F486753
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 956 | 575 | 749 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0066313|Ga0495686_0066313_646_1548 |
| Length | 300 |
| Sequence | LRPLKEISSGGKGSDIGISIRRCRVLLGNVMPSELRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNARSRGWADILSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEHKTPESFRQACRRFVYTENLLAGTANTQDAGSRSTPLQPHDAATPIIKKVITQMESEDGWVTLGEVGRQLANLASDFDPRTFGFRKLSDLVRKTNSFEIDESKGRSMRIRVKPAAAPPPRTRNPRRPAARPSRSGPAGGPAPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 15 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 20 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 21 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 22 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 23 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 24 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 25 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 26 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 27 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 28 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 29 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 30 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 31 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 32 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 33 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 34 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 35 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 36 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 37 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 38 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 41 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 42 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 43 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 44 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 45 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 46 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 47 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 48 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 60 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 67 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 68 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 69 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 70 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 71 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 72 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 73 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 74 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 75 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 76 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 77 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 78 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 79 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 80 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 81 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 82 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 83 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 84 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 85 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 86 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 87 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 88 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 89 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 90 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 91 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 92 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 93 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 94 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 95 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 96 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 97 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 98 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 103 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 104 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 105 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 106 | 2922368715 | |||
| 107 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 108 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 109 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 110 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 111 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 112 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 113 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 114 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 115 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 116 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 117 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 118 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 119 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 120 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 121 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 122 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 123 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 124 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 125 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 126 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 127 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 128 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 129 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 130 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 131 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 132 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 133 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 134 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 135 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 136 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 137 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 138 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 139 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 140 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 141 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 142 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 143 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 144 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 145 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 146 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 147 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 148 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 149 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 150 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 151 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 152 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 153 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 154 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 155 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 156 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 157 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 158 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 159 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 160 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 161 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 162 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 163 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 164 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 165 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 166 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 167 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 168 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 169 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 170 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 171 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 172 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 173 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 174 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 175 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 176 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 177 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 178 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 179 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 180 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 181 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 182 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 183 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 184 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 185 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 186 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 187 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 188 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 189 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 190 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 193 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 194 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 196 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 197 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 201 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 213 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 218 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 221 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 222 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 223 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 224 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 225 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 226 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 227 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 228 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 229 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 230 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 231 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 232 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 233 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 234 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 235 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 237 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 238 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 239 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 240 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 241 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 243 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 244 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 245 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 246 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 248 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 249 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 250 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 251 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 252 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 253 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 255 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 266 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 278 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 281 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 282 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 284 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 285 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 290 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 293 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 295 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 297 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 357 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 358 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 359 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 360 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 361 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 362 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 363 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 365 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 366 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 367 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 368 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 369 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 370 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 371 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 372 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 373 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 374 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 375 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 376 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 377 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 378 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 379 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 380 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 381 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 382 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 383 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 384 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 385 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 386 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 387 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 388 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 389 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 390 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 391 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 460 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 461 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 462 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 463 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 464 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 465 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 468 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 469 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 470 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 471 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 472 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 473 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 474 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 475 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 476 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 477 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 478 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 479 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 480 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 481 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 482 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 494 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 496 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 497 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 498 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 502 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 503 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 506 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 507 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 509 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 510 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 515 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 516 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 517 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 519 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 520 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 521 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 522 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 524 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 525 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 526 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 528 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 529 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 530 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 533 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 534 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 535 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 539 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 540 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 541 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 542 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 543 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 544 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 545 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 546 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 547 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 548 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 549 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 550 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 551 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 552 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 553 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 554 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 555 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 556 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 557 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 558 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 559 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 560 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 561 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 562 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 563 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 564 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 565 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 566 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 567 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 568 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 569 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 570 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 571 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 572 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 573 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 574 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 575 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.32 |
| Metatranscriptomes | 0.1 |
| Isolates | 21.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.85 |
| Nodule | 16.42 |
| Rhizoplane | 4.92 |
| Rhizosphere | 50.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1010478 | 3300001904 | Bacteria | 1513 |
| 2 | JGI24740J21852_10009539 | 3300001979 | Bacteria | 3793 |
| 3 | JGI24740J21852_10018129 | 3300001979 | Bacteria | 2505 |
| 4 | JGI24740J21852_10043019 | 3300001979 | Bacteria | 1349 |
| 5 | JGI24740J21852_10053524 | 3300001979 | Bacteria | 1144 |
| 6 | JGI24739J22299_10045881 | 3300001989 | Bacteria | 1432 |
| 7 | JGI24739J22299_10070700 | 3300001989 | Bacteria | 1086 |
| 8 | JGI24737J22298_10041879 | 3300001990 | Bacteria | 1404 |
| 9 | JGI24735J21928_10050971 | 3300002067 | Bacteria | 1195 |
| 10 | JGI24738J21930_10021365 | 3300002075 | Bacteria | 1342 |
| 11 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 12 | JGI25153J46596_10002640 | 3300003215 | Bacteria | 10246 |
| 13 | JGI25153J46596_10006320 | 3300003215 | Bacteria | 6030 |
| 14 | JGI25153J46596_10008296 | 3300003215 | Bacteria | 4986 |
| 15 | rootL2_10177720 | 3300003322 | Bacteria | 1472 |
| 16 | JGI25160J50197_1000826 | 3300003354 | Bacteria | 16549 |
| 17 | JGI25160J50197_1012801 | 3300003354 | Bacteria | 2890 |
| 18 | JGI25404J52841_10011078 | 3300003659 | Bacteria | 1941 |
| 19 | JGI25404J52841_10039595 | 3300003659 | Bacteria | 998 |
| 20 | Ga0055528_1000544 | 3300003790 | Bacteria | 28745 |
| 21 | Ga0065165_1000953 | 3300005262 | Bacteria | 36442 |
| 22 | Ga0065165_1002778 | 3300005262 | Bacteria | 13850 |
| 23 | Ga0065165_1016141 | 3300005262 | Bacteria | 2810 |
| 24 | Ga0070658_10328052 | 3300005327 | Bacteria | 1307 |
| 25 | Ga0070658_10492434 | 3300005327 | Bacteria | 1058 |
| 26 | Ga0070676_10083914 | 3300005328 | Bacteria | 1939 |
| 27 | Ga0070676_10085855 | 3300005328 | Bacteria | 1919 |
| 28 | Ga0070683_100007383 | 3300005329 | Bacteria | 9286 |
| 29 | Ga0070683_100031653 | 3300005329 | Bacteria | 4813 |
| 30 | Ga0068869_100188815 | 3300005334 | Bacteria | 1619 |
| 31 | Ga0068869_100480231 | 3300005334 | Bacteria | 1035 |
| 32 | Ga0068869_100586891 | 3300005334 | Bacteria | 940 |
| 33 | Ga0070666_10086242 | 3300005335 | Bacteria | 2151 |
| 34 | Ga0070680_100531114 | 3300005336 | Bacteria | 1007 |
| 35 | Ga0070682_100058791 | 3300005337 | Bacteria | 2425 |
| 36 | Ga0070682_100313768 | 3300005337 | Bacteria | 1155 |
| 37 | Ga0070660_100111058 | 3300005339 | Bacteria | 2181 |
| 38 | Ga0070668_100138585 | 3300005347 | Bacteria | 1959 |
| 39 | Ga0070669_100058680 | 3300005353 | Bacteria | 2824 |
| 40 | Ga0070688_100269133 | 3300005365 | Bacteria | 1220 |
| 41 | Ga0070659_100088026 | 3300005366 | Bacteria | 2487 |
| 42 | Ga0070667_100056373 | 3300005367 | Bacteria | 3319 |
| 43 | Ga0070709_10036716 | 3300005434 | Bacteria | 2987 |
| 44 | Ga0070709_10307754 | 3300005434 | Bacteria | 1159 |
| 45 | Ga0070714_100002584 | 3300005435 | Bacteria | 13346 |
| 46 | Ga0070714_100585084 | 3300005435 | Bacteria | 1071 |
| 47 | Ga0070713_100086394 | 3300005436 | Bacteria | 2689 |
| 48 | Ga0070710_10000501 | 3300005437 | Bacteria | 18393 |
| 49 | Ga0070710_10183781 | 3300005437 | Bacteria | 1311 |
| 50 | Ga0070710_10476192 | 3300005437 | Bacteria | 851 |
| 51 | Ga0070701_10033118 | 3300005438 | Bacteria | 2580 |
| 52 | Ga0070711_100044952 | 3300005439 | Bacteria | 3000 |
| 53 | Ga0070663_100021296 | 3300005455 | Bacteria | 4309 |
| 54 | Ga0070663_100027618 | 3300005455 | Bacteria | 3855 |
| 55 | Ga0070663_100079555 | 3300005455 | Bacteria | 2405 |
| 56 | Ga0070663_100312237 | 3300005455 | Bacteria | 1262 |
| 57 | Ga0070678_100086429 | 3300005456 | Bacteria | 2392 |
| 58 | Ga0070678_100198686 | 3300005456 | Bacteria | 1654 |
| 59 | Ga0070662_100023894 | 3300005457 | Bacteria | 4205 |
| 60 | Ga0070662_100089686 | 3300005457 | Bacteria | 2307 |
| 61 | Ga0070681_10033499 | 3300005458 | Bacteria | 5157 |
| 62 | Ga0070681_10182527 | 3300005458 | Bacteria | 2019 |
| 63 | Ga0070698_100736491 | 3300005471 | Bacteria | 929 |
| 64 | Ga0070699_100384408 | 3300005518 | Bacteria | 1268 |
| 65 | Ga0070679_100092244 | 3300005530 | Bacteria | 3016 |
| 66 | Ga0070679_100334912 | 3300005530 | Bacteria | 1462 |
| 67 | Ga0070684_100002474 | 3300005535 | Bacteria | 13604 |
| 68 | Ga0068853_100001742 | 3300005539 | Bacteria | 15948 |
| 69 | Ga0068853_100013884 | 3300005539 | Bacteria | 6585 |
| 70 | Ga0068853_100099647 | 3300005539 | Bacteria | 2567 |
| 71 | Ga0068853_100147807 | 3300005539 | Bacteria | 2113 |
| 72 | Ga0068853_100267441 | 3300005539 | Bacteria | 1573 |
| 73 | Ga0070672_100328535 | 3300005543 | Bacteria | 1301 |
| 74 | Ga0070665_100046083 | 3300005548 | Bacteria | 4379 |
| 75 | Ga0070665_100069708 | 3300005548 | Bacteria | 3524 |
| 76 | Ga0070665_100427743 | 3300005548 | Bacteria | 1333 |
| 77 | Ga0068855_100075640 | 3300005563 | Bacteria | 3909 |
| 78 | Ga0068855_100150914 | 3300005563 | Bacteria | 2642 |
| 79 | Ga0068857_100036325 | 3300005577 | Bacteria | 4365 |
| 80 | Ga0068857_100418811 | 3300005577 | Bacteria | 1248 |
| 81 | Ga0068857_100457678 | 3300005577 | Bacteria | 1194 |
| 82 | Ga0068854_100039271 | 3300005578 | Bacteria | 3334 |
| 83 | Ga0068854_100056832 | 3300005578 | Bacteria | 2821 |
| 84 | Ga0068854_100321297 | 3300005578 | Bacteria | 1258 |
| 85 | Ga0068856_100012955 | 3300005614 | Bacteria | 8074 |
| 86 | Ga0068856_100322481 | 3300005614 | Bacteria | 1562 |
| 87 | Ga0068856_100327042 | 3300005614 | Bacteria | 1551 |
| 88 | Ga0068856_100477409 | 3300005614 | Bacteria | 1268 |
| 89 | Ga0068856_100818653 | 3300005614 | Bacteria | 951 |
| 90 | Ga0068852_100073636 | 3300005616 | Bacteria | 3005 |
| 91 | Ga0068852_100328306 | 3300005616 | Bacteria | 1488 |
| 92 | Ga0068852_100602969 | 3300005616 | Bacteria | 1102 |
| 93 | Ga0068859_100176840 | 3300005617 | Bacteria | 2216 |
| 94 | Ga0068859_100248636 | 3300005617 | Bacteria | 1868 |
| 95 | Ga0068859_100534830 | 3300005617 | Bacteria | 1267 |
| 96 | Ga0068864_100452028 | 3300005618 | Bacteria | 1229 |
| 97 | Ga0068861_100009251 | 3300005719 | Bacteria | 6797 |
| 98 | Ga0068861_100050478 | 3300005719 | Bacteria | 3154 |
| 99 | Ga0068861_100266140 | 3300005719 | Bacteria | 1470 |
| 100 | Ga0068861_100445797 | 3300005719 | Bacteria | 1159 |
| 101 | Ga0068851_10046400 | 3300005834 | Bacteria | 2197 |
| 102 | Ga0068851_10183348 | 3300005834 | Bacteria | 1160 |
| 103 | Ga0068863_100202527 | 3300005841 | Bacteria | 1910 |
| 104 | Ga0068858_100061887 | 3300005842 | Bacteria | 3460 |
| 105 | Ga0068858_100624858 | 3300005842 | Bacteria | 1046 |
| 106 | Ga0068860_100000217 | 3300005843 | Bacteria | 90245 |
| 107 | Ga0068860_100034329 | 3300005843 | Bacteria | 4864 |
| 108 | Ga0068862_100013908 | 3300005844 | Bacteria | 6671 |
| 109 | Ga0068862_100044093 | 3300005844 | Bacteria | 3804 |
| 110 | Ga0068862_100112279 | 3300005844 | Bacteria | 2393 |
| 111 | Ga0068862_100194527 | 3300005844 | Bacteria | 1826 |
| 112 | Ga0081455_10136729 | 3300005937 | Bacteria | 1909 |
| 113 | Ga0081540_1006420 | 3300005983 | Bacteria | 8561 |
| 114 | Ga0081540_1009150 | 3300005983 | Bacteria | 6836 |
| 115 | Ga0081540_1009188 | 3300005983 | Bacteria | 6819 |
| 116 | Ga0081540_1058566 | 3300005983 | Bacteria | 1855 |
| 117 | Ga0081540_1061289 | 3300005983 | Bacteria | 1794 |
| 118 | Ga0081540_1107676 | 3300005983 | Bacteria | 1186 |
| 119 | Ga0070717_10223502 | 3300006028 | Bacteria | 1656 |
| 120 | Ga0070717_10567823 | 3300006028 | Bacteria | 1028 |
| 121 | Ga0075365_10093101 | 3300006038 | Bacteria | 2055 |
| 122 | Ga0075365_10094729 | 3300006038 | Bacteria | 2038 |
| 123 | Ga0075365_10133614 | 3300006038 | Bacteria | 1718 |
| 124 | Ga0075365_10143954 | 3300006038 | Bacteria | 1655 |
| 125 | Ga0075368_10018440 | 3300006042 | Bacteria | 2622 |
| 126 | Ga0075368_10098687 | 3300006042 | Bacteria | 1198 |
| 127 | Ga0075363_100061669 | 3300006048 | Bacteria | 2021 |
| 128 | Ga0075363_100077582 | 3300006048 | Bacteria | 1813 |
| 129 | Ga0075364_10064214 | 3300006051 | Bacteria | 2410 |
| 130 | Ga0075364_10165551 | 3300006051 | Bacteria | 1494 |
| 131 | Ga0070716_100001649 | 3300006173 | Bacteria | 10072 |
| 132 | Ga0070712_100270628 | 3300006175 | Bacteria | 1364 |
| 133 | Ga0075362_10007812 | 3300006177 | Bacteria | 4067 |
| 134 | Ga0075362_10169015 | 3300006177 | Bacteria | 1056 |
| 135 | Ga0075367_10021221 | 3300006178 | Bacteria | 3627 |
| 136 | Ga0075369_10011058 | 3300006186 | Bacteria | 3541 |
| 137 | Ga0075366_10069715 | 3300006195 | Bacteria | 2093 |
| 138 | Ga0075366_10089603 | 3300006195 | Bacteria | 1843 |
| 139 | Ga0075366_10132388 | 3300006195 | Bacteria | 1505 |
| 140 | Ga0075366_10153173 | 3300006195 | Bacteria | 1396 |
| 141 | Ga0097621_100056820 | 3300006237 | Bacteria | 3198 |
| 142 | Ga0075370_10003227 | 3300006353 | Bacteria | 7718 |
| 143 | Ga0075370_10012524 | 3300006353 | Bacteria | 4485 |
| 144 | Ga0068871_100281926 | 3300006358 | Bacteria | 1454 |
| 145 | Ga0068871_100286171 | 3300006358 | Bacteria | 1443 |
| 146 | Ga0068871_100398121 | 3300006358 | Bacteria | 1226 |
| 147 | Ga0075428_100041687 | 3300006844 | Bacteria | 5046 |
| 148 | Ga0075428_100196785 | 3300006844 | Bacteria | 2180 |
| 149 | Ga0075428_100645452 | 3300006844 | Bacteria | 1129 |
| 150 | Ga0075431_100642590 | 3300006847 | Bacteria | 1042 |
| 151 | Ga0075434_100115025 | 3300006871 | Bacteria | 2703 |
| 152 | Ga0075434_100172071 | 3300006871 | Bacteria | 2186 |
| 153 | Ga0068865_100159767 | 3300006881 | Bacteria | 1718 |
| 154 | Ga0068865_100316578 | 3300006881 | Bacteria | 1254 |
| 155 | Ga0097620_100176845 | 3300006931 | Bacteria | 2216 |
| 156 | Ga0097620_100248637 | 3300006931 | Bacteria | 1868 |
| 157 | Ga0097620_100534810 | 3300006931 | Bacteria | 1267 |
| 158 | Ga0099794_10023859 | 3300007265 | Bacteria | 2802 |
| 159 | Ga0105240_10000336 | 3300009093 | Bacteria | 87900 |
| 160 | Ga0105240_10003411 | 3300009093 | Bacteria | 24689 |
| 161 | Ga0105240_10465850 | 3300009093 | Bacteria | 1411 |
| 162 | Ga0111539_10167067 | 3300009094 | Bacteria | 2572 |
| 163 | Ga0105245_10160454 | 3300009098 | Bacteria | 2133 |
| 164 | Ga0105247_10008005 | 3300009101 | Bacteria | 6458 |
| 165 | Ga0105247_10132294 | 3300009101 | Bacteria | 1627 |
| 166 | Ga0105243_10085956 | 3300009148 | Bacteria | 2579 |
| 167 | Ga0105241_10013101 | 3300009174 | Bacteria | 6082 |
| 168 | Ga0105241_10082829 | 3300009174 | Bacteria | 2515 |
| 169 | Ga0105241_10143174 | 3300009174 | Bacteria | 1949 |
| 170 | Ga0105241_10406186 | 3300009174 | Bacteria | 1196 |
| 171 | Ga0105248_10009311 | 3300009177 | Bacteria | 10814 |
| 172 | Ga0105248_10014838 | 3300009177 | Bacteria | 8582 |
| 173 | Ga0105248_10039164 | 3300009177 | Bacteria | 5308 |
| 174 | Ga0105248_10153724 | 3300009177 | Bacteria | 2596 |
| 175 | Ga0105237_10000690 | 3300009545 | Bacteria | 46704 |
| 176 | Ga0105237_10056017 | 3300009545 | Bacteria | 3947 |
| 177 | Ga0105237_10059464 | 3300009545 | Bacteria | 3823 |
| 178 | Ga0105237_10066120 | 3300009545 | Bacteria | 3610 |
| 179 | Ga0105237_10088873 | 3300009545 | Bacteria | 3079 |
| 180 | Ga0105237_10183098 | 3300009545 | Bacteria | 2095 |
| 181 | Ga0105237_10250188 | 3300009545 | Bacteria | 1774 |
| 182 | Ga0105237_10310279 | 3300009545 | Bacteria | 1581 |
| 183 | Ga0105237_10430544 | 3300009545 | Bacteria | 1325 |
| 184 | Ga0105238_10005788 | 3300009551 | Bacteria | 12235 |
| 185 | Ga0105238_10007078 | 3300009551 | Bacteria | 11224 |
| 186 | Ga0105238_10202980 | 3300009551 | Bacteria | 1958 |
| 187 | Ga0105238_10275551 | 3300009551 | Bacteria | 1663 |
| 188 | Ga0105238_10339591 | 3300009551 | Bacteria | 1490 |
| 189 | Ga0105238_10551698 | 3300009551 | Bacteria | 1157 |
| 190 | Ga0105249_10019015 | 3300009553 | Bacteria | 6126 |
| 191 | Ga0105249_10393375 | 3300009553 | Bacteria | 1415 |
| 192 | Ga0105249_10711666 | 3300009553 | Bacteria | 1065 |
| 193 | Ga0099796_10084012 | 3300010159 | Bacteria | 1172 |
| 194 | Ga0105239_10006751 | 3300010375 | Bacteria | 13254 |
| 195 | Ga0105239_10008236 | 3300010375 | Bacteria | 11890 |
| 196 | Ga0105239_10070772 | 3300010375 | Bacteria | 3832 |
| 197 | Ga0105239_10375310 | 3300010375 | Bacteria | 1607 |
| 198 | Ga0105239_10381665 | 3300010375 | Bacteria | 1593 |
| 199 | Ga0105239_10383971 | 3300010375 | Bacteria | 1588 |
| 200 | Ga0105239_10461945 | 3300010375 | Bacteria | 1441 |
| 201 | Ga0105239_10712954 | 3300010375 | Bacteria | 1147 |
| 202 | Ga0105239_10957680 | 3300010375 | Bacteria | 983 |
| 203 | Ga0105246_10121974 | 3300011119 | Bacteria | 1933 |
| 204 | Ga0105246_10426055 | 3300011119 | Bacteria | 1109 |
| 205 | Ga0157370_10006306 | 3300013104 | Bacteria | 13106 |
| 206 | Ga0157369_10118453 | 3300013105 | Bacteria | 2810 |
| 207 | Ga0157369_10155960 | 3300013105 | Bacteria | 2411 |
| 208 | Ga0157374_10371927 | 3300013296 | Bacteria | 1423 |
| 209 | Ga0157378_10126465 | 3300013297 | Bacteria | 2361 |
| 210 | Ga0157378_10207621 | 3300013297 | Bacteria | 1856 |
| 211 | Ga0163162_10038979 | 3300013306 | Bacteria | 4744 |
| 212 | Ga0163162_10194801 | 3300013306 | Bacteria | 2155 |
| 213 | Ga0163162_10370534 | 3300013306 | Bacteria | 1565 |
| 214 | Ga0157372_10138050 | 3300013307 | Bacteria | 2808 |
| 215 | Ga0157372_10737478 | 3300013307 | Bacteria | 1146 |
| 216 | Ga0157375_10249707 | 3300013308 | Bacteria | 1935 |
| 217 | Ga0157375_10409895 | 3300013308 | Bacteria | 1521 |
| 218 | Ga0157375_10595262 | 3300013308 | Bacteria | 1265 |
| 219 | Ga0163163_10108583 | 3300014325 | Bacteria | 2802 |
| 220 | Ga0163163_10546596 | 3300014325 | Bacteria | 1221 |
| 221 | Ga0157380_10030487 | 3300014326 | Bacteria | 4131 |
| 222 | Ga0157380_10089716 | 3300014326 | Bacteria | 2534 |
| 223 | Ga0182008_10020976 | 3300014497 | Bacteria | 3360 |
| 224 | Ga0182008_10041989 | 3300014497 | Bacteria | 2279 |
| 225 | Ga0157379_10341744 | 3300014968 | Bacteria | 1369 |
| 226 | Ga0157376_10402613 | 3300014969 | Bacteria | 1324 |
| 227 | Ga0182007_10037005 | 3300015262 | Bacteria | 1640 |
| 228 | Ga0182007_10054633 | 3300015262 | Bacteria | 1313 |
| 229 | Ga0182005_1005352 | 3300015265 | Bacteria | 4021 |
| 230 | Ga0163161_10189762 | 3300017792 | Bacteria | 1579 |
| 231 | Ga0214543_1003759 | 3300021327 | Bacteria | 29285 |
| 232 | Ga0213876_10060936 | 3300021384 | Bacteria | 1991 |
| 233 | Ga0209563_102799 | 3300025230 | Bacteria | 3815 |
| 234 | Ga0209437_107178 | 3300025233 | Bacteria | 1825 |
| 235 | Ga0209677_103335 | 3300025253 | Bacteria | 5282 |
| 236 | Ga0209148_1015515 | 3300025254 | Bacteria | 1329 |
| 237 | Ga0209129_1001101 | 3300025258 | Bacteria | 15742 |
| 238 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 239 | Ga0209233_1000097 | 3300025261 | Bacteria | 295452 |
| 240 | Ga0209233_1006432 | 3300025261 | Bacteria | 3787 |
| 241 | Ga0209455_1003379 | 3300025272 | Bacteria | 5674 |
| 242 | Ga0209673_1000126 | 3300025273 | Bacteria | 167949 |
| 243 | Ga0209673_1001062 | 3300025273 | Bacteria | 31387 |
| 244 | Ga0209673_1002727 | 3300025273 | Bacteria | 11650 |
| 245 | Ga0209025_1032697 | 3300025294 | Bacteria | 2424 |
| 246 | Ga0209564_1000368 | 3300025295 | Bacteria | 83910 |
| 247 | Ga0209564_1014503 | 3300025295 | Bacteria | 3273 |
| 248 | Ga0209564_1014785 | 3300025295 | Bacteria | 3219 |
| 249 | Ga0209758_1000345 | 3300025297 | Bacteria | 84958 |
| 250 | Ga0209758_1000527 | 3300025297 | Bacteria | 61122 |
| 251 | Ga0209758_1005729 | 3300025297 | Bacteria | 9361 |
| 252 | Ga0209758_1008345 | 3300025297 | Bacteria | 6740 |
| 253 | Ga0209758_1019444 | 3300025297 | Bacteria | 3273 |
| 254 | Ga0209256_1001075 | 3300025299 | Bacteria | 31597 |
| 255 | Ga0209256_1001095 | 3300025299 | Bacteria | 31168 |
| 256 | Ga0207426_1000400 | 3300025302 | Bacteria | 73493 |
| 257 | Ga0207426_1000402 | 3300025302 | Bacteria | 72738 |
| 258 | Ga0207426_1000736 | 3300025302 | Bacteria | 37388 |
| 259 | Ga0207426_1007160 | 3300025302 | Bacteria | 4709 |
| 260 | Ga0209051_1002366 | 3300025303 | Bacteria | 13638 |
| 261 | Ga0207656_10004091 | 3300025321 | Bacteria | 5061 |
| 262 | Ga0207682_10124792 | 3300025893 | Bacteria | 1145 |
| 263 | Ga0207692_10002994 | 3300025898 | Bacteria | 6550 |
| 264 | Ga0207710_10015744 | 3300025900 | Bacteria | 3198 |
| 265 | Ga0207710_10049206 | 3300025900 | Bacteria | 1888 |
| 266 | Ga0207688_10052512 | 3300025901 | Bacteria | 2284 |
| 267 | Ga0207680_10076672 | 3300025903 | Bacteria | 2088 |
| 268 | Ga0207680_10178416 | 3300025903 | Bacteria | 1435 |
| 269 | Ga0207647_10015521 | 3300025904 | Bacteria | 5218 |
| 270 | Ga0207647_10041918 | 3300025904 | Bacteria | 2874 |
| 271 | Ga0207699_10025361 | 3300025906 | Bacteria | 3253 |
| 272 | Ga0207645_10074877 | 3300025907 | Bacteria | 2167 |
| 273 | Ga0207705_10033323 | 3300025909 | Bacteria | 3679 |
| 274 | Ga0207705_10287041 | 3300025909 | Bacteria | 1260 |
| 275 | Ga0207654_10000717 | 3300025911 | Bacteria | 18498 |
| 276 | Ga0207654_10032296 | 3300025911 | Bacteria | 2891 |
| 277 | Ga0207654_10183398 | 3300025911 | Bacteria | 1367 |
| 278 | Ga0207707_10001371 | 3300025912 | Bacteria | 22592 |
| 279 | Ga0207707_10024804 | 3300025912 | Bacteria | 5246 |
| 280 | Ga0207707_10407619 | 3300025912 | Bacteria | 1166 |
| 281 | Ga0207695_10000458 | 3300025913 | Bacteria | 88734 |
| 282 | Ga0207695_10002499 | 3300025913 | Bacteria | 27042 |
| 283 | Ga0207695_10153319 | 3300025913 | Bacteria | 2241 |
| 284 | Ga0207671_10011705 | 3300025914 | Bacteria | 7111 |
| 285 | Ga0207671_10018973 | 3300025914 | Bacteria | 5269 |
| 286 | Ga0207671_10036677 | 3300025914 | Bacteria | 3637 |
| 287 | Ga0207671_10155129 | 3300025914 | Bacteria | 1771 |
| 288 | Ga0207693_10292539 | 3300025915 | Bacteria | 1276 |
| 289 | Ga0207663_10120570 | 3300025916 | Bacteria | 1795 |
| 290 | Ga0207660_10103941 | 3300025917 | Bacteria | 2126 |
| 291 | Ga0207657_10152968 | 3300025919 | Bacteria | 1878 |
| 292 | Ga0207649_10388049 | 3300025920 | Bacteria | 1042 |
| 293 | Ga0207652_10028115 | 3300025921 | Bacteria | 4690 |
| 294 | Ga0207652_10039261 | 3300025921 | Bacteria | 4017 |
| 295 | Ga0207681_10047323 | 3300025923 | Bacteria | 2897 |
| 296 | Ga0207681_10156904 | 3300025923 | Bacteria | 1711 |
| 297 | Ga0207694_10000258 | 3300025924 | Bacteria | 50514 |
| 298 | Ga0207694_10018430 | 3300025924 | Bacteria | 5275 |
| 299 | Ga0207694_10358970 | 3300025924 | Bacteria | 1207 |
| 300 | Ga0207659_10448625 | 3300025926 | Bacteria | 1086 |
| 301 | Ga0207700_10145389 | 3300025928 | Bacteria | 1953 |
| 302 | Ga0207664_10038825 | 3300025929 | Bacteria | 3694 |
| 303 | Ga0207644_10063340 | 3300025931 | Bacteria | 2685 |
| 304 | Ga0207706_10042418 | 3300025933 | Bacteria | 4032 |
| 305 | Ga0207686_10203467 | 3300025934 | Bacteria | 1419 |
| 306 | Ga0207686_10263435 | 3300025934 | Bacteria | 1265 |
| 307 | Ga0207709_10223642 | 3300025935 | Bacteria | 1359 |
| 308 | Ga0207709_10281832 | 3300025935 | Bacteria | 1228 |
| 309 | Ga0207665_10002675 | 3300025939 | Bacteria | 11969 |
| 310 | Ga0207665_10245607 | 3300025939 | Bacteria | 1321 |
| 311 | Ga0207691_10034093 | 3300025940 | Bacteria | 4738 |
| 312 | Ga0207711_10009071 | 3300025941 | Bacteria | 8310 |
| 313 | Ga0207711_10055022 | 3300025941 | Bacteria | 3416 |
| 314 | Ga0207711_10238252 | 3300025941 | Bacteria | 1668 |
| 315 | Ga0207711_10717426 | 3300025941 | Bacteria | 932 |
| 316 | Ga0207689_10016221 | 3300025942 | Bacteria | 6309 |
| 317 | Ga0207689_10504276 | 3300025942 | Bacteria | 1014 |
| 318 | Ga0207689_10647975 | 3300025942 | Bacteria | 890 |
| 319 | Ga0207661_10000331 | 3300025944 | Bacteria | 30097 |
| 320 | Ga0207661_10032719 | 3300025944 | Bacteria | 4032 |
| 321 | Ga0207679_10500171 | 3300025945 | Bacteria | 1084 |
| 322 | Ga0207667_10009886 | 3300025949 | Bacteria | 11193 |
| 323 | Ga0207667_10250852 | 3300025949 | Bacteria | 1810 |
| 324 | Ga0207712_10006823 | 3300025961 | Bacteria | 7205 |
| 325 | Ga0207712_10078385 | 3300025961 | Bacteria | 2397 |
| 326 | Ga0207712_10521476 | 3300025961 | Bacteria | 1018 |
| 327 | Ga0207668_10166914 | 3300025972 | Bacteria | 1722 |
| 328 | Ga0207668_10210924 | 3300025972 | Bacteria | 1553 |
| 329 | Ga0207640_10013426 | 3300025981 | Bacteria | 4694 |
| 330 | Ga0207640_10046755 | 3300025981 | Bacteria | 2787 |
| 331 | Ga0207640_10239367 | 3300025981 | Bacteria | 1401 |
| 332 | Ga0207658_10184508 | 3300025986 | Bacteria | 1729 |
| 333 | Ga0207703_10134015 | 3300026035 | Bacteria | 2142 |
| 334 | Ga0207639_10072505 | 3300026041 | Bacteria | 2696 |
| 335 | Ga0207639_10169897 | 3300026041 | Bacteria | 1845 |
| 336 | Ga0207639_10200816 | 3300026041 | Bacteria | 1710 |
| 337 | Ga0207639_10401952 | 3300026041 | Bacteria | 1234 |
| 338 | Ga0207678_10007094 | 3300026067 | Bacteria | 9938 |
| 339 | Ga0207678_10073914 | 3300026067 | Bacteria | 2921 |
| 340 | Ga0207678_10285905 | 3300026067 | Bacteria | 1416 |
| 341 | Ga0207708_10341706 | 3300026075 | Bacteria | 1226 |
| 342 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 343 | Ga0207702_10376403 | 3300026078 | Bacteria | 1364 |
| 344 | Ga0207702_10479389 | 3300026078 | Bacteria | 1210 |
| 345 | Ga0207641_10056865 | 3300026088 | Bacteria | 3326 |
| 346 | Ga0207641_10421130 | 3300026088 | Bacteria | 1286 |
| 347 | Ga0207648_10258308 | 3300026089 | Bacteria | 1554 |
| 348 | Ga0207676_10443065 | 3300026095 | Bacteria | 1223 |
| 349 | Ga0207676_10536164 | 3300026095 | Bacteria | 1116 |
| 350 | Ga0207674_10056094 | 3300026116 | Bacteria | 4002 |
| 351 | Ga0207674_10065044 | 3300026116 | Bacteria | 3677 |
| 352 | Ga0207674_10077710 | 3300026116 | Bacteria | 3325 |
| 353 | Ga0207674_10084921 | 3300026116 | Bacteria | 3163 |
| 354 | Ga0207674_10174349 | 3300026116 | Bacteria | 2103 |
| 355 | Ga0207674_10501809 | 3300026116 | Bacteria | 1172 |
| 356 | Ga0207674_10789912 | 3300026116 | Bacteria | 916 |
| 357 | Ga0207675_100124665 | 3300026118 | Bacteria | 2439 |
| 358 | Ga0207675_100415244 | 3300026118 | Bacteria | 1328 |
| 359 | Ga0207675_100522830 | 3300026118 | Bacteria | 1183 |
| 360 | Ga0207683_10047777 | 3300026121 | Bacteria | 3748 |
| 361 | Ga0207683_10103844 | 3300026121 | Bacteria | 2539 |
| 362 | Ga0207683_10164930 | 3300026121 | Bacteria | 2004 |
| 363 | Ga0207683_10251174 | 3300026121 | Bacteria | 1614 |
| 364 | Ga0207698_10055008 | 3300026142 | Bacteria | 3064 |
| 365 | Ga0207698_10088361 | 3300026142 | Bacteria | 2527 |
| 366 | Ga0207698_10512724 | 3300026142 | Bacteria | 1169 |
| 367 | Ga0209588_1068054 | 3300027671 | Bacteria | 1150 |
| 368 | Ga0209813_10069552 | 3300027866 | Bacteria | 1142 |
| 369 | Ga0268266_10028226 | 3300028379 | Bacteria | 4771 |
| 370 | Ga0268266_10105070 | 3300028379 | Bacteria | 2494 |
| 371 | Ga0268266_10208603 | 3300028379 | Bacteria | 1791 |
| 372 | Ga0268266_10226873 | 3300028379 | Bacteria | 1719 |
| 373 | Ga0268266_10323895 | 3300028379 | Bacteria | 1443 |
| 374 | Ga0268266_10367665 | 3300028379 | Bacteria | 1354 |
| 375 | Ga0268265_10009598 | 3300028380 | Bacteria | 6535 |
| 376 | Ga0268265_10128860 | 3300028380 | Bacteria | 2099 |
| 377 | Ga0268264_10000271 | 3300028381 | Bacteria | 90154 |
| 378 | Ga0307509_10025601 | 3300031507 | Bacteria | 6586 |
| 379 | Ga0307509_10029127 | 3300031507 | Bacteria | 6132 |
| 380 | Ga0307408_100050149 | 3300031548 | Bacteria | 3001 |
| 381 | Ga0307408_100370555 | 3300031548 | Bacteria | 1221 |
| 382 | Ga0307408_100725981 | 3300031548 | Bacteria | 895 |
| 383 | Ga0307508_10039588 | 3300031616 | Bacteria | 4233 |
| 384 | Ga0307406_10301812 | 3300031901 | Bacteria | 1231 |
| 385 | Ga0307416_100471782 | 3300032002 | Bacteria | 1313 |
| 386 | Ga0307416_100625351 | 3300032002 | Bacteria | 1159 |
| 387 | Ga0307411_10082470 | 3300032005 | Bacteria | 2218 |
| 388 | Ga0307415_100064954 | 3300032126 | Bacteria | 2541 |
| 389 | Ga0316593_10008780 | 3300032168 | Bacteria | 2833 |
| 390 | Ga0307507_10013433 | 3300033179 | Bacteria | 9942 |
| 391 | Ga0307510_10012167 | 3300033180 | Bacteria | 10203 |
| 392 | Ga0307510_10021632 | 3300033180 | Bacteria | 7494 |
| 393 | Ga0307510_10130945 | 3300033180 | Bacteria | 2182 |
| 394 | Ga0307510_10299175 | 3300033180 | Bacteria | 1072 |
| 395 | Ga0373955_0070441 | 3300035172 | Bacteria | 1954 |
| 396 | Ga0316574_0215994 | 3300035398 | Bacteria | 1230 |
| 397 | Ga0373935_0160393 | 3300035692 | Bacteria | 1532 |
| 398 | Ga0373927_0005221 | 3300035695 | Bacteria | 8984 |
| 399 | Ga0373927_0190934 | 3300035695 | Bacteria | 1344 |
| 400 | Ga0373947_0104443 | 3300035725 | Bacteria | 1784 |
| 401 | Ga0316582_0017683 | 3300036647 | Bacteria | 4131 |
| 402 | Ga0373925_0196585 | 3300037068 | Bacteria | 1602 |
| 403 | Ga0395898_0183641 | 3300037466 | Bacteria | 1998 |
| 404 | Ga0395905_0002238 | 3300037471 | Bacteria | 21782 |
| 405 | Ga0395901_0554737 | 3300038443 | Bacteria | 1164 |
| 406 | Ga0436365_0301686 | 3300039437 | Bacteria | 9817 |
| 407 | Ga0436365_0920281 | 3300039437 | Bacteria | 1605 |
| 408 | Ga0436365_1546724 | 3300039437 | Bacteria | 1588 |
| 409 | Ga0436365_1866973 | 3300039437 | Bacteria | 2842 |
| 410 | Ga0436363_1116250 | 3300039450 | Bacteria | 1162 |
| 411 | Ga0451833_0666882 | 3300041491 | Bacteria | 1165 |
| 412 | Ga0451835_0701798 | 3300041492 | Bacteria | 1397 |
| 413 | Ga0451835_0846484 | 3300041492 | Bacteria | 1528 |
| 414 | Ga0451837_0832108 | 3300041494 | Bacteria | 5281 |
| 415 | Ga0451837_1509718 | 3300041494 | Bacteria | 1397 |
| 416 | Ga0451839_0615725 | 3300041496 | Bacteria | 1735 |
| 417 | Ga0451839_1099990 | 3300041496 | Bacteria | 1397 |
| 418 | Ga0451841_0047544 | 3300041498 | Bacteria | 1326 |
| 419 | Ga0451841_0234887 | 3300041498 | Bacteria | 5141 |
| 420 | Ga0451845_0451105 | 3300041501 | Bacteria | 1397 |
| 421 | Ga0451847_0137423 | 3300041503 | Bacteria | 1397 |
| 422 | Ga0451849_0615251 | 3300041505 | Bacteria | 4275 |
| 423 | Ga0451849_0766215 | 3300041505 | Bacteria | 1397 |
| 424 | Ga0451851_0095856 | 3300041507 | Bacteria | 1161 |
| 425 | Ga0451843_0126997 | 3300041509 | Bacteria | 3404 |
| 426 | Ga0451843_0277846 | 3300041509 | Bacteria | 1397 |
| 427 | Ga0451855_0106049 | 3300041511 | Bacteria | 1638 |
| 428 | Ga0451855_0179822 | 3300041511 | Bacteria | 1270 |
| 429 | Ga0451853_3361738 | 3300041512 | Bacteria | 4036 |
| 430 | Ga0451853_3365732 | 3300041512 | Bacteria | 1117 |
| 431 | Ga0439435_0003562 | 3300042436 | Bacteria | 3254 |
| 432 | Ga0495592_0314512 | 3300046454 | Bacteria | 1014 |
| 433 | Ga0495603_0017441 | 3300046455 | Bacteria | 4344 |
| 434 | Ga0495603_0177318 | 3300046455 | Bacteria | 1233 |
| 435 | Ga0495603_0193862 | 3300046455 | Bacteria | 1174 |
| 436 | Ga0495590_0075855 | 3300046457 | Bacteria | 1183 |
| 437 | Ga0495629_0279900 | 3300046459 | Bacteria | 1145 |
| 438 | Ga0495638_0000093 | 3300046460 | Bacteria | 142356 |
| 439 | Ga0495638_0012296 | 3300046460 | Bacteria | 5871 |
| 440 | Ga0495638_0094810 | 3300046460 | Bacteria | 1793 |
| 441 | Ga0495651_0004745 | 3300046462 | Bacteria | 10404 |
| 442 | Ga0495651_0035403 | 3300046462 | Bacteria | 3887 |
| 443 | Ga0495650_0078871 | 3300046471 | Bacteria | 1274 |
| 444 | Ga0495582_0298543 | 3300046473 | Bacteria | 926 |
| 445 | Ga0495605_0058583 | 3300046474 | Bacteria | 1851 |
| 446 | Ga0495605_0073658 | 3300046474 | Bacteria | 1608 |
| 447 | Ga0495639_0033281 | 3300046475 | Bacteria | 2302 |
| 448 | Ga0495639_0130439 | 3300046475 | Bacteria | 1203 |
| 449 | Ga0495664_0021353 | 3300046477 | Bacteria | 3740 |
| 450 | Ga0495664_0366400 | 3300046477 | Bacteria | 867 |
| 451 | Ga0495584_0085316 | 3300046491 | Bacteria | 1591 |
| 452 | Ga0495585_0116112 | 3300046492 | Bacteria | 1419 |
| 453 | Ga0495594_0052519 | 3300046499 | Bacteria | 2244 |
| 454 | Ga0495594_0171331 | 3300046499 | Bacteria | 1235 |
| 455 | Ga0495607_0111819 | 3300046501 | Bacteria | 1447 |
| 456 | Ga0495606_0013391 | 3300046507 | Bacteria | 6481 |
| 457 | Ga0495606_0059370 | 3300046507 | Bacteria | 2454 |
| 458 | Ga0495606_0121737 | 3300046507 | Bacteria | 1561 |
| 459 | Ga0495606_0142679 | 3300046507 | Bacteria | 1413 |
| 460 | Ga0495606_0154064 | 3300046507 | Bacteria | 1346 |
| 461 | Ga0495608_0009046 | 3300046511 | Bacteria | 6968 |
| 462 | Ga0495608_0059301 | 3300046511 | Bacteria | 2522 |
| 463 | Ga0495610_0003544 | 3300046512 | Bacteria | 12092 |
| 464 | Ga0495610_0030536 | 3300046512 | Bacteria | 2823 |
| 465 | Ga0495616_0051909 | 3300046513 | Bacteria | 2043 |
| 466 | Ga0495616_0055497 | 3300046513 | Bacteria | 1961 |
| 467 | Ga0495620_0011824 | 3300046515 | Bacteria | 4538 |
| 468 | Ga0495620_0049015 | 3300046515 | Bacteria | 1810 |
| 469 | Ga0495620_0077440 | 3300046515 | Bacteria | 1350 |
| 470 | Ga0495628_0047046 | 3300046516 | Bacteria | 3425 |
| 471 | Ga0495631_0025660 | 3300046518 | Bacteria | 2711 |
| 472 | Ga0495631_0049221 | 3300046518 | Bacteria | 1846 |
| 473 | Ga0495632_0012123 | 3300046519 | Bacteria | 4986 |
| 474 | Ga0495632_0069407 | 3300046519 | Bacteria | 1697 |
| 475 | Ga0495643_0009325 | 3300046522 | Bacteria | 6109 |
| 476 | Ga0495643_0051206 | 3300046522 | Bacteria | 2221 |
| 477 | Ga0495643_0079847 | 3300046522 | Bacteria | 1704 |
| 478 | Ga0495648_0049617 | 3300046524 | Bacteria | 2571 |
| 479 | Ga0495648_0154229 | 3300046524 | Bacteria | 1195 |
| 480 | Ga0495648_0200028 | 3300046524 | Bacteria | 1001 |
| 481 | Ga0495666_0062894 | 3300046526 | Bacteria | 1772 |
| 482 | Ga0495652_0025991 | 3300046529 | Bacteria | 5173 |
| 483 | Ga0495652_0070348 | 3300046529 | Bacteria | 2925 |
| 484 | Ga0495652_0200162 | 3300046529 | Bacteria | 1516 |
| 485 | Ga0495587_0024739 | 3300046536 | Bacteria | 3677 |
| 486 | Ga0495587_0174020 | 3300046536 | Bacteria | 1222 |
| 487 | Ga0495609_0059358 | 3300046538 | Bacteria | 1691 |
| 488 | Ga0495609_0102151 | 3300046538 | Bacteria | 1242 |
| 489 | Ga0495597_0004648 | 3300046542 | Bacteria | 7477 |
| 490 | Ga0495597_0014749 | 3300046542 | Bacteria | 3716 |
| 491 | Ga0495597_0055352 | 3300046542 | Bacteria | 1740 |
| 492 | Ga0495645_0089611 | 3300046543 | Bacteria | 2199 |
| 493 | Ga0495622_0003148 | 3300046557 | Bacteria | 7810 |
| 494 | Ga0495622_0007018 | 3300046557 | Bacteria | 5228 |
| 495 | Ga0495622_0013881 | 3300046557 | Bacteria | 3737 |
| 496 | Ga0495622_0031590 | 3300046557 | Bacteria | 2474 |
| 497 | Ga0495622_0051770 | 3300046557 | Bacteria | 1904 |
| 498 | Ga0495622_0099376 | 3300046557 | Bacteria | 1334 |
| 499 | Ga0495633_0072008 | 3300046558 | Bacteria | 1612 |
| 500 | Ga0495667_0038688 | 3300046559 | Bacteria | 3175 |
| 501 | Ga0495668_0026449 | 3300046616 | Bacteria | 3292 |
| 502 | Ga0495668_0072194 | 3300046616 | Bacteria | 1896 |
| 503 | Ga0495668_0252893 | 3300046616 | Bacteria | 964 |
| 504 | Ga0495634_0047258 | 3300046642 | Bacteria | 2901 |
| 505 | Ga0495611_0018160 | 3300046648 | Bacteria | 3014 |
| 506 | Ga0495625_0008959 | 3300046660 | Bacteria | 8451 |
| 507 | Ga0495625_0112164 | 3300046660 | Bacteria | 1863 |
| 508 | Ga0495625_0178005 | 3300046660 | Bacteria | 1416 |
| 509 | Ga0495625_0279754 | 3300046660 | Bacteria | 1074 |
| 510 | Ga0495635_0086462 | 3300046663 | Bacteria | 2145 |
| 511 | Ga0495659_0080172 | 3300046664 | Bacteria | 1238 |
| 512 | Ga0495661_0118917 | 3300046665 | Bacteria | 1462 |
| 513 | Ga0495588_0004395 | 3300046674 | Bacteria | 6227 |
| 514 | Ga0495588_0077068 | 3300046674 | Bacteria | 1738 |
| 515 | Ga0495657_0025122 | 3300046675 | Bacteria | 4234 |
| 516 | Ga0495657_0053262 | 3300046675 | Bacteria | 2708 |
| 517 | Ga0495599_0007960 | 3300046678 | Bacteria | 6428 |
| 518 | Ga0495599_0177361 | 3300046678 | Bacteria | 1314 |
| 519 | Ga0495623_0016163 | 3300046679 | Bacteria | 4820 |
| 520 | Ga0495646_0017819 | 3300046680 | Bacteria | 4501 |
| 521 | Ga0495647_0035152 | 3300046681 | Bacteria | 1880 |
| 522 | Ga0495669_0205330 | 3300046684 | Bacteria | 942 |
| 523 | Ga0495613_0007936 | 3300046689 | Bacteria | 7900 |
| 524 | Ga0495613_0042760 | 3300046689 | Bacteria | 3352 |
| 525 | Ga0495624_0038078 | 3300046690 | Bacteria | 3091 |
| 526 | Ga0495624_0190075 | 3300046690 | Bacteria | 1249 |
| 527 | Ga0495624_0270335 | 3300046690 | Bacteria | 1027 |
| 528 | Ga0495670_0018287 | 3300046691 | Bacteria | 3451 |
| 529 | Ga0495670_0050605 | 3300046691 | Bacteria | 2080 |
| 530 | Ga0495670_0060507 | 3300046691 | Bacteria | 1903 |
| 531 | Ga0495649_0128470 | 3300046694 | Bacteria | 1338 |
| 532 | Ga0495600_0001949 | 3300046809 | Bacteria | 11590 |
| 533 | Ga0495600_0013037 | 3300046809 | Bacteria | 5215 |
| 534 | Ga0495660_0006722 | 3300046810 | Bacteria | 6790 |
| 535 | Ga0495660_0126052 | 3300046810 | Bacteria | 1290 |
| 536 | Ga0495660_0153503 | 3300046810 | Bacteria | 1135 |
| 537 | Ga0495581_0066884 | 3300047315 | Bacteria | 2078 |
| 538 | Ga0495604_0026776 | 3300047317 | Bacteria | 4589 |
| 539 | Ga0495604_0038952 | 3300047317 | Bacteria | 3737 |
| 540 | Ga0495636_0025766 | 3300047318 | Bacteria | 2389 |
| 541 | Ga0495674_0068767 | 3300047319 | Bacteria | 3064 |
| 542 | Ga0495672_0092763 | 3300047320 | Bacteria | 1655 |
| 543 | Ga0495676_0094977 | 3300047321 | Bacteria | 2220 |
| 544 | Ga0495676_0307600 | 3300047321 | Bacteria | 1067 |
| 545 | Ga0495680_0056250 | 3300047322 | Bacteria | 3046 |
| 546 | Ga0495687_009909 | 3300047443 | Bacteria | 5273 |
| 547 | Ga0495687_024317 | 3300047443 | Bacteria | 2880 |
| 548 | Ga0495675_0018173 | 3300047444 | Bacteria | 4460 |
| 549 | Ga0495684_0045599 | 3300047471 | Bacteria | 3355 |
| 550 | Ga0495686_0066313 | 3300047472 | Bacteria | 2231 |
| 551 | Ga0495602_0021306 | 3300048088 | Bacteria | 6385 |
| 552 | Ga0495602_0055287 | 3300048088 | Bacteria | 3497 |
| 553 | Ga0496100_0047645 | 3300048903 | Bacteria | 2763 |
| 554 | Ga0496100_0193011 | 3300048903 | Bacteria | 1480 |
| 555 | Ga0496101_0052058 | 3300048904 | Bacteria | 2951 |
| 556 | Ga0496102_0000614 | 3300048905 | Bacteria | 36967 |
| 557 | Ga0496102_0018881 | 3300048905 | Bacteria | 6066 |
| 558 | Ga0496102_0045731 | 3300048905 | Bacteria | 3974 |
| 559 | Ga0496102_0304408 | 3300048905 | Bacteria | 1502 |
| 560 | Ga0496102_0411624 | 3300048905 | Bacteria | 1270 |
| 561 | Ga0496102_0458890 | 3300048905 | Bacteria | 1195 |
| 562 | Ga0496102_0468777 | 3300048905 | Bacteria | 1180 |
| 563 | Ga0496103_0013040 | 3300048906 | Bacteria | 4928 |
| 564 | Ga0496103_0032673 | 3300048906 | Bacteria | 3176 |
| 565 | Ga0496103_0198439 | 3300048906 | Bacteria | 1290 |
| 566 | Ga0496104_0028633 | 3300048907 | Bacteria | 5163 |
| 567 | Ga0496104_0041567 | 3300048907 | Bacteria | 4311 |
| 568 | Ga0496104_0069427 | 3300048907 | Bacteria | 3349 |
| 569 | Ga0496104_0088931 | 3300048907 | Bacteria | 2951 |
| 570 | Ga0496105_0014940 | 3300048908 | Bacteria | 6181 |
| 571 | Ga0496105_0033632 | 3300048908 | Bacteria | 4212 |
| 572 | Ga0496105_0081982 | 3300048908 | Bacteria | 2664 |
| 573 | Ga0496105_0143377 | 3300048908 | Bacteria | 1965 |
| 574 | Ga0496105_0657615 | 3300048908 | Bacteria | 808 |
| 575 | Ga0496106_0097872 | 3300048909 | Bacteria | 2272 |
| 576 | Ga0496106_0307330 | 3300048909 | Bacteria | 1272 |
| 577 | Ga0496107_0104865 | 3300048910 | Bacteria | 2075 |
| 578 | Ga0496108_0054477 | 3300048911 | Bacteria | 3356 |
| 579 | Ga0496108_0597165 | 3300048911 | Bacteria | 962 |
| 580 | Ga0496109_0418734 | 3300048912 | Bacteria | 1265 |
| 581 | Ga0496109_0501941 | 3300048912 | Bacteria | 1145 |
| 582 | Ga0496109_0531469 | 3300048912 | Bacteria | 1110 |
| 583 | Ga0496110_0106873 | 3300048913 | Bacteria | 2511 |
| 584 | Ga0496110_0121491 | 3300048913 | Bacteria | 2354 |
| 585 | Ga0496110_0234521 | 3300048913 | Bacteria | 1669 |
| 586 | Ga0496110_0556462 | 3300048913 | Bacteria | 1042 |
| 587 | Ga0496110_0592077 | 3300048913 | Bacteria | 1006 |
| 588 | Ga0496111_0066281 | 3300048914 | Bacteria | 2622 |
| 589 | Ga0496112_0084499 | 3300048915 | Bacteria | 3139 |
| 590 | Ga0496112_0585805 | 3300048915 | Bacteria | 1048 |
| 591 | Ga0496112_0775612 | 3300048915 | Bacteria | 884 |
| 592 | Ga0496113_0064474 | 3300048916 | Bacteria | 2770 |
| 593 | Ga0496113_0150197 | 3300048916 | Bacteria | 1837 |
| 594 | Ga0496113_0242777 | 3300048916 | Bacteria | 1437 |
| 595 | Ga0496115_0148694 | 3300048918 | Bacteria | 1934 |
| 596 | Ga0496115_0420779 | 3300048918 | Bacteria | 1082 |
| 597 | Ga0496115_0513494 | 3300048918 | Bacteria | 962 |
| 598 | Ga0496116_0024695 | 3300048919 | Bacteria | 4436 |
| 599 | Ga0496116_0048297 | 3300048919 | Bacteria | 2857 |
| 600 | Ga0496116_0072039 | 3300048919 | Bacteria | 2186 |
| 601 | Ga0496116_0108942 | 3300048919 | Bacteria | 1634 |
| 602 | Ga0496116_0255484 | 3300048919 | Bacteria | 869 |
| 603 | Ga0496117_0042409 | 3300048920 | Bacteria | 3320 |
| 604 | Ga0496117_0091177 | 3300048920 | Bacteria | 1961 |
| 605 | Ga0496117_0091313 | 3300048920 | Bacteria | 1959 |
| 606 | Ga0496118_0000353 | 3300048921 | Bacteria | 77839 |
| 607 | Ga0496118_0009194 | 3300048921 | Bacteria | 10034 |
| 608 | Ga0496118_0106169 | 3300048921 | Bacteria | 1880 |
| 609 | Ga0496118_0126991 | 3300048921 | Bacteria | 1647 |
| 610 | Ga0496118_0135790 | 3300048921 | Bacteria | 1570 |
| 611 | Ga0496118_0207637 | 3300048921 | Bacteria | 1153 |
| 612 | Ga0496118_0269996 | 3300048921 | Bacteria | 954 |
| 613 | Ga0496119_0005991 | 3300048922 | Bacteria | 11421 |
| 614 | Ga0496119_0012748 | 3300048922 | Bacteria | 6789 |
| 615 | Ga0496119_0132709 | 3300048922 | Bacteria | 1355 |
| 616 | Ga0496120_0001950 | 3300048923 | Bacteria | 22601 |
| 617 | Ga0496120_0003410 | 3300048923 | Bacteria | 14534 |
| 618 | Ga0496120_0024687 | 3300048923 | Bacteria | 3743 |
| 619 | Ga0496120_0070716 | 3300048923 | Bacteria | 1918 |
| 620 | Ga0496121_0000536 | 3300048924 | Bacteria | 72166 |
| 621 | Ga0496121_0001187 | 3300048924 | Bacteria | 45612 |
| 622 | Ga0496121_0031628 | 3300048924 | Bacteria | 4830 |
| 623 | Ga0496121_0038931 | 3300048924 | Bacteria | 4200 |
| 624 | Ga0496121_0041610 | 3300048924 | Bacteria | 4013 |
| 625 | Ga0496121_0132225 | 3300048924 | Bacteria | 1865 |
| 626 | Ga0496121_0233284 | 3300048924 | Bacteria | 1287 |
| 627 | Ga0496121_0303059 | 3300048924 | Bacteria | 1083 |
| 628 | Ga0496122_0044235 | 3300048925 | Bacteria | 3478 |
| 629 | Ga0496122_0047262 | 3300048925 | Bacteria | 3324 |
| 630 | Ga0496124_0017619 | 3300048927 | Bacteria | 6725 |
| 631 | Ga0496124_0271568 | 3300048927 | Bacteria | 1241 |
| 632 | Ga0496125_0013222 | 3300048928 | Bacteria | 8128 |
| 633 | Ga0496125_0033769 | 3300048928 | Bacteria | 4521 |
| 634 | Ga0496125_0049986 | 3300048928 | Bacteria | 3467 |
| 635 | Ga0496125_0128650 | 3300048928 | Bacteria | 1788 |
| 636 | Ga0496125_0141482 | 3300048928 | Bacteria | 1672 |
| 637 | Ga0496126_0002330 | 3300048929 | Bacteria | 26023 |
| 638 | Ga0496126_0003343 | 3300048929 | Bacteria | 20380 |
| 639 | Ga0496126_0042429 | 3300048929 | Bacteria | 4201 |
| 640 | Ga0496126_0067381 | 3300048929 | Bacteria | 3198 |
| 641 | Ga0496126_0113540 | 3300048929 | Bacteria | 2358 |
| 642 | Ga0496126_0165644 | 3300048929 | Bacteria | 1886 |
| 643 | Ga0496126_0191209 | 3300048929 | Bacteria | 1733 |
| 644 | Ga0496126_0215921 | 3300048929 | Bacteria | 1613 |
| 645 | Ga0496126_0218785 | 3300048929 | Bacteria | 1601 |
| 646 | Ga0496126_0368243 | 3300048929 | Bacteria | 1172 |
| 647 | Ga0496126_0409142 | 3300048929 | Bacteria | 1099 |
| 648 | Ga0495678_075828 | 3300049459 | Bacteria | 1220 |
| 649 | Ga0495682_0027421 | 3300049460 | Bacteria | 2112 |
| 650 | Ga0501033_0028443 | 3300049570 | Bacteria | 4199 |
| 651 | Ga0501034_0044368 | 3300049571 | Bacteria | 4498 |
| 652 | Ga0501034_0044504 | 3300049571 | Bacteria | 4489 |
| 653 | Ga0501034_0124768 | 3300049571 | Bacteria | 2560 |
| 654 | Ga0501038_0024848 | 3300049574 | Bacteria | 5341 |
| 655 | Ga0501039_0141055 | 3300049575 | Bacteria | 1893 |
| 656 | Ga0501043_0075835 | 3300049579 | Bacteria | 2641 |
| 657 | Ga0501047_0029247 | 3300049581 | Bacteria | 5314 |
| 658 | Ga0501067_0132905 | 3300049583 | Bacteria | 1385 |
| 659 | Ga0501073_0442238 | 3300049589 | Bacteria | 899 |
| 660 | Ga0501044_0016392 | 3300049823 | Bacteria | 7956 |
| 661 | nmdc:mga00v17_117832_c1 | 3300050491 | Bacteria | 1689 |
| 662 | nmdc:mga0yw44_184330_c1 | 3300050492 | Bacteria | 1375 |
| 663 | nmdc:mga0yw44_240269_c1 | 3300050492 | Bacteria | 1204 |
| 664 | nmdc:mga0yw44_331417_c1 | 3300050492 | Bacteria | 1023 |
| 665 | nmdc:mga0k408_105533_c1 | 3300050493 | Bacteria | 1663 |
| 666 | nmdc:mga0k408_191336_c1 | 3300050493 | Bacteria | 1221 |
| 667 | nmdc:mga0k408_286695_c1 | 3300050493 | Bacteria | 983 |
| 668 | nmdc:mga06z11_32100_c1 | 3300050494 | Bacteria | 2558 |
| 669 | nmdc:mga06z11_36737_c1 | 3300050494 | Bacteria | 2420 |
| 670 | nmdc:mga04h51_58281_c1 | 3300050495 | Bacteria | 1316 |
| 671 | nmdc:mga04h51_82851_c1 | 3300050495 | Bacteria | 1142 |
| 672 | nmdc:mga07m45_20408_c1 | 3300050496 | Bacteria | 3598 |
| 673 | nmdc:mga07m45_205883_c1 | 3300050496 | Bacteria | 1144 |
| 674 | nmdc:mga07m45_39541_c1 | 3300050496 | Bacteria | 2636 |
| 675 | nmdc:mga08y16_242270_c1 | 3300050511 | Bacteria | 1864 |
| 676 | nmdc:mga0n895_171740_c1 | 3300050512 | Bacteria | 2200 |
| 677 | nmdc:mga0sz30_17972_c1 | 3300050516 | Bacteria | 2826 |
| 678 | Ga0500635_0000082 | 3300053080 | Bacteria | 62117 |
| 679 | Ga0500635_0013594 | 3300053080 | Bacteria | 2368 |
| 680 | Ga0500635_0027315 | 3300053080 | Bacteria | 1813 |
| 681 | Ga0495655_0039111 | 3300053083 | Bacteria | 1200 |
| 682 | Ga0495619_0043214 | 3300053085 | Bacteria | 2954 |
| 683 | Ga0500578_0217792 | 3300053086 | Bacteria | 1162 |
| 684 | Ga0500643_000046 | 3300053087 | Bacteria | 150388 |
| 685 | Ga0500643_004317 | 3300053087 | Bacteria | 6483 |
| 686 | Ga0500644_0135345 | 3300053088 | Bacteria | 974 |
| 687 | Ga0500646_0079314 | 3300053090 | Bacteria | 999 |
| 688 | Ga0500583_0011107 | 3300053092 | Bacteria | 3379 |
| 689 | Ga0500566_0000381 | 3300053094 | Bacteria | 24461 |
| 690 | Ga0500566_0070023 | 3300053094 | Bacteria | 1970 |
| 691 | Ga0500566_0141175 | 3300053094 | Bacteria | 1278 |
| 692 | Ga0500641_0021968 | 3300053096 | Bacteria | 2439 |
| 693 | Ga0500555_003852 | 3300053103 | Bacteria | 4268 |
| 694 | Ga0500556_0107655 | 3300053104 | Bacteria | 1078 |
| 695 | Ga0500557_000054 | 3300053105 | Bacteria | 50111 |
| 696 | Ga0500562_012538 | 3300053108 | Bacteria | 2157 |
| 697 | Ga0500562_019187 | 3300053108 | Bacteria | 1768 |
| 698 | Ga0500569_003280 | 3300053109 | Bacteria | 3289 |
| 699 | Ga0500572_000074 | 3300053111 | Bacteria | 31840 |
| 700 | Ga0500594_0021858 | 3300053118 | Bacteria | 1608 |
| 701 | Ga0500595_002781 | 3300053119 | Bacteria | 8432 |
| 702 | Ga0500595_008745 | 3300053119 | Bacteria | 4120 |
| 703 | Ga0500595_025862 | 3300053119 | Bacteria | 2028 |
| 704 | Ga0500607_013154 | 3300053121 | Bacteria | 4839 |
| 705 | Ga0500607_062768 | 3300053121 | Bacteria | 1940 |
| 706 | Ga0500608_010385 | 3300053122 | Bacteria | 3995 |
| 707 | Ga0500608_099352 | 3300053122 | Bacteria | 1350 |
| 708 | Ga0500618_008138 | 3300053125 | Bacteria | 2946 |
| 709 | Ga0500642_0000136 | 3300053130 | Bacteria | 32674 |
| 710 | Ga0500642_0040912 | 3300053130 | Bacteria | 2001 |
| 711 | Ga0500655_021535 | 3300053133 | Bacteria | 1209 |
| 712 | Ga0500658_0007101 | 3300053134 | Bacteria | 4141 |
| 713 | Ga0500658_0011035 | 3300053134 | Bacteria | 3331 |
| 714 | Ga0500658_0026826 | 3300053134 | Bacteria | 2222 |
| 715 | Ga0500658_0032267 | 3300053134 | Bacteria | 2053 |
| 716 | Ga0500559_0000780 | 3300053136 | Bacteria | 20835 |
| 717 | Ga0500559_0013121 | 3300053136 | Bacteria | 3513 |
| 718 | Ga0500559_0175459 | 3300053136 | Bacteria | 1008 |
| 719 | Ga0500568_0000460 | 3300053139 | Bacteria | 30312 |
| 720 | Ga0500589_113253 | 3300053147 | Bacteria | 1160 |
| 721 | Ga0500590_046515 | 3300053148 | Bacteria | 2217 |
| 722 | Ga0500603_014746 | 3300053150 | Bacteria | 1829 |
| 723 | Ga0500616_0001157 | 3300053153 | Bacteria | 26958 |
| 724 | Ga0500616_0101707 | 3300053153 | Bacteria | 1403 |
| 725 | Ga0500620_004187 | 3300053155 | Bacteria | 3189 |
| 726 | Ga0500622_0000064 | 3300053156 | Bacteria | 127531 |
| 727 | Ga0500622_0012955 | 3300053156 | Bacteria | 4504 |
| 728 | Ga0500624_000027 | 3300053157 | Bacteria | 108821 |
| 729 | Ga0500627_0033964 | 3300053158 | Bacteria | 2159 |
| 730 | Ga0500627_0076808 | 3300053158 | Bacteria | 1485 |
| 731 | Ga0500633_0021962 | 3300053160 | Bacteria | 1948 |
| 732 | Ga0500636_0001429 | 3300053177 | Bacteria | 13007 |
| 733 | Ga0500636_0005358 | 3300053177 | Bacteria | 7315 |
| 734 | Ga0500636_0019166 | 3300053177 | Bacteria | 4048 |
| 735 | Ga0500636_0088371 | 3300053177 | Bacteria | 1777 |
| 736 | Ga0500636_0217722 | 3300053177 | Bacteria | 997 |
| 737 | Ga0500636_0273186 | 3300053177 | Bacteria | 848 |
| 738 | Ga0500637_0000433 | 3300053178 | Bacteria | 15981 |
| 739 | Ga0500637_0027901 | 3300053178 | Bacteria | 3119 |
| 740 | Ga0500637_0069923 | 3300053178 | Bacteria | 2019 |
| 741 | Ga0500637_0125663 | 3300053178 | Bacteria | 1487 |
| 742 | Ga0500625_011807 | 3300053729 | Bacteria | 3979 |
| 743 | Ga0500625_031227 | 3300053729 | Bacteria | 2528 |
| 744 | Ga0500645_023914 | 3300053730 | Bacteria | 1871 |
| 745 | Ga0500609_003116 | 3300053731 | Bacteria | 2351 |
| 746 | Ga0500601_000722 | 3300053737 | Bacteria | 4354 |
| 747 | Ga0500661_002049 | 3300055283 | Bacteria | 3807 |
| 748 | Ga0590071_016772 | 3300059421 | Bacteria | 1719 |
| 749 | Ga0590077_011018 | 3300059426 | Bacteria | 1865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031901 | Ga0307406_10301812 | Ga0307406_103018121 | 223 |
| 2 | iso_pu_bacteria | 2869162929 | 2869166667 | 224 |
| 3 | 3300049581 | Ga0501047_0029247 | Ga0501047_0029247_1440_2243 | 225 |
| 4 | 3300031548 | Ga0307408_100050149 | Ga0307408_1000501494 | 228 |
| 5 | iso_pu_bacteria | 2738541293 | 2738799570 | 229 |
| 6 | 3300039437 | Ga0436365_0920281 | Ga0436365_0920281_578_1321 | 231 |
| 7 | 3300049571 | Ga0501034_0124768 | Ga0501034_0124768_1354_2100 | 232 |
| 8 | iso_pu_bacteria | 2524023209 | 2524463013 | 233 |
| 9 | iso_pu_bacteria | 2582581294 | 2585203182 | 233 |
| 10 | iso_pu_bacteria | 2615840626 | 2616311796 | 233 |
| 11 | iso_pu_bacteria | 2643221582 | 2643918065 | 233 |
| 12 | iso_pu_bacteria | 2643221623 | 2644130286 | 233 |
| 13 | iso_pu_bacteria | 2775507266 | 2778176739 | 233 |
| 14 | iso_pu_bacteria | 2838029111 | 2838034488 | 233 |
| 15 | iso_pu_bacteria | 2842298080 | 2842302145 | 233 |
| 16 | iso_pu_bacteria | 2842357229 | 2842363148 | 233 |
| 17 | iso_pu_bacteria | 2842475841 | 2842481235 | 233 |
| 18 | iso_pu_bacteria | 2842482326 | 2842489104 | 233 |
| 19 | iso_pu_bacteria | 2842502639 | 2842508180 | 233 |
| 20 | iso_pu_bacteria | 2842509118 | 2842513938 | 233 |
| 21 | iso_pu_bacteria | 8056875544 | 8056876649 | 233 |
| 22 | iso_pu_bacteria | 2937113482 | 2937116079 | 234 |
| 23 | iso_pu_bacteria | 2957415311 | 2957416628 | 234 |
| 24 | iso_pu_bacteria | 2957491536 | 2957494162 | 234 |
| 25 | iso_pu_bacteria | 2964712639 | 2964712856 | 234 |
| 26 | iso_pu_bacteria | 2970076120 | 2970078787 | 234 |
| 27 | iso_pu_bacteria | 2977523885 | 2977525453 | 234 |
| 28 | iso_pu_bacteria | 8057874678 | 8057879853 | 234 |
| 29 | 3300025917 | Ga0207660_10103941 | Ga0207660_101039412 | 235 |
| 30 | iso_pu_bacteria | 2513237090 | 2513612214 | 235 |
| 31 | iso_pu_bacteria | 2791355123 | 2792751805 | 235 |
| 32 | iso_pu_bacteria | 2824704595 | 2824707569 | 235 |
| 33 | iso_pu_bacteria | 2824753945 | 2824755710 | 235 |
| 34 | iso_pu_bacteria | 2824763712 | 2824766373 | 235 |
| 35 | iso_pu_bacteria | 2885305155 | 2885310765 | 235 |
| 36 | iso_pu_bacteria | 2885334103 | 2885341189 | 235 |
| 37 | iso_pu_bacteria | 2904711408 | 2904712224 | 235 |
| 38 | iso_pu_bacteria | 8055617313 | 8055619317 | 235 |
| 39 | 3300006178 | Ga0075367_10021221 | Ga0075367_100212212 | 236 |
| 40 | 3300025912 | Ga0207707_10407619 | Ga0207707_104076191 | 236 |
| 41 | 3300032168 | Ga0316593_10008780 | Ga0316593_100087802 | 236 |
| 42 | 3300036647 | Ga0316582_0017683 | Ga0316582_0017683_2433_3161 | 236 |
| 43 | 3300041492 | Ga0451835_0846484 | Ga0451835_0846484_788_1513 | 236 |
| 44 | 3300041494 | Ga0451837_0832108 | Ga0451837_0832108_3093_3818 | 236 |
| 45 | 3300041496 | Ga0451839_0615725 | Ga0451839_0615725_846_1571 | 236 |
| 46 | 3300041498 | Ga0451841_0234887 | Ga0451841_0234887_1448_2173 | 236 |
| 47 | 3300041505 | Ga0451849_0615251 | Ga0451849_0615251_2985_3710 | 236 |
| 48 | 3300041512 | Ga0451853_3361738 | Ga0451853_3361738_219_944 | 236 |
| 49 | 3300046507 | Ga0495606_0013391 | Ga0495606_0013391_3251_3973 | 236 |
| 50 | 3300046512 | Ga0495610_0003544 | Ga0495610_0003544_8475_9197 | 236 |
| 51 | 3300046513 | Ga0495616_0051909 | Ga0495616_0051909_1310_2032 | 236 |
| 52 | 3300046519 | Ga0495632_0012123 | Ga0495632_0012123_3111_3833 | 236 |
| 53 | 3300046522 | Ga0495643_0051206 | Ga0495643_0051206_979_1701 | 236 |
| 54 | 3300046542 | Ga0495597_0004648 | Ga0495597_0004648_3026_3748 | 236 |
| 55 | 3300046660 | Ga0495625_0008959 | Ga0495625_0008959_3228_3950 | 236 |
| 56 | 3300046810 | Ga0495660_0006722 | Ga0495660_0006722_2237_2959 | 236 |
| 57 | 3300047443 | Ga0495687_024317 | Ga0495687_024317_794_1516 | 236 |
| 58 | 3300050494 | nmdc:mga06z11_36737_c1 | nmdc:mga06z11_36737_c1_1319_2056 | 236 |
| 59 | 3300050495 | nmdc:mga04h51_58281_c1 | nmdc:mga04h51_58281_c1_189_926 | 236 |
| 60 | 3300053118 | Ga0500594_0021858 | Ga0500594_0021858_871_1593 | 236 |
| 61 | 3300053134 | Ga0500658_0011035 | Ga0500658_0011035_2089_2811 | 236 |
| 62 | 3300053153 | Ga0500616_0101707 | Ga0500616_0101707_521_1243 | 236 |
| 63 | 3300053156 | Ga0500622_0000064 | Ga0500622_0000064_48177_48899 | 236 |
| 64 | 3300053158 | Ga0500627_0076808 | Ga0500627_0076808_72_794 | 236 |
| 65 | iso_pu_bacteria | 2513237138 | 2513870312 | 236 |
| 66 | iso_pu_bacteria | 2513237164 | 2514032668 | 236 |
| 67 | iso_pu_bacteria | 2515154113 | 2515635666 | 236 |
| 68 | iso_pu_bacteria | 2582581308 | 2585277759 | 236 |
| 69 | iso_pu_bacteria | 2582581867 | 2585403029 | 236 |
| 70 | iso_pu_bacteria | 2585427526 | 2585530430 | 236 |
| 71 | iso_pu_bacteria | 2585427527 | 2585533374 | 236 |
| 72 | iso_pu_bacteria | 2585427530 | 2585557881 | 236 |
| 73 | iso_pu_bacteria | 2585427590 | 2585825229 | 236 |
| 74 | iso_pu_bacteria | 2599185301 | 2599936900 | 236 |
| 75 | iso_pu_bacteria | 2599185352 | 2600196370 | 236 |
| 76 | iso_pu_bacteria | 2615840626 | 2616310564 | 236 |
| 77 | iso_pu_bacteria | 2643221627 | 2644153910 | 236 |
| 78 | iso_pu_bacteria | 2728368998 | 2728749367 | 236 |
| 79 | iso_pu_bacteria | 2751185821 | 2753459734 | 236 |
| 80 | iso_pu_bacteria | 2818991453 | 2819643133 | 236 |
| 81 | iso_pu_bacteria | 2838661181 | 2838668374 | 236 |
| 82 | iso_pu_bacteria | 2838686498 | 2838691049 | 236 |
| 83 | iso_pu_bacteria | 2842110456 | 2842117287 | 236 |
| 84 | iso_pu_bacteria | 2842271015 | 2842275524 | 236 |
| 85 | iso_pu_bacteria | 2844454524 | 2844462240 | 236 |
| 86 | iso_pu_bacteria | 2874612657 | 2874614815 | 236 |
| 87 | iso_pu_bacteria | 2879110137 | 2879114476 | 236 |
| 88 | iso_pu_bacteria | 2889016732 | 2889021441 | 236 |
| 89 | iso_pu_bacteria | 2904690495 | 2904694449 | 236 |
| 90 | iso_pu_bacteria | 2908739725 | 2908741953 | 236 |
| 91 | iso_pu_bacteria | 2908756301 | 2908759638 | 236 |
| 92 | iso_pu_bacteria | 2924718760 | 2924723469 | 236 |
| 93 | iso_pu_bacteria | 2933016740 | 2933019354 | 236 |
| 94 | iso_pu_bacteria | 2933586486 | 2933590031 | 236 |
| 95 | iso_pu_bacteria | 8006984368 | 8006987436 | 236 |
| 96 | iso_pu_bacteria | 8056681323 | 8056687680 | 236 |
| 97 | iso_pu_bacteria | 8056689827 | 8056693473 | 236 |
| 98 | 3300005336 | Ga0070680_100531114 | Ga0070680_1005311141 | 237 |
| 99 | 3300005458 | Ga0070681_10033499 | Ga0070681_100334994 | 237 |
| 100 | 3300035398 | Ga0316574_0215994 | Ga0316574_0215994_143_910 | 237 |
| 101 | 3300048929 | Ga0496126_0218785 | Ga0496126_0218785_406_1164 | 237 |
| 102 | iso_pu_bacteria | 2515154134 | 2515741714 | 237 |
| 103 | iso_pu_bacteria | 2791355266 | 2793359282 | 237 |
| 104 | iso_pu_bacteria | 8004640170 | 8004643018 | 237 |
| 105 | 3300005329 | Ga0070683_100007383 | Ga0070683_1000073835 | 238 |
| 106 | 3300005329 | Ga0070683_100031653 | Ga0070683_1000316534 | 238 |
| 107 | 3300005337 | Ga0070682_100058791 | Ga0070682_1000587912 | 238 |
| 108 | 3300005434 | Ga0070709_10307754 | Ga0070709_103077541 | 238 |
| 109 | 3300005458 | Ga0070681_10182527 | Ga0070681_101825272 | 238 |
| 110 | 3300005530 | Ga0070679_100092244 | Ga0070679_1000922443 | 238 |
| 111 | 3300005530 | Ga0070679_100334912 | Ga0070679_1003349122 | 238 |
| 112 | 3300005535 | Ga0070684_100002474 | Ga0070684_1000024746 | 238 |
| 113 | 3300005578 | Ga0068854_100321297 | Ga0068854_1003212971 | 238 |
| 114 | 3300005983 | Ga0081540_1061289 | Ga0081540_10612893 | 238 |
| 115 | 3300006038 | Ga0075365_10093101 | Ga0075365_100931011 | 238 |
| 116 | 3300006048 | Ga0075363_100077582 | Ga0075363_1000775822 | 238 |
| 117 | 3300006177 | Ga0075362_10007812 | Ga0075362_100078122 | 238 |
| 118 | 3300006358 | Ga0068871_100286171 | Ga0068871_1002861712 | 238 |
| 119 | 3300006844 | Ga0075428_100041687 | Ga0075428_1000416873 | 238 |
| 120 | 3300006847 | Ga0075431_100642590 | Ga0075431_1006425901 | 238 |
| 121 | 3300009545 | Ga0105237_10310279 | Ga0105237_103102793 | 238 |
| 122 | 3300009551 | Ga0105238_10275551 | Ga0105238_102755511 | 238 |
| 123 | 3300013307 | Ga0157372_10138050 | Ga0157372_101380502 | 238 |
| 124 | 3300025273 | Ga0209673_1002727 | Ga0209673_10027275 | 238 |
| 125 | 3300025912 | Ga0207707_10001371 | Ga0207707_1000137115 | 238 |
| 126 | 3300025912 | Ga0207707_10024804 | Ga0207707_100248043 | 238 |
| 127 | 3300025913 | Ga0207695_10153319 | Ga0207695_101533192 | 238 |
| 128 | 3300025921 | Ga0207652_10028115 | Ga0207652_100281152 | 238 |
| 129 | 3300025921 | Ga0207652_10039261 | Ga0207652_100392613 | 238 |
| 130 | 3300025944 | Ga0207661_10000331 | Ga0207661_1000033126 | 238 |
| 131 | 3300025944 | Ga0207661_10032719 | Ga0207661_100327193 | 238 |
| 132 | 3300026116 | Ga0207674_10084921 | Ga0207674_100849213 | 238 |
| 133 | 3300026116 | Ga0207674_10789912 | Ga0207674_107899121 | 238 |
| 134 | 3300028379 | Ga0268266_10323895 | Ga0268266_103238952 | 238 |
| 135 | 3300035695 | Ga0373927_0190934 | Ga0373927_0190934_519_1328 | 238 |
| 136 | 3300037068 | Ga0373925_0196585 | Ga0373925_0196585_29_796 | 238 |
| 137 | 3300041491 | Ga0451833_0666882 | Ga0451833_0666882_149_901 | 238 |
| 138 | 3300041492 | Ga0451835_0701798 | Ga0451835_0701798_169_921 | 238 |
| 139 | 3300041494 | Ga0451837_1509718 | Ga0451837_1509718_169_921 | 238 |
| 140 | 3300041496 | Ga0451839_1099990 | Ga0451839_1099990_169_921 | 238 |
| 141 | 3300041498 | Ga0451841_0047544 | Ga0451841_0047544_98_850 | 238 |
| 142 | 3300041501 | Ga0451845_0451105 | Ga0451845_0451105_169_921 | 238 |
| 143 | 3300041503 | Ga0451847_0137423 | Ga0451847_0137423_169_921 | 238 |
| 144 | 3300041505 | Ga0451849_0766215 | Ga0451849_0766215_169_921 | 238 |
| 145 | 3300041507 | Ga0451851_0095856 | Ga0451851_0095856_169_921 | 238 |
| 146 | 3300041509 | Ga0451843_0277846 | Ga0451843_0277846_169_921 | 238 |
| 147 | 3300041511 | Ga0451855_0179822 | Ga0451855_0179822_458_1210 | 238 |
| 148 | 3300041512 | Ga0451853_3365732 | Ga0451853_3365732_71_823 | 238 |
| 149 | 3300046507 | Ga0495606_0142679 | Ga0495606_0142679_37_768 | 238 |
| 150 | 3300046515 | Ga0495620_0011824 | Ga0495620_0011824_1744_2475 | 238 |
| 151 | 3300046522 | Ga0495643_0079847 | Ga0495643_0079847_633_1364 | 238 |
| 152 | 3300046538 | Ga0495609_0059358 | Ga0495609_0059358_408_1139 | 238 |
| 153 | 3300046557 | Ga0495622_0003148 | Ga0495622_0003148_7018_7749 | 238 |
| 154 | 3300046660 | Ga0495625_0112164 | Ga0495625_0112164_513_1244 | 238 |
| 155 | 3300048088 | Ga0495602_0055287 | Ga0495602_0055287_1196_1927 | 238 |
| 156 | 3300053080 | Ga0500635_0000082 | Ga0500635_0000082_11472_12203 | 238 |
| 157 | 3300053092 | Ga0500583_0011107 | Ga0500583_0011107_2495_3226 | 238 |
| 158 | 3300053094 | Ga0500566_0141175 | Ga0500566_0141175_372_1103 | 238 |
| 159 | 3300053109 | Ga0500569_003280 | Ga0500569_003280_1500_2231 | 238 |
| 160 | 3300053119 | Ga0500595_002781 | Ga0500595_002781_3427_4158 | 238 |
| 161 | 3300053121 | Ga0500607_013154 | Ga0500607_013154_3047_3778 | 238 |
| 162 | 3300053122 | Ga0500608_010385 | Ga0500608_010385_1550_2281 | 238 |
| 163 | 3300053134 | Ga0500658_0007101 | Ga0500658_0007101_602_1345 | 238 |
| 164 | 3300053134 | Ga0500658_0032267 | Ga0500658_0032267_819_1550 | 238 |
| 165 | 3300053148 | Ga0500590_046515 | Ga0500590_046515_176_907 | 238 |
| 166 | 3300053158 | Ga0500627_0033964 | Ga0500627_0033964_781_1542 | 238 |
| 167 | 3300053177 | Ga0500636_0088371 | Ga0500636_0088371_85_816 | 238 |
| 168 | 3300053177 | Ga0500636_0273186 | Ga0500636_0273186_16_747 | 238 |
| 169 | 3300053178 | Ga0500637_0000433 | Ga0500637_0000433_2452_3183 | 238 |
| 170 | 3300053178 | Ga0500637_0027901 | Ga0500637_0027901_1696_2427 | 238 |
| 171 | 3300053178 | Ga0500637_0069923 | Ga0500637_0069923_536_1336 | 238 |
| 172 | 3300053729 | Ga0500625_031227 | Ga0500625_031227_576_1307 | 238 |
| 173 | 3300001979 | JGI24740J21852_10018129 | JGI24740J21852_100181292 | 239 |
| 174 | 3300001979 | JGI24740J21852_10043019 | JGI24740J21852_100430191 | 239 |
| 175 | 3300001989 | JGI24739J22299_10070700 | JGI24739J22299_100707002 | 239 |
| 176 | 3300002067 | JGI24735J21928_10050971 | JGI24735J21928_100509711 | 239 |
| 177 | 3300005334 | Ga0068869_100480231 | Ga0068869_1004802312 | 239 |
| 178 | 3300005337 | Ga0070682_100313768 | Ga0070682_1003137682 | 239 |
| 179 | 3300005539 | Ga0068853_100001742 | Ga0068853_1000017426 | 239 |
| 180 | 3300005539 | Ga0068853_100267441 | Ga0068853_1002674411 | 239 |
| 181 | 3300005577 | Ga0068857_100418811 | Ga0068857_1004188112 | 239 |
| 182 | 3300005719 | Ga0068861_100050478 | Ga0068861_1000504782 | 239 |
| 183 | 3300006051 | Ga0075364_10064214 | Ga0075364_100642142 | 239 |
| 184 | 3300006844 | Ga0075428_100645452 | Ga0075428_1006454522 | 239 |
| 185 | 3300009177 | Ga0105248_10009311 | Ga0105248_100093113 | 239 |
| 186 | 3300009545 | Ga0105237_10066120 | Ga0105237_100661204 | 239 |
| 187 | 3300009551 | Ga0105238_10007078 | Ga0105238_100070786 | 239 |
| 188 | 3300010375 | Ga0105239_10008236 | Ga0105239_100082369 | 239 |
| 189 | 3300010375 | Ga0105239_10461945 | Ga0105239_104619451 | 239 |
| 190 | 3300010375 | Ga0105239_10957680 | Ga0105239_109576801 | 239 |
| 191 | 3300013105 | Ga0157369_10155960 | Ga0157369_101559603 | 239 |
| 192 | 3300013307 | Ga0157372_10737478 | Ga0157372_107374781 | 239 |
| 193 | 3300013308 | Ga0157375_10595262 | Ga0157375_105952622 | 239 |
| 194 | 3300025297 | Ga0209758_1005729 | Ga0209758_10057297 | 239 |
| 195 | 3300025297 | Ga0209758_1019444 | Ga0209758_10194443 | 239 |
| 196 | 3300025904 | Ga0207647_10015521 | Ga0207647_100155213 | 239 |
| 197 | 3300025914 | Ga0207671_10011705 | Ga0207671_100117058 | 239 |
| 198 | 3300025924 | Ga0207694_10018430 | Ga0207694_100184304 | 239 |
| 199 | 3300025941 | Ga0207711_10009071 | Ga0207711_100090719 | 239 |
| 200 | 3300025942 | Ga0207689_10647975 | Ga0207689_106479751 | 239 |
| 201 | 3300025972 | Ga0207668_10166914 | Ga0207668_101669142 | 239 |
| 202 | 3300026041 | Ga0207639_10169897 | Ga0207639_101698971 | 239 |
| 203 | 3300026116 | Ga0207674_10501809 | Ga0207674_105018091 | 239 |
| 204 | 3300031548 | Ga0307408_100370555 | Ga0307408_1003705551 | 239 |
| 205 | 3300046477 | Ga0495664_0021353 | Ga0495664_0021353_1759_2538 | 239 |
| 206 | 3300046477 | Ga0495664_0366400 | Ga0495664_0366400_50_805 | 239 |
| 207 | 3300046542 | Ga0495597_0055352 | Ga0495597_0055352_264_1028 | 239 |
| 208 | 3300046543 | Ga0495645_0089611 | Ga0495645_0089611_1289_2068 | 239 |
| 209 | 3300046664 | Ga0495659_0080172 | Ga0495659_0080172_83_847 | 239 |
| 210 | 3300046678 | Ga0495599_0177361 | Ga0495599_0177361_387_1166 | 239 |
| 211 | 3300046691 | Ga0495670_0018287 | Ga0495670_0018287_84_848 | 239 |
| 212 | 3300046694 | Ga0495649_0128470 | Ga0495649_0128470_267_1031 | 239 |
| 213 | 3300048905 | Ga0496102_0018881 | Ga0496102_0018881_3993_4724 | 239 |
| 214 | 3300048905 | Ga0496102_0468777 | Ga0496102_0468777_100_852 | 239 |
| 215 | 3300048918 | Ga0496115_0420779 | Ga0496115_0420779_311_1069 | 239 |
| 216 | 3300048919 | Ga0496116_0108942 | Ga0496116_0108942_185_916 | 239 |
| 217 | 3300048920 | Ga0496117_0091313 | Ga0496117_0091313_385_1116 | 239 |
| 218 | 3300048921 | Ga0496118_0009194 | Ga0496118_0009194_7172_7903 | 239 |
| 219 | 3300048922 | Ga0496119_0012748 | Ga0496119_0012748_1593_2324 | 239 |
| 220 | 3300048922 | Ga0496119_0132709 | Ga0496119_0132709_230_979 | 239 |
| 221 | 3300048923 | Ga0496120_0003410 | Ga0496120_0003410_5540_6289 | 239 |
| 222 | 3300048924 | Ga0496121_0001187 | Ga0496121_0001187_10177_10908 | 239 |
| 223 | 3300048924 | Ga0496121_0233284 | Ga0496121_0233284_358_1116 | 239 |
| 224 | 3300048928 | Ga0496125_0033769 | Ga0496125_0033769_1009_1767 | 239 |
| 225 | 3300049570 | Ga0501033_0028443 | Ga0501033_0028443_614_1378 | 239 |
| 226 | 3300049571 | Ga0501034_0044368 | Ga0501034_0044368_1419_2183 | 239 |
| 227 | 3300049575 | Ga0501039_0141055 | Ga0501039_0141055_590_1354 | 239 |
| 228 | 3300049583 | Ga0501067_0132905 | Ga0501067_0132905_470_1231 | 239 |
| 229 | 3300049589 | Ga0501073_0442238 | Ga0501073_0442238_73_837 | 239 |
| 230 | 3300049823 | Ga0501044_0016392 | Ga0501044_0016392_2497_3261 | 239 |
| 231 | 3300050492 | nmdc:mga0yw44_331417_c1 | nmdc:mga0yw44_331417_c1_43_807 | 239 |
| 232 | 3300050493 | nmdc:mga0k408_105533_c1 | nmdc:mga0k408_105533_c1_720_1484 | 239 |
| 233 | 3300053088 | Ga0500644_0135345 | Ga0500644_0135345_69_806 | 239 |
| 234 | 3300053090 | Ga0500646_0079314 | Ga0500646_0079314_249_983 | 239 |
| 235 | 3300053103 | Ga0500555_003852 | Ga0500555_003852_1085_1819 | 239 |
| 236 | iso_pu_bacteria | 2824653114 | 2824658249 | 239 |
| 237 | iso_pu_bacteria | 2842038055 | 2842040425 | 239 |
| 238 | iso_pu_bacteria | 2842045827 | 2842046630 | 239 |
| 239 | 3300001979 | JGI24740J21852_10009539 | JGI24740J21852_100095394 | 240 |
| 240 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_100000667 | 240 |
| 241 | 3300003322 | rootL2_10177720 | rootL2_101777202 | 240 |
| 242 | 3300003659 | JGI25404J52841_10011078 | JGI25404J52841_100110782 | 240 |
| 243 | 3300003659 | JGI25404J52841_10039595 | JGI25404J52841_100395951 | 240 |
| 244 | 3300003790 | Ga0055528_1000544 | Ga0055528_10005442 | 240 |
| 245 | 3300005327 | Ga0070658_10328052 | Ga0070658_103280522 | 240 |
| 246 | 3300005327 | Ga0070658_10492434 | Ga0070658_104924341 | 240 |
| 247 | 3300005328 | Ga0070676_10085855 | Ga0070676_100858553 | 240 |
| 248 | 3300005334 | Ga0068869_100188815 | Ga0068869_1001888152 | 240 |
| 249 | 3300005365 | Ga0070688_100269133 | Ga0070688_1002691332 | 240 |
| 250 | 3300005434 | Ga0070709_10036716 | Ga0070709_100367162 | 240 |
| 251 | 3300005435 | Ga0070714_100002584 | Ga0070714_10000258414 | 240 |
| 252 | 3300005435 | Ga0070714_100585084 | Ga0070714_1005850841 | 240 |
| 253 | 3300005436 | Ga0070713_100086394 | Ga0070713_1000863942 | 240 |
| 254 | 3300005437 | Ga0070710_10000501 | Ga0070710_100005018 | 240 |
| 255 | 3300005437 | Ga0070710_10183781 | Ga0070710_101837811 | 240 |
| 256 | 3300005437 | Ga0070710_10476192 | Ga0070710_104761921 | 240 |
| 257 | 3300005438 | Ga0070701_10033118 | Ga0070701_100331182 | 240 |
| 258 | 3300005439 | Ga0070711_100044952 | Ga0070711_1000449524 | 240 |
| 259 | 3300005455 | Ga0070663_100027618 | Ga0070663_1000276182 | 240 |
| 260 | 3300005456 | Ga0070678_100086429 | Ga0070678_1000864293 | 240 |
| 261 | 3300005456 | Ga0070678_100198686 | Ga0070678_1001986862 | 240 |
| 262 | 3300005471 | Ga0070698_100736491 | Ga0070698_1007364911 | 240 |
| 263 | 3300005539 | Ga0068853_100013884 | Ga0068853_1000138847 | 240 |
| 264 | 3300005539 | Ga0068853_100099647 | Ga0068853_1000996471 | 240 |
| 265 | 3300005543 | Ga0070672_100328535 | Ga0070672_1003285352 | 240 |
| 266 | 3300005548 | Ga0070665_100069708 | Ga0070665_1000697085 | 240 |
| 267 | 3300005548 | Ga0070665_100427743 | Ga0070665_1004277431 | 240 |
| 268 | 3300005563 | Ga0068855_100075640 | Ga0068855_1000756405 | 240 |
| 269 | 3300005577 | Ga0068857_100036325 | Ga0068857_1000363254 | 240 |
| 270 | 3300005577 | Ga0068857_100457678 | Ga0068857_1004576781 | 240 |
| 271 | 3300005578 | Ga0068854_100039271 | Ga0068854_1000392714 | 240 |
| 272 | 3300005578 | Ga0068854_100056832 | Ga0068854_1000568324 | 240 |
| 273 | 3300005614 | Ga0068856_100012955 | Ga0068856_1000129558 | 240 |
| 274 | 3300005614 | Ga0068856_100322481 | Ga0068856_1003224811 | 240 |
| 275 | 3300005614 | Ga0068856_100818653 | Ga0068856_1008186532 | 240 |
| 276 | 3300005616 | Ga0068852_100602969 | Ga0068852_1006029692 | 240 |
| 277 | 3300005617 | Ga0068859_100176840 | Ga0068859_1001768402 | 240 |
| 278 | 3300005617 | Ga0068859_100248636 | Ga0068859_1002486361 | 240 |
| 279 | 3300005617 | Ga0068859_100534830 | Ga0068859_1005348302 | 240 |
| 280 | 3300005618 | Ga0068864_100452028 | Ga0068864_1004520282 | 240 |
| 281 | 3300005719 | Ga0068861_100266140 | Ga0068861_1002661401 | 240 |
| 282 | 3300005719 | Ga0068861_100445797 | Ga0068861_1004457971 | 240 |
| 283 | 3300005834 | Ga0068851_10046400 | Ga0068851_100464003 | 240 |
| 284 | 3300005834 | Ga0068851_10183348 | Ga0068851_101833481 | 240 |
| 285 | 3300005842 | Ga0068858_100061887 | Ga0068858_1000618873 | 240 |
| 286 | 3300005842 | Ga0068858_100624858 | Ga0068858_1006248582 | 240 |
| 287 | 3300005843 | Ga0068860_100000217 | Ga0068860_10000021731 | 240 |
| 288 | 3300005844 | Ga0068862_100044093 | Ga0068862_1000440933 | 240 |
| 289 | 3300005937 | Ga0081455_10136729 | Ga0081455_101367292 | 240 |
| 290 | 3300005983 | Ga0081540_1006420 | Ga0081540_10064205 | 240 |
| 291 | 3300005983 | Ga0081540_1009150 | Ga0081540_10091507 | 240 |
| 292 | 3300005983 | Ga0081540_1058566 | Ga0081540_10585662 | 240 |
| 293 | 3300005983 | Ga0081540_1107676 | Ga0081540_11076761 | 240 |
| 294 | 3300006028 | Ga0070717_10223502 | Ga0070717_102235022 | 240 |
| 295 | 3300006028 | Ga0070717_10567823 | Ga0070717_105678231 | 240 |
| 296 | 3300006038 | Ga0075365_10143954 | Ga0075365_101439542 | 240 |
| 297 | 3300006173 | Ga0070716_100001649 | Ga0070716_1000016496 | 240 |
| 298 | 3300006175 | Ga0070712_100270628 | Ga0070712_1002706282 | 240 |
| 299 | 3300006195 | Ga0075366_10089603 | Ga0075366_100896032 | 240 |
| 300 | 3300006195 | Ga0075366_10153173 | Ga0075366_101531731 | 240 |
| 301 | 3300006237 | Ga0097621_100056820 | Ga0097621_1000568203 | 240 |
| 302 | 3300006353 | Ga0075370_10003227 | Ga0075370_100032278 | 240 |
| 303 | 3300006358 | Ga0068871_100281926 | Ga0068871_1002819262 | 240 |
| 304 | 3300006358 | Ga0068871_100398121 | Ga0068871_1003981212 | 240 |
| 305 | 3300006844 | Ga0075428_100196785 | Ga0075428_1001967852 | 240 |
| 306 | 3300006871 | Ga0075434_100115025 | Ga0075434_1001150253 | 240 |
| 307 | 3300006871 | Ga0075434_100172071 | Ga0075434_1001720714 | 240 |
| 308 | 3300006881 | Ga0068865_100159767 | Ga0068865_1001597672 | 240 |
| 309 | 3300006881 | Ga0068865_100316578 | Ga0068865_1003165782 | 240 |
| 310 | 3300006931 | Ga0097620_100176845 | Ga0097620_1001768452 | 240 |
| 311 | 3300006931 | Ga0097620_100248637 | Ga0097620_1002486372 | 240 |
| 312 | 3300006931 | Ga0097620_100534810 | Ga0097620_1005348102 | 240 |
| 313 | 3300007265 | Ga0099794_10023859 | Ga0099794_100238593 | 240 |
| 314 | 3300009093 | Ga0105240_10000336 | Ga0105240_1000033629 | 240 |
| 315 | 3300009093 | Ga0105240_10003411 | Ga0105240_1000341113 | 240 |
| 316 | 3300009094 | Ga0111539_10167067 | Ga0111539_101670672 | 240 |
| 317 | 3300009098 | Ga0105245_10160454 | Ga0105245_101604542 | 240 |
| 318 | 3300009101 | Ga0105247_10008005 | Ga0105247_100080054 | 240 |
| 319 | 3300009101 | Ga0105247_10132294 | Ga0105247_101322942 | 240 |
| 320 | 3300009148 | Ga0105243_10085956 | Ga0105243_100859562 | 240 |
| 321 | 3300009174 | Ga0105241_10013101 | Ga0105241_100131016 | 240 |
| 322 | 3300009174 | Ga0105241_10082829 | Ga0105241_100828293 | 240 |
| 323 | 3300009174 | Ga0105241_10406186 | Ga0105241_104061861 | 240 |
| 324 | 3300009177 | Ga0105248_10014838 | Ga0105248_100148384 | 240 |
| 325 | 3300009177 | Ga0105248_10153724 | Ga0105248_101537242 | 240 |
| 326 | 3300009545 | Ga0105237_10000690 | Ga0105237_1000069032 | 240 |
| 327 | 3300009545 | Ga0105237_10056017 | Ga0105237_100560174 | 240 |
| 328 | 3300009545 | Ga0105237_10088873 | Ga0105237_100888733 | 240 |
| 329 | 3300009545 | Ga0105237_10183098 | Ga0105237_101830983 | 240 |
| 330 | 3300009545 | Ga0105237_10250188 | Ga0105237_102501883 | 240 |
| 331 | 3300009551 | Ga0105238_10005788 | Ga0105238_1000578812 | 240 |
| 332 | 3300009551 | Ga0105238_10339591 | Ga0105238_103395912 | 240 |
| 333 | 3300009551 | Ga0105238_10551698 | Ga0105238_105516982 | 240 |
| 334 | 3300009553 | Ga0105249_10393375 | Ga0105249_103933752 | 240 |
| 335 | 3300009553 | Ga0105249_10711666 | Ga0105249_107116661 | 240 |
| 336 | 3300010159 | Ga0099796_10084012 | Ga0099796_100840122 | 240 |
| 337 | 3300010375 | Ga0105239_10006751 | Ga0105239_1000675113 | 240 |
| 338 | 3300010375 | Ga0105239_10070772 | Ga0105239_100707725 | 240 |
| 339 | 3300010375 | Ga0105239_10375310 | Ga0105239_103753102 | 240 |
| 340 | 3300010375 | Ga0105239_10712954 | Ga0105239_107129542 | 240 |
| 341 | 3300011119 | Ga0105246_10426055 | Ga0105246_104260552 | 240 |
| 342 | 3300013104 | Ga0157370_10006306 | Ga0157370_100063062 | 240 |
| 343 | 3300013105 | Ga0157369_10118453 | Ga0157369_101184532 | 240 |
| 344 | 3300013296 | Ga0157374_10371927 | Ga0157374_103719272 | 240 |
| 345 | 3300013297 | Ga0157378_10126465 | Ga0157378_101264652 | 240 |
| 346 | 3300013297 | Ga0157378_10207621 | Ga0157378_102076211 | 240 |
| 347 | 3300013306 | Ga0163162_10038979 | Ga0163162_100389792 | 240 |
| 348 | 3300013306 | Ga0163162_10370534 | Ga0163162_103705342 | 240 |
| 349 | 3300013308 | Ga0157375_10249707 | Ga0157375_102497072 | 240 |
| 350 | 3300013308 | Ga0157375_10409895 | Ga0157375_104098952 | 240 |
| 351 | 3300014325 | Ga0163163_10108583 | Ga0163163_101085832 | 240 |
| 352 | 3300014326 | Ga0157380_10030487 | Ga0157380_100304872 | 240 |
| 353 | 3300014326 | Ga0157380_10089716 | Ga0157380_100897162 | 240 |
| 354 | 3300014497 | Ga0182008_10020976 | Ga0182008_100209764 | 240 |
| 355 | 3300014497 | Ga0182008_10041989 | Ga0182008_100419892 | 240 |
| 356 | 3300014968 | Ga0157379_10341744 | Ga0157379_103417442 | 240 |
| 357 | 3300014969 | Ga0157376_10402613 | Ga0157376_104026132 | 240 |
| 358 | 3300015262 | Ga0182007_10037005 | Ga0182007_100370052 | 240 |
| 359 | 3300015262 | Ga0182007_10054633 | Ga0182007_100546331 | 240 |
| 360 | 3300015265 | Ga0182005_1005352 | Ga0182005_10053524 | 240 |
| 361 | 3300017792 | Ga0163161_10189762 | Ga0163161_101897622 | 240 |
| 362 | 3300021327 | Ga0214543_1003759 | Ga0214543_100375924 | 240 |
| 363 | 3300021384 | Ga0213876_10060936 | Ga0213876_100609361 | 240 |
| 364 | 3300025233 | Ga0209437_107178 | Ga0209437_1071782 | 240 |
| 365 | 3300025253 | Ga0209677_103335 | Ga0209677_1033354 | 240 |
| 366 | 3300025254 | Ga0209148_1015515 | Ga0209148_10155152 | 240 |
| 367 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010653 | 240 |
| 368 | 3300025261 | Ga0209233_1000097 | Ga0209233_1000097278 | 240 |
| 369 | 3300025261 | Ga0209233_1006432 | Ga0209233_10064324 | 240 |
| 370 | 3300025272 | Ga0209455_1003379 | Ga0209455_10033791 | 240 |
| 371 | 3300025273 | Ga0209673_1000126 | Ga0209673_100012672 | 240 |
| 372 | 3300025295 | Ga0209564_1000368 | Ga0209564_100036810 | 240 |
| 373 | 3300025297 | Ga0209758_1000527 | Ga0209758_10005273 | 240 |
| 374 | 3300025299 | Ga0209256_1001075 | Ga0209256_100107520 | 240 |
| 375 | 3300025303 | Ga0209051_1002366 | Ga0209051_100236612 | 240 |
| 376 | 3300025321 | Ga0207656_10004091 | Ga0207656_100040916 | 240 |
| 377 | 3300025893 | Ga0207682_10124792 | Ga0207682_101247921 | 240 |
| 378 | 3300025898 | Ga0207692_10002994 | Ga0207692_100029941 | 240 |
| 379 | 3300025900 | Ga0207710_10015744 | Ga0207710_100157443 | 240 |
| 380 | 3300025900 | Ga0207710_10049206 | Ga0207710_100492061 | 240 |
| 381 | 3300025901 | Ga0207688_10052512 | Ga0207688_100525121 | 240 |
| 382 | 3300025903 | Ga0207680_10178416 | Ga0207680_101784162 | 240 |
| 383 | 3300025906 | Ga0207699_10025361 | Ga0207699_100253613 | 240 |
| 384 | 3300025909 | Ga0207705_10287041 | Ga0207705_102870412 | 240 |
| 385 | 3300025911 | Ga0207654_10000717 | Ga0207654_100007177 | 240 |
| 386 | 3300025911 | Ga0207654_10032296 | Ga0207654_100322962 | 240 |
| 387 | 3300025913 | Ga0207695_10000458 | Ga0207695_1000045861 | 240 |
| 388 | 3300025913 | Ga0207695_10002499 | Ga0207695_1000249912 | 240 |
| 389 | 3300025914 | Ga0207671_10018973 | Ga0207671_100189732 | 240 |
| 390 | 3300025914 | Ga0207671_10155129 | Ga0207671_101551291 | 240 |
| 391 | 3300025915 | Ga0207693_10292539 | Ga0207693_102925391 | 240 |
| 392 | 3300025916 | Ga0207663_10120570 | Ga0207663_101205702 | 240 |
| 393 | 3300025923 | Ga0207681_10047323 | Ga0207681_100473233 | 240 |
| 394 | 3300025923 | Ga0207681_10156904 | Ga0207681_101569041 | 240 |
| 395 | 3300025924 | Ga0207694_10000258 | Ga0207694_1000025838 | 240 |
| 396 | 3300025926 | Ga0207659_10448625 | Ga0207659_104486251 | 240 |
| 397 | 3300025928 | Ga0207700_10145389 | Ga0207700_101453892 | 240 |
| 398 | 3300025929 | Ga0207664_10038825 | Ga0207664_100388252 | 240 |
| 399 | 3300025934 | Ga0207686_10263435 | Ga0207686_102634352 | 240 |
| 400 | 3300025935 | Ga0207709_10281832 | Ga0207709_102818322 | 240 |
| 401 | 3300025939 | Ga0207665_10002675 | Ga0207665_1000267511 | 240 |
| 402 | 3300025940 | Ga0207691_10034093 | Ga0207691_100340932 | 240 |
| 403 | 3300025941 | Ga0207711_10238252 | Ga0207711_102382522 | 240 |
| 404 | 3300025941 | Ga0207711_10717426 | Ga0207711_107174262 | 240 |
| 405 | 3300025945 | Ga0207679_10500171 | Ga0207679_105001711 | 240 |
| 406 | 3300025949 | Ga0207667_10009886 | Ga0207667_100098862 | 240 |
| 407 | 3300025961 | Ga0207712_10078385 | Ga0207712_100783852 | 240 |
| 408 | 3300025961 | Ga0207712_10521476 | Ga0207712_105214762 | 240 |
| 409 | 3300025972 | Ga0207668_10210924 | Ga0207668_102109241 | 240 |
| 410 | 3300025981 | Ga0207640_10013426 | Ga0207640_100134262 | 240 |
| 411 | 3300025981 | Ga0207640_10046755 | Ga0207640_100467552 | 240 |
| 412 | 3300026035 | Ga0207703_10134015 | Ga0207703_101340152 | 240 |
| 413 | 3300026041 | Ga0207639_10072505 | Ga0207639_100725053 | 240 |
| 414 | 3300026041 | Ga0207639_10401952 | Ga0207639_104019521 | 240 |
| 415 | 3300026067 | Ga0207678_10007094 | Ga0207678_100070944 | 240 |
| 416 | 3300026067 | Ga0207678_10073914 | Ga0207678_100739144 | 240 |
| 417 | 3300026067 | Ga0207678_10285905 | Ga0207678_102859052 | 240 |
| 418 | 3300026075 | Ga0207708_10341706 | Ga0207708_103417062 | 240 |
| 419 | 3300026078 | Ga0207702_10000006 | Ga0207702_1000000625 | 240 |
| 420 | 3300026078 | Ga0207702_10376403 | Ga0207702_103764032 | 240 |
| 421 | 3300026088 | Ga0207641_10421130 | Ga0207641_104211302 | 240 |
| 422 | 3300026095 | Ga0207676_10443065 | Ga0207676_104430651 | 240 |
| 423 | 3300026095 | Ga0207676_10536164 | Ga0207676_105361642 | 240 |
| 424 | 3300026116 | Ga0207674_10056094 | Ga0207674_100560942 | 240 |
| 425 | 3300026116 | Ga0207674_10065044 | Ga0207674_100650442 | 240 |
| 426 | 3300026116 | Ga0207674_10077710 | Ga0207674_100777102 | 240 |
| 427 | 3300026118 | Ga0207675_100124665 | Ga0207675_1001246653 | 240 |
| 428 | 3300026118 | Ga0207675_100415244 | Ga0207675_1004152441 | 240 |
| 429 | 3300026118 | Ga0207675_100522830 | Ga0207675_1005228301 | 240 |
| 430 | 3300026121 | Ga0207683_10047777 | Ga0207683_100477773 | 240 |
| 431 | 3300026121 | Ga0207683_10103844 | Ga0207683_101038443 | 240 |
| 432 | 3300026121 | Ga0207683_10164930 | Ga0207683_101649302 | 240 |
| 433 | 3300026121 | Ga0207683_10251174 | Ga0207683_102511742 | 240 |
| 434 | 3300026142 | Ga0207698_10055008 | Ga0207698_100550083 | 240 |
| 435 | 3300026142 | Ga0207698_10512724 | Ga0207698_105127241 | 240 |
| 436 | 3300027671 | Ga0209588_1068054 | Ga0209588_10680542 | 240 |
| 437 | 3300028379 | Ga0268266_10105070 | Ga0268266_101050702 | 240 |
| 438 | 3300028379 | Ga0268266_10226873 | Ga0268266_102268732 | 240 |
| 439 | 3300028379 | Ga0268266_10367665 | Ga0268266_103676651 | 240 |
| 440 | 3300028381 | Ga0268264_10000271 | Ga0268264_1000027131 | 240 |
| 441 | 3300031507 | Ga0307509_10025601 | Ga0307509_100256017 | 240 |
| 442 | 3300031507 | Ga0307509_10029127 | Ga0307509_100291272 | 240 |
| 443 | 3300031548 | Ga0307408_100725981 | Ga0307408_1007259811 | 240 |
| 444 | 3300031616 | Ga0307508_10039588 | Ga0307508_100395887 | 240 |
| 445 | 3300032002 | Ga0307416_100471782 | Ga0307416_1004717822 | 240 |
| 446 | 3300032002 | Ga0307416_100625351 | Ga0307416_1006253512 | 240 |
| 447 | 3300032005 | Ga0307411_10082470 | Ga0307411_100824702 | 240 |
| 448 | 3300032126 | Ga0307415_100064954 | Ga0307415_1000649542 | 240 |
| 449 | 3300033179 | Ga0307507_10013433 | Ga0307507_100134333 | 240 |
| 450 | 3300033180 | Ga0307510_10012167 | Ga0307510_100121675 | 240 |
| 451 | 3300033180 | Ga0307510_10299175 | Ga0307510_102991751 | 240 |
| 452 | 3300035172 | Ga0373955_0070441 | Ga0373955_0070441_558_1361 | 240 |
| 453 | 3300035692 | Ga0373935_0160393 | Ga0373935_0160393_480_1247 | 240 |
| 454 | 3300035695 | Ga0373927_0005221 | Ga0373927_0005221_4499_5266 | 240 |
| 455 | 3300035725 | Ga0373947_0104443 | Ga0373947_0104443_989_1756 | 240 |
| 456 | 3300037466 | Ga0395898_0183641 | Ga0395898_0183641_1147_1914 | 240 |
| 457 | 3300038443 | Ga0395901_0554737 | Ga0395901_0554737_66_833 | 240 |
| 458 | 3300039437 | Ga0436365_0301686 | Ga0436365_0301686_119_886 | 240 |
| 459 | 3300039437 | Ga0436365_1546724 | Ga0436365_1546724_791_1558 | 240 |
| 460 | 3300039437 | Ga0436365_1866973 | Ga0436365_1866973_1989_2750 | 240 |
| 461 | 3300039450 | Ga0436363_1116250 | Ga0436363_1116250_357_1124 | 240 |
| 462 | 3300041509 | Ga0451843_0126997 | Ga0451843_0126997_1792_2526 | 240 |
| 463 | 3300041511 | Ga0451855_0106049 | Ga0451855_0106049_632_1366 | 240 |
| 464 | 3300042436 | Ga0439435_0003562 | Ga0439435_0003562_783_1550 | 240 |
| 465 | 3300046455 | Ga0495603_0017441 | Ga0495603_0017441_1466_2233 | 240 |
| 466 | 3300046455 | Ga0495603_0177318 | Ga0495603_0177318_434_1183 | 240 |
| 467 | 3300046455 | Ga0495603_0193862 | Ga0495603_0193862_134_904 | 240 |
| 468 | 3300046460 | Ga0495638_0000093 | Ga0495638_0000093_122773_123507 | 240 |
| 469 | 3300046460 | Ga0495638_0094810 | Ga0495638_0094810_467_1237 | 240 |
| 470 | 3300046462 | Ga0495651_0004745 | Ga0495651_0004745_8270_9073 | 240 |
| 471 | 3300046471 | Ga0495650_0078871 | Ga0495650_0078871_291_1061 | 240 |
| 472 | 3300046473 | Ga0495582_0298543 | Ga0495582_0298543_112_882 | 240 |
| 473 | 3300046474 | Ga0495605_0073658 | Ga0495605_0073658_129_899 | 240 |
| 474 | 3300046475 | Ga0495639_0033281 | Ga0495639_0033281_751_1521 | 240 |
| 475 | 3300046475 | Ga0495639_0130439 | Ga0495639_0130439_60_827 | 240 |
| 476 | 3300046492 | Ga0495585_0116112 | Ga0495585_0116112_514_1281 | 240 |
| 477 | 3300046499 | Ga0495594_0052519 | Ga0495594_0052519_337_1104 | 240 |
| 478 | 3300046499 | Ga0495594_0171331 | Ga0495594_0171331_353_1123 | 240 |
| 479 | 3300046501 | Ga0495607_0111819 | Ga0495607_0111819_694_1428 | 240 |
| 480 | 3300046507 | Ga0495606_0059370 | Ga0495606_0059370_201_983 | 240 |
| 481 | 3300046511 | Ga0495608_0009046 | Ga0495608_0009046_1543_2346 | 240 |
| 482 | 3300046516 | Ga0495628_0047046 | Ga0495628_0047046_1529_2332 | 240 |
| 483 | 3300046518 | Ga0495631_0025660 | Ga0495631_0025660_699_1469 | 240 |
| 484 | 3300046518 | Ga0495631_0049221 | Ga0495631_0049221_907_1677 | 240 |
| 485 | 3300046519 | Ga0495632_0069407 | Ga0495632_0069407_385_1155 | 240 |
| 486 | 3300046524 | Ga0495648_0154229 | Ga0495648_0154229_210_1019 | 240 |
| 487 | 3300046526 | Ga0495666_0062894 | Ga0495666_0062894_821_1588 | 240 |
| 488 | 3300046529 | Ga0495652_0025991 | Ga0495652_0025991_2018_2821 | 240 |
| 489 | 3300046536 | Ga0495587_0024739 | Ga0495587_0024739_1653_2456 | 240 |
| 490 | 3300046557 | Ga0495622_0007018 | Ga0495622_0007018_2744_3493 | 240 |
| 491 | 3300046557 | Ga0495622_0031590 | Ga0495622_0031590_1376_2143 | 240 |
| 492 | 3300046557 | Ga0495622_0099376 | Ga0495622_0099376_432_1199 | 240 |
| 493 | 3300046558 | Ga0495633_0072008 | Ga0495633_0072008_670_1437 | 240 |
| 494 | 3300046559 | Ga0495667_0038688 | Ga0495667_0038688_538_1341 | 240 |
| 495 | 3300046616 | Ga0495668_0026449 | Ga0495668_0026449_2394_3128 | 240 |
| 496 | 3300046616 | Ga0495668_0252893 | Ga0495668_0252893_108_878 | 240 |
| 497 | 3300046642 | Ga0495634_0047258 | Ga0495634_0047258_1346_2149 | 240 |
| 498 | 3300046648 | Ga0495611_0018160 | Ga0495611_0018160_779_1513 | 240 |
| 499 | 3300046660 | Ga0495625_0178005 | Ga0495625_0178005_443_1177 | 240 |
| 500 | 3300046663 | Ga0495635_0086462 | Ga0495635_0086462_1124_1927 | 240 |
| 501 | 3300046674 | Ga0495588_0004395 | Ga0495588_0004395_998_1765 | 240 |
| 502 | 3300046675 | Ga0495657_0053262 | Ga0495657_0053262_1788_2591 | 240 |
| 503 | 3300046678 | Ga0495599_0007960 | Ga0495599_0007960_4391_5194 | 240 |
| 504 | 3300046679 | Ga0495623_0016163 | Ga0495623_0016163_987_1790 | 240 |
| 505 | 3300046680 | Ga0495646_0017819 | Ga0495646_0017819_1232_2035 | 240 |
| 506 | 3300046681 | Ga0495647_0035152 | Ga0495647_0035152_866_1636 | 240 |
| 507 | 3300046684 | Ga0495669_0205330 | Ga0495669_0205330_42_809 | 240 |
| 508 | 3300046689 | Ga0495613_0042760 | Ga0495613_0042760_1420_2223 | 240 |
| 509 | 3300046690 | Ga0495624_0190075 | Ga0495624_0190075_112_861 | 240 |
| 510 | 3300046691 | Ga0495670_0050605 | Ga0495670_0050605_104_838 | 240 |
| 511 | 3300046691 | Ga0495670_0060507 | Ga0495670_0060507_767_1537 | 240 |
| 512 | 3300046809 | Ga0495600_0001949 | Ga0495600_0001949_3780_4583 | 240 |
| 513 | 3300046810 | Ga0495660_0126052 | Ga0495660_0126052_360_1094 | 240 |
| 514 | 3300046810 | Ga0495660_0153503 | Ga0495660_0153503_28_798 | 240 |
| 515 | 3300047315 | Ga0495581_0066884 | Ga0495581_0066884_1271_2041 | 240 |
| 516 | 3300047317 | Ga0495604_0026776 | Ga0495604_0026776_1226_2029 | 240 |
| 517 | 3300047318 | Ga0495636_0025766 | Ga0495636_0025766_167_901 | 240 |
| 518 | 3300047319 | Ga0495674_0068767 | Ga0495674_0068767_1895_2698 | 240 |
| 519 | 3300047320 | Ga0495672_0092763 | Ga0495672_0092763_393_1142 | 240 |
| 520 | 3300047322 | Ga0495680_0056250 | Ga0495680_0056250_1089_1892 | 240 |
| 521 | 3300047444 | Ga0495675_0018173 | Ga0495675_0018173_2568_3371 | 240 |
| 522 | 3300047471 | Ga0495684_0045599 | Ga0495684_0045599_1271_2074 | 240 |
| 523 | 3300048088 | Ga0495602_0021306 | Ga0495602_0021306_4262_5065 | 240 |
| 524 | 3300048903 | Ga0496100_0047645 | Ga0496100_0047645_107_841 | 240 |
| 525 | 3300048905 | Ga0496102_0000614 | Ga0496102_0000614_833_1567 | 240 |
| 526 | 3300048906 | Ga0496103_0032673 | Ga0496103_0032673_2165_2899 | 240 |
| 527 | 3300048907 | Ga0496104_0088931 | Ga0496104_0088931_757_1524 | 240 |
| 528 | 3300048908 | Ga0496105_0657615 | Ga0496105_0657615_21_788 | 240 |
| 529 | 3300048911 | Ga0496108_0597165 | Ga0496108_0597165_158_949 | 240 |
| 530 | 3300048912 | Ga0496109_0501941 | Ga0496109_0501941_20_787 | 240 |
| 531 | 3300048913 | Ga0496110_0121491 | Ga0496110_0121491_46_828 | 240 |
| 532 | 3300048915 | Ga0496112_0775612 | Ga0496112_0775612_46_813 | 240 |
| 533 | 3300048918 | Ga0496115_0148694 | Ga0496115_0148694_1147_1917 | 240 |
| 534 | 3300048918 | Ga0496115_0513494 | Ga0496115_0513494_163_915 | 240 |
| 535 | 3300048919 | Ga0496116_0024695 | Ga0496116_0024695_573_1307 | 240 |
| 536 | 3300048920 | Ga0496117_0042409 | Ga0496117_0042409_587_1321 | 240 |
| 537 | 3300048921 | Ga0496118_0000353 | Ga0496118_0000353_76532_77266 | 240 |
| 538 | 3300048921 | Ga0496118_0135790 | Ga0496118_0135790_39_764 | 240 |
| 539 | 3300048923 | Ga0496120_0001950 | Ga0496120_0001950_571_1305 | 240 |
| 540 | 3300048924 | Ga0496121_0000536 | Ga0496121_0000536_583_1317 | 240 |
| 541 | 3300048924 | Ga0496121_0031628 | Ga0496121_0031628_4037_4804 | 240 |
| 542 | 3300048924 | Ga0496121_0038931 | Ga0496121_0038931_2878_3648 | 240 |
| 543 | 3300048924 | Ga0496121_0041610 | Ga0496121_0041610_1539_2309 | 240 |
| 544 | 3300048924 | Ga0496121_0303059 | Ga0496121_0303059_73_843 | 240 |
| 545 | 3300048925 | Ga0496122_0044235 | Ga0496122_0044235_514_1248 | 240 |
| 546 | 3300048925 | Ga0496122_0047262 | Ga0496122_0047262_1700_2467 | 240 |
| 547 | 3300048928 | Ga0496125_0049986 | Ga0496125_0049986_2201_2935 | 240 |
| 548 | 3300048928 | Ga0496125_0128650 | Ga0496125_0128650_956_1723 | 240 |
| 549 | 3300048929 | Ga0496126_0002330 | Ga0496126_0002330_8878_9648 | 240 |
| 550 | 3300048929 | Ga0496126_0003343 | Ga0496126_0003343_7816_8583 | 240 |
| 551 | 3300048929 | Ga0496126_0042429 | Ga0496126_0042429_2934_3701 | 240 |
| 552 | 3300048929 | Ga0496126_0165644 | Ga0496126_0165644_41_847 | 240 |
| 553 | 3300048929 | Ga0496126_0191209 | Ga0496126_0191209_208_999 | 240 |
| 554 | 3300048929 | Ga0496126_0409142 | Ga0496126_0409142_255_1022 | 240 |
| 555 | 3300049459 | Ga0495678_075828 | Ga0495678_075828_54_788 | 240 |
| 556 | 3300049571 | Ga0501034_0044504 | Ga0501034_0044504_162_932 | 240 |
| 557 | 3300049574 | Ga0501038_0024848 | Ga0501038_0024848_4480_5268 | 240 |
| 558 | 3300049579 | Ga0501043_0075835 | Ga0501043_0075835_667_1455 | 240 |
| 559 | 3300050493 | nmdc:mga0k408_286695_c1 | nmdc:mga0k408_286695_c1_114_881 | 240 |
| 560 | 3300050494 | nmdc:mga06z11_32100_c1 | nmdc:mga06z11_32100_c1_885_1652 | 240 |
| 561 | 3300050496 | nmdc:mga07m45_20408_c1 | nmdc:mga07m45_20408_c1_2160_2927 | 240 |
| 562 | 3300050511 | nmdc:mga08y16_242270_c1 | nmdc:mga08y16_242270_c1_340_1107 | 240 |
| 563 | 3300050512 | nmdc:mga0n895_171740_c1 | nmdc:mga0n895_171740_c1_474_1241 | 240 |
| 564 | 3300053080 | Ga0500635_0013594 | Ga0500635_0013594_1555_2304 | 240 |
| 565 | 3300053080 | Ga0500635_0027315 | Ga0500635_0027315_446_1213 | 240 |
| 566 | 3300053085 | Ga0495619_0043214 | Ga0495619_0043214_1264_2067 | 240 |
| 567 | 3300053087 | Ga0500643_004317 | Ga0500643_004317_1496_2287 | 240 |
| 568 | 3300053096 | Ga0500641_0021968 | Ga0500641_0021968_657_1427 | 240 |
| 569 | 3300053108 | Ga0500562_012538 | Ga0500562_012538_1264_1998 | 240 |
| 570 | 3300053108 | Ga0500562_019187 | Ga0500562_019187_434_1204 | 240 |
| 571 | 3300053119 | Ga0500595_008745 | Ga0500595_008745_2849_3616 | 240 |
| 572 | 3300053125 | Ga0500618_008138 | Ga0500618_008138_14_805 | 240 |
| 573 | 3300053133 | Ga0500655_021535 | Ga0500655_021535_369_1139 | 240 |
| 574 | 3300053139 | Ga0500568_0000460 | Ga0500568_0000460_2337_3071 | 240 |
| 575 | 3300053147 | Ga0500589_113253 | Ga0500589_113253_291_1061 | 240 |
| 576 | 3300053150 | Ga0500603_014746 | Ga0500603_014746_565_1332 | 240 |
| 577 | 3300053153 | Ga0500616_0001157 | Ga0500616_0001157_9714_10448 | 240 |
| 578 | 3300053157 | Ga0500624_000027 | Ga0500624_000027_15020_15811 | 240 |
| 579 | 3300053177 | Ga0500636_0005358 | Ga0500636_0005358_3608_4399 | 240 |
| 580 | 3300053177 | Ga0500636_0019166 | Ga0500636_0019166_1218_1985 | 240 |
| 581 | 3300053177 | Ga0500636_0217722 | Ga0500636_0217722_105_872 | 240 |
| 582 | 3300053178 | Ga0500637_0125663 | Ga0500637_0125663_407_1174 | 240 |
| 583 | 3300059421 | Ga0590071_016772 | Ga0590071_016772_808_1590 | 240 |
| 584 | 3300059426 | Ga0590077_011018 | Ga0590077_011018_444_1226 | 240 |
| 585 | iso_pu_bacteria | 2507262055 | 2507507892 | 240 |
| 586 | iso_pu_bacteria | 2508501009 | 2508542003 | 240 |
| 587 | iso_pu_bacteria | 2508501042 | 2508692453 | 240 |
| 588 | iso_pu_bacteria | 2511231028 | 2511395272 | 240 |
| 589 | iso_pu_bacteria | 2513237094 | 2513639331 | 240 |
| 590 | iso_pu_bacteria | 2513237095 | 2513647293 | 240 |
| 591 | iso_pu_bacteria | 2513237102 | 2513700113 | 240 |
| 592 | iso_pu_bacteria | 2513237139 | 2513878282 | 240 |
| 593 | iso_pu_bacteria | 2513237161 | 2514009663 | 240 |
| 594 | iso_pu_bacteria | 2515154112 | 2515626791 | 240 |
| 595 | iso_pu_bacteria | 2517093001 | 2517103903 | 240 |
| 596 | iso_pu_bacteria | 2528768022 | 2528853057 | 240 |
| 597 | iso_pu_bacteria | 2617270735 | 2617346570 | 240 |
| 598 | iso_pu_bacteria | 2802429603 | 2805918470 | 240 |
| 599 | iso_pu_bacteria | 2816332527 | 2818236331 | 240 |
| 600 | iso_pu_bacteria | 2824617872 | 2824622888 | 240 |
| 601 | iso_pu_bacteria | 2824626560 | 2824631961 | 240 |
| 602 | iso_pu_bacteria | 2824635225 | 2824638540 | 240 |
| 603 | iso_pu_bacteria | 2824644064 | 2824649621 | 240 |
| 604 | iso_pu_bacteria | 2824661429 | 2824665343 | 240 |
| 605 | iso_pu_bacteria | 2824671348 | 2824678064 | 240 |
| 606 | iso_pu_bacteria | 2824687955 | 2824694458 | 240 |
| 607 | iso_pu_bacteria | 2824696289 | 2824699681 | 240 |
| 608 | iso_pu_bacteria | 2824714736 | 2824716194 | 240 |
| 609 | iso_pu_bacteria | 2824723954 | 2824726838 | 240 |
| 610 | iso_pu_bacteria | 2824773399 | 2824777316 | 240 |
| 611 | iso_pu_bacteria | 2838122688 | 2838122893 | 240 |
| 612 | iso_pu_bacteria | 2841949485 | 2841950844 | 240 |
| 613 | iso_pu_bacteria | 2841966195 | 2841973704 | 240 |
| 614 | iso_pu_bacteria | 2841983080 | 2841988960 | 240 |
| 615 | iso_pu_bacteria | 2847939898 | 2847947506 | 240 |
| 616 | iso_pu_bacteria | 2849076700 | 2849078618 | 240 |
| 617 | iso_pu_bacteria | 2857509624 | 2857513004 | 240 |
| 618 | iso_pu_bacteria | 2874590934 | 2874598995 | 240 |
| 619 | iso_pu_bacteria | 2874620515 | 2874622313 | 240 |
| 620 | iso_pu_bacteria | 2874645413 | 2874650558 | 240 |
| 621 | iso_pu_bacteria | 2876771140 | 2876779034 | 240 |
| 622 | iso_pu_bacteria | 2876808645 | 2876810623 | 240 |
| 623 | iso_pu_bacteria | 2876818435 | 2876822638 | 240 |
| 624 | iso_pu_bacteria | 2879074833 | 2879082827 | 240 |
| 625 | iso_pu_bacteria | 2879099564 | 2879102845 | 240 |
| 626 | iso_pu_bacteria | 2879127579 | 2879133108 | 240 |
| 627 | iso_pu_bacteria | 2879142872 | 2879149395 | 240 |
| 628 | iso_pu_bacteria | 2881364244 | 2881364705 | 240 |
| 629 | iso_pu_bacteria | 2885366525 | 2885369668 | 240 |
| 630 | iso_pu_bacteria | 2888378607 | 2888385226 | 240 |
| 631 | iso_pu_bacteria | 2888388044 | 2888393013 | 240 |
| 632 | iso_pu_bacteria | 2888419890 | 2888425369 | 240 |
| 633 | iso_pu_bacteria | 2904666416 | 2904667924 | 240 |
| 634 | iso_pu_bacteria | 2906626472 | 2906632295 | 240 |
| 635 | iso_pu_bacteria | 2922368715 | 2922372666 | 240 |
| 636 | iso_pu_bacteria | 2929615660 | 2929620479 | 240 |
| 637 | iso_pu_bacteria | 2929624759 | 2929626372 | 240 |
| 638 | iso_pu_bacteria | 2932784394 | 2932784755 | 240 |
| 639 | iso_pu_bacteria | 2932794094 | 2932795370 | 240 |
| 640 | iso_pu_bacteria | 2932809354 | 2932809735 | 240 |
| 641 | iso_pu_bacteria | 2932818245 | 2932818520 | 240 |
| 642 | iso_pu_bacteria | 2932828146 | 2932828538 | 240 |
| 643 | iso_pu_bacteria | 2933577622 | 2933582397 | 240 |
| 644 | iso_pu_bacteria | 2935608549 | 2935609617 | 240 |
| 645 | iso_pu_bacteria | 2935616580 | 2935617496 | 240 |
| 646 | iso_pu_bacteria | 2935638405 | 2935639022 | 240 |
| 647 | iso_pu_bacteria | 2935648319 | 2935652236 | 240 |
| 648 | iso_pu_bacteria | 2935656913 | 2935660818 | 240 |
| 649 | iso_pu_bacteria | 2935665750 | 2935666126 | 240 |
| 650 | iso_pu_bacteria | 2935675223 | 2935675775 | 240 |
| 651 | iso_pu_bacteria | 2935684952 | 2935685216 | 240 |
| 652 | iso_pu_bacteria | 2935694250 | 2935694906 | 240 |
| 653 | iso_pu_bacteria | 2935703347 | 2935704029 | 240 |
| 654 | iso_pu_bacteria | 2935713505 | 2935713769 | 240 |
| 655 | iso_pu_bacteria | 2935722832 | 2935724388 | 240 |
| 656 | iso_pu_bacteria | 2935732158 | 2935733254 | 240 |
| 657 | iso_pu_bacteria | 2935741537 | 2935742633 | 240 |
| 658 | iso_pu_bacteria | 2935750917 | 2935751181 | 240 |
| 659 | iso_pu_bacteria | 2935760218 | 2935760295 | 240 |
| 660 | iso_pu_bacteria | 2935769743 | 2935770008 | 240 |
| 661 | iso_pu_bacteria | 2935777560 | 2935784783 | 240 |
| 662 | iso_pu_bacteria | 2935785616 | 2935785750 | 240 |
| 663 | iso_pu_bacteria | 2935793552 | 2935794322 | 240 |
| 664 | iso_pu_bacteria | 2935801545 | 2935802112 | 240 |
| 665 | iso_pu_bacteria | 2935810662 | 2935810934 | 240 |
| 666 | iso_pu_bacteria | 2935819856 | 2935822779 | 240 |
| 667 | iso_pu_bacteria | 2935827899 | 2935828517 | 240 |
| 668 | iso_pu_bacteria | 2935837841 | 2935839893 | 240 |
| 669 | iso_pu_bacteria | 2935847175 | 2935848361 | 240 |
| 670 | iso_pu_bacteria | 2935855204 | 2935856121 | 240 |
| 671 | iso_pu_bacteria | 2935864058 | 2935865935 | 240 |
| 672 | iso_pu_bacteria | 2935873716 | 2935877740 | 240 |
| 673 | iso_pu_bacteria | 2935908558 | 2935909836 | 240 |
| 674 | iso_pu_bacteria | 2935916978 | 2935917560 | 240 |
| 675 | iso_pu_bacteria | 2935926038 | 2935927316 | 240 |
| 676 | iso_pu_bacteria | 2935934488 | 2935936839 | 240 |
| 677 | iso_pu_bacteria | 2935942939 | 2935944858 | 240 |
| 678 | iso_pu_bacteria | 2935951376 | 2935953295 | 240 |
| 679 | iso_pu_bacteria | 2935959822 | 2935961204 | 240 |
| 680 | iso_pu_bacteria | 2935967501 | 2935970135 | 240 |
| 681 | iso_pu_bacteria | 2935975950 | 2935980436 | 240 |
| 682 | iso_pu_bacteria | 2935984226 | 2935986703 | 240 |
| 683 | iso_pu_bacteria | 2935992306 | 2935992685 | 240 |
| 684 | iso_pu_bacteria | 2936002035 | 2936002557 | 240 |
| 685 | iso_pu_bacteria | 2936011229 | 2936014874 | 240 |
| 686 | iso_pu_bacteria | 2936019824 | 2936022145 | 240 |
| 687 | iso_pu_bacteria | 2936028420 | 2936032833 | 240 |
| 688 | iso_pu_bacteria | 2936037263 | 2936037646 | 240 |
| 689 | iso_pu_bacteria | 2936046547 | 2936050615 | 240 |
| 690 | iso_pu_bacteria | 2936055302 | 2936059609 | 240 |
| 691 | iso_pu_bacteria | 2940556831 | 2940558017 | 240 |
| 692 | iso_pu_bacteria | 2941531003 | 2941536832 | 240 |
| 693 | iso_pu_bacteria | 2941538514 | 2941540767 | 240 |
| 694 | iso_pu_bacteria | 3005506211 | 3005507305 | 240 |
| 695 | iso_pu_bacteria | 3005710791 | 3005715605 | 240 |
| 696 | iso_pu_bacteria | 8016522445 | 8016528904 | 240 |
| 697 | iso_pu_bacteria | 8016530956 | 8016534098 | 240 |
| 698 | iso_pu_bacteria | 8016539877 | 8016547327 | 240 |
| 699 | iso_pu_bacteria | 8016548790 | 8016554816 | 240 |
| 700 | iso_pu_bacteria | 8016557553 | 8016563179 | 240 |
| 701 | iso_pu_bacteria | 8016566248 | 8016572440 | 240 |
| 702 | iso_pu_bacteria | 8016583857 | 8016593882 | 240 |
| 703 | iso_pu_bacteria | 8016595262 | 8016600935 | 240 |
| 704 | iso_pu_bacteria | 8016613128 | 8016615377 | 240 |
| 705 | iso_pu_bacteria | 8016630954 | 8016639414 | 240 |
| 706 | iso_pu_bacteria | 8017057580 | 8017064632 | 240 |
| 707 | iso_pu_bacteria | 8019538911 | 8019545802 | 240 |
| 708 | iso_pu_bacteria | 8019547302 | 8019552919 | 240 |
| 709 | iso_pu_bacteria | 8019576017 | 8019583998 | 240 |
| 710 | iso_pu_bacteria | 8019586578 | 8019591805 | 240 |
| 711 | iso_pu_bacteria | 8019597564 | 8019599532 | 240 |
| 712 | iso_pu_bacteria | 8019619141 | 8019619569 | 240 |
| 713 | iso_pu_bacteria | 8019638758 | 8019646352 | 240 |
| 714 | iso_pu_bacteria | 8019648815 | 8019649102 | 240 |
| 715 | iso_pu_bacteria | 8019678201 | 8019685228 | 240 |
| 716 | iso_pu_bacteria | 8019687851 | 8019690838 | 240 |
| 717 | iso_pu_bacteria | 8055742211 | 8055745341 | 240 |
| 718 | iso_pu_bacteria | 8056967851 | 8056968806 | 240 |
| 719 | 3300003354 | JGI25160J50197_1000826 | JGI25160J50197_100082614 | 241 |
| 720 | 3300005455 | Ga0070663_100312237 | Ga0070663_1003122372 | 241 |
| 721 | 3300006042 | Ga0075368_10098687 | Ga0075368_100986871 | 241 |
| 722 | 3300006051 | Ga0075364_10165551 | Ga0075364_101655512 | 241 |
| 723 | 3300006186 | Ga0075369_10011058 | Ga0075369_100110582 | 241 |
| 724 | 3300006195 | Ga0075366_10132388 | Ga0075366_101323882 | 241 |
| 725 | 3300025302 | Ga0207426_1000402 | Ga0207426_10004027 | 241 |
| 726 | 3300046542 | Ga0495597_0014749 | Ga0495597_0014749_1037_1828 | 241 |
| 727 | 3300048928 | Ga0496125_0013222 | Ga0496125_0013222_2466_3266 | 241 |
| 728 | 3300050491 | nmdc:mga00v17_117832_c1 | nmdc:mga00v17_117832_c1_421_1221 | 241 |
| 729 | 3300050492 | nmdc:mga0yw44_184330_c1 | nmdc:mga0yw44_184330_c1_338_1138 | 241 |
| 730 | 3300003215 | JGI25153J46596_10006320 | JGI25153J46596_100063203 | 242 |
| 731 | 3300005983 | Ga0081540_1009188 | Ga0081540_10091881 | 242 |
| 732 | 3300025295 | Ga0209564_1014503 | Ga0209564_10145032 | 242 |
| 733 | 3300046524 | Ga0495648_0200028 | Ga0495648_0200028_150_950 | 242 |
| 734 | 3300053087 | Ga0500643_000046 | Ga0500643_000046_110775_111575 | 242 |
| 735 | 3300053094 | Ga0500566_0070023 | Ga0500566_0070023_82_882 | 242 |
| 736 | 3300053104 | Ga0500556_0107655 | Ga0500556_0107655_52_852 | 242 |
| 737 | 3300053105 | Ga0500557_000054 | Ga0500557_000054_14988_15788 | 242 |
| 738 | 3300053121 | Ga0500607_062768 | Ga0500607_062768_698_1498 | 242 |
| 739 | 3300053122 | Ga0500608_099352 | Ga0500608_099352_504_1304 | 242 |
| 740 | 3300053136 | Ga0500559_0175459 | Ga0500559_0175459_44_844 | 242 |
| 741 | 3300053155 | Ga0500620_004187 | Ga0500620_004187_163_963 | 242 |
| 742 | 3300053156 | Ga0500622_0012955 | Ga0500622_0012955_2263_3063 | 242 |
| 743 | 3300053160 | Ga0500633_0021962 | Ga0500633_0021962_700_1500 | 242 |
| 744 | 3300053177 | Ga0500636_0001429 | Ga0500636_0001429_11123_11923 | 242 |
| 745 | 3300053729 | Ga0500625_011807 | Ga0500625_011807_1152_1952 | 242 |
| 746 | 3300053737 | Ga0500601_000722 | Ga0500601_000722_2225_3025 | 242 |
| 747 | 3300055283 | Ga0500661_002049 | Ga0500661_002049_1592_2392 | 242 |
| 748 | 3300005334 | Ga0068869_100586891 | Ga0068869_1005868911 | 243 |
| 749 | 3300005548 | Ga0070665_100046083 | Ga0070665_1000460833 | 243 |
| 750 | 3300025909 | Ga0207705_10033323 | Ga0207705_100333233 | 243 |
| 751 | 3300025939 | Ga0207665_10245607 | Ga0207665_102456072 | 243 |
| 752 | 3300025942 | Ga0207689_10504276 | Ga0207689_105042761 | 243 |
| 753 | 3300028379 | Ga0268266_10028226 | Ga0268266_100282262 | 243 |
| 754 | 3300037471 | Ga0395905_0002238 | Ga0395905_0002238_3033_3833 | 243 |
| 755 | 3300046460 | Ga0495638_0012296 | Ga0495638_0012296_1585_2415 | 243 |
| 756 | 3300046507 | Ga0495606_0121737 | Ga0495606_0121737_285_1085 | 243 |
| 757 | 3300048912 | Ga0496109_0531469 | Ga0496109_0531469_247_1047 | 243 |
| 758 | 3300048919 | Ga0496116_0255484 | Ga0496116_0255484_29_826 | 243 |
| 759 | 3300048929 | Ga0496126_0113540 | Ga0496126_0113540_1083_1883 | 243 |
| 760 | 3300053086 | Ga0500578_0217792 | Ga0500578_0217792_184_981 | 243 |
| 761 | 3300053094 | Ga0500566_0000381 | Ga0500566_0000381_9695_10495 | 243 |
| 762 | 3300053111 | Ga0500572_000074 | Ga0500572_000074_14865_15644 | 243 |
| 763 | 3300053130 | Ga0500642_0000136 | Ga0500642_0000136_1493_2284 | 243 |
| 764 | 3300053130 | Ga0500642_0040912 | Ga0500642_0040912_475_1275 | 243 |
| 765 | 3300053134 | Ga0500658_0026826 | Ga0500658_0026826_35_865 | 243 |
| 766 | 3300053136 | Ga0500559_0000780 | Ga0500559_0000780_4428_5207 | 243 |
| 767 | 3300053136 | Ga0500559_0013121 | Ga0500559_0013121_1036_1836 | 243 |
| 768 | 3300001904 | JGI24736J21556_1010478 | JGI24736J21556_10104782 | 244 |
| 769 | 3300001979 | JGI24740J21852_10053524 | JGI24740J21852_100535241 | 244 |
| 770 | 3300001989 | JGI24739J22299_10045881 | JGI24739J22299_100458812 | 244 |
| 771 | 3300001990 | JGI24737J22298_10041879 | JGI24737J22298_100418792 | 244 |
| 772 | 3300002075 | JGI24738J21930_10021365 | JGI24738J21930_100213652 | 244 |
| 773 | 3300003215 | JGI25153J46596_10002640 | JGI25153J46596_100026406 | 244 |
| 774 | 3300003215 | JGI25153J46596_10008296 | JGI25153J46596_100082962 | 244 |
| 775 | 3300003354 | JGI25160J50197_1012801 | JGI25160J50197_10128012 | 244 |
| 776 | 3300005262 | Ga0065165_1000953 | Ga0065165_10009536 | 244 |
| 777 | 3300005262 | Ga0065165_1002778 | Ga0065165_10027789 | 244 |
| 778 | 3300005262 | Ga0065165_1016141 | Ga0065165_10161412 | 244 |
| 779 | 3300005328 | Ga0070676_10083914 | Ga0070676_100839142 | 244 |
| 780 | 3300005335 | Ga0070666_10086242 | Ga0070666_100862422 | 244 |
| 781 | 3300005339 | Ga0070660_100111058 | Ga0070660_1001110582 | 244 |
| 782 | 3300005347 | Ga0070668_100138585 | Ga0070668_1001385852 | 244 |
| 783 | 3300005353 | Ga0070669_100058680 | Ga0070669_1000586805 | 244 |
| 784 | 3300005366 | Ga0070659_100088026 | Ga0070659_1000880262 | 244 |
| 785 | 3300005367 | Ga0070667_100056373 | Ga0070667_1000563732 | 244 |
| 786 | 3300005455 | Ga0070663_100021296 | Ga0070663_1000212964 | 244 |
| 787 | 3300005455 | Ga0070663_100079555 | Ga0070663_1000795552 | 244 |
| 788 | 3300005457 | Ga0070662_100023894 | Ga0070662_1000238941 | 244 |
| 789 | 3300005457 | Ga0070662_100089686 | Ga0070662_1000896862 | 244 |
| 790 | 3300005518 | Ga0070699_100384408 | Ga0070699_1003844082 | 244 |
| 791 | 3300005539 | Ga0068853_100147807 | Ga0068853_1001478072 | 244 |
| 792 | 3300005563 | Ga0068855_100150914 | Ga0068855_1001509142 | 244 |
| 793 | 3300005614 | Ga0068856_100327042 | Ga0068856_1003270422 | 244 |
| 794 | 3300005614 | Ga0068856_100477409 | Ga0068856_1004774091 | 244 |
| 795 | 3300005616 | Ga0068852_100073636 | Ga0068852_1000736362 | 244 |
| 796 | 3300005616 | Ga0068852_100328306 | Ga0068852_1003283062 | 244 |
| 797 | 3300005719 | Ga0068861_100009251 | Ga0068861_1000092515 | 244 |
| 798 | 3300005841 | Ga0068863_100202527 | Ga0068863_1002025272 | 244 |
| 799 | 3300005843 | Ga0068860_100034329 | Ga0068860_1000343295 | 244 |
| 800 | 3300005844 | Ga0068862_100013908 | Ga0068862_1000139084 | 244 |
| 801 | 3300005844 | Ga0068862_100112279 | Ga0068862_1001122792 | 244 |
| 802 | 3300005844 | Ga0068862_100194527 | Ga0068862_1001945272 | 244 |
| 803 | 3300006038 | Ga0075365_10094729 | Ga0075365_100947292 | 244 |
| 804 | 3300006038 | Ga0075365_10133614 | Ga0075365_101336142 | 244 |
| 805 | 3300006042 | Ga0075368_10018440 | Ga0075368_100184402 | 244 |
| 806 | 3300006048 | Ga0075363_100061669 | Ga0075363_1000616692 | 244 |
| 807 | 3300006177 | Ga0075362_10169015 | Ga0075362_101690151 | 244 |
| 808 | 3300006195 | Ga0075366_10069715 | Ga0075366_100697152 | 244 |
| 809 | 3300006353 | Ga0075370_10012524 | Ga0075370_100125242 | 244 |
| 810 | 3300009093 | Ga0105240_10465850 | Ga0105240_104658501 | 244 |
| 811 | 3300009174 | Ga0105241_10143174 | Ga0105241_101431742 | 244 |
| 812 | 3300009177 | Ga0105248_10039164 | Ga0105248_100391642 | 244 |
| 813 | 3300009545 | Ga0105237_10059464 | Ga0105237_100594642 | 244 |
| 814 | 3300009545 | Ga0105237_10430544 | Ga0105237_104305442 | 244 |
| 815 | 3300009551 | Ga0105238_10202980 | Ga0105238_102029802 | 244 |
| 816 | 3300009553 | Ga0105249_10019015 | Ga0105249_100190155 | 244 |
| 817 | 3300010375 | Ga0105239_10381665 | Ga0105239_103816652 | 244 |
| 818 | 3300010375 | Ga0105239_10383971 | Ga0105239_103839712 | 244 |
| 819 | 3300011119 | Ga0105246_10121974 | Ga0105246_101219742 | 244 |
| 820 | 3300013306 | Ga0163162_10194801 | Ga0163162_101948012 | 244 |
| 821 | 3300014325 | Ga0163163_10546596 | Ga0163163_105465962 | 244 |
| 822 | 3300025230 | Ga0209563_102799 | Ga0209563_1027993 | 244 |
| 823 | 3300025258 | Ga0209129_1001101 | Ga0209129_100110113 | 244 |
| 824 | 3300025273 | Ga0209673_1001062 | Ga0209673_10010624 | 244 |
| 825 | 3300025294 | Ga0209025_1032697 | Ga0209025_10326972 | 244 |
| 826 | 3300025295 | Ga0209564_1014785 | Ga0209564_10147852 | 244 |
| 827 | 3300025297 | Ga0209758_1000345 | Ga0209758_100034575 | 244 |
| 828 | 3300025297 | Ga0209758_1008345 | Ga0209758_10083453 | 244 |
| 829 | 3300025299 | Ga0209256_1001095 | Ga0209256_100109533 | 244 |
| 830 | 3300025302 | Ga0207426_1000400 | Ga0207426_10004008 | 244 |
| 831 | 3300025302 | Ga0207426_1000736 | Ga0207426_100073641 | 244 |
| 832 | 3300025302 | Ga0207426_1007160 | Ga0207426_10071602 | 244 |
| 833 | 3300025903 | Ga0207680_10076672 | Ga0207680_100766722 | 244 |
| 834 | 3300025904 | Ga0207647_10041918 | Ga0207647_100419182 | 244 |
| 835 | 3300025907 | Ga0207645_10074877 | Ga0207645_100748772 | 244 |
| 836 | 3300025911 | Ga0207654_10183398 | Ga0207654_101833982 | 244 |
| 837 | 3300025914 | Ga0207671_10036677 | Ga0207671_100366772 | 244 |
| 838 | 3300025919 | Ga0207657_10152968 | Ga0207657_101529682 | 244 |
| 839 | 3300025920 | Ga0207649_10388049 | Ga0207649_103880492 | 244 |
| 840 | 3300025924 | Ga0207694_10358970 | Ga0207694_103589702 | 244 |
| 841 | 3300025931 | Ga0207644_10063340 | Ga0207644_100633402 | 244 |
| 842 | 3300025933 | Ga0207706_10042418 | Ga0207706_100424183 | 244 |
| 843 | 3300025934 | Ga0207686_10203467 | Ga0207686_102034672 | 244 |
| 844 | 3300025935 | Ga0207709_10223642 | Ga0207709_102236422 | 244 |
| 845 | 3300025941 | Ga0207711_10055022 | Ga0207711_100550224 | 244 |
| 846 | 3300025942 | Ga0207689_10016221 | Ga0207689_100162211 | 244 |
| 847 | 3300025949 | Ga0207667_10250852 | Ga0207667_102508522 | 244 |
| 848 | 3300025961 | Ga0207712_10006823 | Ga0207712_100068236 | 244 |
| 849 | 3300025981 | Ga0207640_10239367 | Ga0207640_102393672 | 244 |
| 850 | 3300025986 | Ga0207658_10184508 | Ga0207658_101845082 | 244 |
| 851 | 3300026041 | Ga0207639_10200816 | Ga0207639_102008162 | 244 |
| 852 | 3300026078 | Ga0207702_10479389 | Ga0207702_104793891 | 244 |
| 853 | 3300026088 | Ga0207641_10056865 | Ga0207641_100568652 | 244 |
| 854 | 3300026089 | Ga0207648_10258308 | Ga0207648_102583082 | 244 |
| 855 | 3300026116 | Ga0207674_10174349 | Ga0207674_101743492 | 244 |
| 856 | 3300026142 | Ga0207698_10088361 | Ga0207698_100883612 | 244 |
| 857 | 3300027866 | Ga0209813_10069552 | Ga0209813_100695522 | 244 |
| 858 | 3300028379 | Ga0268266_10208603 | Ga0268266_102086031 | 244 |
| 859 | 3300028380 | Ga0268265_10009598 | Ga0268265_100095986 | 244 |
| 860 | 3300028380 | Ga0268265_10128860 | Ga0268265_101288602 | 244 |
| 861 | 3300033180 | Ga0307510_10021632 | Ga0307510_100216324 | 244 |
| 862 | 3300033180 | Ga0307510_10130945 | Ga0307510_101309452 | 244 |
| 863 | 3300046454 | Ga0495592_0314512 | Ga0495592_0314512_44_856 | 244 |
| 864 | 3300046457 | Ga0495590_0075855 | Ga0495590_0075855_348_1160 | 244 |
| 865 | 3300046459 | Ga0495629_0279900 | Ga0495629_0279900_269_1069 | 244 |
| 866 | 3300046462 | Ga0495651_0035403 | Ga0495651_0035403_2531_3331 | 244 |
| 867 | 3300046474 | Ga0495605_0058583 | Ga0495605_0058583_724_1524 | 244 |
| 868 | 3300046491 | Ga0495584_0085316 | Ga0495584_0085316_11_811 | 244 |
| 869 | 3300046507 | Ga0495606_0154064 | Ga0495606_0154064_85_885 | 244 |
| 870 | 3300046511 | Ga0495608_0059301 | Ga0495608_0059301_1695_2495 | 244 |
| 871 | 3300046512 | Ga0495610_0030536 | Ga0495610_0030536_919_1719 | 244 |
| 872 | 3300046513 | Ga0495616_0055497 | Ga0495616_0055497_23_823 | 244 |
| 873 | 3300046515 | Ga0495620_0049015 | Ga0495620_0049015_562_1374 | 244 |
| 874 | 3300046515 | Ga0495620_0077440 | Ga0495620_0077440_226_1026 | 244 |
| 875 | 3300046522 | Ga0495643_0009325 | Ga0495643_0009325_3585_4385 | 244 |
| 876 | 3300046524 | Ga0495648_0049617 | Ga0495648_0049617_1354_2166 | 244 |
| 877 | 3300046529 | Ga0495652_0070348 | Ga0495652_0070348_309_1109 | 244 |
| 878 | 3300046529 | Ga0495652_0200162 | Ga0495652_0200162_73_885 | 244 |
| 879 | 3300046536 | Ga0495587_0174020 | Ga0495587_0174020_103_903 | 244 |
| 880 | 3300046538 | Ga0495609_0102151 | Ga0495609_0102151_123_935 | 244 |
| 881 | 3300046557 | Ga0495622_0013881 | Ga0495622_0013881_2221_3021 | 244 |
| 882 | 3300046557 | Ga0495622_0051770 | Ga0495622_0051770_861_1673 | 244 |
| 883 | 3300046616 | Ga0495668_0072194 | Ga0495668_0072194_992_1792 | 244 |
| 884 | 3300046660 | Ga0495625_0279754 | Ga0495625_0279754_74_874 | 244 |
| 885 | 3300046665 | Ga0495661_0118917 | Ga0495661_0118917_596_1396 | 244 |
| 886 | 3300046674 | Ga0495588_0077068 | Ga0495588_0077068_350_1150 | 244 |
| 887 | 3300046675 | Ga0495657_0025122 | Ga0495657_0025122_2094_2894 | 244 |
| 888 | 3300046689 | Ga0495613_0007936 | Ga0495613_0007936_911_1711 | 244 |
| 889 | 3300046690 | Ga0495624_0038078 | Ga0495624_0038078_1427_2227 | 244 |
| 890 | 3300046690 | Ga0495624_0270335 | Ga0495624_0270335_92_904 | 244 |
| 891 | 3300046809 | Ga0495600_0013037 | Ga0495600_0013037_2068_2868 | 244 |
| 892 | 3300047317 | Ga0495604_0038952 | Ga0495604_0038952_865_1665 | 244 |
| 893 | 3300047321 | Ga0495676_0094977 | Ga0495676_0094977_809_1609 | 244 |
| 894 | 3300047321 | Ga0495676_0307600 | Ga0495676_0307600_215_1027 | 244 |
| 895 | 3300047443 | Ga0495687_009909 | Ga0495687_009909_4042_4842 | 244 |
| 896 | 3300047472 | Ga0495686_0066313 | Ga0495686_0066313_646_1548 | 244 |
| 897 | 3300048903 | Ga0496100_0193011 | Ga0496100_0193011_26_817 | 244 |
| 898 | 3300048904 | Ga0496101_0052058 | Ga0496101_0052058_565_1356 | 244 |
| 899 | 3300048905 | Ga0496102_0045731 | Ga0496102_0045731_1852_2652 | 244 |
| 900 | 3300048905 | Ga0496102_0304408 | Ga0496102_0304408_377_1168 | 244 |
| 901 | 3300048905 | Ga0496102_0411624 | Ga0496102_0411624_306_1106 | 244 |
| 902 | 3300048905 | Ga0496102_0458890 | Ga0496102_0458890_199_987 | 244 |
| 903 | 3300048906 | Ga0496103_0013040 | Ga0496103_0013040_2026_2826 | 244 |
| 904 | 3300048906 | Ga0496103_0198439 | Ga0496103_0198439_462_1253 | 244 |
| 905 | 3300048907 | Ga0496104_0028633 | Ga0496104_0028633_2614_3414 | 244 |
| 906 | 3300048907 | Ga0496104_0041567 | Ga0496104_0041567_2289_3080 | 244 |
| 907 | 3300048907 | Ga0496104_0069427 | Ga0496104_0069427_1811_2611 | 244 |
| 908 | 3300048908 | Ga0496105_0014940 | Ga0496105_0014940_192_992 | 244 |
| 909 | 3300048908 | Ga0496105_0033632 | Ga0496105_0033632_1849_2640 | 244 |
| 910 | 3300048908 | Ga0496105_0081982 | Ga0496105_0081982_1347_2147 | 244 |
| 911 | 3300048908 | Ga0496105_0143377 | Ga0496105_0143377_892_1692 | 244 |
| 912 | 3300048909 | Ga0496106_0097872 | Ga0496106_0097872_295_1086 | 244 |
| 913 | 3300048909 | Ga0496106_0307330 | Ga0496106_0307330_16_816 | 244 |
| 914 | 3300048910 | Ga0496107_0104865 | Ga0496107_0104865_78_878 | 244 |
| 915 | 3300048911 | Ga0496108_0054477 | Ga0496108_0054477_248_1048 | 244 |
| 916 | 3300048912 | Ga0496109_0418734 | Ga0496109_0418734_309_1109 | 244 |
| 917 | 3300048913 | Ga0496110_0106873 | Ga0496110_0106873_857_1648 | 244 |
| 918 | 3300048913 | Ga0496110_0234521 | Ga0496110_0234521_168_968 | 244 |
| 919 | 3300048913 | Ga0496110_0556462 | Ga0496110_0556462_29_829 | 244 |
| 920 | 3300048913 | Ga0496110_0592077 | Ga0496110_0592077_41_841 | 244 |
| 921 | 3300048914 | Ga0496111_0066281 | Ga0496111_0066281_1262_2062 | 244 |
| 922 | 3300048915 | Ga0496112_0084499 | Ga0496112_0084499_2071_2871 | 244 |
| 923 | 3300048915 | Ga0496112_0585805 | Ga0496112_0585805_34_825 | 244 |
| 924 | 3300048916 | Ga0496113_0064474 | Ga0496113_0064474_559_1359 | 244 |
| 925 | 3300048916 | Ga0496113_0150197 | Ga0496113_0150197_37_837 | 244 |
| 926 | 3300048916 | Ga0496113_0242777 | Ga0496113_0242777_172_963 | 244 |
| 927 | 3300048919 | Ga0496116_0048297 | Ga0496116_0048297_223_1014 | 244 |
| 928 | 3300048919 | Ga0496116_0072039 | Ga0496116_0072039_982_1782 | 244 |
| 929 | 3300048920 | Ga0496117_0091177 | Ga0496117_0091177_827_1627 | 244 |
| 930 | 3300048921 | Ga0496118_0106169 | Ga0496118_0106169_734_1534 | 244 |
| 931 | 3300048921 | Ga0496118_0126991 | Ga0496118_0126991_525_1325 | 244 |
| 932 | 3300048921 | Ga0496118_0207637 | Ga0496118_0207637_188_976 | 244 |
| 933 | 3300048921 | Ga0496118_0269996 | Ga0496118_0269996_135_926 | 244 |
| 934 | 3300048922 | Ga0496119_0005991 | Ga0496119_0005991_9710_10510 | 244 |
| 935 | 3300048923 | Ga0496120_0024687 | Ga0496120_0024687_850_1650 | 244 |
| 936 | 3300048923 | Ga0496120_0070716 | Ga0496120_0070716_138_929 | 244 |
| 937 | 3300048924 | Ga0496121_0132225 | Ga0496121_0132225_702_1493 | 244 |
| 938 | 3300048927 | Ga0496124_0017619 | Ga0496124_0017619_2214_3005 | 244 |
| 939 | 3300048927 | Ga0496124_0271568 | Ga0496124_0271568_133_933 | 244 |
| 940 | 3300048928 | Ga0496125_0141482 | Ga0496125_0141482_695_1495 | 244 |
| 941 | 3300048929 | Ga0496126_0067381 | Ga0496126_0067381_2096_2989 | 244 |
| 942 | 3300048929 | Ga0496126_0215921 | Ga0496126_0215921_617_1417 | 244 |
| 943 | 3300048929 | Ga0496126_0368243 | Ga0496126_0368243_148_948 | 244 |
| 944 | 3300049460 | Ga0495682_0027421 | Ga0495682_0027421_1048_1860 | 244 |
| 945 | 3300050492 | nmdc:mga0yw44_240269_c1 | nmdc:mga0yw44_240269_c1_75_875 | 244 |
| 946 | 3300050493 | nmdc:mga0k408_191336_c1 | nmdc:mga0k408_191336_c1_97_897 | 244 |
| 947 | 3300050495 | nmdc:mga04h51_82851_c1 | nmdc:mga04h51_82851_c1_242_1042 | 244 |
| 948 | 3300050496 | nmdc:mga07m45_205883_c1 | nmdc:mga07m45_205883_c1_271_1062 | 244 |
| 949 | 3300050496 | nmdc:mga07m45_39541_c1 | nmdc:mga07m45_39541_c1_492_1292 | 244 |
| 950 | 3300050516 | nmdc:mga0sz30_17972_c1 | nmdc:mga0sz30_17972_c1_1897_2697 | 244 |
| 951 | 3300053083 | Ga0495655_0039111 | Ga0495655_0039111_205_1005 | 244 |
| 952 | 3300053119 | Ga0500595_025862 | Ga0500595_025862_970_1782 | 244 |
| 953 | 3300053730 | Ga0500645_023914 | Ga0500645_023914_893_1693 | 244 |
| 954 | 3300053731 | Ga0500609_003116 | Ga0500609_003116_1040_1834 | 244 |
| 955 | iso_pu_bacteria | 2903727486 | 2903730529 | 244 |
| 956 | iso_pu_bacteria | 2935883170 | 2935883737 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dim-assembly1.cif.gz_A | crystal structure of phosphoribosylglycinamide synthetase from anaerococcus prevotii | 0.8694 | 96 | 142 |
| 5yaa-assembly4.cif.gz_D | crystal structure of marf1 nyn domain from mus musculus | 0.8091 | 8 | 148 |
| 6fdl-assembly2.cif.gz_B | crystal structure of the nyn domain of human marf1 | 0.8017 | 8 | 149 |
| 6fdl-assembly1.cif.gz_A | crystal structure of the nyn domain of human marf1 | 0.7992 | 8 | 149 |
| 5yaa-assembly4.cif.gz_D | crystal structure of marf1 nyn domain from mus musculus | 0.7648 | 8 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9FJ91_216_314_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9001 | 53 | 145 | 3.40.50.1010 |
| 2czgB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8738 | 96 | 142 | 3.40.50.20 |
| af_P9WHH3_154_271_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8669 | 96 | 126 | 3.50.50.60 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8499 | 97 | 126 | 3.50.50.60 |
| af_Q57905_62_208_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8442 | 8 | 143 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434DGT3-F1-model_v4 | NYN domain-containing protein | 0.9504 | 1 | 141 |
GO:0004540
|
| AF-A0A7X0KP36-F1-model_v4 | NYN domain-containing protein | 0.9492 | 1 | 140 |
GO:0004540
|
| AF-A0A7C3H1K2-F1-model_v4 | NYN domain-containing protein | 0.9442 | 4 | 143 |
GO:0004540
|
| AF-F0XZS7-F1-model_v4 | NYN domain-containing protein | 0.9432 | 10 | 142 |
GO:0004540
|
| AF-A0A350KQV8-F1-model_v4 | deleted | 0.9431 | 3 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar