 3300046471 | Bacteria | 3092 |
| 278 | Ga0495605_0002606 | 3300046474 | Bacteria | 11082 |
| 279 | Ga0495605_0011032 | 3300046474 | Bacteria | 5048 |
| 280 | Ga0495662_0008737 | 3300046476 | Bacteria | 4982 |
| 281 | Ga0495585_0006116 | 3300046492 | Bacteria | 7518 |
| 282 | Ga0495585_0012321 | 3300046492 | Bacteria | 5038 |
| 283 | Ga0495596_0035987 | 3300046500 | Bacteria | 1962 |
| 284 | Ga0495607_0007805 | 3300046501 | Bacteria | 7367 |
| 285 | Ga0495607_0074920 | 3300046501 | Bacteria | 1877 |
| 286 | Ga0495583_0002711 | 3300046506 | Bacteria | 14673 |
| 287 | Ga0495583_0016652 | 3300046506 | Bacteria | 3941 |
| 288 | Ga0495606_0001089 | 3300046507 | Bacteria | 38890 |
| 289 | Ga0495606_0007913 | 3300046507 | Bacteria | 9373 |
| 290 | Ga0495606_0036604 | 3300046507 | Bacteria | 3341 |
| 291 | Ga0495606_0071160 | 3300046507 | Bacteria | 2191 |
| 292 | Ga0495610_0002729 | 3300046512 | Bacteria | 14510 |
| 293 | Ga0495616_0006597 | 3300046513 | Bacteria | 7013 |
| 294 | Ga0495616_0034968 | 3300046513 | Bacteria | 2604 |
| 295 | Ga0495620_0014593 | 3300046515 | Bacteria | 3990 |
| 296 | Ga0495630_0005038 | 3300046517 | Bacteria | 9294 |
| 297 | Ga0495631_0002125 | 3300046518 | Bacteria | 11474 |
| 298 | Ga0495631_0014589 | 3300046518 | Bacteria | 3786 |
| 299 | Ga0495632_0004409 | 3300046519 | Bacteria | 9566 |
| 300 | Ga0495632_0004862 | 3300046519 | Bacteria | 9014 |
| 301 | Ga0495632_0004881 | 3300046519 | Bacteria | 8995 |
| 302 | Ga0495632_0072670 | 3300046519 | Bacteria | 1650 |
| 303 | Ga0495643_0005952 | 3300046522 | Bacteria | 8136 |
| 304 | Ga0495644_0090904 | 3300046523 | Bacteria | 1152 |
| 305 | Ga0495663_0039079 | 3300046525 | Bacteria | 1437 |
| 306 | Ga0495586_0060886 | 3300046535 | Bacteria | 2054 |
| 307 | Ga0495609_0007260 | 3300046538 | Bacteria | 5552 |
| 308 | Ga0495622_0004239 | 3300046557 | Bacteria | 6683 |
| 309 | Ga0495633_0102106 | 3300046558 | Bacteria | 1331 |
| 310 | Ga0495668_0048638 | 3300046616 | Bacteria | 2352 |
| 311 | Ga0495625_0001863 | 3300046660 | Bacteria | 23982 |
| 312 | Ga0495625_0015058 | 3300046660 | Bacteria | 6141 |
| 313 | Ga0495625_0116683 | 3300046660 | Bacteria | 1821 |
| 314 | Ga0495625_0117278 | 3300046660 | Bacteria | 1815 |
| 315 | Ga0495625_0169887 | 3300046660 | Bacteria | 1456 |
| 316 | Ga0495625_0170796 | 3300046660 | Bacteria | 1452 |
| 317 | Ga0495625_0309993 | 3300046660 | Bacteria | 1008 |
| 318 | Ga0495635_0056234 | 3300046663 | Bacteria | 2709 |
| 319 | Ga0495635_0235611 | 3300046663 | Bacteria | 1236 |
| 320 | Ga0495588_0038172 | 3300046674 | Bacteria | 2443 |
| 321 | Ga0495649_0100101 | 3300046694 | Bacteria | 1541 |
| 322 | Ga0495589_0045844 | 3300046794 | Bacteria | 2171 |
| 323 | Ga0495589_0202998 | 3300046794 | Bacteria | 935 |
| 324 | Ga0495600_0031813 | 3300046809 | Bacteria | 3420 |
| 325 | Ga0495660_0012720 | 3300046810 | Bacteria | 4882 |
| 326 | Ga0495660_0020342 | 3300046810 | Bacteria | 3803 |
| 327 | Ga0495604_0322288 | 3300047317 | Bacteria | 1032 |
| 328 | Ga0495636_0001864 | 3300047318 | Bacteria | 8057 |
| 329 | Ga0495674_0261849 | 3300047319 | Bacteria | 1421 |
| 330 | Ga0495683_0019656 | 3300047323 | Bacteria | 3485 |
| 331 | Ga0495687_010735 | 3300047443 | Bacteria | 4995 |
| 332 | Ga0495684_0233587 | 3300047471 | Bacteria | 1344 |
| 333 | Ga0495686_0000796 | 3300047472 | Bacteria | 41000 |
| 334 | Ga0495686_0006004 | 3300047472 | Bacteria | 9442 |
| 335 | Ga0495686_0009754 | 3300047472 | Bacteria | 6891 |
| 336 | Ga0495686_0031084 | 3300047472 | Bacteria | 3465 |
| 337 | Ga0495602_0294564 | 3300048088 | Bacteria | 1190 |
| 338 | Ga0495615_0038972 | 3300048090 | Bacteria | 1177 |
| 339 | Ga0495615_0053191 | 3300048090 | Bacteria | 1048 |
| 340 | Ga0496100_0142905 | 3300048903 | Bacteria | 1698 |
| 341 | Ga0496100_0203515 | 3300048903 | Bacteria | 1444 |
| 342 | Ga0496101_0018868 | 3300048904 | Bacteria | 4697 |
| 343 | Ga0496102_0006068 | 3300048905 | Bacteria | 10302 |
| 344 | Ga0496103_0008717 | 3300048906 | Bacteria | 6018 |
| 345 | Ga0496104_0261715 | 3300048907 | Bacteria | 1642 |
| 346 | Ga0496105_0210137 | 3300048908 | Bacteria | 1586 |
| 347 | Ga0496106_0000658 | 3300048909 | Bacteria | 24761 |
| 348 | Ga0496108_0659317 | 3300048911 | Bacteria | 909 |
| 349 | Ga0496110_0025054 | 3300048913 | Bacteria | 5093 |
| 350 | Ga0496111_0022201 | 3300048914 | Bacteria | 4439 |
| 351 | Ga0496114_0262734 | 3300048917 | Bacteria | 1520 |
| 352 | Ga0496116_0001006 | 3300048919 | Bacteria | 34404 |
| 353 | Ga0496116_0021891 | 3300048919 | Bacteria | 4807 |
| 354 | Ga0496116_0089363 | 3300048919 | Bacteria | 1879 |
| 355 | Ga0496116_0115852 | 3300048919 | Bacteria | 1563 |
| 356 | Ga0496117_0000353 | 3300048920 | Bacteria | 81061 |
| 357 | Ga0496117_0005327 | 3300048920 | Bacteria | 13581 |
| 358 | Ga0496118_0000204 | 3300048921 | Bacteria | 104260 |
| 359 | Ga0496118_0005459 | 3300048921 | Bacteria | 14454 |
| 360 | Ga0496118_0009796 | 3300048921 | Bacteria | 9604 |
| 361 | Ga0496118_0047464 | 3300048921 | Bacteria | 3327 |
| 362 | Ga0496119_0013782 | 3300048922 | Bacteria | 6398 |
| 363 | Ga0496119_0015557 | 3300048922 | Bacteria | 5845 |
| 364 | Ga0496119_0020529 | 3300048922 | Bacteria | 4817 |
| 365 | Ga0496119_0066011 | 3300048922 | Bacteria | 2140 |
| 366 | Ga0496119_0157567 | 3300048922 | Bacteria | 1211 |
| 367 | Ga0496120_0037801 | 3300048923 | Bacteria | 2861 |
| 368 | Ga0496120_0048116 | 3300048923 | Bacteria | 2455 |
| 369 | Ga0496121_0000378 | 3300048924 | Bacteria | 91381 |
| 370 | Ga0496121_0024989 | 3300048924 | Bacteria | 5689 |
| 371 | Ga0496121_0029249 | 3300048924 | Bacteria | 5102 |
| 372 | Ga0496121_0038184 | 3300048924 | Bacteria | 4257 |
| 373 | Ga0496121_0100735 | 3300048924 | Bacteria | 2229 |
| 374 | Ga0496121_0136605 | 3300048924 | Bacteria | 1825 |
| 375 | Ga0496121_0151991 | 3300048924 | Bacteria | 1702 |
| 376 | Ga0496121_0201167 | 3300048924 | Bacteria | 1420 |
| 377 | Ga0496121_0204151 | 3300048924 | Bacteria | 1406 |
| 378 | Ga0496121_0306743 | 3300048924 | Bacteria | 1075 |
| 379 | Ga0496122_0001317 | 3300048925 | Bacteria | 40726 |
| 380 | Ga0496122_0003507 | 3300048925 | Bacteria | 20601 |
| 381 | Ga0496122_0014776 | 3300048925 | Bacteria | 7523 |
| 382 | Ga0496122_0020665 | 3300048925 | Bacteria | 5933 |
| 383 | Ga0496122_0028477 | 3300048925 | Bacteria | 4738 |
| 384 | Ga0496122_0050724 | 3300048925 | Bacteria | 3161 |
| 385 | Ga0496122_0098445 | 3300048925 | Bacteria | 1964 |
| 386 | Ga0496123_0000448 | 3300048926 | Bacteria | 73842 |
| 387 | Ga0496123_0007623 | 3300048926 | Bacteria | 10131 |
| 388 | Ga0496123_0013544 | 3300048926 | Bacteria | 6830 |
| 389 | Ga0496123_0024065 | 3300048926 | Bacteria | 4640 |
| 390 | Ga0496123_0059051 | 3300048926 | Bacteria | 2483 |
| 391 | Ga0496124_0000687 | 3300048927 | Bacteria | 55709 |
| 392 | Ga0496124_0002515 | 3300048927 | Bacteria | 23851 |
| 393 | Ga0496124_0005688 | 3300048927 | Bacteria | 13894 |
| 394 | Ga0496124_0027025 | 3300048927 | Bacteria | 5162 |
| 395 | Ga0496124_0040458 | 3300048927 | Bacteria | 4031 |
| 396 | Ga0496124_0116439 | 3300048927 | Bacteria | 2142 |
| 397 | Ga0496124_0150157 | 3300048927 | Bacteria | 1829 |
| 398 | Ga0496125_0001127 | 3300048928 | Bacteria | 40785 |
| 399 | Ga0496125_0018120 | 3300048928 | Bacteria | 6692 |
| 400 | Ga0496125_0019265 | 3300048928 | Bacteria | 6444 |
| 401 | Ga0496125_0027274 | 3300048928 | Bacteria | 5182 |
| 402 | Ga0496125_0061679 | 3300048928 | Bacteria | 3005 |
| 403 | Ga0496126_0002636 | 3300048929 | Bacteria | 23833 |
| 404 | Ga0496126_0032771 | 3300048929 | Bacteria | 4892 |
| 405 | Ga0496126_0057510 | 3300048929 | Bacteria | 3510 |
| 406 | Ga0496126_0063346 | 3300048929 | Bacteria | 3314 |
| 407 | Ga0496126_0076645 | 3300048929 | Bacteria | 2966 |
| 408 | Ga0496126_0125110 | 3300048929 | Bacteria | 2226 |
| 409 | Ga0495678_003522 | 3300049459 | Bacteria | 9623 |
| 410 | Ga0495678_010175 | 3300049459 | Bacteria | 4585 |
| 411 | Ga0495678_089111 | 3300049459 | Bacteria | 1090 |
| 412 | Ga0495682_0046054 | 3300049460 | Bacteria | 1593 |
| 413 | Ga0501031_0108159 | 3300049568 | Bacteria | 1815 |
| 414 | Ga0501033_0012045 | 3300049570 | Bacteria | 6603 |
| 415 | Ga0501034_0104034 | 3300049571 | Bacteria | 2833 |
| 416 | Ga0501036_0111674 | 3300049572 | Bacteria | 2310 |
| 417 | Ga0501038_0106498 | 3300049574 | Bacteria | 2327 |
| 418 | Ga0501039_0202771 | 3300049575 | Bacteria | 1560 |
| 419 | Ga0501043_0110335 | 3300049579 | Bacteria | 2160 |
| 420 | Ga0501047_0190379 | 3300049581 | Bacteria | 1915 |
| 421 | Ga0501068_0031640 | 3300049584 | Bacteria | 3143 |
| 422 | Ga0501069_0157026 | 3300049585 | Bacteria | 1309 |
| 423 | Ga0501073_0077193 | 3300049589 | Bacteria | 2318 |
| 424 | Ga0501073_0135613 | 3300049589 | Bacteria | 1706 |
| 425 | Ga0501080_0063665 | 3300049742 | Bacteria | 3432 |
| 426 | Ga0501083_0118133 | 3300049744 | Bacteria | 1740 |
| 427 | Ga0501280_004692 | 3300049776 | Bacteria | 1991 |
| 428 | Ga0501035_0000927 | 3300049822 | Bacteria | 31062 |
| 429 | Ga0501035_0048895 | 3300049822 | Bacteria | 3791 |
| 430 | Ga0501035_0071198 | 3300049822 | Bacteria | 3079 |
| 431 | Ga0501044_0023860 | 3300049823 | Bacteria | 6501 |
| 432 | Ga0501044_0081759 | 3300049823 | Bacteria | 3269 |
| 433 | nmdc:mga03683_47598_c1 | 3300050489 | Bacteria | 1780 |
| 434 | nmdc:mga0yw44_127769_c1 | 3300050492 | Bacteria | 1643 |
| 435 | nmdc:mga0k408_26375_c1 | 3300050493 | Bacteria | 3294 |
| 436 | nmdc:mga07m45_45410_c1 | 3300050496 | Bacteria | 2467 |
| 437 | Ga0500578_0047074 | 3300053086 | Bacteria | 2767 |
| 438 | Ga0500651_0031083 | 3300053093 | Bacteria | 3362 |
| 439 | Ga0500650_0016254 | 3300053098 | Bacteria | 3189 |
| 440 | Ga0500569_001435 | 3300053109 | Bacteria | 4494 |
| 441 | Ga0500618_002874 | 3300053125 | Bacteria | 6177 |
| 442 | Ga0500658_0000720 | 3300053134 | Bacteria | 13662 |
| 443 | Ga0500658_0007741 | 3300053134 | Bacteria | 3968 |
| 444 | Ga0500568_0015244 | 3300053139 | Bacteria | 3445 |
| 445 | Ga0500573_0003989 | 3300053140 | Bacteria | 7709 |
| 446 | Ga0500590_002326 | 3300053148 | Bacteria | 8366 |
| 447 | Ga0500604_0078927 | 3300053151 | Bacteria | 1060 |
| 448 | Ga0500616_0001219 | 3300053153 | Bacteria | 25876 |
| 449 | Ga0500616_0033208 | 3300053153 | Bacteria | 2816 |
| 450 | Ga0500622_0006163 | 3300053156 | Bacteria | 7032 |
| 451 | Ga0500627_0002349 | 3300053158 | Bacteria | 5591 |
| 452 | Ga0500627_0164150 | 3300053158 | Bacteria | 1002 |
| 453 | Ga0500636_0043214 | 3300053177 | Bacteria | 2661 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046794 | Ga0495589_0202998 | Ga0495589_0202998_131_865 | 241 |
| 2 | iso_pu_bacteria | 2957422303 | 2957427850 | 246 |
| 3 | 3300049579 | Ga0501043_0110335 | Ga0501043_0110335_349_1164 | 247 |
| 4 | 3300049570 | Ga0501033_0012045 | Ga0501033_0012045_2270_3055 | 248 |
| 5 | 3300049571 | Ga0501034_0104034 | Ga0501034_0104034_972_1757 | 248 |
| 6 | 3300049574 | Ga0501038_0106498 | Ga0501038_0106498_1145_1930 | 248 |
| 7 | 3300049581 | Ga0501047_0190379 | Ga0501047_0190379_190_975 | 248 |
| 8 | 3300049822 | Ga0501035_0048895 | Ga0501035_0048895_710_1495 | 248 |
| 9 | 3300049823 | Ga0501044_0081759 | Ga0501044_0081759_1140_1925 | 248 |
| 10 | 3300046523 | Ga0495644_0090904 | Ga0495644_0090904_23_775 | 250 |
| 11 | 3300048924 | Ga0496121_0204151 | Ga0496121_0204151_21_776 | 250 |
| 12 | 3300053151 | Ga0500604_0078927 | Ga0500604_0078927_26_781 | 251 |
| 13 | iso_pu_bacteria | 2757320392 | 2757569590 | 254 |
| 14 | 3300028800 | Ga0265338_10088641 | Ga0265338_100886412 | 256 |
| 15 | 3300031712 | Ga0265342_10056505 | Ga0265342_100565051 | 261 |
| 16 | 3300031250 | Ga0265331_10020463 | Ga0265331_100204635 | 265 |
| 17 | 3300031711 | Ga0265314_10002209 | Ga0265314_1000220915 | 265 |
| 18 | 3300005329 | Ga0070683_100105238 | Ga0070683_1001052382 | 267 |
| 19 | 3300005337 | Ga0070682_100241363 | Ga0070682_1002413631 | 267 |
| 20 | 3300005539 | Ga0068853_100009904 | Ga0068853_1000099049 | 267 |
| 21 | 3300005563 | Ga0068855_100035482 | Ga0068855_1000354821 | 267 |
| 22 | 3300005577 | Ga0068857_100000172 | Ga0068857_10000017217 | 267 |
| 23 | 3300005614 | Ga0068856_100033134 | Ga0068856_1000331342 | 267 |
| 24 | 3300005616 | Ga0068852_100167764 | Ga0068852_1001677642 | 267 |
| 25 | 3300009093 | Ga0105240_10006088 | Ga0105240_100060882 | 267 |
| 26 | 3300009545 | Ga0105237_10005759 | Ga0105237_100057592 | 267 |
| 27 | 3300009551 | Ga0105238_10002694 | Ga0105238_1000269411 | 267 |
| 28 | 3300013100 | Ga0157373_10050213 | Ga0157373_100502135 | 267 |
| 29 | 3300025914 | Ga0207671_10011527 | Ga0207671_100115273 | 267 |
| 30 | 3300026078 | Ga0207702_10009015 | Ga0207702_100090156 | 267 |
| 31 | 3300026088 | Ga0207641_10755740 | Ga0207641_107557401 | 267 |
| 32 | 3300026116 | Ga0207674_10000952 | Ga0207674_1000095218 | 267 |
| 33 | 3300026142 | Ga0207698_10372802 | Ga0207698_103728021 | 267 |
| 34 | 3300003790 | Ga0055528_1000240 | Ga0055528_100024041 | 268 |
| 35 | 3300005341 | Ga0070691_10000389 | Ga0070691_100003891 | 268 |
| 36 | 3300005434 | Ga0070709_10092495 | Ga0070709_100924951 | 268 |
| 37 | 3300005458 | Ga0070681_10135044 | Ga0070681_101350441 | 268 |
| 38 | 3300005535 | Ga0070684_100370140 | Ga0070684_1003701402 | 268 |
| 39 | 3300006914 | Ga0075436_100031012 | Ga0075436_1000310122 | 268 |
| 40 | 3300010375 | Ga0105239_10047560 | Ga0105239_100475607 | 268 |
| 41 | 3300013104 | Ga0157370_10039972 | Ga0157370_100399721 | 268 |
| 42 | 3300013105 | Ga0157369_10008714 | Ga0157369_1000871410 | 268 |
| 43 | 3300025273 | Ga0209673_1000013 | Ga0209673_1000013279 | 268 |
| 44 | 3300025295 | Ga0209564_1000525 | Ga0209564_100052542 | 268 |
| 45 | 3300025299 | Ga0209256_1000769 | Ga0209256_10007692 | 268 |
| 46 | 3300025944 | Ga0207661_10076473 | Ga0207661_100764732 | 268 |
| 47 | 3300002773 | JGI25152J39213_1003223 | JGI25152J39213_10032232 | 269 |
| 48 | 3300048919 | Ga0496116_0001006 | Ga0496116_0001006_10142_10951 | 269 |
| 49 | 3300048921 | Ga0496118_0009796 | Ga0496118_0009796_1734_2543 | 269 |
| 50 | 3300048924 | Ga0496121_0024989 | Ga0496121_0024989_522_1331 | 269 |
| 51 | 3300048924 | Ga0496121_0151991 | Ga0496121_0151991_288_1097 | 269 |
| 52 | 3300048925 | Ga0496122_0003507 | Ga0496122_0003507_4067_4876 | 269 |
| 53 | 3300048927 | Ga0496124_0002515 | Ga0496124_0002515_18684_19493 | 269 |
| 54 | iso_pu_bacteria | 2599185156 | 2599331606 | 269 |
| 55 | 3300048922 | Ga0496119_0066011 | Ga0496119_0066011_244_1119 | 270 |
| 56 | 3300048925 | Ga0496122_0050724 | Ga0496122_0050724_534_1409 | 270 |
| 57 | 3300048926 | Ga0496123_0059051 | Ga0496123_0059051_194_1069 | 270 |
| 58 | 3300048928 | Ga0496125_0061679 | Ga0496125_0061679_31_906 | 270 |
| 59 | iso_pu_bacteria | 2751185800 | 2753359644 | 270 |
| 60 | 3300049823 | Ga0501044_0023860 | Ga0501044_0023860_5393_6220 | 271 |
| 61 | iso_pu_bacteria | 2842205361 | 2842205882 | 271 |
| 62 | iso_pu_bacteria | 2842278818 | 2842279339 | 271 |
| 63 | iso_pu_bacteria | 2842922631 | 2842924005 | 271 |
| 64 | iso_pu_bacteria | 2758568016 | 2758641903 | 272 |
| 65 | iso_pu_bacteria | 2840764183 | 2840767584 | 272 |
| 66 | 3300031241 | Ga0265325_10000060 | Ga0265325_1000006041 | 273 |
| 67 | 3300031249 | Ga0265339_10000925 | Ga0265339_1000092522 | 273 |
| 68 | 3300031344 | Ga0265316_10070737 | Ga0265316_100707372 | 273 |
| 69 | 3300031595 | Ga0265313_10003035 | Ga0265313_100030355 | 273 |
| 70 | 3300046517 | Ga0495630_0005038 | Ga0495630_0005038_4585_5460 | 273 |
| 71 | iso_pu_bacteria | 2534681786 | 2535485007 | 273 |
| 72 | iso_pu_bacteria | 2791355091 | 2792620195 | 273 |
| 73 | iso_pu_bacteria | 2791355092 | 2792626385 | 273 |
| 74 | 3300003578 | Ga0006562J51391_1025531 | Ga0006562J51391_10255311 | 274 |
| 75 | 3300005335 | Ga0070666_10017612 | Ga0070666_100176124 | 274 |
| 76 | 3300005367 | Ga0070667_100004771 | Ga0070667_10000477112 | 274 |
| 77 | 3300005563 | Ga0068855_100054628 | Ga0068855_1000546285 | 274 |
| 78 | 3300025903 | Ga0207680_10005594 | Ga0207680_1000559411 | 274 |
| 79 | 3300025986 | Ga0207658_10018317 | Ga0207658_100183173 | 274 |
| 80 | 3300028379 | Ga0268266_10132689 | Ga0268266_101326893 | 274 |
| 81 | 3300044901 | Ga0466960_0033385 | Ga0466960_0033385_1236_2117 | 274 |
| 82 | 3300047472 | Ga0495686_0031084 | Ga0495686_0031084_562_1404 | 274 |
| 83 | iso_pu_bacteria | 2738541317 | 2738946095 | 274 |
| 84 | iso_pu_bacteria | 2854911287 | 2854912263 | 274 |
| 85 | iso_pu_bacteria | 2913308742 | 2913311322 | 274 |
| 86 | iso_pu_bacteria | 2915650412 | 2915653034 | 274 |
| 87 | 3300035692 | Ga0373935_0005207 | Ga0373935_0005207_6511_7374 | 275 |
| 88 | 3300046462 | Ga0495651_0251845 | Ga0495651_0251845_304_1182 | 275 |
| 89 | 3300046535 | Ga0495586_0060886 | Ga0495586_0060886_935_1813 | 275 |
| 90 | 3300047471 | Ga0495684_0233587 | Ga0495684_0233587_373_1251 | 275 |
| 91 | iso_pu_bacteria | 2509276021 | 2509392498 | 275 |
| 92 | iso_pu_bacteria | 2509276033 | 2509446586 | 275 |
| 93 | iso_pu_bacteria | 2510065019 | 2510133484 | 275 |
| 94 | iso_pu_bacteria | 2510065057 | 2510303268 | 275 |
| 95 | iso_pu_bacteria | 2510461076 | 2510894866 | 275 |
| 96 | iso_pu_bacteria | 2511231027 | 2511389683 | 275 |
| 97 | iso_pu_bacteria | 2511231052 | 2511501994 | 275 |
| 98 | iso_pu_bacteria | 2512047086 | 2512533364 | 275 |
| 99 | iso_pu_bacteria | 2512875026 | 2512971069 | 275 |
| 100 | iso_pu_bacteria | 2513237084 | 2513573424 | 275 |
| 101 | iso_pu_bacteria | 2513237085 | 2513577453 | 275 |
| 102 | iso_pu_bacteria | 2513237086 | 2513582609 | 275 |
| 103 | iso_pu_bacteria | 2513237089 | 2513604574 | 275 |
| 104 | iso_pu_bacteria | 2513237091 | 2513615489 | 275 |
| 105 | iso_pu_bacteria | 2513237093 | 2513629911 | 275 |
| 106 | iso_pu_bacteria | 2513237140 | 2513881278 | 275 |
| 107 | iso_pu_bacteria | 2513237143 | 2513902409 | 275 |
| 108 | iso_pu_bacteria | 2513237156 | 2513984570 | 275 |
| 109 | iso_pu_bacteria | 2513237160 | 2514007627 | 275 |
| 110 | iso_pu_bacteria | 2513237162 | 2514021991 | 275 |
| 111 | iso_pu_bacteria | 2515075009 | 2515112452 | 275 |
| 112 | iso_pu_bacteria | 2515154107 | 2515608787 | 275 |
| 113 | iso_pu_bacteria | 2515154113 | 2515632792 | 275 |
| 114 | iso_pu_bacteria | 2515154114 | 2515639940 | 275 |
| 115 | iso_pu_bacteria | 2515154116 | 2515655854 | 275 |
| 116 | iso_pu_bacteria | 2515154134 | 2515740289 | 275 |
| 117 | iso_pu_bacteria | 2516653046 | 2516893290 | 275 |
| 118 | iso_pu_bacteria | 2516653085 | 2517076566 | 275 |
| 119 | iso_pu_bacteria | 2517093000 | 2517095334 | 275 |
| 120 | iso_pu_bacteria | 2517287029 | 2517406936 | 275 |
| 121 | iso_pu_bacteria | 2517487022 | 2517570047 | 275 |
| 122 | iso_pu_bacteria | 2519899620 | 2520378598 | 275 |
| 123 | iso_pu_bacteria | 2524023207 | 2524448808 | 275 |
| 124 | iso_pu_bacteria | 2529292951 | 2530645681 | 275 |
| 125 | iso_pu_bacteria | 2551306084 | 2551675132 | 275 |
| 126 | iso_pu_bacteria | 2551306084 | 2551680542 | 275 |
| 127 | iso_pu_bacteria | 2551306085 | 2551688075 | 275 |
| 128 | iso_pu_bacteria | 2551306086 | 2551691115 | 275 |
| 129 | iso_pu_bacteria | 2551306087 | 2551704441 | 275 |
| 130 | iso_pu_bacteria | 2551306089 | 2551709578 | 275 |
| 131 | iso_pu_bacteria | 2551306090 | 2551722487 | 275 |
| 132 | iso_pu_bacteria | 2551306091 | 2551727351 | 275 |
| 133 | iso_pu_bacteria | 2551306092 | 2551735318 | 275 |
| 134 | iso_pu_bacteria | 2551306093 | 2551741804 | 275 |
| 135 | iso_pu_bacteria | 2585427526 | 2585527805 | 275 |
| 136 | iso_pu_bacteria | 2615840624 | 2616292313 | 275 |
| 137 | iso_pu_bacteria | 2643221637 | 2644210202 | 275 |
| 138 | iso_pu_bacteria | 2643221718 | 2644653754 | 275 |
| 139 | iso_pu_bacteria | 2718217882 | 2719181332 | 275 |
| 140 | iso_pu_bacteria | 2718217927 | 2719385941 | 275 |
| 141 | iso_pu_bacteria | 2718217997 | 2719665755 | 275 |
| 142 | iso_pu_bacteria | 2718218009 | 2719732081 | 275 |
| 143 | iso_pu_bacteria | 2718218199 | 2720492175 | 275 |
| 144 | iso_pu_bacteria | 2718218232 | 2720613438 | 275 |
| 145 | iso_pu_bacteria | 2718218233 | 2720620316 | 275 |
| 146 | iso_pu_bacteria | 2718218235 | 2720631740 | 275 |
| 147 | iso_pu_bacteria | 2718218269 | 2720775468 | 275 |
| 148 | iso_pu_bacteria | 2718218363 | 2721147426 | 275 |
| 149 | iso_pu_bacteria | 2718218365 | 2721158959 | 275 |
| 150 | iso_pu_bacteria | 2718218366 | 2721164344 | 275 |
| 151 | iso_pu_bacteria | 2718218423 | 2721399721 | 275 |
| 152 | iso_pu_bacteria | 2721755514 | 2722840514 | 275 |
| 153 | iso_pu_bacteria | 2721755556 | 2723027086 | 275 |
| 154 | iso_pu_bacteria | 2721755684 | 2723560698 | 275 |
| 155 | iso_pu_bacteria | 2721755685 | 2723567287 | 275 |
| 156 | iso_pu_bacteria | 2721755809 | 2724038534 | 275 |
| 157 | iso_pu_bacteria | 2721755810 | 2724044837 | 275 |
| 158 | iso_pu_bacteria | 2721755819 | 2724090075 | 275 |
| 159 | iso_pu_bacteria | 2721755822 | 2724104552 | 275 |
| 160 | iso_pu_bacteria | 2721755823 | 2724110348 | 275 |
| 161 | iso_pu_bacteria | 2724679232 | 2725948628 | 275 |
| 162 | iso_pu_bacteria | 2728369352 | 2730108022 | 275 |
| 163 | iso_pu_bacteria | 2728369365 | 2730164569 | 275 |
| 164 | iso_pu_bacteria | 2728369397 | 2730298591 | 275 |
| 165 | iso_pu_bacteria | 2738541333 | 2739036672 | 275 |
| 166 | iso_pu_bacteria | 2765235802 | 2765464804 | 275 |
| 167 | iso_pu_bacteria | 2765235942 | 2766067387 | 275 |
| 168 | iso_pu_bacteria | 2775506904 | 2776280396 | 275 |
| 169 | iso_pu_bacteria | 2791355082 | 2792581698 | 275 |
| 170 | iso_pu_bacteria | 2791355256 | 2793294834 | 275 |
| 171 | iso_pu_bacteria | 2791355259 | 2793312412 | 275 |
| 172 | iso_pu_bacteria | 2791355260 | 2793322949 | 275 |
| 173 | iso_pu_bacteria | 2791355261 | 2793330980 | 275 |
| 174 | iso_pu_bacteria | 2791355262 | 2793335900 | 275 |
| 175 | iso_pu_bacteria | 2791355263 | 2793341677 | 275 |
| 176 | iso_pu_bacteria | 2791355264 | 2793349964 | 275 |
| 177 | iso_pu_bacteria | 2791355265 | 2793352919 | 275 |
| 178 | iso_pu_bacteria | 2791355266 | 2793360789 | 275 |
| 179 | iso_pu_bacteria | 2791355267 | 2793366893 | 275 |
| 180 | iso_pu_bacteria | 2802428858 | 2802719542 | 275 |
| 181 | iso_pu_bacteria | 2802428859 | 2802726865 | 275 |
| 182 | iso_pu_bacteria | 2802428860 | 2802732276 | 275 |
| 183 | iso_pu_bacteria | 2802428861 | 2802739879 | 275 |
| 184 | iso_pu_bacteria | 2802428862 | 2802745385 | 275 |
| 185 | iso_pu_bacteria | 2802428863 | 2802752777 | 275 |
| 186 | iso_pu_bacteria | 2802429268 | 2804752446 | 275 |
| 187 | iso_pu_bacteria | 2802429605 | 2805925853 | 275 |
| 188 | iso_pu_bacteria | 2802429606 | 2805933426 | 275 |
| 189 | iso_pu_bacteria | 2802429634 | 2806050737 | 275 |
| 190 | iso_pu_bacteria | 2802429635 | 2806057554 | 275 |
| 191 | iso_pu_bacteria | 2838016132 | 2838018059 | 275 |
| 192 | iso_pu_bacteria | 2838022645 | 2838026262 | 275 |
| 193 | iso_pu_bacteria | 2838042994 | 2838043600 | 275 |
| 194 | iso_pu_bacteria | 2838048938 | 2838053513 | 275 |
| 195 | iso_pu_bacteria | 2838061910 | 2838065657 | 275 |
| 196 | iso_pu_bacteria | 2838068647 | 2838074372 | 275 |
| 197 | iso_pu_bacteria | 2838668709 | 2838673769 | 275 |
| 198 | iso_pu_bacteria | 2838680041 | 2838682056 | 275 |
| 199 | iso_pu_bacteria | 2838686498 | 2838691951 | 275 |
| 200 | iso_pu_bacteria | 2838694306 | 2838696628 | 275 |
| 201 | iso_pu_bacteria | 2838701080 | 2838706213 | 275 |
| 202 | iso_pu_bacteria | 2838707686 | 2838710133 | 275 |
| 203 | iso_pu_bacteria | 2838729681 | 2838732902 | 275 |
| 204 | iso_pu_bacteria | 2838742623 | 2838745780 | 275 |
| 205 | iso_pu_bacteria | 2839993093 | 2839994726 | 275 |
| 206 | iso_pu_bacteria | 2841851746 | 2841855762 | 275 |
| 207 | iso_pu_bacteria | 2841864319 | 2841864379 | 275 |
| 208 | iso_pu_bacteria | 2842077413 | 2842078306 | 275 |
| 209 | iso_pu_bacteria | 2842110456 | 2842114239 | 275 |
| 210 | iso_pu_bacteria | 2842118031 | 2842119185 | 275 |
| 211 | iso_pu_bacteria | 2842146304 | 2842150967 | 275 |
| 212 | iso_pu_bacteria | 2842156927 | 2842157247 | 275 |
| 213 | iso_pu_bacteria | 2842163707 | 2842167905 | 275 |
| 214 | iso_pu_bacteria | 2842180545 | 2842181169 | 275 |
| 215 | iso_pu_bacteria | 2842192696 | 2842194366 | 275 |
| 216 | iso_pu_bacteria | 2842198810 | 2842201805 | 275 |
| 217 | iso_pu_bacteria | 2842217011 | 2842217411 | 275 |
| 218 | iso_pu_bacteria | 2842229732 | 2842230773 | 275 |
| 219 | iso_pu_bacteria | 2842237096 | 2842239545 | 275 |
| 220 | iso_pu_bacteria | 2842243621 | 2842245121 | 275 |
| 221 | iso_pu_bacteria | 2842250916 | 2842255887 | 275 |
| 222 | iso_pu_bacteria | 2842257432 | 2842258934 | 275 |
| 223 | iso_pu_bacteria | 2842264693 | 2842265893 | 275 |
| 224 | iso_pu_bacteria | 2842271015 | 2842276396 | 275 |
| 225 | iso_pu_bacteria | 2842285085 | 2842285988 | 275 |
| 226 | iso_pu_bacteria | 2842291075 | 2842291968 | 275 |
| 227 | iso_pu_bacteria | 2842304105 | 2842304464 | 275 |
| 228 | iso_pu_bacteria | 2842311132 | 2842314388 | 275 |
| 229 | iso_pu_bacteria | 2842317721 | 2842317761 | 275 |
| 230 | iso_pu_bacteria | 2842341865 | 2842345272 | 275 |
| 231 | iso_pu_bacteria | 2842363717 | 2842364719 | 275 |
| 232 | iso_pu_bacteria | 2842370503 | 2842372623 | 275 |
| 233 | iso_pu_bacteria | 2842377471 | 2842378364 | 275 |
| 234 | iso_pu_bacteria | 2842384541 | 2842385695 | 275 |
| 235 | iso_pu_bacteria | 2842395702 | 2842398840 | 275 |
| 236 | iso_pu_bacteria | 2842402390 | 2842403348 | 275 |
| 237 | iso_pu_bacteria | 2842409023 | 2842409279 | 275 |
| 238 | iso_pu_bacteria | 2842415677 | 2842415933 | 275 |
| 239 | iso_pu_bacteria | 2842422224 | 2842427512 | 275 |
| 240 | iso_pu_bacteria | 2842428310 | 2842429470 | 275 |
| 241 | iso_pu_bacteria | 2842434925 | 2842436083 | 275 |
| 242 | iso_pu_bacteria | 2842441272 | 2842442430 | 275 |
| 243 | iso_pu_bacteria | 2842447887 | 2842450722 | 275 |
| 244 | iso_pu_bacteria | 2842462802 | 2842463891 | 275 |
| 245 | iso_pu_bacteria | 2842469257 | 2842470412 | 275 |
| 246 | iso_pu_bacteria | 2842489311 | 2842490171 | 275 |
| 247 | iso_pu_bacteria | 2842495871 | 2842496032 | 275 |
| 248 | iso_pu_bacteria | 2842871566 | 2842871778 | 275 |
| 249 | iso_pu_bacteria | 2844454524 | 2844458993 | 275 |
| 250 | iso_pu_bacteria | 2855825444 | 2855826013 | 275 |
| 251 | iso_pu_bacteria | 2855839649 | 2855841358 | 275 |
| 252 | iso_pu_bacteria | 2857516855 | 2857519875 | 275 |
| 253 | iso_pu_bacteria | 2858800743 | 2858802345 | 275 |
| 254 | iso_pu_bacteria | 2891373044 | 2891373190 | 275 |
| 255 | iso_pu_bacteria | 2894652903 | 2894656155 | 275 |
| 256 | iso_pu_bacteria | 2913295892 | 2913300812 | 275 |
| 257 | iso_pu_bacteria | 2915980308 | 2915981864 | 275 |
| 258 | iso_pu_bacteria | 2915986958 | 2915990058 | 275 |
| 259 | iso_pu_bacteria | 2915993759 | 2915994340 | 275 |
| 260 | iso_pu_bacteria | 2916000859 | 2916004361 | 275 |
| 261 | iso_pu_bacteria | 2916007675 | 2916008213 | 275 |
| 262 | iso_pu_bacteria | 2916014648 | 2916017719 | 275 |
| 263 | iso_pu_bacteria | 2916021584 | 2916024210 | 275 |
| 264 | iso_pu_bacteria | 2916028427 | 2916031743 | 275 |
| 265 | iso_pu_bacteria | 2916035215 | 2916041295 | 275 |
| 266 | iso_pu_bacteria | 2916041962 | 2916045229 | 275 |
| 267 | iso_pu_bacteria | 2916048683 | 2916052301 | 275 |
| 268 | iso_pu_bacteria | 2916055098 | 2916056412 | 275 |
| 269 | iso_pu_bacteria | 2916061851 | 2916067550 | 275 |
| 270 | iso_pu_bacteria | 2916068649 | 2916073238 | 275 |
| 271 | iso_pu_bacteria | 2916076590 | 2916077400 | 275 |
| 272 | iso_pu_bacteria | 2921201388 | 2921202966 | 275 |
| 273 | iso_pu_bacteria | 2921208531 | 2921210435 | 275 |
| 274 | iso_pu_bacteria | 2921237296 | 2921240748 | 275 |
| 275 | iso_pu_bacteria | 2921244191 | 2921244659 | 275 |
| 276 | iso_pu_bacteria | 2921250672 | 2921251147 | 275 |
| 277 | iso_pu_bacteria | 2921257292 | 2921259544 | 275 |
| 278 | iso_pu_bacteria | 2921263974 | 2921265091 | 275 |
| 279 | iso_pu_bacteria | 2921282425 | 2921283520 | 275 |
| 280 | iso_pu_bacteria | 2921289301 | 2921293672 | 275 |
| 281 | iso_pu_bacteria | 2921296804 | 2921297853 | 275 |
| 282 | iso_pu_bacteria | 2924144063 | 2924147123 | 275 |
| 283 | iso_pu_bacteria | 2924150972 | 2924155233 | 275 |
| 284 | iso_pu_bacteria | 2924158325 | 2924160788 | 275 |
| 285 | iso_pu_bacteria | 2924165586 | 2924167366 | 275 |
| 286 | iso_pu_bacteria | 2924172951 | 2924179007 | 275 |
| 287 | iso_pu_bacteria | 2924179722 | 2924184095 | 275 |
| 288 | iso_pu_bacteria | 2924186466 | 2924189044 | 275 |
| 289 | iso_pu_bacteria | 2924193448 | 2924194771 | 275 |
| 290 | iso_pu_bacteria | 2924200457 | 2924203381 | 275 |
| 291 | iso_pu_bacteria | 2924207177 | 2924208856 | 275 |
| 292 | iso_pu_bacteria | 2924214083 | 2924215560 | 275 |
| 293 | iso_pu_bacteria | 2924221636 | 2924226533 | 275 |
| 294 | iso_pu_bacteria | 2924228884 | 2924229925 | 275 |
| 295 | iso_pu_bacteria | 2933570622 | 2933571738 | 275 |
| 296 | iso_pu_bacteria | 2933586486 | 2933590334 | 275 |
| 297 | iso_pu_bacteria | 2933599457 | 2933604828 | 275 |
| 298 | iso_pu_bacteria | 2935894831 | 2935897517 | 275 |
| 299 | iso_pu_bacteria | 2935901341 | 2935905514 | 275 |
| 300 | iso_pu_bacteria | 2936367885 | 2936372533 | 275 |
| 301 | iso_pu_bacteria | 2936375103 | 2936376476 | 275 |
| 302 | iso_pu_bacteria | 2936381700 | 2936387261 | 275 |
| 303 | iso_pu_bacteria | 2936996657 | 2936998098 | 275 |
| 304 | iso_pu_bacteria | 2937002841 | 2937005089 | 275 |
| 305 | iso_pu_bacteria | 2937009748 | 2937012183 | 275 |
| 306 | iso_pu_bacteria | 2937016420 | 2937018658 | 275 |
| 307 | iso_pu_bacteria | 2937023124 | 2937028997 | 275 |
| 308 | iso_pu_bacteria | 2937029754 | 2937031302 | 275 |
| 309 | iso_pu_bacteria | 2937036028 | 2937038557 | 275 |
| 310 | iso_pu_bacteria | 2937042894 | 2937047329 | 275 |
| 311 | iso_pu_bacteria | 2937049772 | 2937050924 | 275 |
| 312 | iso_pu_bacteria | 2937056579 | 2937061519 | 275 |
| 313 | iso_pu_bacteria | 2937063883 | 2937065204 | 275 |
| 314 | iso_pu_bacteria | 2937071275 | 2937073073 | 275 |
| 315 | iso_pu_bacteria | 2937078374 | 2937079823 | 275 |
| 316 | iso_pu_bacteria | 2937084907 | 2937086796 | 275 |
| 317 | iso_pu_bacteria | 2937091812 | 2937096235 | 275 |
| 318 | iso_pu_bacteria | 2937098957 | 2937099560 | 275 |
| 319 | iso_pu_bacteria | 2937106411 | 2937110033 | 275 |
| 320 | iso_pu_bacteria | 2937113482 | 2937116244 | 275 |
| 321 | iso_pu_bacteria | 2937119839 | 2937123054 | 275 |
| 322 | iso_pu_bacteria | 2937126314 | 2937128733 | 275 |
| 323 | iso_pu_bacteria | 2957375807 | 2957376610 | 275 |
| 324 | iso_pu_bacteria | 2957382221 | 2957384827 | 275 |
| 325 | iso_pu_bacteria | 2957388812 | 2957394870 | 275 |
| 326 | iso_pu_bacteria | 2957395598 | 2957398245 | 275 |
| 327 | iso_pu_bacteria | 2957402308 | 2957403181 | 275 |
| 328 | iso_pu_bacteria | 2957408893 | 2957411574 | 275 |
| 329 | iso_pu_bacteria | 2957415311 | 2957418298 | 275 |
| 330 | iso_pu_bacteria | 2957430029 | 2957432824 | 275 |
| 331 | iso_pu_bacteria | 2957437181 | 2957439190 | 275 |
| 332 | iso_pu_bacteria | 2957443900 | 2957445013 | 275 |
| 333 | iso_pu_bacteria | 2957450854 | 2957455994 | 275 |
| 334 | iso_pu_bacteria | 2957457609 | 2957459895 | 275 |
| 335 | iso_pu_bacteria | 2957464669 | 2957466017 | 275 |
| 336 | iso_pu_bacteria | 2957471148 | 2957477112 | 275 |
| 337 | iso_pu_bacteria | 2957478035 | 2957479194 | 275 |
| 338 | iso_pu_bacteria | 2957484790 | 2957486281 | 275 |
| 339 | iso_pu_bacteria | 2957491536 | 2957498014 | 275 |
| 340 | iso_pu_bacteria | 2957498199 | 2957503653 | 275 |
| 341 | iso_pu_bacteria | 2957505466 | 2957507632 | 275 |
| 342 | iso_pu_bacteria | 2960591022 | 2960592691 | 275 |
| 343 | iso_pu_bacteria | 2960597568 | 2960602662 | 275 |
| 344 | iso_pu_bacteria | 2960603979 | 2960605959 | 275 |
| 345 | iso_pu_bacteria | 2960610863 | 2960612445 | 275 |
| 346 | iso_pu_bacteria | 2960617483 | 2960619989 | 275 |
| 347 | iso_pu_bacteria | 2960624210 | 2960630899 | 275 |
| 348 | iso_pu_bacteria | 2960631154 | 2960632808 | 275 |
| 349 | iso_pu_bacteria | 2960637947 | 2960639176 | 275 |
| 350 | iso_pu_bacteria | 2960645483 | 2960650530 | 275 |
| 351 | iso_pu_bacteria | 2960652885 | 2960660014 | 275 |
| 352 | iso_pu_bacteria | 2960660292 | 2960660825 | 275 |
| 353 | iso_pu_bacteria | 2960667422 | 2960670991 | 275 |
| 354 | iso_pu_bacteria | 2960674078 | 2960679026 | 275 |
| 355 | iso_pu_bacteria | 2960680706 | 2960681885 | 275 |
| 356 | iso_pu_bacteria | 2960687367 | 2960689975 | 275 |
| 357 | iso_pu_bacteria | 2960693952 | 2960694258 | 275 |
| 358 | iso_pu_bacteria | 2964607997 | 2964608461 | 275 |
| 359 | iso_pu_bacteria | 2964615318 | 2964616601 | 275 |
| 360 | iso_pu_bacteria | 2964621998 | 2964622557 | 275 |
| 361 | iso_pu_bacteria | 2964628898 | 2964635778 | 275 |
| 362 | iso_pu_bacteria | 2964636051 | 2964640972 | 275 |
| 363 | iso_pu_bacteria | 2964643177 | 2964643986 | 275 |
| 364 | iso_pu_bacteria | 2964649959 | 2964651761 | 275 |
| 365 | iso_pu_bacteria | 2964656573 | 2964660986 | 275 |
| 366 | iso_pu_bacteria | 2964663802 | 2964667069 | 275 |
| 367 | iso_pu_bacteria | 2964670856 | 2964672555 | 275 |
| 368 | iso_pu_bacteria | 2964678106 | 2964684116 | 275 |
| 369 | iso_pu_bacteria | 2964685014 | 2964686471 | 275 |
| 370 | iso_pu_bacteria | 2964691889 | 2964698115 | 275 |
| 371 | iso_pu_bacteria | 2964698721 | 2964702297 | 275 |
| 372 | iso_pu_bacteria | 2964705432 | 2964711869 | 275 |
| 373 | iso_pu_bacteria | 2964712639 | 2964716746 | 275 |
| 374 | iso_pu_bacteria | 2964719344 | 2964723915 | 275 |
| 375 | iso_pu_bacteria | 2967664464 | 2967664702 | 275 |
| 376 | iso_pu_bacteria | 2967671571 | 2967674464 | 275 |
| 377 | iso_pu_bacteria | 2967678726 | 2967681832 | 275 |
| 378 | iso_pu_bacteria | 2967686174 | 2967690801 | 275 |
| 379 | iso_pu_bacteria | 2967693043 | 2967695229 | 275 |
| 380 | iso_pu_bacteria | 2967699805 | 2967703895 | 275 |
| 381 | iso_pu_bacteria | 2967706974 | 2967713308 | 275 |
| 382 | iso_pu_bacteria | 2967714385 | 2967716686 | 275 |
| 383 | iso_pu_bacteria | 2967721400 | 2967721687 | 275 |
| 384 | iso_pu_bacteria | 2967728569 | 2967735009 | 275 |
| 385 | iso_pu_bacteria | 2967735183 | 2967736885 | 275 |
| 386 | iso_pu_bacteria | 2967742019 | 2967746126 | 275 |
| 387 | iso_pu_bacteria | 2967748971 | 2967755506 | 275 |
| 388 | iso_pu_bacteria | 2967755722 | 2967758774 | 275 |
| 389 | iso_pu_bacteria | 2967762386 | 2967765404 | 275 |
| 390 | iso_pu_bacteria | 2967769361 | 2967775682 | 275 |
| 391 | iso_pu_bacteria | 2967775926 | 2967777016 | 275 |
| 392 | iso_pu_bacteria | 2970019648 | 2970026494 | 275 |
| 393 | iso_pu_bacteria | 2970026789 | 2970030774 | 275 |
| 394 | iso_pu_bacteria | 2970033650 | 2970039746 | 275 |
| 395 | iso_pu_bacteria | 2970040964 | 2970046737 | 275 |
| 396 | iso_pu_bacteria | 2970047711 | 2970051514 | 275 |
| 397 | iso_pu_bacteria | 2970054988 | 2970057787 | 275 |
| 398 | iso_pu_bacteria | 2970061556 | 2970066722 | 275 |
| 399 | iso_pu_bacteria | 2970068827 | 2970072975 | 275 |
| 400 | iso_pu_bacteria | 2970076120 | 2970077483 | 275 |
| 401 | iso_pu_bacteria | 2970088815 | 2970091148 | 275 |
| 402 | iso_pu_bacteria | 2970095765 | 2970100659 | 275 |
| 403 | iso_pu_bacteria | 2970102677 | 2970107524 | 275 |
| 404 | iso_pu_bacteria | 2970109326 | 2970110841 | 275 |
| 405 | iso_pu_bacteria | 2970116247 | 2970122140 | 275 |
| 406 | iso_pu_bacteria | 2970122695 | 2970123006 | 275 |
| 407 | iso_pu_bacteria | 2970129317 | 2970131709 | 275 |
| 408 | iso_pu_bacteria | 2970136068 | 2970142504 | 275 |
| 409 | iso_pu_bacteria | 2970143518 | 2970144074 | 275 |
| 410 | iso_pu_bacteria | 2970149975 | 2970154231 | 275 |
| 411 | iso_pu_bacteria | 2970156795 | 2970160192 | 275 |
| 412 | iso_pu_bacteria | 2970164137 | 2970167147 | 275 |
| 413 | iso_pu_bacteria | 2970170962 | 2970173259 | 275 |
| 414 | iso_pu_bacteria | 2970177841 | 2970180296 | 275 |
| 415 | iso_pu_bacteria | 2970184632 | 2970187604 | 275 |
| 416 | iso_pu_bacteria | 2970191845 | 2970193361 | 275 |
| 417 | iso_pu_bacteria | 2977516862 | 2977517715 | 275 |
| 418 | iso_pu_bacteria | 2977523885 | 2977529018 | 275 |
| 419 | iso_pu_bacteria | 2977530762 | 2977531695 | 275 |
| 420 | iso_pu_bacteria | 2977537788 | 2977540539 | 275 |
| 421 | iso_pu_bacteria | 2977544691 | 2977548510 | 275 |
| 422 | iso_pu_bacteria | 2977551784 | 2977554393 | 275 |
| 423 | iso_pu_bacteria | 2977558990 | 2977559734 | 275 |
| 424 | iso_pu_bacteria | 2977565890 | 2977572235 | 275 |
| 425 | iso_pu_bacteria | 2977572785 | 2977575314 | 275 |
| 426 | iso_pu_bacteria | 2977579622 | 2977580199 | 275 |
| 427 | iso_pu_bacteria | 2989349275 | 2989349450 | 275 |
| 428 | iso_pu_bacteria | 2989771324 | 2989774971 | 275 |
| 429 | iso_pu_bacteria | 639633055 | 639648702 | 275 |
| 430 | iso_pu_bacteria | 648276728 | 648739582 | 275 |
| 431 | iso_pu_bacteria | 8003992118 | 8003993873 | 275 |
| 432 | iso_pu_bacteria | 8003999396 | 8004001419 | 275 |
| 433 | iso_pu_bacteria | 8005275841 | 8005280722 | 275 |
| 434 | iso_pu_bacteria | 8005282627 | 8005285340 | 275 |
| 435 | iso_pu_bacteria | 8005289223 | 8005293243 | 275 |
| 436 | iso_pu_bacteria | 8005301065 | 8005302707 | 275 |
| 437 | iso_pu_bacteria | 8005307578 | 8005309893 | 275 |
| 438 | iso_pu_bacteria | 8005376324 | 8005379389 | 275 |
| 439 | iso_pu_bacteria | 8005382845 | 8005385393 | 275 |
| 440 | iso_pu_bacteria | 8005395548 | 8005396614 | 275 |
| 441 | iso_pu_bacteria | 8005430974 | 8005436411 | 275 |
| 442 | iso_pu_bacteria | 8005460587 | 8005463125 | 275 |
| 443 | iso_pu_bacteria | 8005497431 | 8005500486 | 275 |
| 444 | iso_pu_bacteria | 8005556819 | 8005557543 | 275 |
| 445 | iso_pu_bacteria | 8005563573 | 8005568713 | 275 |
| 446 | iso_pu_bacteria | 8005619151 | 8005621862 | 275 |
| 447 | iso_pu_bacteria | 8005626139 | 8005627104 | 275 |
| 448 | iso_pu_bacteria | 8005658619 | 8005659498 | 275 |
| 449 | iso_pu_bacteria | 8005688590 | 8005694723 | 275 |
| 450 | iso_pu_bacteria | 8005695170 | 8005699853 | 275 |
| 451 | iso_pu_bacteria | 8018127388 | 8018130065 | 275 |
| 452 | iso_pu_bacteria | 8018163183 | 8018166630 | 275 |
| 453 | iso_pu_bacteria | 8018176218 | 8018179682 | 275 |
| 454 | iso_pu_bacteria | 8023680758 | 8023685217 | 275 |
| 455 | iso_pu_bacteria | 8024479707 | 8024483371 | 275 |
| 456 | iso_pu_bacteria | 8024501048 | 8024501494 | 275 |
| 457 | iso_pu_bacteria | 8054558443 | 8054561204 | 275 |
| 458 | iso_pu_bacteria | 8056375014 | 8056376778 | 275 |
| 459 | iso_pu_bacteria | 8056382006 | 8056387986 | 275 |
| 460 | 3300046519 | Ga0495632_0004881 | Ga0495632_0004881_7685_8515 | 276 |
| 461 | 3300050492 | nmdc:mga0yw44_127769_c1 | nmdc:mga0yw44_127769_c1_185_1015 | 276 |
| 462 | iso_pu_bacteria | 2508501122 | 2509111418 | 276 |
| 463 | iso_pu_bacteria | 2509276019 | 2509375642 | 276 |
| 464 | iso_pu_bacteria | 2513237138 | 2513864785 | 276 |
| 465 | iso_pu_bacteria | 2513237159 | 2513997040 | 276 |
| 466 | iso_pu_bacteria | 2516143018 | 2516209732 | 276 |
| 467 | iso_pu_bacteria | 2558860100 | 2558867957 | 276 |
| 468 | iso_pu_bacteria | 2582581283 | 2585166161 | 276 |
| 469 | iso_pu_bacteria | 2582581299 | 2585229871 | 276 |
| 470 | iso_pu_bacteria | 2582581306 | 2585267636 | 276 |
| 471 | iso_pu_bacteria | 2582581865 | 2585386695 | 276 |
| 472 | iso_pu_bacteria | 2582581866 | 2585393073 | 276 |
| 473 | iso_pu_bacteria | 2582581867 | 2585404369 | 276 |
| 474 | iso_pu_bacteria | 2585427528 | 2585537699 | 276 |
| 475 | iso_pu_bacteria | 2585427590 | 2585821931 | 276 |
| 476 | iso_pu_bacteria | 2585427593 | 2585835649 | 276 |
| 477 | iso_pu_bacteria | 2585427594 | 2585843003 | 276 |
| 478 | iso_pu_bacteria | 2599185352 | 2600195665 | 276 |
| 479 | iso_pu_bacteria | 2643221557 | 2643803549 | 276 |
| 480 | iso_pu_bacteria | 2643221599 | 2644003899 | 276 |
| 481 | iso_pu_bacteria | 2643221607 | 2644050706 | 276 |
| 482 | iso_pu_bacteria | 2643221610 | 2644067516 | 276 |
| 483 | iso_pu_bacteria | 2643221618 | 2644107665 | 276 |
| 484 | iso_pu_bacteria | 2643221626 | 2644148664 | 276 |
| 485 | iso_pu_bacteria | 2643221634 | 2644192576 | 276 |
| 486 | iso_pu_bacteria | 2643221636 | 2644205180 | 276 |
| 487 | iso_pu_bacteria | 2643221643 | 2644239704 | 276 |
| 488 | iso_pu_bacteria | 2643221655 | 2644309059 | 276 |
| 489 | iso_pu_bacteria | 2643221659 | 2644332887 | 276 |
| 490 | iso_pu_bacteria | 2643221668 | 2644375196 | 276 |
| 491 | iso_pu_bacteria | 2643221675 | 2644418569 | 276 |
| 492 | iso_pu_bacteria | 2643221680 | 2644451936 | 276 |
| 493 | iso_pu_bacteria | 2643221686 | 2644483624 | 276 |
| 494 | iso_pu_bacteria | 2643221688 | 2644491821 | 276 |
| 495 | iso_pu_bacteria | 2643221689 | 2644501374 | 276 |
| 496 | iso_pu_bacteria | 2643221698 | 2644545941 | 276 |
| 497 | iso_pu_bacteria | 2643221712 | 2644615001 | 276 |
| 498 | iso_pu_bacteria | 2643221723 | 2644676537 | 276 |
| 499 | iso_pu_bacteria | 2643221726 | 2644690698 | 276 |
| 500 | iso_pu_bacteria | 2690316117 | 2692315812 | 276 |
| 501 | iso_pu_bacteria | 2738541293 | 2738804184 | 276 |
| 502 | iso_pu_bacteria | 2751185821 | 2753461896 | 276 |
| 503 | iso_pu_bacteria | 2767802442 | 2770195273 | 276 |
| 504 | iso_pu_bacteria | 2775507049 | 2776913575 | 276 |
| 505 | iso_pu_bacteria | 2791355094 | 2792639332 | 276 |
| 506 | iso_pu_bacteria | 2791355253 | 2793279957 | 276 |
| 507 | iso_pu_bacteria | 2802429633 | 2806046222 | 276 |
| 508 | iso_pu_bacteria | 2802429636 | 2806064936 | 276 |
| 509 | iso_pu_bacteria | 2802429637 | 2806072204 | 276 |
| 510 | iso_pu_bacteria | 2838074704 | 2838079555 | 276 |
| 511 | iso_pu_bacteria | 2842521101 | 2842522718 | 276 |
| 512 | iso_pu_bacteria | 2844163670 | 2844167790 | 276 |
| 513 | iso_pu_bacteria | 2847417321 | 2847419124 | 276 |
| 514 | iso_pu_bacteria | 2848992105 | 2848994153 | 276 |
| 515 | iso_pu_bacteria | 2850079185 | 2850081183 | 276 |
| 516 | iso_pu_bacteria | 2855872281 | 2855876796 | 276 |
| 517 | iso_pu_bacteria | 2896384573 | 2896384887 | 276 |
| 518 | iso_pu_bacteria | 2899803654 | 2899809044 | 276 |
| 519 | iso_pu_bacteria | 2920760137 | 2920765760 | 276 |
| 520 | iso_pu_bacteria | 2920822456 | 2920824761 | 276 |
| 521 | iso_pu_bacteria | 2923556063 | 2923558065 | 276 |
| 522 | iso_pu_bacteria | 2928521798 | 2928523715 | 276 |
| 523 | iso_pu_bacteria | 2941499720 | 2941504934 | 276 |
| 524 | iso_pu_bacteria | 2954011201 | 2954015998 | 276 |
| 525 | iso_pu_bacteria | 3003930520 | 3003933810 | 276 |
| 526 | iso_pu_bacteria | 3005409236 | 3005414957 | 276 |
| 527 | iso_pu_bacteria | 3005452660 | 3005454381 | 276 |
| 528 | iso_pu_bacteria | 643692032 | 643826015 | 276 |
| 529 | iso_pu_bacteria | 8005570704 | 8005574409 | 276 |
| 530 | iso_pu_bacteria | 8049293176 | 8049295019 | 276 |
| 531 | iso_pu_bacteria | 8055431914 | 8055435798 | 276 |
| 532 | 3300032133 | Ga0316583_10038243 | Ga0316583_100382432 | 277 |
| 533 | 3300005937 | Ga0081455_10001970 | Ga0081455_100019706 | 278 |
| 534 | 3300035398 | Ga0316574_0233395 | Ga0316574_0233395_312_1151 | 278 |
| 535 | iso_pu_bacteria | 2510917022 | 2511135236 | 278 |
| 536 | iso_pu_bacteria | 2510917028 | 2511181681 | 278 |
| 537 | iso_pu_bacteria | 2524023209 | 2524459394 | 278 |
| 538 | iso_pu_bacteria | 2582581294 | 2585200310 | 278 |
| 539 | iso_pu_bacteria | 2582581298 | 2585222665 | 278 |
| 540 | iso_pu_bacteria | 2582581307 | 2585270973 | 278 |
| 541 | iso_pu_bacteria | 2582581308 | 2585277322 | 278 |
| 542 | iso_pu_bacteria | 2582581315 | 2585323505 | 278 |
| 543 | iso_pu_bacteria | 2582581316 | 2585331640 | 278 |
| 544 | iso_pu_bacteria | 2585427527 | 2585533942 | 278 |
| 545 | iso_pu_bacteria | 2585427529 | 2585545248 | 278 |
| 546 | iso_pu_bacteria | 2585427530 | 2585552207 | 278 |
| 547 | iso_pu_bacteria | 2585427531 | 2585558697 | 278 |
| 548 | iso_pu_bacteria | 2585427608 | 2585898062 | 278 |
| 549 | iso_pu_bacteria | 2585427609 | 2585904333 | 278 |
| 550 | iso_pu_bacteria | 2585428125 | 2587980550 | 278 |
| 551 | iso_pu_bacteria | 2615840626 | 2616308702 | 278 |
| 552 | iso_pu_bacteria | 2615840698 | 2616556995 | 278 |
| 553 | iso_pu_bacteria | 2617270742 | 2617385798 | 278 |
| 554 | iso_pu_bacteria | 2667528174 | 2671111601 | 278 |
| 555 | iso_pu_bacteria | 2775507266 | 2778174136 | 278 |
| 556 | iso_pu_bacteria | 2818991448 | 2819608982 | 278 |
| 557 | iso_pu_bacteria | 2818991453 | 2819637789 | 278 |
| 558 | iso_pu_bacteria | 2838029111 | 2838029972 | 278 |
| 559 | iso_pu_bacteria | 2842298080 | 2842301915 | 278 |
| 560 | iso_pu_bacteria | 2842357229 | 2842357619 | 278 |
| 561 | iso_pu_bacteria | 2842475841 | 2842476743 | 278 |
| 562 | iso_pu_bacteria | 2842482326 | 2842484718 | 278 |
| 563 | iso_pu_bacteria | 2842502639 | 2842503500 | 278 |
| 564 | iso_pu_bacteria | 2842509118 | 2842511307 | 278 |
| 565 | iso_pu_bacteria | 2852387548 | 2852390026 | 278 |
| 566 | iso_pu_bacteria | 2919100787 | 2919106549 | 278 |
| 567 | iso_pu_bacteria | 2919408235 | 2919411572 | 278 |
| 568 | iso_pu_bacteria | 3005416602 | 3005419985 | 278 |
| 569 | iso_pu_bacteria | 3005445848 | 3005448281 | 278 |
| 570 | iso_pu_bacteria | 8005314921 | 8005316936 | 278 |
| 571 | iso_pu_bacteria | 8005484373 | 8005485266 | 278 |
| 572 | iso_pu_bacteria | 8005542996 | 8005545287 | 278 |
| 573 | iso_pu_bacteria | 8005645114 | 8005649749 | 278 |
| 574 | iso_pu_bacteria | 8005682033 | 8005683065 | 278 |
| 575 | iso_pu_bacteria | 8046767195 | 8046770413 | 278 |
| 576 | iso_pu_bacteria | 8057575449 | 8057575918 | 278 |
| 577 | 3300003187 | JGI25151J46595_10006484 | JGI25151J46595_100064845 | 279 |
| 578 | 3300003215 | JGI25153J46596_10007880 | JGI25153J46596_100078804 | 279 |
| 579 | 3300003354 | JGI25160J50197_1000582 | JGI25160J50197_100058214 | 279 |
| 580 | 3300003771 | Ga0055526_1001046 | Ga0055526_100104613 | 279 |
| 581 | 3300003790 | Ga0055528_1000646 | Ga0055528_100064625 | 279 |
| 582 | 3300003790 | Ga0055528_1001280 | Ga0055528_100128010 | 279 |
| 583 | 3300004625 | Ga0055543_1000623 | Ga0055543_100062314 | 279 |
| 584 | 3300005262 | Ga0065165_1027428 | Ga0065165_10274281 | 279 |
| 585 | 3300005467 | Ga0070706_100376136 | Ga0070706_1003761362 | 279 |
| 586 | 3300005471 | Ga0070698_100064385 | Ga0070698_1000643852 | 279 |
| 587 | 3300005842 | Ga0068858_100311112 | Ga0068858_1003111122 | 279 |
| 588 | 3300006038 | Ga0075365_10004193 | Ga0075365_100041932 | 279 |
| 589 | 3300006042 | Ga0075368_10053301 | Ga0075368_100533012 | 279 |
| 590 | 3300006177 | Ga0075362_10001282 | Ga0075362_1000128210 | 279 |
| 591 | 3300006178 | Ga0075367_10001089 | Ga0075367_1000108911 | 279 |
| 592 | 3300006186 | Ga0075369_10002276 | Ga0075369_100022767 | 279 |
| 593 | 3300006186 | Ga0075369_10079707 | Ga0075369_100797071 | 279 |
| 594 | 3300006195 | Ga0075366_10102335 | Ga0075366_101023352 | 279 |
| 595 | 3300006946 | Ga0079104_1002821 | Ga0079104_10028215 | 279 |
| 596 | 3300009766 | Ga0123342_1022424 | Ga0123342_10224244 | 279 |
| 597 | 3300014968 | Ga0157379_10218865 | Ga0157379_102188652 | 279 |
| 598 | 3300021320 | Ga0214544_1001350 | Ga0214544_10013505 | 279 |
| 599 | 3300021321 | Ga0214542_1002270 | Ga0214542_10022704 | 279 |
| 600 | 3300021327 | Ga0214543_1000028 | Ga0214543_1000028194 | 279 |
| 601 | 3300022739 | Ga0228711_1000016 | Ga0228711_100001662 | 279 |
| 602 | 3300022740 | Ga0228710_1000013 | Ga0228710_100001372 | 279 |
| 603 | 3300025245 | Ga0207425_1003612 | Ga0207425_10036122 | 279 |
| 604 | 3300025258 | Ga0209129_1000161 | Ga0209129_100016120 | 279 |
| 605 | 3300025258 | Ga0209129_1000167 | Ga0209129_100016788 | 279 |
| 606 | 3300025273 | Ga0209673_1000010 | Ga0209673_100001040 | 279 |
| 607 | 3300025273 | Ga0209673_1000296 | Ga0209673_100029685 | 279 |
| 608 | 3300025273 | Ga0209673_1001064 | Ga0209673_10010647 | 279 |
| 609 | 3300025273 | Ga0209673_1041716 | Ga0209673_10417162 | 279 |
| 610 | 3300025284 | Ga0209130_1004153 | Ga0209130_10041532 | 279 |
| 611 | 3300025284 | Ga0209130_1021928 | Ga0209130_10219282 | 279 |
| 612 | 3300025291 | Ga0209675_1013418 | Ga0209675_10134183 | 279 |
| 613 | 3300025292 | Ga0209676_1014017 | Ga0209676_10140174 | 279 |
| 614 | 3300025292 | Ga0209676_1030238 | Ga0209676_10302382 | 279 |
| 615 | 3300025294 | Ga0209025_1000119 | Ga0209025_100011958 | 279 |
| 616 | 3300025294 | Ga0209025_1000695 | Ga0209025_100069519 | 279 |
| 617 | 3300025294 | Ga0209025_1003074 | Ga0209025_10030744 | 279 |
| 618 | 3300025294 | Ga0209025_1006218 | Ga0209025_10062184 | 279 |
| 619 | 3300025294 | Ga0209025_1088277 | Ga0209025_10882771 | 279 |
| 620 | 3300025295 | Ga0209564_1000638 | Ga0209564_100063837 | 279 |
| 621 | 3300025295 | Ga0209564_1005895 | Ga0209564_10058957 | 279 |
| 622 | 3300025295 | Ga0209564_1023695 | Ga0209564_10236952 | 279 |
| 623 | 3300025297 | Ga0209758_1000598 | Ga0209758_100059847 | 279 |
| 624 | 3300025297 | Ga0209758_1000710 | Ga0209758_100071024 | 279 |
| 625 | 3300025298 | Ga0209050_1013563 | Ga0209050_10135634 | 279 |
| 626 | 3300025299 | Ga0209256_1000383 | Ga0209256_100038311 | 279 |
| 627 | 3300025299 | Ga0209256_1001954 | Ga0209256_100195414 | 279 |
| 628 | 3300025299 | Ga0209256_1028230 | Ga0209256_10282302 | 279 |
| 629 | 3300025302 | Ga0207426_1000039 | Ga0207426_1000039278 | 279 |
| 630 | 3300025303 | Ga0209051_1000253 | Ga0209051_100025392 | 279 |
| 631 | 3300025303 | Ga0209051_1001954 | Ga0209051_100195410 | 279 |
| 632 | 3300025303 | Ga0209051_1007263 | Ga0209051_10072636 | 279 |
| 633 | 3300025303 | Ga0209051_1020188 | Ga0209051_10201883 | 279 |
| 634 | 3300025304 | Ga0209257_1005407 | Ga0209257_10054074 | 279 |
| 635 | 3300025910 | Ga0207684_10075386 | Ga0207684_100753862 | 279 |
| 636 | 3300025924 | Ga0207694_10096375 | Ga0207694_100963752 | 279 |
| 637 | 3300025928 | Ga0207700_10187094 | Ga0207700_101870942 | 279 |
| 638 | 3300027111 | Ga0209281_1000221 | Ga0209281_100022158 | 279 |
| 639 | 3300027111 | Ga0209281_1000453 | Ga0209281_100045328 | 279 |
| 640 | 3300027666 | Ga0209282_1000041 | Ga0209282_100004158 | 279 |
| 641 | 3300028794 | Ga0307515_10000023 | Ga0307515_10000023266 | 279 |
| 642 | 3300028794 | Ga0307515_10045603 | Ga0307515_100456033 | 279 |
| 643 | 3300031456 | Ga0307513_10013160 | Ga0307513_1001316015 | 279 |
| 644 | 3300031456 | Ga0307513_10017501 | Ga0307513_100175012 | 279 |
| 645 | 3300031548 | Ga0307408_100029521 | Ga0307408_1000295213 | 279 |
| 646 | 3300031911 | Ga0307412_10224122 | Ga0307412_102241222 | 279 |
| 647 | 3300031967 | Ga0315914_1000030 | Ga0315914_100003073 | 279 |
| 648 | 3300032002 | Ga0307416_100121986 | Ga0307416_1001219863 | 279 |
| 649 | 3300033430 | Ga0315913_1000017 | Ga0315913_100001771 | 279 |
| 650 | 3300033464 | Ga0315915_1000017 | Ga0315915_100001794 | 279 |
| 651 | 3300035172 | Ga0373955_0055765 | Ga0373955_0055765_1116_1955 | 279 |
| 652 | 3300035695 | Ga0373927_0000556 | Ga0373927_0000556_25706_26545 | 279 |
| 653 | 3300037068 | Ga0373925_0002597 | Ga0373925_0002597_8663_9502 | 279 |
| 654 | 3300041441 | Ga0451787_547467 | Ga0451787_547467_13_852 | 279 |
| 655 | 3300041492 | Ga0451835_0182672 | Ga0451835_0182672_727_1566 | 279 |
| 656 | 3300041494 | Ga0451837_1006229 | Ga0451837_1006229_27_869 | 279 |
| 657 | 3300041494 | Ga0451837_1707933 | Ga0451837_1707933_90_929 | 279 |
| 658 | 3300041496 | Ga0451839_0446078 | Ga0451839_0446078_331_1170 | 279 |
| 659 | 3300041501 | Ga0451845_0273193 | Ga0451845_0273193_67_906 | 279 |
| 660 | 3300041503 | Ga0451847_0827233 | Ga0451847_0827233_705_1544 | 279 |
| 661 | 3300041505 | Ga0451849_0988520 | Ga0451849_0988520_164_1003 | 279 |
| 662 | 3300041507 | Ga0451851_1044136 | Ga0451851_1044136_376_1215 | 279 |
| 663 | 3300042007 | Ga0439449_0006695 | Ga0439449_0006695_1608_2447 | 279 |
| 664 | 3300046460 | Ga0495638_0000638 | Ga0495638_0000638_22174_23013 | 279 |
| 665 | 3300046460 | Ga0495638_0047437 | Ga0495638_0047437_121_960 | 279 |
| 666 | 3300046460 | Ga0495638_0126441 | Ga0495638_0126441_512_1351 | 279 |
| 667 | 3300046471 | Ga0495650_0021715 | Ga0495650_0021715_121_960 | 279 |
| 668 | 3300046474 | Ga0495605_0002606 | Ga0495605_0002606_448_1287 | 279 |
| 669 | 3300046474 | Ga0495605_0011032 | Ga0495605_0011032_3055_3894 | 279 |
| 670 | 3300046492 | Ga0495585_0012321 | Ga0495585_0012321_106_945 | 279 |
| 671 | 3300046500 | Ga0495596_0035987 | Ga0495596_0035987_947_1786 | 279 |
| 672 | 3300046501 | Ga0495607_0007805 | Ga0495607_0007805_2371_3210 | 279 |
| 673 | 3300046501 | Ga0495607_0074920 | Ga0495607_0074920_659_1498 | 279 |
| 674 | 3300046507 | Ga0495606_0007913 | Ga0495606_0007913_4170_5009 | 279 |
| 675 | 3300046507 | Ga0495606_0036604 | Ga0495606_0036604_751_1590 | 279 |
| 676 | 3300046513 | Ga0495616_0006597 | Ga0495616_0006597_3643_4482 | 279 |
| 677 | 3300046513 | Ga0495616_0034968 | Ga0495616_0034968_791_1630 | 279 |
| 678 | 3300046518 | Ga0495631_0002125 | Ga0495631_0002125_7562_8401 | 279 |
| 679 | 3300046518 | Ga0495631_0014589 | Ga0495631_0014589_2282_3121 | 279 |
| 680 | 3300046519 | Ga0495632_0004409 | Ga0495632_0004409_4285_5124 | 279 |
| 681 | 3300046519 | Ga0495632_0004862 | Ga0495632_0004862_1593_2432 | 279 |
| 682 | 3300046522 | Ga0495643_0005952 | Ga0495643_0005952_512_1351 | 279 |
| 683 | 3300046525 | Ga0495663_0039079 | Ga0495663_0039079_89_928 | 279 |
| 684 | 3300046538 | Ga0495609_0007260 | Ga0495609_0007260_2290_3129 | 279 |
| 685 | 3300046616 | Ga0495668_0048638 | Ga0495668_0048638_1203_2042 | 279 |
| 686 | 3300046660 | Ga0495625_0001863 | Ga0495625_0001863_18185_19024 | 279 |
| 687 | 3300046660 | Ga0495625_0015058 | Ga0495625_0015058_2669_3508 | 279 |
| 688 | 3300046660 | Ga0495625_0169887 | Ga0495625_0169887_541_1380 | 279 |
| 689 | 3300046663 | Ga0495635_0235611 | Ga0495635_0235611_138_977 | 279 |
| 690 | 3300046810 | Ga0495660_0012720 | Ga0495660_0012720_1028_1867 | 279 |
| 691 | 3300046810 | Ga0495660_0020342 | Ga0495660_0020342_413_1252 | 279 |
| 692 | 3300047318 | Ga0495636_0001864 | Ga0495636_0001864_3083_3922 | 279 |
| 693 | 3300047323 | Ga0495683_0019656 | Ga0495683_0019656_1993_2832 | 279 |
| 694 | 3300047443 | Ga0495687_010735 | Ga0495687_010735_524_1363 | 279 |
| 695 | 3300048090 | Ga0495615_0038972 | Ga0495615_0038972_46_885 | 279 |
| 696 | 3300048919 | Ga0496116_0089363 | Ga0496116_0089363_495_1334 | 279 |
| 697 | 3300048919 | Ga0496116_0115852 | Ga0496116_0115852_49_888 | 279 |
| 698 | 3300048920 | Ga0496117_0005327 | Ga0496117_0005327_1962_2804 | 279 |
| 699 | 3300048921 | Ga0496118_0005459 | Ga0496118_0005459_6071_6910 | 279 |
| 700 | 3300048922 | Ga0496119_0157567 | Ga0496119_0157567_125_964 | 279 |
| 701 | 3300048924 | Ga0496121_0100735 | Ga0496121_0100735_796_1635 | 279 |
| 702 | 3300048924 | Ga0496121_0136605 | Ga0496121_0136605_713_1552 | 279 |
| 703 | 3300048925 | Ga0496122_0001317 | Ga0496122_0001317_11097_11939 | 279 |
| 704 | 3300048925 | Ga0496122_0098445 | Ga0496122_0098445_666_1505 | 279 |
| 705 | 3300048926 | Ga0496123_0000448 | Ga0496123_0000448_34518_35360 | 279 |
| 706 | 3300048927 | Ga0496124_0005688 | Ga0496124_0005688_11048_11890 | 279 |
| 707 | 3300048927 | Ga0496124_0040458 | Ga0496124_0040458_242_1081 | 279 |
| 708 | 3300048928 | Ga0496125_0001127 | Ga0496125_0001127_14111_14953 | 279 |
| 709 | 3300048929 | Ga0496126_0032771 | Ga0496126_0032771_303_1145 | 279 |
| 710 | 3300048929 | Ga0496126_0076645 | Ga0496126_0076645_1186_2025 | 279 |
| 711 | 3300048929 | Ga0496126_0125110 | Ga0496126_0125110_208_1047 | 279 |
| 712 | 3300049459 | Ga0495678_003522 | Ga0495678_003522_7593_8432 | 279 |
| 713 | 3300049459 | Ga0495678_089111 | Ga0495678_089111_154_993 | 279 |
| 714 | 3300049460 | Ga0495682_0046054 | Ga0495682_0046054_13_852 | 279 |
| 715 | 3300049568 | Ga0501031_0108159 | Ga0501031_0108159_396_1238 | 279 |
| 716 | 3300049572 | Ga0501036_0111674 | Ga0501036_0111674_673_1512 | 279 |
| 717 | 3300049575 | Ga0501039_0202771 | Ga0501039_0202771_592_1431 | 279 |
| 718 | 3300049589 | Ga0501073_0077193 | Ga0501073_0077193_166_1005 | 279 |
| 719 | 3300049742 | Ga0501080_0063665 | Ga0501080_0063665_1532_2371 | 279 |
| 720 | 3300049744 | Ga0501083_0118133 | Ga0501083_0118133_660_1499 | 279 |
| 721 | 3300049776 | Ga0501280_004692 | Ga0501280_004692_248_1099 | 279 |
| 722 | 3300049822 | Ga0501035_0071198 | Ga0501035_0071198_1423_2265 | 279 |
| 723 | 3300050489 | nmdc:mga03683_47598_c1 | nmdc:mga03683_47598_c1_626_1468 | 279 |
| 724 | 3300050493 | nmdc:mga0k408_26375_c1 | nmdc:mga0k408_26375_c1_637_1479 | 279 |
| 725 | 3300050496 | nmdc:mga07m45_45410_c1 | nmdc:mga07m45_45410_c1_393_1235 | 279 |
| 726 | 3300053086 | Ga0500578_0047074 | Ga0500578_0047074_571_1410 | 279 |
| 727 | 3300053098 | Ga0500650_0016254 | Ga0500650_0016254_1220_2059 | 279 |
| 728 | 3300053109 | Ga0500569_001435 | Ga0500569_001435_3581_4420 | 279 |
| 729 | 3300053134 | Ga0500658_0000720 | Ga0500658_0000720_3601_4440 | 279 |
| 730 | 3300053140 | Ga0500573_0003989 | Ga0500573_0003989_3347_4186 | 279 |
| 731 | 3300053153 | Ga0500616_0001219 | Ga0500616_0001219_12168_13007 | 279 |
| 732 | 3300053153 | Ga0500616_0033208 | Ga0500616_0033208_512_1351 | 279 |
| 733 | 3300053158 | Ga0500627_0002349 | Ga0500627_0002349_2513_3352 | 279 |
| 734 | iso_pu_bacteria | 2513237088 | 2513594714 | 279 |
| 735 | iso_pu_bacteria | 2643221653 | 2644298431 | 279 |
| 736 | iso_pu_bacteria | 2643221719 | 2644656660 | 279 |
| 737 | iso_pu_bacteria | 2818991272 | 2819241708 | 279 |
| 738 | iso_pu_bacteria | 2837651117 | 2837653336 | 279 |
| 739 | iso_pu_bacteria | 2989776772 | 2989778959 | 279 |
| 740 | iso_pu_bacteria | 8005246636 | 8005248512 | 279 |
| 741 | 3300002774 | JGI25150J39212_1000439 | JGI25150J39212_10004397 | 280 |
| 742 | 3300002987 | JGI25159J45721_1000020 | JGI25159J45721_100002028 | 280 |
| 743 | 3300003187 | JGI25151J46595_10000083 | JGI25151J46595_1000008351 | 280 |
| 744 | 3300003187 | JGI25151J46595_10012789 | JGI25151J46595_100127891 | 280 |
| 745 | 3300003215 | JGI25153J46596_10000210 | JGI25153J46596_1000021015 | 280 |
| 746 | 3300003354 | JGI25160J50197_1000055 | JGI25160J50197_100005528 | 280 |
| 747 | 3300003354 | JGI25160J50197_1017356 | JGI25160J50197_10173562 | 280 |
| 748 | 3300003374 | JGI25161J50226_1000411 | JGI25161J50226_100041113 | 280 |
| 749 | 3300003771 | Ga0055526_1000508 | Ga0055526_100050831 | 280 |
| 750 | 3300003771 | Ga0055526_1028491 | Ga0055526_10284912 | 280 |
| 751 | 3300003775 | Ga0055524_1000319 | Ga0055524_100031919 | 280 |
| 752 | 3300003775 | Ga0055524_1043767 | Ga0055524_10437672 | 280 |
| 753 | 3300003790 | Ga0055528_1005677 | Ga0055528_10056773 | 280 |
| 754 | 3300003794 | Ga0055531_10017314 | Ga0055531_100173143 | 280 |
| 755 | 3300004625 | Ga0055543_1000240 | Ga0055543_100024016 | 280 |
| 756 | 3300005262 | Ga0065165_1001002 | Ga0065165_100100210 | 280 |
| 757 | 3300005355 | Ga0070671_100041567 | Ga0070671_1000415671 | 280 |
| 758 | 3300006038 | Ga0075365_10042626 | Ga0075365_100426262 | 280 |
| 759 | 3300006178 | Ga0075367_10054146 | Ga0075367_100541462 | 280 |
| 760 | 3300006186 | Ga0075369_10022250 | Ga0075369_100222502 | 280 |
| 761 | 3300009011 | Ga0105251_10021359 | Ga0105251_100213594 | 280 |
| 762 | 3300009092 | Ga0105250_10023520 | Ga0105250_100235203 | 280 |
| 763 | 3300009177 | Ga0105248_10041541 | Ga0105248_100415414 | 280 |
| 764 | 3300009766 | Ga0123342_1014483 | Ga0123342_10144832 | 280 |
| 765 | 3300013249 | Ga0171463_1003 | Ga0171463_1003596 | 280 |
| 766 | 3300015690 | Ga0183363_1329 | Ga0183363_13292 | 280 |
| 767 | 3300021321 | Ga0214542_1023610 | Ga0214542_10236101 | 280 |
| 768 | 3300021327 | Ga0214543_1000078 | Ga0214543_100007850 | 280 |
| 769 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024199 | 280 |
| 770 | 3300025258 | Ga0209129_1000184 | Ga0209129_100018487 | 280 |
| 771 | 3300025258 | Ga0209129_1001218 | Ga0209129_100121812 | 280 |
| 772 | 3300025263 | Ga0209565_1019625 | Ga0209565_10196252 | 280 |
| 773 | 3300025273 | Ga0209673_1001836 | Ga0209673_10018369 | 280 |
| 774 | 3300025273 | Ga0209673_1044199 | Ga0209673_10441991 | 280 |
| 775 | 3300025284 | Ga0209130_1000026 | Ga0209130_1000026330 | 280 |
| 776 | 3300025292 | Ga0209676_1008398 | Ga0209676_10083984 | 280 |
| 777 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050128 | 280 |
| 778 | 3300025294 | Ga0209025_1000767 | Ga0209025_100076718 | 280 |
| 779 | 3300025294 | Ga0209025_1015166 | Ga0209025_10151664 | 280 |
| 780 | 3300025295 | Ga0209564_1000208 | Ga0209564_100020828 | 280 |
| 781 | 3300025295 | Ga0209564_1010711 | Ga0209564_10107116 | 280 |
| 782 | 3300025297 | Ga0209758_1000083 | Ga0209758_1000083129 | 280 |
| 783 | 3300025298 | Ga0209050_1010952 | Ga0209050_10109522 | 280 |
| 784 | 3300025299 | Ga0209256_1000042 | Ga0209256_100004267 | 280 |
| 785 | 3300025299 | Ga0209256_1002837 | Ga0209256_10028373 | 280 |
| 786 | 3300025299 | Ga0209256_1018012 | Ga0209256_10180122 | 280 |
| 787 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006993 | 280 |
| 788 | 3300025302 | Ga0207426_1000697 | Ga0207426_100069732 | 280 |
| 789 | 3300025304 | Ga0209257_1007329 | Ga0209257_10073294 | 280 |
| 790 | 3300025931 | Ga0207644_10034481 | Ga0207644_100344812 | 280 |
| 791 | 3300025972 | Ga0207668_10010333 | Ga0207668_100103331 | 280 |
| 792 | 3300028794 | Ga0307515_10002518 | Ga0307515_1000251821 | 280 |
| 793 | 3300028794 | Ga0307515_10033971 | Ga0307515_100339718 | 280 |
| 794 | 3300031731 | Ga0307405_10050711 | Ga0307405_100507112 | 280 |
| 795 | 3300031901 | Ga0307406_10053226 | Ga0307406_100532262 | 280 |
| 796 | 3300031911 | Ga0307412_10015488 | Ga0307412_100154883 | 280 |
| 797 | 3300041404 | Ga0439436_0009228 | Ga0439436_0009228_214_1056 | 280 |
| 798 | 3300041407 | Ga0439447_051615 | Ga0439447_051615_52_894 | 280 |
| 799 | 3300042015 | Ga0439462_0006428 | Ga0439462_0006428_2046_2888 | 280 |
| 800 | 3300042122 | Ga0450920_012072 | Ga0450920_012072_490_1332 | 280 |
| 801 | 3300046453 | Ga0495627_067670 | Ga0495627_067670_104_946 | 280 |
| 802 | 3300046454 | Ga0495592_0028499 | Ga0495592_0028499_432_1274 | 280 |
| 803 | 3300046459 | Ga0495629_0066519 | Ga0495629_0066519_1580_2422 | 280 |
| 804 | 3300046476 | Ga0495662_0008737 | Ga0495662_0008737_3351_4193 | 280 |
| 805 | 3300046492 | Ga0495585_0006116 | Ga0495585_0006116_6495_7337 | 280 |
| 806 | 3300046506 | Ga0495583_0002711 | Ga0495583_0002711_3825_4667 | 280 |
| 807 | 3300046507 | Ga0495606_0001089 | Ga0495606_0001089_30009_30851 | 280 |
| 808 | 3300046507 | Ga0495606_0071160 | Ga0495606_0071160_964_1806 | 280 |
| 809 | 3300046512 | Ga0495610_0002729 | Ga0495610_0002729_5791_6633 | 280 |
| 810 | 3300046515 | Ga0495620_0014593 | Ga0495620_0014593_1524_2366 | 280 |
| 811 | 3300046519 | Ga0495632_0072670 | Ga0495632_0072670_408_1250 | 280 |
| 812 | 3300046557 | Ga0495622_0004239 | Ga0495622_0004239_1238_2080 | 280 |
| 813 | 3300046558 | Ga0495633_0102106 | Ga0495633_0102106_198_1040 | 280 |
| 814 | 3300046660 | Ga0495625_0116683 | Ga0495625_0116683_923_1765 | 280 |
| 815 | 3300046660 | Ga0495625_0117278 | Ga0495625_0117278_113_955 | 280 |
| 816 | 3300046660 | Ga0495625_0170796 | Ga0495625_0170796_422_1264 | 280 |
| 817 | 3300046660 | Ga0495625_0309993 | Ga0495625_0309993_23_865 | 280 |
| 818 | 3300046663 | Ga0495635_0056234 | Ga0495635_0056234_832_1674 | 280 |
| 819 | 3300046674 | Ga0495588_0038172 | Ga0495588_0038172_1405_2247 | 280 |
| 820 | 3300046794 | Ga0495589_0045844 | Ga0495589_0045844_631_1473 | 280 |
| 821 | 3300046809 | Ga0495600_0031813 | Ga0495600_0031813_114_956 | 280 |
| 822 | 3300047317 | Ga0495604_0322288 | Ga0495604_0322288_114_956 | 280 |
| 823 | 3300047319 | Ga0495674_0261849 | Ga0495674_0261849_257_1099 | 280 |
| 824 | 3300047472 | Ga0495686_0000796 | Ga0495686_0000796_18176_19018 | 280 |
| 825 | 3300047472 | Ga0495686_0006004 | Ga0495686_0006004_3800_4642 | 280 |
| 826 | 3300047472 | Ga0495686_0009754 | Ga0495686_0009754_5830_6672 | 280 |
| 827 | 3300048088 | Ga0495602_0294564 | Ga0495602_0294564_27_869 | 280 |
| 828 | 3300048090 | Ga0495615_0053191 | Ga0495615_0053191_164_1006 | 280 |
| 829 | 3300048903 | Ga0496100_0203515 | Ga0496100_0203515_83_925 | 280 |
| 830 | 3300048904 | Ga0496101_0018868 | Ga0496101_0018868_842_1684 | 280 |
| 831 | 3300048907 | Ga0496104_0261715 | Ga0496104_0261715_227_1069 | 280 |
| 832 | 3300048908 | Ga0496105_0210137 | Ga0496105_0210137_553_1395 | 280 |
| 833 | 3300048911 | Ga0496108_0659317 | Ga0496108_0659317_19_861 | 280 |
| 834 | 3300048913 | Ga0496110_0025054 | Ga0496110_0025054_3977_4819 | 280 |
| 835 | 3300048914 | Ga0496111_0022201 | Ga0496111_0022201_402_1244 | 280 |
| 836 | 3300048917 | Ga0496114_0262734 | Ga0496114_0262734_103_945 | 280 |
| 837 | 3300048919 | Ga0496116_0021891 | Ga0496116_0021891_3415_4257 | 280 |
| 838 | 3300048922 | Ga0496119_0020529 | Ga0496119_0020529_3392_4234 | 280 |
| 839 | 3300048924 | Ga0496121_0029249 | Ga0496121_0029249_1901_2743 | 280 |
| 840 | 3300048924 | Ga0496121_0201167 | Ga0496121_0201167_515_1357 | 280 |
| 841 | 3300048925 | Ga0496122_0028477 | Ga0496122_0028477_3494_4336 | 280 |
| 842 | 3300048926 | Ga0496123_0024065 | Ga0496123_0024065_441_1283 | 280 |
| 843 | 3300048927 | Ga0496124_0000687 | Ga0496124_0000687_43412_44254 | 280 |
| 844 | 3300048927 | Ga0496124_0150157 | Ga0496124_0150157_198_1040 | 280 |
| 845 | 3300048928 | Ga0496125_0027274 | Ga0496125_0027274_834_1676 | 280 |
| 846 | 3300048929 | Ga0496126_0002636 | Ga0496126_0002636_15517_16362 | 280 |
| 847 | 3300048929 | Ga0496126_0057510 | Ga0496126_0057510_2092_2934 | 280 |
| 848 | 3300049459 | Ga0495678_010175 | Ga0495678_010175_574_1416 | 280 |
| 849 | 3300049584 | Ga0501068_0031640 | Ga0501068_0031640_653_1498 | 280 |
| 850 | 3300049585 | Ga0501069_0157026 | Ga0501069_0157026_62_907 | 280 |
| 851 | 3300049589 | Ga0501073_0135613 | Ga0501073_0135613_422_1267 | 280 |
| 852 | 3300049822 | Ga0501035_0000927 | Ga0501035_0000927_6434_7279 | 280 |
| 853 | 3300053148 | Ga0500590_002326 | Ga0500590_002326_4256_5098 | 280 |
| 854 | 3300053158 | Ga0500627_0164150 | Ga0500627_0164150_55_903 | 280 |
| 855 | 3300053177 | Ga0500636_0043214 | Ga0500636_0043214_869_1711 | 280 |
| 856 | 3300005546 | Ga0070696_100252058 | Ga0070696_1002520582 | 281 |
| 857 | 3300036647 | Ga0316582_0181328 | Ga0316582_0181328_449_1300 | 281 |
| 858 | 3300042436 | Ga0439435_0000469 | Ga0439435_0000469_2112_2972 | 281 |
| 859 | iso_pu_bacteria | 2671180139 | 2671694834 | 281 |
| 860 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_1000001201 | 282 |
| 861 | 3300002737 | JGI25162J39368_1000274 | JGI25162J39368_10002746 | 282 |
| 862 | 3300002737 | JGI25162J39368_1003049 | JGI25162J39368_10030493 | 282 |
| 863 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_1000011182 | 282 |
| 864 | 3300002741 | JGI25157J39369_1000030 | JGI25157J39369_10000303 | 282 |
| 865 | 3300002773 | JGI25152J39213_1007081 | JGI25152J39213_10070813 | 282 |
| 866 | 3300002987 | JGI25159J45721_1000782 | JGI25159J45721_100078212 | 282 |
| 867 | 3300002987 | JGI25159J45721_1001080 | JGI25159J45721_100108011 | 282 |
| 868 | 3300003187 | JGI25151J46595_10025737 | JGI25151J46595_100257372 | 282 |
| 869 | 3300003214 | JGI25165J46597_1000337 | JGI25165J46597_10003375 | 282 |
| 870 | 3300003214 | JGI25165J46597_1000696 | JGI25165J46597_10006965 | 282 |
| 871 | 3300003215 | JGI25153J46596_10001886 | JGI25153J46596_1000188610 | 282 |
| 872 | 3300003215 | JGI25153J46596_10012130 | JGI25153J46596_100121303 | 282 |
| 873 | 3300003215 | JGI25153J46596_10012137 | JGI25153J46596_100121373 | 282 |
| 874 | 3300003322 | rootL2_10009459 | rootL2_100094599 | 282 |
| 875 | 3300003354 | JGI25160J50197_1000087 | JGI25160J50197_100008764 | 282 |
| 876 | 3300003374 | JGI25161J50226_1000066 | JGI25161J50226_100006632 | 282 |
| 877 | 3300003374 | JGI25161J50226_1000138 | JGI25161J50226_100013849 | 282 |
| 878 | 3300003771 | Ga0055526_1015057 | Ga0055526_10150574 | 282 |
| 879 | 3300003790 | Ga0055528_1005314 | Ga0055528_10053149 | 282 |
| 880 | 3300003792 | Ga0055540_1006491 | Ga0055540_10064914 | 282 |
| 881 | 3300003856 | Ga0058692_1014329 | Ga0058692_10143291 | 282 |
| 882 | 3300004625 | Ga0055543_1000053 | Ga0055543_100005380 | 282 |
| 883 | 3300004625 | Ga0055543_1000068 | Ga0055543_100006864 | 282 |
| 884 | 3300005262 | Ga0065165_1000839 | Ga0065165_100083932 | 282 |
| 885 | 3300005262 | Ga0065165_1006285 | Ga0065165_10062853 | 282 |
| 886 | 3300005367 | Ga0070667_100642758 | Ga0070667_1006427581 | 282 |
| 887 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005715 | 282 |
| 888 | 3300009545 | Ga0105237_10000766 | Ga0105237_1000076622 | 282 |
| 889 | 3300010375 | Ga0105239_10001069 | Ga0105239_100010696 | 282 |
| 890 | 3300013104 | Ga0157370_10000046 | Ga0157370_1000004661 | 282 |
| 891 | 3300013105 | Ga0157369_10385871 | Ga0157369_103858712 | 282 |
| 892 | 3300015262 | Ga0182007_10002120 | Ga0182007_100021205 | 282 |
| 893 | 3300015265 | Ga0182005_1004429 | Ga0182005_10044292 | 282 |
| 894 | 3300025206 | Ga0209435_100012 | Ga0209435_100012181 | 282 |
| 895 | 3300025233 | Ga0209437_100047 | Ga0209437_100047111 | 282 |
| 896 | 3300025233 | Ga0209437_100165 | Ga0209437_1001659 | 282 |
| 897 | 3300025245 | Ga0207425_1002614 | Ga0207425_10026143 | 282 |
| 898 | 3300025245 | Ga0207425_1012443 | Ga0207425_10124432 | 282 |
| 899 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026181 | 282 |
| 900 | 3300025246 | Ga0209646_1004329 | Ga0209646_10043292 | 282 |
| 901 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014181 | 282 |
| 902 | 3300025253 | Ga0209677_100811 | Ga0209677_1008112 | 282 |
| 903 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012181 | 282 |
| 904 | 3300025258 | Ga0209129_1003533 | Ga0209129_10035334 | 282 |
| 905 | 3300025258 | Ga0209129_1003776 | Ga0209129_10037769 | 282 |
| 906 | 3300025258 | Ga0209129_1004343 | Ga0209129_10043436 | 282 |
| 907 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048291 | 282 |
| 908 | 3300025261 | Ga0209233_1000069 | Ga0209233_1000069139 | 282 |
| 909 | 3300025261 | Ga0209233_1000257 | Ga0209233_100025763 | 282 |
| 910 | 3300025273 | Ga0209673_1006371 | Ga0209673_10063716 | 282 |
| 911 | 3300025284 | Ga0209130_1000021 | Ga0209130_1000021293 | 282 |
| 912 | 3300025284 | Ga0209130_1000081 | Ga0209130_100008110 | 282 |
| 913 | 3300025294 | Ga0209025_1016503 | Ga0209025_10165034 | 282 |
| 914 | 3300025295 | Ga0209564_1000260 | Ga0209564_100026031 | 282 |
| 915 | 3300025297 | Ga0209758_1000961 | Ga0209758_100096110 | 282 |
| 916 | 3300025297 | Ga0209758_1003274 | Ga0209758_10032745 | 282 |
| 917 | 3300025297 | Ga0209758_1003835 | Ga0209758_10038356 | 282 |
| 918 | 3300025299 | Ga0209256_1003038 | Ga0209256_100303810 | 282 |
| 919 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008490 | 282 |
| 920 | 3300025302 | Ga0207426_1000010 | Ga0207426_100001065 | 282 |
| 921 | 3300025304 | Ga0209257_1025688 | Ga0209257_10256883 | 282 |
| 922 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011202 | 282 |
| 923 | 3300025914 | Ga0207671_10000241 | Ga0207671_100002419 | 282 |
| 924 | 3300027312 | Ga0209371_1004493 | Ga0209371_10044932 | 282 |
| 925 | 3300028379 | Ga0268266_10313698 | Ga0268266_103136981 | 282 |
| 926 | 3300030500 | Ga0268256_1004316 | Ga0268256_10043162 | 282 |
| 927 | 3300041413 | Ga0439465_0019336 | Ga0439465_0019336_999_1847 | 282 |
| 928 | 3300045976 | Ga0466967_0521347 | Ga0466967_0521347_148_996 | 282 |
| 929 | 3300046506 | Ga0495583_0016652 | Ga0495583_0016652_412_1260 | 282 |
| 930 | 3300046694 | Ga0495649_0100101 | Ga0495649_0100101_15_863 | 282 |
| 931 | 3300048903 | Ga0496100_0142905 | Ga0496100_0142905_316_1164 | 282 |
| 932 | 3300048905 | Ga0496102_0006068 | Ga0496102_0006068_4635_5483 | 282 |
| 933 | 3300048906 | Ga0496103_0008717 | Ga0496103_0008717_4548_5396 | 282 |
| 934 | 3300048909 | Ga0496106_0000658 | Ga0496106_0000658_12878_13726 | 282 |
| 935 | 3300048920 | Ga0496117_0000353 | Ga0496117_0000353_8091_8939 | 282 |
| 936 | 3300048921 | Ga0496118_0000204 | Ga0496118_0000204_33443_34291 | 282 |
| 937 | 3300048921 | Ga0496118_0047464 | Ga0496118_0047464_307_1155 | 282 |
| 938 | 3300048922 | Ga0496119_0013782 | Ga0496119_0013782_727_1575 | 282 |
| 939 | 3300048922 | Ga0496119_0015557 | Ga0496119_0015557_726_1574 | 282 |
| 940 | 3300048923 | Ga0496120_0037801 | Ga0496120_0037801_1854_2702 | 282 |
| 941 | 3300048923 | Ga0496120_0048116 | Ga0496120_0048116_255_1103 | 282 |
| 942 | 3300048924 | Ga0496121_0000378 | Ga0496121_0000378_81014_81862 | 282 |
| 943 | 3300048924 | Ga0496121_0038184 | Ga0496121_0038184_2639_3487 | 282 |
| 944 | 3300048924 | Ga0496121_0306743 | Ga0496121_0306743_40_888 | 282 |
| 945 | 3300048925 | Ga0496122_0014776 | Ga0496122_0014776_1269_2117 | 282 |
| 946 | 3300048925 | Ga0496122_0020665 | Ga0496122_0020665_744_1592 | 282 |
| 947 | 3300048926 | Ga0496123_0007623 | Ga0496123_0007623_8707_9555 | 282 |
| 948 | 3300048926 | Ga0496123_0013544 | Ga0496123_0013544_4961_5809 | 282 |
| 949 | 3300048927 | Ga0496124_0027025 | Ga0496124_0027025_293_1141 | 282 |
| 950 | 3300048927 | Ga0496124_0116439 | Ga0496124_0116439_515_1363 | 282 |
| 951 | 3300048928 | Ga0496125_0018120 | Ga0496125_0018120_4535_5383 | 282 |
| 952 | 3300048928 | Ga0496125_0019265 | Ga0496125_0019265_908_1756 | 282 |
| 953 | 3300048929 | Ga0496126_0063346 | Ga0496126_0063346_483_1331 | 282 |
| 954 | 3300053093 | Ga0500651_0031083 | Ga0500651_0031083_771_1619 | 282 |
| 955 | 3300053125 | Ga0500618_002874 | Ga0500618_002874_1883_2731 | 282 |
| 956 | 3300053134 | Ga0500658_0007741 | Ga0500658_0007741_2030_2878 | 282 |
| 957 | 3300053139 | Ga0500568_0015244 | Ga0500568_0015244_1368_2216 | 282 |
| 958 | 3300053156 | Ga0500622_0006163 | Ga0500622_0006163_753_1601 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s4d-assembly1.cif.gz_A | crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt | 0.9669 | 8 | 268 |
| 1s4d-assembly4.cif.gz_H | crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt | 0.9668 | 8 | 270 |
| 1s4d-assembly6.cif.gz_M | crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt | 0.9656 | 10 | 268 |
| 1s4d-assembly5.cif.gz_J | crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt | 0.9636 | 8 | 268 |
| 1s4d-assembly3.cif.gz_F | crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt | 0.9626 | 8 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s4dH02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9925 | 130 | 270 | 3.30.950.10 |
| 1s4dH02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9779 | 130 | 270 | 3.30.950.10 |
| 1s4dE01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9521 | 6 | 129 | 3.40.1010.10 |
| af_I6X5I7_276_403_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9303 | 132 | 251 | 3.30.950.10 |
| 1s4dE01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.93 | 6 | 129 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J4N8S3-F1-model_v4 | Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) | 0.9803 | 165 | 252 |
GO:0004851
GO:0019354 GO:0032259 |
| AF-A0A7K4NN19-F1-model_v4 | Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) | 0.9757 | 169 | 257 |
GO:0004851
GO:0019354 GO:0032259 |
| AF-A0A3D5JMN9-F1-model_v4 | deleted | 0.9735 | 179 | 262 |
|
| AF-A0A256GSE8-F1-model_v4 | uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) | 0.9668 | 9 | 267 |
GO:0004851
GO:0019354 GO:0032259 |
| AF-B1HRE5-F1-model_v4 | Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) | 0.9663 | 168 | 262 |
GO:0004851
GO:0016020 GO:0019354 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar