F486753

General Info

Members Datasets Scaffolds Average Seq Length
956 575 749 253

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0066313|Ga0495686_0066313_646_1548
Length 300
Sequence LRPLKEISSGGKGSDIGISIRRCRVLLGNVMPSELRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNARSRGWADILSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEHKTPESFRQACRRFVYTENLLAGTANTQDAGSRSTPLQPHDAATPIIKKVITQMESEDGWVTLGEVGRQLANLASDFDPRTFGFRKLSDLVRKTNSFEIDESKGRSMRIRVKPAAAPPPRTRNPRRPAARPSRSGPAGGPAPKA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
20 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
21 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
22 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
23 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
24 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
25 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
26 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
27 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
30 2643221582 Rhizobium sp. Root651 Isolate Unclassified
31 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
32 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
33 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
34 2738541293 Rhizobium sp. GV031 Isolate Unclassified
35 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
36 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
37 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
38 2791355266 Rhizobium sp. L43 Isolate Nodule
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
41 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
42 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
43 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
44 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
45 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
46 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
47 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
48 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
60 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
67 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
68 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
69 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
70 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
71 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
72 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
73 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
74 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
75 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
76 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
77 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
78 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
79 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
80 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
81 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
82 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
85 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
86 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
87 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
88 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
89 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
90 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
91 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
92 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
93 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
94 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
103 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
104 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
105 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
106 2922368715
107 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
108 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
109 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
110 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
111 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
112 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
113 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
114 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
115 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
116 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
117 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
118 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
119 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
120 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
121 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
122 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
123 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
124 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
125 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
126 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
127 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
128 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
129 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
130 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
131 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
132 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
133 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
134 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
135 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
136 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
137 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
138 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
139 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
140 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
141 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
142 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
143 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
144 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
145 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
146 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
147 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
148 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
149 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
150 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
151 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
152 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
153 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
154 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
155 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
156 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
157 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
158 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
159 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
160 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
161 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
162 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
163 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
164 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
165 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
166 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
167 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
168 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
171 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
172 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
173 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
174 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
175 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
176 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
177 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
178 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
179 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
180 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
181 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
182 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
183 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
188 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
189 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
190 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
191 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
192 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
193 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
194 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
195 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
196 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
197 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
198 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
199 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
200 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
201 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
202 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
207 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
208 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
209 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
210 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
211 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
212 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
213 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
214 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
215 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
216 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
222 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
223 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
227 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
228 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
229 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
232 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
235 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
241 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
242 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
243 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
244 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
245 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
246 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
247 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
248 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
249 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
250 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
257 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
258 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
259 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
260 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
261 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
262 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
263 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
264 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
265 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
266 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
267 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
268 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
269 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
270 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
271 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
272 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
273 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
274 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
275 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
276 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
277 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
278 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
279 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
280 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
281 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
282 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
283 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
284 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
285 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
287 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
290 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
291 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
294 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
296 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
298 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
353 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
357 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
358 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
359 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
360 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
361 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
362 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
363 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
365 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
366 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
367 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
368 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
369 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
370 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
371 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
372 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
373 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
374 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
375 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
376 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
377 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
378 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
379 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
380 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
381 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
382 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
383 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
384 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
385 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
386 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
387 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
388 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
389 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
390 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
391 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
392 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
393 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
394 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
395 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
396 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
397 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
398 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
399 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
400 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
401 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
402 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
403 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
404 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
405 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
408 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
409 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
410 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
411 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
415 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
416 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
417 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
418 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
419 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
420 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
421 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
422 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
423 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
424 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
425 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
426 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
427 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
428 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
429 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
430 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
431 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
434 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
435 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
436 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
437 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
438 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
439 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
440 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
441 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
442 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
443 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
444 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
445 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
448 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
449 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
450 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
451 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
452 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
453 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
454 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
455 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
456 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
457 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
458 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
459 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
460 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
461 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
462 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
463 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
464 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
465 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
470 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
471 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
474 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
475 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
476 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
479 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
480 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
481 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
482 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
483 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
484 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
491 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
494 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
497 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
500 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
501 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
502 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
503 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
504 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
505 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
506 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
507 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
508 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
509 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
510 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
511 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
512 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
513 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
514 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
515 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
516 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
517 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
518 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
519 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
520 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
521 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
522 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
525 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
526 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
529 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
530 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
533 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
534 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
535 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
536 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
540 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
541 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
542 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
543 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
544 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
545 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
546 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
549 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
550 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
551 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
552 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
553 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
558 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
559 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
560 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
561 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
562 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
563 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
564 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
565 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
566 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
567 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
568 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
569 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
570 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
571 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
572 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
573 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
574 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
575 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.32
Metatranscriptomes 0.1
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.85
Nodule 16.42
Rhizoplane 4.92
Rhizosphere 50.73
Stem 0
Stem Tuber 0
Unclassified 13.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1010478 3300001904 Bacteria 1513
2 JGI24740J21852_10009539 3300001979 Bacteria 3793
3 JGI24740J21852_10018129 3300001979 Bacteria 2505
4 JGI24740J21852_10043019 3300001979 Bacteria 1349
5 JGI24740J21852_10053524 3300001979 Bacteria 1144
6 JGI24739J22299_10045881 3300001989 Bacteria 1432
7 JGI24739J22299_10070700 3300001989 Bacteria 1086
8 JGI24737J22298_10041879 3300001990 Bacteria 1404
9 JGI24735J21928_10050971 3300002067 Bacteria 1195
10 JGI24738J21930_10021365 3300002075 Bacteria 1342
11 JGI25165J46597_1000006 3300003214 Bacteria 529784
12 JGI25153J46596_10002640 3300003215 Bacteria 10246
13 JGI25153J46596_10006320 3300003215 Bacteria 6030
14 JGI25153J46596_10008296 3300003215 Bacteria 4986
15 rootL2_10177720 3300003322 Bacteria 1472
16 JGI25160J50197_1000826 3300003354 Bacteria 16549
17 JGI25160J50197_1012801 3300003354 Bacteria 2890
18 JGI25404J52841_10011078 3300003659 Bacteria 1941
19 JGI25404J52841_10039595 3300003659 Bacteria 998
20 Ga0055528_1000544 3300003790 Bacteria 28745
21 Ga0065165_1000953 3300005262 Bacteria 36442
22 Ga0065165_1002778 3300005262 Bacteria 13850
23 Ga0065165_1016141 3300005262 Bacteria 2810
24 Ga0070658_10328052 3300005327 Bacteria 1307
25 Ga0070658_10492434 3300005327 Bacteria 1058
26 Ga0070676_10083914 3300005328 Bacteria 1939
27 Ga0070676_10085855 3300005328 Bacteria 1919
28 Ga0070683_100007383 3300005329 Bacteria 9286
29 Ga0070683_100031653 3300005329 Bacteria 4813
30 Ga0068869_100188815 3300005334 Bacteria 1619
31 Ga0068869_100480231 3300005334 Bacteria 1035
32 Ga0068869_100586891 3300005334 Bacteria 940
33 Ga0070666_10086242 3300005335 Bacteria 2151
34 Ga0070680_100531114 3300005336 Bacteria 1007
35 Ga0070682_100058791 3300005337 Bacteria 2425
36 Ga0070682_100313768 3300005337 Bacteria 1155
37 Ga0070660_100111058 3300005339 Bacteria 2181
38 Ga0070668_100138585 3300005347 Bacteria 1959
39 Ga0070669_100058680 3300005353 Bacteria 2824
40 Ga0070688_100269133 3300005365 Bacteria 1220
41 Ga0070659_100088026 3300005366 Bacteria 2487
42 Ga0070667_100056373 3300005367 Bacteria 3319
43 Ga0070709_10036716 3300005434 Bacteria 2987
44 Ga0070709_10307754 3300005434 Bacteria 1159
45 Ga0070714_100002584 3300005435 Bacteria 13346
46 Ga0070714_100585084 3300005435 Bacteria 1071
47 Ga0070713_100086394 3300005436 Bacteria 2689
48 Ga0070710_10000501 3300005437 Bacteria 18393
49 Ga0070710_10183781 3300005437 Bacteria 1311
50 Ga0070710_10476192 3300005437 Bacteria 851
51 Ga0070701_10033118 3300005438 Bacteria 2580
52 Ga0070711_100044952 3300005439 Bacteria 3000
53 Ga0070663_100021296 3300005455 Bacteria 4309
54 Ga0070663_100027618 3300005455 Bacteria 3855
55 Ga0070663_100079555 3300005455 Bacteria 2405
56 Ga0070663_100312237 3300005455 Bacteria 1262
57 Ga0070678_100086429 3300005456 Bacteria 2392
58 Ga0070678_100198686 3300005456 Bacteria 1654
59 Ga0070662_100023894 3300005457 Bacteria 4205
60 Ga0070662_100089686 3300005457 Bacteria 2307
61 Ga0070681_10033499 3300005458 Bacteria 5157
62 Ga0070681_10182527 3300005458 Bacteria 2019
63 Ga0070698_100736491 3300005471 Bacteria 929
64 Ga0070699_100384408 3300005518 Bacteria 1268
65 Ga0070679_100092244 3300005530 Bacteria 3016
66 Ga0070679_100334912 3300005530 Bacteria 1462
67 Ga0070684_100002474 3300005535 Bacteria 13604
68 Ga0068853_100001742 3300005539 Bacteria 15948
69 Ga0068853_100013884 3300005539 Bacteria 6585
70 Ga0068853_100099647 3300005539 Bacteria 2567
71 Ga0068853_100147807 3300005539 Bacteria 2113
72 Ga0068853_100267441 3300005539 Bacteria 1573
73 Ga0070672_100328535 3300005543 Bacteria 1301
74 Ga0070665_100046083 3300005548 Bacteria 4379
75 Ga0070665_100069708 3300005548 Bacteria 3524
76 Ga0070665_100427743 3300005548 Bacteria 1333
77 Ga0068855_100075640 3300005563 Bacteria 3909
78 Ga0068855_100150914 3300005563 Bacteria 2642
79 Ga0068857_100036325 3300005577 Bacteria 4365
80 Ga0068857_100418811 3300005577 Bacteria 1248
81 Ga0068857_100457678 3300005577 Bacteria 1194
82 Ga0068854_100039271 3300005578 Bacteria 3334
83 Ga0068854_100056832 3300005578 Bacteria 2821
84 Ga0068854_100321297 3300005578 Bacteria 1258
85 Ga0068856_100012955 3300005614 Bacteria 8074
86 Ga0068856_100322481 3300005614 Bacteria 1562
87 Ga0068856_100327042 3300005614 Bacteria 1551
88 Ga0068856_100477409 3300005614 Bacteria 1268
89 Ga0068856_100818653 3300005614 Bacteria 951
90 Ga0068852_100073636 3300005616 Bacteria 3005
91 Ga0068852_100328306 3300005616 Bacteria 1488
92 Ga0068852_100602969 3300005616 Bacteria 1102
93 Ga0068859_100176840 3300005617 Bacteria 2216
94 Ga0068859_100248636 3300005617 Bacteria 1868
95 Ga0068859_100534830 3300005617 Bacteria 1267
96 Ga0068864_100452028 3300005618 Bacteria 1229
97 Ga0068861_100009251 3300005719 Bacteria 6797
98 Ga0068861_100050478 3300005719 Bacteria 3154
99 Ga0068861_100266140 3300005719 Bacteria 1470
100 Ga0068861_100445797 3300005719 Bacteria 1159
101 Ga0068851_10046400 3300005834 Bacteria 2197
102 Ga0068851_10183348 3300005834 Bacteria 1160
103 Ga0068863_100202527 3300005841 Bacteria 1910
104 Ga0068858_100061887 3300005842 Bacteria 3460
105 Ga0068858_100624858 3300005842 Bacteria 1046
106 Ga0068860_100000217 3300005843 Bacteria 90245
107 Ga0068860_100034329 3300005843 Bacteria 4864
108 Ga0068862_100013908 3300005844 Bacteria 6671
109 Ga0068862_100044093 3300005844 Bacteria 3804
110 Ga0068862_100112279 3300005844 Bacteria 2393
111 Ga0068862_100194527 3300005844 Bacteria 1826
112 Ga0081455_10136729 3300005937 Bacteria 1909
113 Ga0081540_1006420 3300005983 Bacteria 8561
114 Ga0081540_1009150 3300005983 Bacteria 6836
115 Ga0081540_1009188 3300005983 Bacteria 6819
116 Ga0081540_1058566 3300005983 Bacteria 1855
117 Ga0081540_1061289 3300005983 Bacteria 1794
118 Ga0081540_1107676 3300005983 Bacteria 1186
119 Ga0070717_10223502 3300006028 Bacteria 1656
120 Ga0070717_10567823 3300006028 Bacteria 1028
121 Ga0075365_10093101 3300006038 Bacteria 2055
122 Ga0075365_10094729 3300006038 Bacteria 2038
123 Ga0075365_10133614 3300006038 Bacteria 1718
124 Ga0075365_10143954 3300006038 Bacteria 1655
125 Ga0075368_10018440 3300006042 Bacteria 2622
126 Ga0075368_10098687 3300006042 Bacteria 1198
127 Ga0075363_100061669 3300006048 Bacteria 2021
128 Ga0075363_100077582 3300006048 Bacteria 1813
129 Ga0075364_10064214 3300006051 Bacteria 2410
130 Ga0075364_10165551 3300006051 Bacteria 1494
131 Ga0070716_100001649 3300006173 Bacteria 10072
132 Ga0070712_100270628 3300006175 Bacteria 1364
133 Ga0075362_10007812 3300006177 Bacteria 4067
134 Ga0075362_10169015 3300006177 Bacteria 1056
135 Ga0075367_10021221 3300006178 Bacteria 3627
136 Ga0075369_10011058 3300006186 Bacteria 3541
137 Ga0075366_10069715 3300006195 Bacteria 2093
138 Ga0075366_10089603 3300006195 Bacteria 1843
139 Ga0075366_10132388 3300006195 Bacteria 1505
140 Ga0075366_10153173 3300006195 Bacteria 1396
141 Ga0097621_100056820 3300006237 Bacteria 3198
142 Ga0075370_10003227 3300006353 Bacteria 7718
143 Ga0075370_10012524 3300006353 Bacteria 4485
144 Ga0068871_100281926 3300006358 Bacteria 1454
145 Ga0068871_100286171 3300006358 Bacteria 1443
146 Ga0068871_100398121 3300006358 Bacteria 1226
147 Ga0075428_100041687 3300006844 Bacteria 5046
148 Ga0075428_100196785 3300006844 Bacteria 2180
149 Ga0075428_100645452 3300006844 Bacteria 1129
150 Ga0075431_100642590 3300006847 Bacteria 1042
151 Ga0075434_100115025 3300006871 Bacteria 2703
152 Ga0075434_100172071 3300006871 Bacteria 2186
153 Ga0068865_100159767 3300006881 Bacteria 1718
154 Ga0068865_100316578 3300006881 Bacteria 1254
155 Ga0097620_100176845 3300006931 Bacteria 2216
156 Ga0097620_100248637 3300006931 Bacteria 1868
157 Ga0097620_100534810 3300006931 Bacteria 1267
158 Ga0099794_10023859 3300007265 Bacteria 2802
159 Ga0105240_10000336 3300009093 Bacteria 87900
160 Ga0105240_10003411 3300009093 Bacteria 24689
161 Ga0105240_10465850 3300009093 Bacteria 1411
162 Ga0111539_10167067 3300009094 Bacteria 2572
163 Ga0105245_10160454 3300009098 Bacteria 2133
164 Ga0105247_10008005 3300009101 Bacteria 6458
165 Ga0105247_10132294 3300009101 Bacteria 1627
166 Ga0105243_10085956 3300009148 Bacteria 2579
167 Ga0105241_10013101 3300009174 Bacteria 6082
168 Ga0105241_10082829 3300009174 Bacteria 2515
169 Ga0105241_10143174 3300009174 Bacteria 1949
170 Ga0105241_10406186 3300009174 Bacteria 1196
171 Ga0105248_10009311 3300009177 Bacteria 10814
172 Ga0105248_10014838 3300009177 Bacteria 8582
173 Ga0105248_10039164 3300009177 Bacteria 5308
174 Ga0105248_10153724 3300009177 Bacteria 2596
175 Ga0105237_10000690 3300009545 Bacteria 46704
176 Ga0105237_10056017 3300009545 Bacteria 3947
177 Ga0105237_10059464 3300009545 Bacteria 3823
178 Ga0105237_10066120 3300009545 Bacteria 3610
179 Ga0105237_10088873 3300009545 Bacteria 3079
180 Ga0105237_10183098 3300009545 Bacteria 2095
181 Ga0105237_10250188 3300009545 Bacteria 1774
182 Ga0105237_10310279 3300009545 Bacteria 1581
183 Ga0105237_10430544 3300009545 Bacteria 1325
184 Ga0105238_10005788 3300009551 Bacteria 12235
185 Ga0105238_10007078 3300009551 Bacteria 11224
186 Ga0105238_10202980 3300009551 Bacteria 1958
187 Ga0105238_10275551 3300009551 Bacteria 1663
188 Ga0105238_10339591 3300009551 Bacteria 1490
189 Ga0105238_10551698 3300009551 Bacteria 1157
190 Ga0105249_10019015 3300009553 Bacteria 6126
191 Ga0105249_10393375 3300009553 Bacteria 1415
192 Ga0105249_10711666 3300009553 Bacteria 1065
193 Ga0099796_10084012 3300010159 Bacteria 1172
194 Ga0105239_10006751 3300010375 Bacteria 13254
195 Ga0105239_10008236 3300010375 Bacteria 11890
196 Ga0105239_10070772 3300010375 Bacteria 3832
197 Ga0105239_10375310 3300010375 Bacteria 1607
198 Ga0105239_10381665 3300010375 Bacteria 1593
199 Ga0105239_10383971 3300010375 Bacteria 1588
200 Ga0105239_10461945 3300010375 Bacteria 1441
201 Ga0105239_10712954 3300010375 Bacteria 1147
202 Ga0105239_10957680 3300010375 Bacteria 983
203 Ga0105246_10121974 3300011119 Bacteria 1933
204 Ga0105246_10426055 3300011119 Bacteria 1109
205 Ga0157370_10006306 3300013104 Bacteria 13106
206 Ga0157369_10118453 3300013105 Bacteria 2810
207 Ga0157369_10155960 3300013105 Bacteria 2411
208 Ga0157374_10371927 3300013296 Bacteria 1423
209 Ga0157378_10126465 3300013297 Bacteria 2361
210 Ga0157378_10207621 3300013297 Bacteria 1856
211 Ga0163162_10038979 3300013306 Bacteria 4744
212 Ga0163162_10194801 3300013306 Bacteria 2155
213 Ga0163162_10370534 3300013306 Bacteria 1565
214 Ga0157372_10138050 3300013307 Bacteria 2808
215 Ga0157372_10737478 3300013307 Bacteria 1146
216 Ga0157375_10249707 3300013308 Bacteria 1935
217 Ga0157375_10409895 3300013308 Bacteria 1521
218 Ga0157375_10595262 3300013308 Bacteria 1265
219 Ga0163163_10108583 3300014325 Bacteria 2802
220 Ga0163163_10546596 3300014325 Bacteria 1221
221 Ga0157380_10030487 3300014326 Bacteria 4131
222 Ga0157380_10089716 3300014326 Bacteria 2534
223 Ga0182008_10020976 3300014497 Bacteria 3360
224 Ga0182008_10041989 3300014497 Bacteria 2279
225 Ga0157379_10341744 3300014968 Bacteria 1369
226 Ga0157376_10402613 3300014969 Bacteria 1324
227 Ga0182007_10037005 3300015262 Bacteria 1640
228 Ga0182007_10054633 3300015262 Bacteria 1313
229 Ga0182005_1005352 3300015265 Bacteria 4021
230 Ga0163161_10189762 3300017792 Bacteria 1579
231 Ga0214543_1003759 3300021327 Bacteria 29285
232 Ga0213876_10060936 3300021384 Bacteria 1991
233 Ga0209563_102799 3300025230 Bacteria 3815
234 Ga0209437_107178 3300025233 Bacteria 1825
235 Ga0209677_103335 3300025253 Bacteria 5282
236 Ga0209148_1015515 3300025254 Bacteria 1329
237 Ga0209129_1001101 3300025258 Bacteria 15742
238 Ga0209233_1000010 3300025261 Bacteria 1194329
239 Ga0209233_1000097 3300025261 Bacteria 295452
240 Ga0209233_1006432 3300025261 Bacteria 3787
241 Ga0209455_1003379 3300025272 Bacteria 5674
242 Ga0209673_1000126 3300025273 Bacteria 167949
243 Ga0209673_1001062 3300025273 Bacteria 31387
244 Ga0209673_1002727 3300025273 Bacteria 11650
245 Ga0209025_1032697 3300025294 Bacteria 2424
246 Ga0209564_1000368 3300025295 Bacteria 83910
247 Ga0209564_1014503 3300025295 Bacteria 3273
248 Ga0209564_1014785 3300025295 Bacteria 3219
249 Ga0209758_1000345 3300025297 Bacteria 84958
250 Ga0209758_1000527 3300025297 Bacteria 61122
251 Ga0209758_1005729 3300025297 Bacteria 9361
252 Ga0209758_1008345 3300025297 Bacteria 6740
253 Ga0209758_1019444 3300025297 Bacteria 3273
254 Ga0209256_1001075 3300025299 Bacteria 31597
255 Ga0209256_1001095 3300025299 Bacteria 31168
256 Ga0207426_1000400 3300025302 Bacteria 73493
257 Ga0207426_1000402 3300025302 Bacteria 72738
258 Ga0207426_1000736 3300025302 Bacteria 37388
259 Ga0207426_1007160 3300025302 Bacteria 4709
260 Ga0209051_1002366 3300025303 Bacteria 13638
261 Ga0207656_10004091 3300025321 Bacteria 5061
262 Ga0207682_10124792 3300025893 Bacteria 1145
263 Ga0207692_10002994 3300025898 Bacteria 6550
264 Ga0207710_10015744 3300025900 Bacteria 3198
265 Ga0207710_10049206 3300025900 Bacteria 1888
266 Ga0207688_10052512 3300025901 Bacteria 2284
267 Ga0207680_10076672 3300025903 Bacteria 2088
268 Ga0207680_10178416 3300025903 Bacteria 1435
269 Ga0207647_10015521 3300025904 Bacteria 5218
270 Ga0207647_10041918 3300025904 Bacteria 2874
271 Ga0207699_10025361 3300025906 Bacteria 3253
272 Ga0207645_10074877 3300025907 Bacteria 2167
273 Ga0207705_10033323 3300025909 Bacteria 3679
274 Ga0207705_10287041 3300025909 Bacteria 1260
275 Ga0207654_10000717 3300025911 Bacteria 18498
276 Ga0207654_10032296 3300025911 Bacteria 2891
277 Ga0207654_10183398 3300025911 Bacteria 1367
278 Ga0207707_10001371 3300025912 Bacteria 22592
279 Ga0207707_10024804 3300025912 Bacteria 5246
280 Ga0207707_10407619 3300025912 Bacteria 1166
281 Ga0207695_10000458 3300025913 Bacteria 88734
282 Ga0207695_10002499 3300025913 Bacteria 27042
283 Ga0207695_10153319 3300025913 Bacteria 2241
284 Ga0207671_10011705 3300025914 Bacteria 7111
285 Ga0207671_10018973 3300025914 Bacteria 5269
286 Ga0207671_10036677 3300025914 Bacteria 3637
287 Ga0207671_10155129 3300025914 Bacteria 1771
288 Ga0207693_10292539 3300025915 Bacteria 1276
289 Ga0207663_10120570 3300025916 Bacteria 1795
290 Ga0207660_10103941 3300025917 Bacteria 2126
291 Ga0207657_10152968 3300025919 Bacteria 1878
292 Ga0207649_10388049 3300025920 Bacteria 1042
293 Ga0207652_10028115 3300025921 Bacteria 4690
294 Ga0207652_10039261 3300025921 Bacteria 4017
295 Ga0207681_10047323 3300025923 Bacteria 2897
296 Ga0207681_10156904 3300025923 Bacteria 1711
297 Ga0207694_10000258 3300025924 Bacteria 50514
298 Ga0207694_10018430 3300025924 Bacteria 5275
299 Ga0207694_10358970 3300025924 Bacteria 1207
300 Ga0207659_10448625 3300025926 Bacteria 1086
301 Ga0207700_10145389 3300025928 Bacteria 1953
302 Ga0207664_10038825 3300025929 Bacteria 3694
303 Ga0207644_10063340 3300025931 Bacteria 2685
304 Ga0207706_10042418 3300025933 Bacteria 4032
305 Ga0207686_10203467 3300025934 Bacteria 1419
306 Ga0207686_10263435 3300025934 Bacteria 1265
307 Ga0207709_10223642 3300025935 Bacteria 1359
308 Ga0207709_10281832 3300025935 Bacteria 1228
309 Ga0207665_10002675 3300025939 Bacteria 11969
310 Ga0207665_10245607 3300025939 Bacteria 1321
311 Ga0207691_10034093 3300025940 Bacteria 4738
312 Ga0207711_10009071 3300025941 Bacteria 8310
313 Ga0207711_10055022 3300025941 Bacteria 3416
314 Ga0207711_10238252 3300025941 Bacteria 1668
315 Ga0207711_10717426 3300025941 Bacteria 932
316 Ga0207689_10016221 3300025942 Bacteria 6309
317 Ga0207689_10504276 3300025942 Bacteria 1014
318 Ga0207689_10647975 3300025942 Bacteria 890
319 Ga0207661_10000331 3300025944 Bacteria 30097
320 Ga0207661_10032719 3300025944 Bacteria 4032
321 Ga0207679_10500171 3300025945 Bacteria 1084
322 Ga0207667_10009886 3300025949 Bacteria 11193
323 Ga0207667_10250852 3300025949 Bacteria 1810
324 Ga0207712_10006823 3300025961 Bacteria 7205
325 Ga0207712_10078385 3300025961 Bacteria 2397
326 Ga0207712_10521476 3300025961 Bacteria 1018
327 Ga0207668_10166914 3300025972 Bacteria 1722
328 Ga0207668_10210924 3300025972 Bacteria 1553
329 Ga0207640_10013426 3300025981 Bacteria 4694
330 Ga0207640_10046755 3300025981 Bacteria 2787
331 Ga0207640_10239367 3300025981 Bacteria 1401
332 Ga0207658_10184508 3300025986 Bacteria 1729
333 Ga0207703_10134015 3300026035 Bacteria 2142
334 Ga0207639_10072505 3300026041 Bacteria 2696
335 Ga0207639_10169897 3300026041 Bacteria 1845
336 Ga0207639_10200816 3300026041 Bacteria 1710
337 Ga0207639_10401952 3300026041 Bacteria 1234
338 Ga0207678_10007094 3300026067 Bacteria 9938
339 Ga0207678_10073914 3300026067 Bacteria 2921
340 Ga0207678_10285905 3300026067 Bacteria 1416
341 Ga0207708_10341706 3300026075 Bacteria 1226
342 Ga0207702_10000006 3300026078 Bacteria 346370
343 Ga0207702_10376403 3300026078 Bacteria 1364
344 Ga0207702_10479389 3300026078 Bacteria 1210
345 Ga0207641_10056865 3300026088 Bacteria 3326
346 Ga0207641_10421130 3300026088 Bacteria 1286
347 Ga0207648_10258308 3300026089 Bacteria 1554
348 Ga0207676_10443065 3300026095 Bacteria 1223
349 Ga0207676_10536164 3300026095 Bacteria 1116
350 Ga0207674_10056094 3300026116 Bacteria 4002
351 Ga0207674_10065044 3300026116 Bacteria 3677
352 Ga0207674_10077710 3300026116 Bacteria 3325
353 Ga0207674_10084921 3300026116 Bacteria 3163
354 Ga0207674_10174349 3300026116 Bacteria 2103
355 Ga0207674_10501809 3300026116 Bacteria 1172
356 Ga0207674_10789912 3300026116 Bacteria 916
357 Ga0207675_100124665 3300026118 Bacteria 2439
358 Ga0207675_100415244 3300026118 Bacteria 1328
359 Ga0207675_100522830 3300026118 Bacteria 1183
360 Ga0207683_10047777 3300026121 Bacteria 3748
361 Ga0207683_10103844 3300026121 Bacteria 2539
362 Ga0207683_10164930 3300026121 Bacteria 2004
363 Ga0207683_10251174 3300026121 Bacteria 1614
364 Ga0207698_10055008 3300026142 Bacteria 3064
365 Ga0207698_10088361 3300026142 Bacteria 2527
366 Ga0207698_10512724 3300026142 Bacteria 1169
367 Ga0209588_1068054 3300027671 Bacteria 1150
368 Ga0209813_10069552 3300027866 Bacteria 1142
369 Ga0268266_10028226 3300028379 Bacteria 4771
370 Ga0268266_10105070 3300028379 Bacteria 2494
371 Ga0268266_10208603 3300028379 Bacteria 1791
372 Ga0268266_10226873 3300028379 Bacteria 1719
373 Ga0268266_10323895 3300028379 Bacteria 1443
374 Ga0268266_10367665 3300028379 Bacteria 1354
375 Ga0268265_10009598 3300028380 Bacteria 6535
376 Ga0268265_10128860 3300028380 Bacteria 2099
377 Ga0268264_10000271 3300028381 Bacteria 90154
378 Ga0307509_10025601 3300031507 Bacteria 6586
379 Ga0307509_10029127 3300031507 Bacteria 6132
380 Ga0307408_100050149 3300031548 Bacteria 3001
381 Ga0307408_100370555 3300031548 Bacteria 1221
382 Ga0307408_100725981 3300031548 Bacteria 895
383 Ga0307508_10039588 3300031616 Bacteria 4233
384 Ga0307406_10301812 3300031901 Bacteria 1231
385 Ga0307416_100471782 3300032002 Bacteria 1313
386 Ga0307416_100625351 3300032002 Bacteria 1159
387 Ga0307411_10082470 3300032005 Bacteria 2218
388 Ga0307415_100064954 3300032126 Bacteria 2541
389 Ga0316593_10008780 3300032168 Bacteria 2833
390 Ga0307507_10013433 3300033179 Bacteria 9942
391 Ga0307510_10012167 3300033180 Bacteria 10203
392 Ga0307510_10021632 3300033180 Bacteria 7494
393 Ga0307510_10130945 3300033180 Bacteria 2182
394 Ga0307510_10299175 3300033180 Bacteria 1072
395 Ga0373955_0070441 3300035172 Bacteria 1954
396 Ga0316574_0215994 3300035398 Bacteria 1230
397 Ga0373935_0160393 3300035692 Bacteria 1532
398 Ga0373927_0005221 3300035695 Bacteria 8984
399 Ga0373927_0190934 3300035695 Bacteria 1344
400 Ga0373947_0104443 3300035725 Bacteria 1784
401 Ga0316582_0017683 3300036647 Bacteria 4131
402 Ga0373925_0196585 3300037068 Bacteria 1602
403 Ga0395898_0183641 3300037466 Bacteria 1998
404 Ga0395905_0002238 3300037471 Bacteria 21782
405 Ga0395901_0554737 3300038443 Bacteria 1164
406 Ga0436365_0301686 3300039437 Bacteria 9817
407 Ga0436365_0920281 3300039437 Bacteria 1605
408 Ga0436365_1546724 3300039437 Bacteria 1588
409 Ga0436365_1866973 3300039437 Bacteria 2842
410 Ga0436363_1116250 3300039450 Bacteria 1162
411 Ga0451833_0666882 3300041491 Bacteria 1165
412 Ga0451835_0701798 3300041492 Bacteria 1397
413 Ga0451835_0846484 3300041492 Bacteria 1528
414 Ga0451837_0832108 3300041494 Bacteria 5281
415 Ga0451837_1509718 3300041494 Bacteria 1397
416 Ga0451839_0615725 3300041496 Bacteria 1735
417 Ga0451839_1099990 3300041496 Bacteria 1397
418 Ga0451841_0047544 3300041498 Bacteria 1326
419 Ga0451841_0234887 3300041498 Bacteria 5141
420 Ga0451845_0451105 3300041501 Bacteria 1397
421 Ga0451847_0137423 3300041503 Bacteria 1397
422 Ga0451849_0615251 3300041505 Bacteria 4275
423 Ga0451849_0766215 3300041505 Bacteria 1397
424 Ga0451851_0095856 3300041507 Bacteria 1161
425 Ga0451843_0126997 3300041509 Bacteria 3404
426 Ga0451843_0277846 3300041509 Bacteria 1397
427 Ga0451855_0106049 3300041511 Bacteria 1638
428 Ga0451855_0179822 3300041511 Bacteria 1270
429 Ga0451853_3361738 3300041512 Bacteria 4036
430 Ga0451853_3365732 3300041512 Bacteria 1117
431 Ga0439435_0003562 3300042436 Bacteria 3254
432 Ga0495592_0314512 3300046454 Bacteria 1014
433 Ga0495603_0017441 3300046455 Bacteria 4344
434 Ga0495603_0177318 3300046455 Bacteria 1233
435 Ga0495603_0193862 3300046455 Bacteria 1174
436 Ga0495590_0075855 3300046457 Bacteria 1183
437 Ga0495629_0279900 3300046459 Bacteria 1145
438 Ga0495638_0000093 3300046460 Bacteria 142356
439 Ga0495638_0012296 3300046460 Bacteria 5871
440 Ga0495638_0094810 3300046460 Bacteria 1793
441 Ga0495651_0004745 3300046462 Bacteria 10404
442 Ga0495651_0035403 3300046462 Bacteria 3887
443 Ga0495650_0078871 3300046471 Bacteria 1274
444 Ga0495582_0298543 3300046473 Bacteria 926
445 Ga0495605_0058583 3300046474 Bacteria 1851
446 Ga0495605_0073658 3300046474 Bacteria 1608
447 Ga0495639_0033281 3300046475 Bacteria 2302
448 Ga0495639_0130439 3300046475 Bacteria 1203
449 Ga0495664_0021353 3300046477 Bacteria 3740
450 Ga0495664_0366400 3300046477 Bacteria 867
451 Ga0495584_0085316 3300046491 Bacteria 1591
452 Ga0495585_0116112 3300046492 Bacteria 1419
453 Ga0495594_0052519 3300046499 Bacteria 2244
454 Ga0495594_0171331 3300046499 Bacteria 1235
455 Ga0495607_0111819 3300046501 Bacteria 1447
456 Ga0495606_0013391 3300046507 Bacteria 6481
457 Ga0495606_0059370 3300046507 Bacteria 2454
458 Ga0495606_0121737 3300046507 Bacteria 1561
459 Ga0495606_0142679 3300046507 Bacteria 1413
460 Ga0495606_0154064 3300046507 Bacteria 1346
461 Ga0495608_0009046 3300046511 Bacteria 6968
462 Ga0495608_0059301 3300046511 Bacteria 2522
463 Ga0495610_0003544 3300046512 Bacteria 12092
464 Ga0495610_0030536 3300046512 Bacteria 2823
465 Ga0495616_0051909 3300046513 Bacteria 2043
466 Ga0495616_0055497 3300046513 Bacteria 1961
467 Ga0495620_0011824 3300046515 Bacteria 4538
468 Ga0495620_0049015 3300046515 Bacteria 1810
469 Ga0495620_0077440 3300046515 Bacteria 1350
470 Ga0495628_0047046 3300046516 Bacteria 3425
471 Ga0495631_0025660 3300046518 Bacteria 2711
472 Ga0495631_0049221 3300046518 Bacteria 1846
473 Ga0495632_0012123 3300046519 Bacteria 4986
474 Ga0495632_0069407 3300046519 Bacteria 1697
475 Ga0495643_0009325 3300046522 Bacteria 6109
476 Ga0495643_0051206 3300046522 Bacteria 2221
477 Ga0495643_0079847 3300046522 Bacteria 1704
478 Ga0495648_0049617 3300046524 Bacteria 2571
479 Ga0495648_0154229 3300046524 Bacteria 1195
480 Ga0495648_0200028 3300046524 Bacteria 1001
481 Ga0495666_0062894 3300046526 Bacteria 1772
482 Ga0495652_0025991 3300046529 Bacteria 5173
483 Ga0495652_0070348 3300046529 Bacteria 2925
484 Ga0495652_0200162 3300046529 Bacteria 1516
485 Ga0495587_0024739 3300046536 Bacteria 3677
486 Ga0495587_0174020 3300046536 Bacteria 1222
487 Ga0495609_0059358 3300046538 Bacteria 1691
488 Ga0495609_0102151 3300046538 Bacteria 1242
489 Ga0495597_0004648 3300046542 Bacteria 7477
490 Ga0495597_0014749 3300046542 Bacteria 3716
491 Ga0495597_0055352 3300046542 Bacteria 1740
492 Ga0495645_0089611 3300046543 Bacteria 2199
493 Ga0495622_0003148 3300046557 Bacteria 7810
494 Ga0495622_0007018 3300046557 Bacteria 5228
495 Ga0495622_0013881 3300046557 Bacteria 3737
496 Ga0495622_0031590 3300046557 Bacteria 2474
497 Ga0495622_0051770 3300046557 Bacteria 1904
498 Ga0495622_0099376 3300046557 Bacteria 1334
499 Ga0495633_0072008 3300046558 Bacteria 1612
500 Ga0495667_0038688 3300046559 Bacteria 3175
501 Ga0495668_0026449 3300046616 Bacteria 3292
502 Ga0495668_0072194 3300046616 Bacteria 1896
503 Ga0495668_0252893 3300046616 Bacteria 964
504 Ga0495634_0047258 3300046642 Bacteria 2901
505 Ga0495611_0018160 3300046648 Bacteria 3014
506 Ga0495625_0008959 3300046660 Bacteria 8451
507 Ga0495625_0112164 3300046660 Bacteria 1863
508 Ga0495625_0178005 3300046660 Bacteria 1416
509 Ga0495625_0279754 3300046660 Bacteria 1074
510 Ga0495635_0086462 3300046663 Bacteria 2145
511 Ga0495659_0080172 3300046664 Bacteria 1238
512 Ga0495661_0118917 3300046665 Bacteria 1462
513 Ga0495588_0004395 3300046674 Bacteria 6227
514 Ga0495588_0077068 3300046674 Bacteria 1738
515 Ga0495657_0025122 3300046675 Bacteria 4234
516 Ga0495657_0053262 3300046675 Bacteria 2708
517 Ga0495599_0007960 3300046678 Bacteria 6428
518 Ga0495599_0177361 3300046678 Bacteria 1314
519 Ga0495623_0016163 3300046679 Bacteria 4820
520 Ga0495646_0017819 3300046680 Bacteria 4501
521 Ga0495647_0035152 3300046681 Bacteria 1880
522 Ga0495669_0205330 3300046684 Bacteria 942
523 Ga0495613_0007936 3300046689 Bacteria 7900
524 Ga0495613_0042760 3300046689 Bacteria 3352
525 Ga0495624_0038078 3300046690 Bacteria 3091
526 Ga0495624_0190075 3300046690 Bacteria 1249
527 Ga0495624_0270335 3300046690 Bacteria 1027
528 Ga0495670_0018287 3300046691 Bacteria 3451
529 Ga0495670_0050605 3300046691 Bacteria 2080
530 Ga0495670_0060507 3300046691 Bacteria 1903
531 Ga0495649_0128470 3300046694 Bacteria 1338
532 Ga0495600_0001949 3300046809 Bacteria 11590
533 Ga0495600_0013037 3300046809 Bacteria 5215
534 Ga0495660_0006722 3300046810 Bacteria 6790
535 Ga0495660_0126052 3300046810 Bacteria 1290
536 Ga0495660_0153503 3300046810 Bacteria 1135
537 Ga0495581_0066884 3300047315 Bacteria 2078
538 Ga0495604_0026776 3300047317 Bacteria 4589
539 Ga0495604_0038952 3300047317 Bacteria 3737
540 Ga0495636_0025766 3300047318 Bacteria 2389
541 Ga0495674_0068767 3300047319 Bacteria 3064
542 Ga0495672_0092763 3300047320 Bacteria 1655
543 Ga0495676_0094977 3300047321 Bacteria 2220
544 Ga0495676_0307600 3300047321 Bacteria 1067
545 Ga0495680_0056250 3300047322 Bacteria 3046
546 Ga0495687_009909 3300047443 Bacteria 5273
547 Ga0495687_024317 3300047443 Bacteria 2880
548 Ga0495675_0018173 3300047444 Bacteria 4460
549 Ga0495684_0045599 3300047471 Bacteria 3355
550 Ga0495686_0066313 3300047472 Bacteria 2231
551 Ga0495602_0021306 3300048088 Bacteria 6385
552 Ga0495602_0055287 3300048088 Bacteria 3497
553 Ga0496100_0047645 3300048903 Bacteria 2763
554 Ga0496100_0193011 3300048903 Bacteria 1480
555 Ga0496101_0052058 3300048904 Bacteria 2951
556 Ga0496102_0000614 3300048905 Bacteria 36967
557 Ga0496102_0018881 3300048905 Bacteria 6066
558 Ga0496102_0045731 3300048905 Bacteria 3974
559 Ga0496102_0304408 3300048905 Bacteria 1502
560 Ga0496102_0411624 3300048905 Bacteria 1270
561 Ga0496102_0458890 3300048905 Bacteria 1195
562 Ga0496102_0468777 3300048905 Bacteria 1180
563 Ga0496103_0013040 3300048906 Bacteria 4928
564 Ga0496103_0032673 3300048906 Bacteria 3176
565 Ga0496103_0198439 3300048906 Bacteria 1290
566 Ga0496104_0028633 3300048907 Bacteria 5163
567 Ga0496104_0041567 3300048907 Bacteria 4311
568 Ga0496104_0069427 3300048907 Bacteria 3349
569 Ga0496104_0088931 3300048907 Bacteria 2951
570 Ga0496105_0014940 3300048908 Bacteria 6181
571 Ga0496105_0033632 3300048908 Bacteria 4212
572 Ga0496105_0081982 3300048908 Bacteria 2664
573 Ga0496105_0143377 3300048908 Bacteria 1965
574 Ga0496105_0657615 3300048908 Bacteria 808
575 Ga0496106_0097872 3300048909 Bacteria 2272
576 Ga0496106_0307330 3300048909 Bacteria 1272
577 Ga0496107_0104865 3300048910 Bacteria 2075
578 Ga0496108_0054477 3300048911 Bacteria 3356
579 Ga0496108_0597165 3300048911 Bacteria 962
580 Ga0496109_0418734 3300048912 Bacteria 1265
581 Ga0496109_0501941 3300048912 Bacteria 1145
582 Ga0496109_0531469 3300048912 Bacteria 1110
583 Ga0496110_0106873 3300048913 Bacteria 2511
584 Ga0496110_0121491 3300048913 Bacteria 2354
585 Ga0496110_0234521 3300048913 Bacteria 1669
586 Ga0496110_0556462 3300048913 Bacteria 1042
587 Ga0496110_0592077 3300048913 Bacteria 1006
588 Ga0496111_0066281 3300048914 Bacteria 2622
589 Ga0496112_0084499 3300048915 Bacteria 3139
590 Ga0496112_0585805 3300048915 Bacteria 1048
591 Ga0496112_0775612 3300048915 Bacteria 884
592 Ga0496113_0064474 3300048916 Bacteria 2770
593 Ga0496113_0150197 3300048916 Bacteria 1837
594 Ga0496113_0242777 3300048916 Bacteria 1437
595 Ga0496115_0148694 3300048918 Bacteria 1934
596 Ga0496115_0420779 3300048918 Bacteria 1082
597 Ga0496115_0513494 3300048918 Bacteria 962
598 Ga0496116_0024695 3300048919 Bacteria 4436
599 Ga0496116_0048297 3300048919 Bacteria 2857
600 Ga0496116_0072039 3300048919 Bacteria 2186
601 Ga0496116_0108942 3300048919 Bacteria 1634
602 Ga0496116_0255484 3300048919 Bacteria 869
603 Ga0496117_0042409 3300048920 Bacteria 3320
604 Ga0496117_0091177 3300048920 Bacteria 1961
605 Ga0496117_0091313 3300048920 Bacteria 1959
606 Ga0496118_0000353 3300048921 Bacteria 77839
607 Ga0496118_0009194 3300048921 Bacteria 10034
608 Ga0496118_0106169 3300048921 Bacteria 1880
609 Ga0496118_0126991 3300048921 Bacteria 1647
610 Ga0496118_0135790 3300048921 Bacteria 1570
611 Ga0496118_0207637 3300048921 Bacteria 1153
612 Ga0496118_0269996 3300048921 Bacteria 954
613 Ga0496119_0005991 3300048922 Bacteria 11421
614 Ga0496119_0012748 3300048922 Bacteria 6789
615 Ga0496119_0132709 3300048922 Bacteria 1355
616 Ga0496120_0001950 3300048923 Bacteria 22601
617 Ga0496120_0003410 3300048923 Bacteria 14534
618 Ga0496120_0024687 3300048923 Bacteria 3743
619 Ga0496120_0070716 3300048923 Bacteria 1918
620 Ga0496121_0000536 3300048924 Bacteria 72166
621 Ga0496121_0001187 3300048924 Bacteria 45612
622 Ga0496121_0031628 3300048924 Bacteria 4830
623 Ga0496121_0038931 3300048924 Bacteria 4200
624 Ga0496121_0041610 3300048924 Bacteria 4013
625 Ga0496121_0132225 3300048924 Bacteria 1865
626 Ga0496121_0233284 3300048924 Bacteria 1287
627 Ga0496121_0303059 3300048924 Bacteria 1083
628 Ga0496122_0044235 3300048925 Bacteria 3478
629 Ga0496122_0047262 3300048925 Bacteria 3324
630 Ga0496124_0017619 3300048927 Bacteria 6725
631 Ga0496124_0271568 3300048927 Bacteria 1241
632 Ga0496125_0013222 3300048928 Bacteria 8128
633 Ga0496125_0033769 3300048928 Bacteria 4521
634 Ga0496125_0049986 3300048928 Bacteria 3467
635 Ga0496125_0128650 3300048928 Bacteria 1788
636 Ga0496125_0141482 3300048928 Bacteria 1672
637 Ga0496126_0002330 3300048929 Bacteria 26023
638 Ga0496126_0003343 3300048929 Bacteria 20380
639 Ga0496126_0042429 3300048929 Bacteria 4201
640 Ga0496126_0067381 3300048929 Bacteria 3198
641 Ga0496126_0113540 3300048929 Bacteria 2358
642 Ga0496126_0165644 3300048929 Bacteria 1886
643 Ga0496126_0191209 3300048929 Bacteria 1733
644 Ga0496126_0215921 3300048929 Bacteria 1613
645 Ga0496126_0218785 3300048929 Bacteria 1601
646 Ga0496126_0368243 3300048929 Bacteria 1172
647 Ga0496126_0409142 3300048929 Bacteria 1099
648 Ga0495678_075828 3300049459 Bacteria 1220
649 Ga0495682_0027421 3300049460 Bacteria 2112
650 Ga0501033_0028443 3300049570 Bacteria 4199
651 Ga0501034_0044368 3300049571 Bacteria 4498
652 Ga0501034_0044504 3300049571 Bacteria 4489
653 Ga0501034_0124768 3300049571 Bacteria 2560
654 Ga0501038_0024848 3300049574 Bacteria 5341
655 Ga0501039_0141055 3300049575 Bacteria 1893
656 Ga0501043_0075835 3300049579 Bacteria 2641
657 Ga0501047_0029247 3300049581 Bacteria 5314
658 Ga0501067_0132905 3300049583 Bacteria 1385
659 Ga0501073_0442238 3300049589 Bacteria 899
660 Ga0501044_0016392 3300049823 Bacteria 7956
661 nmdc:mga00v17_117832_c1 3300050491 Bacteria 1689
662 nmdc:mga0yw44_184330_c1 3300050492 Bacteria 1375
663 nmdc:mga0yw44_240269_c1 3300050492 Bacteria 1204
664 nmdc:mga0yw44_331417_c1 3300050492 Bacteria 1023
665 nmdc:mga0k408_105533_c1 3300050493 Bacteria 1663
666 nmdc:mga0k408_191336_c1 3300050493 Bacteria 1221
667 nmdc:mga0k408_286695_c1 3300050493 Bacteria 983
668 nmdc:mga06z11_32100_c1 3300050494 Bacteria 2558
669 nmdc:mga06z11_36737_c1 3300050494 Bacteria 2420
670 nmdc:mga04h51_58281_c1 3300050495 Bacteria 1316
671 nmdc:mga04h51_82851_c1 3300050495 Bacteria 1142
672 nmdc:mga07m45_20408_c1 3300050496 Bacteria 3598
673 nmdc:mga07m45_205883_c1 3300050496 Bacteria 1144
674 nmdc:mga07m45_39541_c1 3300050496 Bacteria 2636
675 nmdc:mga08y16_242270_c1 3300050511 Bacteria 1864
676 nmdc:mga0n895_171740_c1 3300050512 Bacteria 2200
677 nmdc:mga0sz30_17972_c1 3300050516 Bacteria 2826
678 Ga0500635_0000082 3300053080 Bacteria 62117
679 Ga0500635_0013594 3300053080 Bacteria 2368
680 Ga0500635_0027315 3300053080 Bacteria 1813
681 Ga0495655_0039111 3300053083 Bacteria 1200
682 Ga0495619_0043214 3300053085 Bacteria 2954
683 Ga0500578_0217792 3300053086 Bacteria 1162
684 Ga0500643_000046 3300053087 Bacteria 150388
685 Ga0500643_004317 3300053087 Bacteria 6483
686 Ga0500644_0135345 3300053088 Bacteria 974
687 Ga0500646_0079314 3300053090 Bacteria 999
688 Ga0500583_0011107 3300053092 Bacteria 3379
689 Ga0500566_0000381 3300053094 Bacteria 24461
690 Ga0500566_0070023 3300053094 Bacteria 1970
691 Ga0500566_0141175 3300053094 Bacteria 1278
692 Ga0500641_0021968 3300053096 Bacteria 2439
693 Ga0500555_003852 3300053103 Bacteria 4268
694 Ga0500556_0107655 3300053104 Bacteria 1078
695 Ga0500557_000054 3300053105 Bacteria 50111
696 Ga0500562_012538 3300053108 Bacteria 2157
697 Ga0500562_019187 3300053108 Bacteria 1768
698 Ga0500569_003280 3300053109 Bacteria 3289
699 Ga0500572_000074 3300053111 Bacteria 31840
700 Ga0500594_0021858 3300053118 Bacteria 1608
701 Ga0500595_002781 3300053119 Bacteria 8432
702 Ga0500595_008745 3300053119 Bacteria 4120
703 Ga0500595_025862 3300053119 Bacteria 2028
704 Ga0500607_013154 3300053121 Bacteria 4839
705 Ga0500607_062768 3300053121 Bacteria 1940
706 Ga0500608_010385 3300053122 Bacteria 3995
707 Ga0500608_099352 3300053122 Bacteria 1350
708 Ga0500618_008138 3300053125 Bacteria 2946
709 Ga0500642_0000136 3300053130 Bacteria 32674
710 Ga0500642_0040912 3300053130 Bacteria 2001
711 Ga0500655_021535 3300053133 Bacteria 1209
712 Ga0500658_0007101 3300053134 Bacteria 4141
713 Ga0500658_0011035 3300053134 Bacteria 3331
714 Ga0500658_0026826 3300053134 Bacteria 2222
715 Ga0500658_0032267 3300053134 Bacteria 2053
716 Ga0500559_0000780 3300053136 Bacteria 20835
717 Ga0500559_0013121 3300053136 Bacteria 3513
718 Ga0500559_0175459 3300053136 Bacteria 1008
719 Ga0500568_0000460 3300053139 Bacteria 30312
720 Ga0500589_113253 3300053147 Bacteria 1160
721 Ga0500590_046515 3300053148 Bacteria 2217
722 Ga0500603_014746 3300053150 Bacteria 1829
723 Ga0500616_0001157 3300053153 Bacteria 26958
724 Ga0500616_0101707 3300053153 Bacteria 1403
725 Ga0500620_004187 3300053155 Bacteria 3189
726 Ga0500622_0000064 3300053156 Bacteria 127531
727 Ga0500622_0012955 3300053156 Bacteria 4504
728 Ga0500624_000027 3300053157 Bacteria 108821
729 Ga0500627_0033964 3300053158 Bacteria 2159
730 Ga0500627_0076808 3300053158 Bacteria 1485
731 Ga0500633_0021962 3300053160 Bacteria 1948
732 Ga0500636_0001429 3300053177 Bacteria 13007
733 Ga0500636_0005358 3300053177 Bacteria 7315
734 Ga0500636_0019166 3300053177 Bacteria 4048
735 Ga0500636_0088371 3300053177 Bacteria 1777
736 Ga0500636_0217722 3300053177 Bacteria 997
737 Ga0500636_0273186 3300053177 Bacteria 848
738 Ga0500637_0000433 3300053178 Bacteria 15981
739 Ga0500637_0027901 3300053178 Bacteria 3119
740 Ga0500637_0069923 3300053178 Bacteria 2019
741 Ga0500637_0125663 3300053178 Bacteria 1487
742 Ga0500625_011807 3300053729 Bacteria 3979
743 Ga0500625_031227 3300053729 Bacteria 2528
744 Ga0500645_023914 3300053730 Bacteria 1871
745 Ga0500609_003116 3300053731 Bacteria 2351
746 Ga0500601_000722 3300053737 Bacteria 4354
747 Ga0500661_002049 3300055283 Bacteria 3807
748 Ga0590071_016772 3300059421 Bacteria 1719
749 Ga0590077_011018 3300059426 Bacteria 1865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10301812 Ga0307406_103018121 223
2 iso_pu_bacteria 2869162929 2869166667 224
3 3300049581 Ga0501047_0029247 Ga0501047_0029247_1440_2243 225
4 3300031548 Ga0307408_100050149 Ga0307408_1000501494 228
5 iso_pu_bacteria 2738541293 2738799570 229
6 3300039437 Ga0436365_0920281 Ga0436365_0920281_578_1321 231
7 3300049571 Ga0501034_0124768 Ga0501034_0124768_1354_2100 232
8 iso_pu_bacteria 2524023209 2524463013 233
9 iso_pu_bacteria 2582581294 2585203182 233
10 iso_pu_bacteria 2615840626 2616311796 233
11 iso_pu_bacteria 2643221582 2643918065 233
12 iso_pu_bacteria 2643221623 2644130286 233
13 iso_pu_bacteria 2775507266 2778176739 233
14 iso_pu_bacteria 2838029111 2838034488 233
15 iso_pu_bacteria 2842298080 2842302145 233
16 iso_pu_bacteria 2842357229 2842363148 233
17 iso_pu_bacteria 2842475841 2842481235 233
18 iso_pu_bacteria 2842482326 2842489104 233
19 iso_pu_bacteria 2842502639 2842508180 233
20 iso_pu_bacteria 2842509118 2842513938 233
21 iso_pu_bacteria 8056875544 8056876649 233
22 iso_pu_bacteria 2937113482 2937116079 234
23 iso_pu_bacteria 2957415311 2957416628 234
24 iso_pu_bacteria 2957491536 2957494162 234
25 iso_pu_bacteria 2964712639 2964712856 234
26 iso_pu_bacteria 2970076120 2970078787 234
27 iso_pu_bacteria 2977523885 2977525453 234
28 iso_pu_bacteria 8057874678 8057879853 234
29 3300025917 Ga0207660_10103941 Ga0207660_101039412 235
30 iso_pu_bacteria 2513237090 2513612214 235
31 iso_pu_bacteria 2791355123 2792751805 235
32 iso_pu_bacteria 2824704595 2824707569 235
33 iso_pu_bacteria 2824753945 2824755710 235
34 iso_pu_bacteria 2824763712 2824766373 235
35 iso_pu_bacteria 2885305155 2885310765 235
36 iso_pu_bacteria 2885334103 2885341189 235
37 iso_pu_bacteria 2904711408 2904712224 235
38 iso_pu_bacteria 8055617313 8055619317 235
39 3300006178 Ga0075367_10021221 Ga0075367_100212212 236
40 3300025912 Ga0207707_10407619 Ga0207707_104076191 236
41 3300032168 Ga0316593_10008780 Ga0316593_100087802 236
42 3300036647 Ga0316582_0017683 Ga0316582_0017683_2433_3161 236
43 3300041492 Ga0451835_0846484 Ga0451835_0846484_788_1513 236
44 3300041494 Ga0451837_0832108 Ga0451837_0832108_3093_3818 236
45 3300041496 Ga0451839_0615725 Ga0451839_0615725_846_1571 236
46 3300041498 Ga0451841_0234887 Ga0451841_0234887_1448_2173 236
47 3300041505 Ga0451849_0615251 Ga0451849_0615251_2985_3710 236
48 3300041512 Ga0451853_3361738 Ga0451853_3361738_219_944 236
49 3300046507 Ga0495606_0013391 Ga0495606_0013391_3251_3973 236
50 3300046512 Ga0495610_0003544 Ga0495610_0003544_8475_9197 236
51 3300046513 Ga0495616_0051909 Ga0495616_0051909_1310_2032 236
52 3300046519 Ga0495632_0012123 Ga0495632_0012123_3111_3833 236
53 3300046522 Ga0495643_0051206 Ga0495643_0051206_979_1701 236
54 3300046542 Ga0495597_0004648 Ga0495597_0004648_3026_3748 236
55 3300046660 Ga0495625_0008959 Ga0495625_0008959_3228_3950 236
56 3300046810 Ga0495660_0006722 Ga0495660_0006722_2237_2959 236
57 3300047443 Ga0495687_024317 Ga0495687_024317_794_1516 236
58 3300050494 nmdc:mga06z11_36737_c1 nmdc:mga06z11_36737_c1_1319_2056 236
59 3300050495 nmdc:mga04h51_58281_c1 nmdc:mga04h51_58281_c1_189_926 236
60 3300053118 Ga0500594_0021858 Ga0500594_0021858_871_1593 236
61 3300053134 Ga0500658_0011035 Ga0500658_0011035_2089_2811 236
62 3300053153 Ga0500616_0101707 Ga0500616_0101707_521_1243 236
63 3300053156 Ga0500622_0000064 Ga0500622_0000064_48177_48899 236
64 3300053158 Ga0500627_0076808 Ga0500627_0076808_72_794 236
65 iso_pu_bacteria 2513237138 2513870312 236
66 iso_pu_bacteria 2513237164 2514032668 236
67 iso_pu_bacteria 2515154113 2515635666 236
68 iso_pu_bacteria 2582581308 2585277759 236
69 iso_pu_bacteria 2582581867 2585403029 236
70 iso_pu_bacteria 2585427526 2585530430 236
71 iso_pu_bacteria 2585427527 2585533374 236
72 iso_pu_bacteria 2585427530 2585557881 236
73 iso_pu_bacteria 2585427590 2585825229 236
74 iso_pu_bacteria 2599185301 2599936900 236
75 iso_pu_bacteria 2599185352 2600196370 236
76 iso_pu_bacteria 2615840626 2616310564 236
77 iso_pu_bacteria 2643221627 2644153910 236
78 iso_pu_bacteria 2728368998 2728749367 236
79 iso_pu_bacteria 2751185821 2753459734 236
80 iso_pu_bacteria 2818991453 2819643133 236
81 iso_pu_bacteria 2838661181 2838668374 236
82 iso_pu_bacteria 2838686498 2838691049 236
83 iso_pu_bacteria 2842110456 2842117287 236
84 iso_pu_bacteria 2842271015 2842275524 236
85 iso_pu_bacteria 2844454524 2844462240 236
86 iso_pu_bacteria 2874612657 2874614815 236
87 iso_pu_bacteria 2879110137 2879114476 236
88 iso_pu_bacteria 2889016732 2889021441 236
89 iso_pu_bacteria 2904690495 2904694449 236
90 iso_pu_bacteria 2908739725 2908741953 236
91 iso_pu_bacteria 2908756301 2908759638 236
92 iso_pu_bacteria 2924718760 2924723469 236
93 iso_pu_bacteria 2933016740 2933019354 236
94 iso_pu_bacteria 2933586486 2933590031 236
95 iso_pu_bacteria 8006984368 8006987436 236
96 iso_pu_bacteria 8056681323 8056687680 236
97 iso_pu_bacteria 8056689827 8056693473 236
98 3300005336 Ga0070680_100531114 Ga0070680_1005311141 237
99 3300005458 Ga0070681_10033499 Ga0070681_100334994 237
100 3300035398 Ga0316574_0215994 Ga0316574_0215994_143_910 237
101 3300048929 Ga0496126_0218785 Ga0496126_0218785_406_1164 237
102 iso_pu_bacteria 2515154134 2515741714 237
103 iso_pu_bacteria 2791355266 2793359282 237
104 iso_pu_bacteria 8004640170 8004643018 237
105 3300005329 Ga0070683_100007383 Ga0070683_1000073835 238
106 3300005329 Ga0070683_100031653 Ga0070683_1000316534 238
107 3300005337 Ga0070682_100058791 Ga0070682_1000587912 238
108 3300005434 Ga0070709_10307754 Ga0070709_103077541 238
109 3300005458 Ga0070681_10182527 Ga0070681_101825272 238
110 3300005530 Ga0070679_100092244 Ga0070679_1000922443 238
111 3300005530 Ga0070679_100334912 Ga0070679_1003349122 238
112 3300005535 Ga0070684_100002474 Ga0070684_1000024746 238
113 3300005578 Ga0068854_100321297 Ga0068854_1003212971 238
114 3300005983 Ga0081540_1061289 Ga0081540_10612893 238
115 3300006038 Ga0075365_10093101 Ga0075365_100931011 238
116 3300006048 Ga0075363_100077582 Ga0075363_1000775822 238
117 3300006177 Ga0075362_10007812 Ga0075362_100078122 238
118 3300006358 Ga0068871_100286171 Ga0068871_1002861712 238
119 3300006844 Ga0075428_100041687 Ga0075428_1000416873 238
120 3300006847 Ga0075431_100642590 Ga0075431_1006425901 238
121 3300009545 Ga0105237_10310279 Ga0105237_103102793 238
122 3300009551 Ga0105238_10275551 Ga0105238_102755511 238
123 3300013307 Ga0157372_10138050 Ga0157372_101380502 238
124 3300025273 Ga0209673_1002727 Ga0209673_10027275 238
125 3300025912 Ga0207707_10001371 Ga0207707_1000137115 238
126 3300025912 Ga0207707_10024804 Ga0207707_100248043 238
127 3300025913 Ga0207695_10153319 Ga0207695_101533192 238
128 3300025921 Ga0207652_10028115 Ga0207652_100281152 238
129 3300025921 Ga0207652_10039261 Ga0207652_100392613 238
130 3300025944 Ga0207661_10000331 Ga0207661_1000033126 238
131 3300025944 Ga0207661_10032719 Ga0207661_100327193 238
132 3300026116 Ga0207674_10084921 Ga0207674_100849213 238
133 3300026116 Ga0207674_10789912 Ga0207674_107899121 238
134 3300028379 Ga0268266_10323895 Ga0268266_103238952 238
135 3300035695 Ga0373927_0190934 Ga0373927_0190934_519_1328 238
136 3300037068 Ga0373925_0196585 Ga0373925_0196585_29_796 238
137 3300041491 Ga0451833_0666882 Ga0451833_0666882_149_901 238
138 3300041492 Ga0451835_0701798 Ga0451835_0701798_169_921 238
139 3300041494 Ga0451837_1509718 Ga0451837_1509718_169_921 238
140 3300041496 Ga0451839_1099990 Ga0451839_1099990_169_921 238
141 3300041498 Ga0451841_0047544 Ga0451841_0047544_98_850 238
142 3300041501 Ga0451845_0451105 Ga0451845_0451105_169_921 238
143 3300041503 Ga0451847_0137423 Ga0451847_0137423_169_921 238
144 3300041505 Ga0451849_0766215 Ga0451849_0766215_169_921 238
145 3300041507 Ga0451851_0095856 Ga0451851_0095856_169_921 238
146 3300041509 Ga0451843_0277846 Ga0451843_0277846_169_921 238
147 3300041511 Ga0451855_0179822 Ga0451855_0179822_458_1210 238
148 3300041512 Ga0451853_3365732 Ga0451853_3365732_71_823 238
149 3300046507 Ga0495606_0142679 Ga0495606_0142679_37_768 238
150 3300046515 Ga0495620_0011824 Ga0495620_0011824_1744_2475 238
151 3300046522 Ga0495643_0079847 Ga0495643_0079847_633_1364 238
152 3300046538 Ga0495609_0059358 Ga0495609_0059358_408_1139 238
153 3300046557 Ga0495622_0003148 Ga0495622_0003148_7018_7749 238
154 3300046660 Ga0495625_0112164 Ga0495625_0112164_513_1244 238
155 3300048088 Ga0495602_0055287 Ga0495602_0055287_1196_1927 238
156 3300053080 Ga0500635_0000082 Ga0500635_0000082_11472_12203 238
157 3300053092 Ga0500583_0011107 Ga0500583_0011107_2495_3226 238
158 3300053094 Ga0500566_0141175 Ga0500566_0141175_372_1103 238
159 3300053109 Ga0500569_003280 Ga0500569_003280_1500_2231 238
160 3300053119 Ga0500595_002781 Ga0500595_002781_3427_4158 238
161 3300053121 Ga0500607_013154 Ga0500607_013154_3047_3778 238
162 3300053122 Ga0500608_010385 Ga0500608_010385_1550_2281 238
163 3300053134 Ga0500658_0007101 Ga0500658_0007101_602_1345 238
164 3300053134 Ga0500658_0032267 Ga0500658_0032267_819_1550 238
165 3300053148 Ga0500590_046515 Ga0500590_046515_176_907 238
166 3300053158 Ga0500627_0033964 Ga0500627_0033964_781_1542 238
167 3300053177 Ga0500636_0088371 Ga0500636_0088371_85_816 238
168 3300053177 Ga0500636_0273186 Ga0500636_0273186_16_747 238
169 3300053178 Ga0500637_0000433 Ga0500637_0000433_2452_3183 238
170 3300053178 Ga0500637_0027901 Ga0500637_0027901_1696_2427 238
171 3300053178 Ga0500637_0069923 Ga0500637_0069923_536_1336 238
172 3300053729 Ga0500625_031227 Ga0500625_031227_576_1307 238
173 3300001979 JGI24740J21852_10018129 JGI24740J21852_100181292 239
174 3300001979 JGI24740J21852_10043019 JGI24740J21852_100430191 239
175 3300001989 JGI24739J22299_10070700 JGI24739J22299_100707002 239
176 3300002067 JGI24735J21928_10050971 JGI24735J21928_100509711 239
177 3300005334 Ga0068869_100480231 Ga0068869_1004802312 239
178 3300005337 Ga0070682_100313768 Ga0070682_1003137682 239
179 3300005539 Ga0068853_100001742 Ga0068853_1000017426 239
180 3300005539 Ga0068853_100267441 Ga0068853_1002674411 239
181 3300005577 Ga0068857_100418811 Ga0068857_1004188112 239
182 3300005719 Ga0068861_100050478 Ga0068861_1000504782 239
183 3300006051 Ga0075364_10064214 Ga0075364_100642142 239
184 3300006844 Ga0075428_100645452 Ga0075428_1006454522 239
185 3300009177 Ga0105248_10009311 Ga0105248_100093113 239
186 3300009545 Ga0105237_10066120 Ga0105237_100661204 239
187 3300009551 Ga0105238_10007078 Ga0105238_100070786 239
188 3300010375 Ga0105239_10008236 Ga0105239_100082369 239
189 3300010375 Ga0105239_10461945 Ga0105239_104619451 239
190 3300010375 Ga0105239_10957680 Ga0105239_109576801 239
191 3300013105 Ga0157369_10155960 Ga0157369_101559603 239
192 3300013307 Ga0157372_10737478 Ga0157372_107374781 239
193 3300013308 Ga0157375_10595262 Ga0157375_105952622 239
194 3300025297 Ga0209758_1005729 Ga0209758_10057297 239
195 3300025297 Ga0209758_1019444 Ga0209758_10194443 239
196 3300025904 Ga0207647_10015521 Ga0207647_100155213 239
197 3300025914 Ga0207671_10011705 Ga0207671_100117058 239
198 3300025924 Ga0207694_10018430 Ga0207694_100184304 239
199 3300025941 Ga0207711_10009071 Ga0207711_100090719 239
200 3300025942 Ga0207689_10647975 Ga0207689_106479751 239
201 3300025972 Ga0207668_10166914 Ga0207668_101669142 239
202 3300026041 Ga0207639_10169897 Ga0207639_101698971 239
203 3300026116 Ga0207674_10501809 Ga0207674_105018091 239
204 3300031548 Ga0307408_100370555 Ga0307408_1003705551 239
205 3300046477 Ga0495664_0021353 Ga0495664_0021353_1759_2538 239
206 3300046477 Ga0495664_0366400 Ga0495664_0366400_50_805 239
207 3300046542 Ga0495597_0055352 Ga0495597_0055352_264_1028 239
208 3300046543 Ga0495645_0089611 Ga0495645_0089611_1289_2068 239
209 3300046664 Ga0495659_0080172 Ga0495659_0080172_83_847 239
210 3300046678 Ga0495599_0177361 Ga0495599_0177361_387_1166 239
211 3300046691 Ga0495670_0018287 Ga0495670_0018287_84_848 239
212 3300046694 Ga0495649_0128470 Ga0495649_0128470_267_1031 239
213 3300048905 Ga0496102_0018881 Ga0496102_0018881_3993_4724 239
214 3300048905 Ga0496102_0468777 Ga0496102_0468777_100_852 239
215 3300048918 Ga0496115_0420779 Ga0496115_0420779_311_1069 239
216 3300048919 Ga0496116_0108942 Ga0496116_0108942_185_916 239
217 3300048920 Ga0496117_0091313 Ga0496117_0091313_385_1116 239
218 3300048921 Ga0496118_0009194 Ga0496118_0009194_7172_7903 239
219 3300048922 Ga0496119_0012748 Ga0496119_0012748_1593_2324 239
220 3300048922 Ga0496119_0132709 Ga0496119_0132709_230_979 239
221 3300048923 Ga0496120_0003410 Ga0496120_0003410_5540_6289 239
222 3300048924 Ga0496121_0001187 Ga0496121_0001187_10177_10908 239
223 3300048924 Ga0496121_0233284 Ga0496121_0233284_358_1116 239
224 3300048928 Ga0496125_0033769 Ga0496125_0033769_1009_1767 239
225 3300049570 Ga0501033_0028443 Ga0501033_0028443_614_1378 239
226 3300049571 Ga0501034_0044368 Ga0501034_0044368_1419_2183 239
227 3300049575 Ga0501039_0141055 Ga0501039_0141055_590_1354 239
228 3300049583 Ga0501067_0132905 Ga0501067_0132905_470_1231 239
229 3300049589 Ga0501073_0442238 Ga0501073_0442238_73_837 239
230 3300049823 Ga0501044_0016392 Ga0501044_0016392_2497_3261 239
231 3300050492 nmdc:mga0yw44_331417_c1 nmdc:mga0yw44_331417_c1_43_807 239
232 3300050493 nmdc:mga0k408_105533_c1 nmdc:mga0k408_105533_c1_720_1484 239
233 3300053088 Ga0500644_0135345 Ga0500644_0135345_69_806 239
234 3300053090 Ga0500646_0079314 Ga0500646_0079314_249_983 239
235 3300053103 Ga0500555_003852 Ga0500555_003852_1085_1819 239
236 iso_pu_bacteria 2824653114 2824658249 239
237 iso_pu_bacteria 2842038055 2842040425 239
238 iso_pu_bacteria 2842045827 2842046630 239
239 3300001979 JGI24740J21852_10009539 JGI24740J21852_100095394 240
240 3300003214 JGI25165J46597_1000006 JGI25165J46597_100000667 240
241 3300003322 rootL2_10177720 rootL2_101777202 240
242 3300003659 JGI25404J52841_10011078 JGI25404J52841_100110782 240
243 3300003659 JGI25404J52841_10039595 JGI25404J52841_100395951 240
244 3300003790 Ga0055528_1000544 Ga0055528_10005442 240
245 3300005327 Ga0070658_10328052 Ga0070658_103280522 240
246 3300005327 Ga0070658_10492434 Ga0070658_104924341 240
247 3300005328 Ga0070676_10085855 Ga0070676_100858553 240
248 3300005334 Ga0068869_100188815 Ga0068869_1001888152 240
249 3300005365 Ga0070688_100269133 Ga0070688_1002691332 240
250 3300005434 Ga0070709_10036716 Ga0070709_100367162 240
251 3300005435 Ga0070714_100002584 Ga0070714_10000258414 240
252 3300005435 Ga0070714_100585084 Ga0070714_1005850841 240
253 3300005436 Ga0070713_100086394 Ga0070713_1000863942 240
254 3300005437 Ga0070710_10000501 Ga0070710_100005018 240
255 3300005437 Ga0070710_10183781 Ga0070710_101837811 240
256 3300005437 Ga0070710_10476192 Ga0070710_104761921 240
257 3300005438 Ga0070701_10033118 Ga0070701_100331182 240
258 3300005439 Ga0070711_100044952 Ga0070711_1000449524 240
259 3300005455 Ga0070663_100027618 Ga0070663_1000276182 240
260 3300005456 Ga0070678_100086429 Ga0070678_1000864293 240
261 3300005456 Ga0070678_100198686 Ga0070678_1001986862 240
262 3300005471 Ga0070698_100736491 Ga0070698_1007364911 240
263 3300005539 Ga0068853_100013884 Ga0068853_1000138847 240
264 3300005539 Ga0068853_100099647 Ga0068853_1000996471 240
265 3300005543 Ga0070672_100328535 Ga0070672_1003285352 240
266 3300005548 Ga0070665_100069708 Ga0070665_1000697085 240
267 3300005548 Ga0070665_100427743 Ga0070665_1004277431 240
268 3300005563 Ga0068855_100075640 Ga0068855_1000756405 240
269 3300005577 Ga0068857_100036325 Ga0068857_1000363254 240
270 3300005577 Ga0068857_100457678 Ga0068857_1004576781 240
271 3300005578 Ga0068854_100039271 Ga0068854_1000392714 240
272 3300005578 Ga0068854_100056832 Ga0068854_1000568324 240
273 3300005614 Ga0068856_100012955 Ga0068856_1000129558 240
274 3300005614 Ga0068856_100322481 Ga0068856_1003224811 240
275 3300005614 Ga0068856_100818653 Ga0068856_1008186532 240
276 3300005616 Ga0068852_100602969 Ga0068852_1006029692 240
277 3300005617 Ga0068859_100176840 Ga0068859_1001768402 240
278 3300005617 Ga0068859_100248636 Ga0068859_1002486361 240
279 3300005617 Ga0068859_100534830 Ga0068859_1005348302 240
280 3300005618 Ga0068864_100452028 Ga0068864_1004520282 240
281 3300005719 Ga0068861_100266140 Ga0068861_1002661401 240
282 3300005719 Ga0068861_100445797 Ga0068861_1004457971 240
283 3300005834 Ga0068851_10046400 Ga0068851_100464003 240
284 3300005834 Ga0068851_10183348 Ga0068851_101833481 240
285 3300005842 Ga0068858_100061887 Ga0068858_1000618873 240
286 3300005842 Ga0068858_100624858 Ga0068858_1006248582 240
287 3300005843 Ga0068860_100000217 Ga0068860_10000021731 240
288 3300005844 Ga0068862_100044093 Ga0068862_1000440933 240
289 3300005937 Ga0081455_10136729 Ga0081455_101367292 240
290 3300005983 Ga0081540_1006420 Ga0081540_10064205 240
291 3300005983 Ga0081540_1009150 Ga0081540_10091507 240
292 3300005983 Ga0081540_1058566 Ga0081540_10585662 240
293 3300005983 Ga0081540_1107676 Ga0081540_11076761 240
294 3300006028 Ga0070717_10223502 Ga0070717_102235022 240
295 3300006028 Ga0070717_10567823 Ga0070717_105678231 240
296 3300006038 Ga0075365_10143954 Ga0075365_101439542 240
297 3300006173 Ga0070716_100001649 Ga0070716_1000016496 240
298 3300006175 Ga0070712_100270628 Ga0070712_1002706282 240
299 3300006195 Ga0075366_10089603 Ga0075366_100896032 240
300 3300006195 Ga0075366_10153173 Ga0075366_101531731 240
301 3300006237 Ga0097621_100056820 Ga0097621_1000568203 240
302 3300006353 Ga0075370_10003227 Ga0075370_100032278 240
303 3300006358 Ga0068871_100281926 Ga0068871_1002819262 240
304 3300006358 Ga0068871_100398121 Ga0068871_1003981212 240
305 3300006844 Ga0075428_100196785 Ga0075428_1001967852 240
306 3300006871 Ga0075434_100115025 Ga0075434_1001150253 240
307 3300006871 Ga0075434_100172071 Ga0075434_1001720714 240
308 3300006881 Ga0068865_100159767 Ga0068865_1001597672 240
309 3300006881 Ga0068865_100316578 Ga0068865_1003165782 240
310 3300006931 Ga0097620_100176845 Ga0097620_1001768452 240
311 3300006931 Ga0097620_100248637 Ga0097620_1002486372 240
312 3300006931 Ga0097620_100534810 Ga0097620_1005348102 240
313 3300007265 Ga0099794_10023859 Ga0099794_100238593 240
314 3300009093 Ga0105240_10000336 Ga0105240_1000033629 240
315 3300009093 Ga0105240_10003411 Ga0105240_1000341113 240
316 3300009094 Ga0111539_10167067 Ga0111539_101670672 240
317 3300009098 Ga0105245_10160454 Ga0105245_101604542 240
318 3300009101 Ga0105247_10008005 Ga0105247_100080054 240
319 3300009101 Ga0105247_10132294 Ga0105247_101322942 240
320 3300009148 Ga0105243_10085956 Ga0105243_100859562 240
321 3300009174 Ga0105241_10013101 Ga0105241_100131016 240
322 3300009174 Ga0105241_10082829 Ga0105241_100828293 240
323 3300009174 Ga0105241_10406186 Ga0105241_104061861 240
324 3300009177 Ga0105248_10014838 Ga0105248_100148384 240
325 3300009177 Ga0105248_10153724 Ga0105248_101537242 240
326 3300009545 Ga0105237_10000690 Ga0105237_1000069032 240
327 3300009545 Ga0105237_10056017 Ga0105237_100560174 240
328 3300009545 Ga0105237_10088873 Ga0105237_100888733 240
329 3300009545 Ga0105237_10183098 Ga0105237_101830983 240
330 3300009545 Ga0105237_10250188 Ga0105237_102501883 240
331 3300009551 Ga0105238_10005788 Ga0105238_1000578812 240
332 3300009551 Ga0105238_10339591 Ga0105238_103395912 240
333 3300009551 Ga0105238_10551698 Ga0105238_105516982 240
334 3300009553 Ga0105249_10393375 Ga0105249_103933752 240
335 3300009553 Ga0105249_10711666 Ga0105249_107116661 240
336 3300010159 Ga0099796_10084012 Ga0099796_100840122 240
337 3300010375 Ga0105239_10006751 Ga0105239_1000675113 240
338 3300010375 Ga0105239_10070772 Ga0105239_100707725 240
339 3300010375 Ga0105239_10375310 Ga0105239_103753102 240
340 3300010375 Ga0105239_10712954 Ga0105239_107129542 240
341 3300011119 Ga0105246_10426055 Ga0105246_104260552 240
342 3300013104 Ga0157370_10006306 Ga0157370_100063062 240
343 3300013105 Ga0157369_10118453 Ga0157369_101184532 240
344 3300013296 Ga0157374_10371927 Ga0157374_103719272 240
345 3300013297 Ga0157378_10126465 Ga0157378_101264652 240
346 3300013297 Ga0157378_10207621 Ga0157378_102076211 240
347 3300013306 Ga0163162_10038979 Ga0163162_100389792 240
348 3300013306 Ga0163162_10370534 Ga0163162_103705342 240
349 3300013308 Ga0157375_10249707 Ga0157375_102497072 240
350 3300013308 Ga0157375_10409895 Ga0157375_104098952 240
351 3300014325 Ga0163163_10108583 Ga0163163_101085832 240
352 3300014326 Ga0157380_10030487 Ga0157380_100304872 240
353 3300014326 Ga0157380_10089716 Ga0157380_100897162 240
354 3300014497 Ga0182008_10020976 Ga0182008_100209764 240
355 3300014497 Ga0182008_10041989 Ga0182008_100419892 240
356 3300014968 Ga0157379_10341744 Ga0157379_103417442 240
357 3300014969 Ga0157376_10402613 Ga0157376_104026132 240
358 3300015262 Ga0182007_10037005 Ga0182007_100370052 240
359 3300015262 Ga0182007_10054633 Ga0182007_100546331 240
360 3300015265 Ga0182005_1005352 Ga0182005_10053524 240
361 3300017792 Ga0163161_10189762 Ga0163161_101897622 240
362 3300021327 Ga0214543_1003759 Ga0214543_100375924 240
363 3300021384 Ga0213876_10060936 Ga0213876_100609361 240
364 3300025233 Ga0209437_107178 Ga0209437_1071782 240
365 3300025253 Ga0209677_103335 Ga0209677_1033354 240
366 3300025254 Ga0209148_1015515 Ga0209148_10155152 240
367 3300025261 Ga0209233_1000010 Ga0209233_1000010653 240
368 3300025261 Ga0209233_1000097 Ga0209233_1000097278 240
369 3300025261 Ga0209233_1006432 Ga0209233_10064324 240
370 3300025272 Ga0209455_1003379 Ga0209455_10033791 240
371 3300025273 Ga0209673_1000126 Ga0209673_100012672 240
372 3300025295 Ga0209564_1000368 Ga0209564_100036810 240
373 3300025297 Ga0209758_1000527 Ga0209758_10005273 240
374 3300025299 Ga0209256_1001075 Ga0209256_100107520 240
375 3300025303 Ga0209051_1002366 Ga0209051_100236612 240
376 3300025321 Ga0207656_10004091 Ga0207656_100040916 240
377 3300025893 Ga0207682_10124792 Ga0207682_101247921 240
378 3300025898 Ga0207692_10002994 Ga0207692_100029941 240
379 3300025900 Ga0207710_10015744 Ga0207710_100157443 240
380 3300025900 Ga0207710_10049206 Ga0207710_100492061 240
381 3300025901 Ga0207688_10052512 Ga0207688_100525121 240
382 3300025903 Ga0207680_10178416 Ga0207680_101784162 240
383 3300025906 Ga0207699_10025361 Ga0207699_100253613 240
384 3300025909 Ga0207705_10287041 Ga0207705_102870412 240
385 3300025911 Ga0207654_10000717 Ga0207654_100007177 240
386 3300025911 Ga0207654_10032296 Ga0207654_100322962 240
387 3300025913 Ga0207695_10000458 Ga0207695_1000045861 240
388 3300025913 Ga0207695_10002499 Ga0207695_1000249912 240
389 3300025914 Ga0207671_10018973 Ga0207671_100189732 240
390 3300025914 Ga0207671_10155129 Ga0207671_101551291 240
391 3300025915 Ga0207693_10292539 Ga0207693_102925391 240
392 3300025916 Ga0207663_10120570 Ga0207663_101205702 240
393 3300025923 Ga0207681_10047323 Ga0207681_100473233 240
394 3300025923 Ga0207681_10156904 Ga0207681_101569041 240
395 3300025924 Ga0207694_10000258 Ga0207694_1000025838 240
396 3300025926 Ga0207659_10448625 Ga0207659_104486251 240
397 3300025928 Ga0207700_10145389 Ga0207700_101453892 240
398 3300025929 Ga0207664_10038825 Ga0207664_100388252 240
399 3300025934 Ga0207686_10263435 Ga0207686_102634352 240
400 3300025935 Ga0207709_10281832 Ga0207709_102818322 240
401 3300025939 Ga0207665_10002675 Ga0207665_1000267511 240
402 3300025940 Ga0207691_10034093 Ga0207691_100340932 240
403 3300025941 Ga0207711_10238252 Ga0207711_102382522 240
404 3300025941 Ga0207711_10717426 Ga0207711_107174262 240
405 3300025945 Ga0207679_10500171 Ga0207679_105001711 240
406 3300025949 Ga0207667_10009886 Ga0207667_100098862 240
407 3300025961 Ga0207712_10078385 Ga0207712_100783852 240
408 3300025961 Ga0207712_10521476 Ga0207712_105214762 240
409 3300025972 Ga0207668_10210924 Ga0207668_102109241 240
410 3300025981 Ga0207640_10013426 Ga0207640_100134262 240
411 3300025981 Ga0207640_10046755 Ga0207640_100467552 240
412 3300026035 Ga0207703_10134015 Ga0207703_101340152 240
413 3300026041 Ga0207639_10072505 Ga0207639_100725053 240
414 3300026041 Ga0207639_10401952 Ga0207639_104019521 240
415 3300026067 Ga0207678_10007094 Ga0207678_100070944 240
416 3300026067 Ga0207678_10073914 Ga0207678_100739144 240
417 3300026067 Ga0207678_10285905 Ga0207678_102859052 240
418 3300026075 Ga0207708_10341706 Ga0207708_103417062 240
419 3300026078 Ga0207702_10000006 Ga0207702_1000000625 240
420 3300026078 Ga0207702_10376403 Ga0207702_103764032 240
421 3300026088 Ga0207641_10421130 Ga0207641_104211302 240
422 3300026095 Ga0207676_10443065 Ga0207676_104430651 240
423 3300026095 Ga0207676_10536164 Ga0207676_105361642 240
424 3300026116 Ga0207674_10056094 Ga0207674_100560942 240
425 3300026116 Ga0207674_10065044 Ga0207674_100650442 240
426 3300026116 Ga0207674_10077710 Ga0207674_100777102 240
427 3300026118 Ga0207675_100124665 Ga0207675_1001246653 240
428 3300026118 Ga0207675_100415244 Ga0207675_1004152441 240
429 3300026118 Ga0207675_100522830 Ga0207675_1005228301 240
430 3300026121 Ga0207683_10047777 Ga0207683_100477773 240
431 3300026121 Ga0207683_10103844 Ga0207683_101038443 240
432 3300026121 Ga0207683_10164930 Ga0207683_101649302 240
433 3300026121 Ga0207683_10251174 Ga0207683_102511742 240
434 3300026142 Ga0207698_10055008 Ga0207698_100550083 240
435 3300026142 Ga0207698_10512724 Ga0207698_105127241 240
436 3300027671 Ga0209588_1068054 Ga0209588_10680542 240
437 3300028379 Ga0268266_10105070 Ga0268266_101050702 240
438 3300028379 Ga0268266_10226873 Ga0268266_102268732 240
439 3300028379 Ga0268266_10367665 Ga0268266_103676651 240
440 3300028381 Ga0268264_10000271 Ga0268264_1000027131 240
441 3300031507 Ga0307509_10025601 Ga0307509_100256017 240
442 3300031507 Ga0307509_10029127 Ga0307509_100291272 240
443 3300031548 Ga0307408_100725981 Ga0307408_1007259811 240
444 3300031616 Ga0307508_10039588 Ga0307508_100395887 240
445 3300032002 Ga0307416_100471782 Ga0307416_1004717822 240
446 3300032002 Ga0307416_100625351 Ga0307416_1006253512 240
447 3300032005 Ga0307411_10082470 Ga0307411_100824702 240
448 3300032126 Ga0307415_100064954 Ga0307415_1000649542 240
449 3300033179 Ga0307507_10013433 Ga0307507_100134333 240
450 3300033180 Ga0307510_10012167 Ga0307510_100121675 240
451 3300033180 Ga0307510_10299175 Ga0307510_102991751 240
452 3300035172 Ga0373955_0070441 Ga0373955_0070441_558_1361 240
453 3300035692 Ga0373935_0160393 Ga0373935_0160393_480_1247 240
454 3300035695 Ga0373927_0005221 Ga0373927_0005221_4499_5266 240
455 3300035725 Ga0373947_0104443 Ga0373947_0104443_989_1756 240
456 3300037466 Ga0395898_0183641 Ga0395898_0183641_1147_1914 240
457 3300038443 Ga0395901_0554737 Ga0395901_0554737_66_833 240
458 3300039437 Ga0436365_0301686 Ga0436365_0301686_119_886 240
459 3300039437 Ga0436365_1546724 Ga0436365_1546724_791_1558 240
460 3300039437 Ga0436365_1866973 Ga0436365_1866973_1989_2750 240
461 3300039450 Ga0436363_1116250 Ga0436363_1116250_357_1124 240
462 3300041509 Ga0451843_0126997 Ga0451843_0126997_1792_2526 240
463 3300041511 Ga0451855_0106049 Ga0451855_0106049_632_1366 240
464 3300042436 Ga0439435_0003562 Ga0439435_0003562_783_1550 240
465 3300046455 Ga0495603_0017441 Ga0495603_0017441_1466_2233 240
466 3300046455 Ga0495603_0177318 Ga0495603_0177318_434_1183 240
467 3300046455 Ga0495603_0193862 Ga0495603_0193862_134_904 240
468 3300046460 Ga0495638_0000093 Ga0495638_0000093_122773_123507 240
469 3300046460 Ga0495638_0094810 Ga0495638_0094810_467_1237 240
470 3300046462 Ga0495651_0004745 Ga0495651_0004745_8270_9073 240
471 3300046471 Ga0495650_0078871 Ga0495650_0078871_291_1061 240
472 3300046473 Ga0495582_0298543 Ga0495582_0298543_112_882 240
473 3300046474 Ga0495605_0073658 Ga0495605_0073658_129_899 240
474 3300046475 Ga0495639_0033281 Ga0495639_0033281_751_1521 240
475 3300046475 Ga0495639_0130439 Ga0495639_0130439_60_827 240
476 3300046492 Ga0495585_0116112 Ga0495585_0116112_514_1281 240
477 3300046499 Ga0495594_0052519 Ga0495594_0052519_337_1104 240
478 3300046499 Ga0495594_0171331 Ga0495594_0171331_353_1123 240
479 3300046501 Ga0495607_0111819 Ga0495607_0111819_694_1428 240
480 3300046507 Ga0495606_0059370 Ga0495606_0059370_201_983 240
481 3300046511 Ga0495608_0009046 Ga0495608_0009046_1543_2346 240
482 3300046516 Ga0495628_0047046 Ga0495628_0047046_1529_2332 240
483 3300046518 Ga0495631_0025660 Ga0495631_0025660_699_1469 240
484 3300046518 Ga0495631_0049221 Ga0495631_0049221_907_1677 240
485 3300046519 Ga0495632_0069407 Ga0495632_0069407_385_1155 240
486 3300046524 Ga0495648_0154229 Ga0495648_0154229_210_1019 240
487 3300046526 Ga0495666_0062894 Ga0495666_0062894_821_1588 240
488 3300046529 Ga0495652_0025991 Ga0495652_0025991_2018_2821 240
489 3300046536 Ga0495587_0024739 Ga0495587_0024739_1653_2456 240
490 3300046557 Ga0495622_0007018 Ga0495622_0007018_2744_3493 240
491 3300046557 Ga0495622_0031590 Ga0495622_0031590_1376_2143 240
492 3300046557 Ga0495622_0099376 Ga0495622_0099376_432_1199 240
493 3300046558 Ga0495633_0072008 Ga0495633_0072008_670_1437 240
494 3300046559 Ga0495667_0038688 Ga0495667_0038688_538_1341 240
495 3300046616 Ga0495668_0026449 Ga0495668_0026449_2394_3128 240
496 3300046616 Ga0495668_0252893 Ga0495668_0252893_108_878 240
497 3300046642 Ga0495634_0047258 Ga0495634_0047258_1346_2149 240
498 3300046648 Ga0495611_0018160 Ga0495611_0018160_779_1513 240
499 3300046660 Ga0495625_0178005 Ga0495625_0178005_443_1177 240
500 3300046663 Ga0495635_0086462 Ga0495635_0086462_1124_1927 240
501 3300046674 Ga0495588_0004395 Ga0495588_0004395_998_1765 240
502 3300046675 Ga0495657_0053262 Ga0495657_0053262_1788_2591 240
503 3300046678 Ga0495599_0007960 Ga0495599_0007960_4391_5194 240
504 3300046679 Ga0495623_0016163 Ga0495623_0016163_987_1790 240
505 3300046680 Ga0495646_0017819 Ga0495646_0017819_1232_2035 240
506 3300046681 Ga0495647_0035152 Ga0495647_0035152_866_1636 240
507 3300046684 Ga0495669_0205330 Ga0495669_0205330_42_809 240
508 3300046689 Ga0495613_0042760 Ga0495613_0042760_1420_2223 240
509 3300046690 Ga0495624_0190075 Ga0495624_0190075_112_861 240
510 3300046691 Ga0495670_0050605 Ga0495670_0050605_104_838 240
511 3300046691 Ga0495670_0060507 Ga0495670_0060507_767_1537 240
512 3300046809 Ga0495600_0001949 Ga0495600_0001949_3780_4583 240
513 3300046810 Ga0495660_0126052 Ga0495660_0126052_360_1094 240
514 3300046810 Ga0495660_0153503 Ga0495660_0153503_28_798 240
515 3300047315 Ga0495581_0066884 Ga0495581_0066884_1271_2041 240
516 3300047317 Ga0495604_0026776 Ga0495604_0026776_1226_2029 240
517 3300047318 Ga0495636_0025766 Ga0495636_0025766_167_901 240
518 3300047319 Ga0495674_0068767 Ga0495674_0068767_1895_2698 240
519 3300047320 Ga0495672_0092763 Ga0495672_0092763_393_1142 240
520 3300047322 Ga0495680_0056250 Ga0495680_0056250_1089_1892 240
521 3300047444 Ga0495675_0018173 Ga0495675_0018173_2568_3371 240
522 3300047471 Ga0495684_0045599 Ga0495684_0045599_1271_2074 240
523 3300048088 Ga0495602_0021306 Ga0495602_0021306_4262_5065 240
524 3300048903 Ga0496100_0047645 Ga0496100_0047645_107_841 240
525 3300048905 Ga0496102_0000614 Ga0496102_0000614_833_1567 240
526 3300048906 Ga0496103_0032673 Ga0496103_0032673_2165_2899 240
527 3300048907 Ga0496104_0088931 Ga0496104_0088931_757_1524 240
528 3300048908 Ga0496105_0657615 Ga0496105_0657615_21_788 240
529 3300048911 Ga0496108_0597165 Ga0496108_0597165_158_949 240
530 3300048912 Ga0496109_0501941 Ga0496109_0501941_20_787 240
531 3300048913 Ga0496110_0121491 Ga0496110_0121491_46_828 240
532 3300048915 Ga0496112_0775612 Ga0496112_0775612_46_813 240
533 3300048918 Ga0496115_0148694 Ga0496115_0148694_1147_1917 240
534 3300048918 Ga0496115_0513494 Ga0496115_0513494_163_915 240
535 3300048919 Ga0496116_0024695 Ga0496116_0024695_573_1307 240
536 3300048920 Ga0496117_0042409 Ga0496117_0042409_587_1321 240
537 3300048921 Ga0496118_0000353 Ga0496118_0000353_76532_77266 240
538 3300048921 Ga0496118_0135790 Ga0496118_0135790_39_764 240
539 3300048923 Ga0496120_0001950 Ga0496120_0001950_571_1305 240
540 3300048924 Ga0496121_0000536 Ga0496121_0000536_583_1317 240
541 3300048924 Ga0496121_0031628 Ga0496121_0031628_4037_4804 240
542 3300048924 Ga0496121_0038931 Ga0496121_0038931_2878_3648 240
543 3300048924 Ga0496121_0041610 Ga0496121_0041610_1539_2309 240
544 3300048924 Ga0496121_0303059 Ga0496121_0303059_73_843 240
545 3300048925 Ga0496122_0044235 Ga0496122_0044235_514_1248 240
546 3300048925 Ga0496122_0047262 Ga0496122_0047262_1700_2467 240
547 3300048928 Ga0496125_0049986 Ga0496125_0049986_2201_2935 240
548 3300048928 Ga0496125_0128650 Ga0496125_0128650_956_1723 240
549 3300048929 Ga0496126_0002330 Ga0496126_0002330_8878_9648 240
550 3300048929 Ga0496126_0003343 Ga0496126_0003343_7816_8583 240
551 3300048929 Ga0496126_0042429 Ga0496126_0042429_2934_3701 240
552 3300048929 Ga0496126_0165644 Ga0496126_0165644_41_847 240
553 3300048929 Ga0496126_0191209 Ga0496126_0191209_208_999 240
554 3300048929 Ga0496126_0409142 Ga0496126_0409142_255_1022 240
555 3300049459 Ga0495678_075828 Ga0495678_075828_54_788 240
556 3300049571 Ga0501034_0044504 Ga0501034_0044504_162_932 240
557 3300049574 Ga0501038_0024848 Ga0501038_0024848_4480_5268 240
558 3300049579 Ga0501043_0075835 Ga0501043_0075835_667_1455 240
559 3300050493 nmdc:mga0k408_286695_c1 nmdc:mga0k408_286695_c1_114_881 240
560 3300050494 nmdc:mga06z11_32100_c1 nmdc:mga06z11_32100_c1_885_1652 240
561 3300050496 nmdc:mga07m45_20408_c1 nmdc:mga07m45_20408_c1_2160_2927 240
562 3300050511 nmdc:mga08y16_242270_c1 nmdc:mga08y16_242270_c1_340_1107 240
563 3300050512 nmdc:mga0n895_171740_c1 nmdc:mga0n895_171740_c1_474_1241 240
564 3300053080 Ga0500635_0013594 Ga0500635_0013594_1555_2304 240
565 3300053080 Ga0500635_0027315 Ga0500635_0027315_446_1213 240
566 3300053085 Ga0495619_0043214 Ga0495619_0043214_1264_2067 240
567 3300053087 Ga0500643_004317 Ga0500643_004317_1496_2287 240
568 3300053096 Ga0500641_0021968 Ga0500641_0021968_657_1427 240
569 3300053108 Ga0500562_012538 Ga0500562_012538_1264_1998 240
570 3300053108 Ga0500562_019187 Ga0500562_019187_434_1204 240
571 3300053119 Ga0500595_008745 Ga0500595_008745_2849_3616 240
572 3300053125 Ga0500618_008138 Ga0500618_008138_14_805 240
573 3300053133 Ga0500655_021535 Ga0500655_021535_369_1139 240
574 3300053139 Ga0500568_0000460 Ga0500568_0000460_2337_3071 240
575 3300053147 Ga0500589_113253 Ga0500589_113253_291_1061 240
576 3300053150 Ga0500603_014746 Ga0500603_014746_565_1332 240
577 3300053153 Ga0500616_0001157 Ga0500616_0001157_9714_10448 240
578 3300053157 Ga0500624_000027 Ga0500624_000027_15020_15811 240
579 3300053177 Ga0500636_0005358 Ga0500636_0005358_3608_4399 240
580 3300053177 Ga0500636_0019166 Ga0500636_0019166_1218_1985 240
581 3300053177 Ga0500636_0217722 Ga0500636_0217722_105_872 240
582 3300053178 Ga0500637_0125663 Ga0500637_0125663_407_1174 240
583 3300059421 Ga0590071_016772 Ga0590071_016772_808_1590 240
584 3300059426 Ga0590077_011018 Ga0590077_011018_444_1226 240
585 iso_pu_bacteria 2507262055 2507507892 240
586 iso_pu_bacteria 2508501009 2508542003 240
587 iso_pu_bacteria 2508501042 2508692453 240
588 iso_pu_bacteria 2511231028 2511395272 240
589 iso_pu_bacteria 2513237094 2513639331 240
590 iso_pu_bacteria 2513237095 2513647293 240
591 iso_pu_bacteria 2513237102 2513700113 240
592 iso_pu_bacteria 2513237139 2513878282 240
593 iso_pu_bacteria 2513237161 2514009663 240
594 iso_pu_bacteria 2515154112 2515626791 240
595 iso_pu_bacteria 2517093001 2517103903 240
596 iso_pu_bacteria 2528768022 2528853057 240
597 iso_pu_bacteria 2617270735 2617346570 240
598 iso_pu_bacteria 2802429603 2805918470 240
599 iso_pu_bacteria 2816332527 2818236331 240
600 iso_pu_bacteria 2824617872 2824622888 240
601 iso_pu_bacteria 2824626560 2824631961 240
602 iso_pu_bacteria 2824635225 2824638540 240
603 iso_pu_bacteria 2824644064 2824649621 240
604 iso_pu_bacteria 2824661429 2824665343 240
605 iso_pu_bacteria 2824671348 2824678064 240
606 iso_pu_bacteria 2824687955 2824694458 240
607 iso_pu_bacteria 2824696289 2824699681 240
608 iso_pu_bacteria 2824714736 2824716194 240
609 iso_pu_bacteria 2824723954 2824726838 240
610 iso_pu_bacteria 2824773399 2824777316 240
611 iso_pu_bacteria 2838122688 2838122893 240
612 iso_pu_bacteria 2841949485 2841950844 240
613 iso_pu_bacteria 2841966195 2841973704 240
614 iso_pu_bacteria 2841983080 2841988960 240
615 iso_pu_bacteria 2847939898 2847947506 240
616 iso_pu_bacteria 2849076700 2849078618 240
617 iso_pu_bacteria 2857509624 2857513004 240
618 iso_pu_bacteria 2874590934 2874598995 240
619 iso_pu_bacteria 2874620515 2874622313 240
620 iso_pu_bacteria 2874645413 2874650558 240
621 iso_pu_bacteria 2876771140 2876779034 240
622 iso_pu_bacteria 2876808645 2876810623 240
623 iso_pu_bacteria 2876818435 2876822638 240
624 iso_pu_bacteria 2879074833 2879082827 240
625 iso_pu_bacteria 2879099564 2879102845 240
626 iso_pu_bacteria 2879127579 2879133108 240
627 iso_pu_bacteria 2879142872 2879149395 240
628 iso_pu_bacteria 2881364244 2881364705 240
629 iso_pu_bacteria 2885366525 2885369668 240
630 iso_pu_bacteria 2888378607 2888385226 240
631 iso_pu_bacteria 2888388044 2888393013 240
632 iso_pu_bacteria 2888419890 2888425369 240
633 iso_pu_bacteria 2904666416 2904667924 240
634 iso_pu_bacteria 2906626472 2906632295 240
635 iso_pu_bacteria 2922368715 2922372666 240
636 iso_pu_bacteria 2929615660 2929620479 240
637 iso_pu_bacteria 2929624759 2929626372 240
638 iso_pu_bacteria 2932784394 2932784755 240
639 iso_pu_bacteria 2932794094 2932795370 240
640 iso_pu_bacteria 2932809354 2932809735 240
641 iso_pu_bacteria 2932818245 2932818520 240
642 iso_pu_bacteria 2932828146 2932828538 240
643 iso_pu_bacteria 2933577622 2933582397 240
644 iso_pu_bacteria 2935608549 2935609617 240
645 iso_pu_bacteria 2935616580 2935617496 240
646 iso_pu_bacteria 2935638405 2935639022 240
647 iso_pu_bacteria 2935648319 2935652236 240
648 iso_pu_bacteria 2935656913 2935660818 240
649 iso_pu_bacteria 2935665750 2935666126 240
650 iso_pu_bacteria 2935675223 2935675775 240
651 iso_pu_bacteria 2935684952 2935685216 240
652 iso_pu_bacteria 2935694250 2935694906 240
653 iso_pu_bacteria 2935703347 2935704029 240
654 iso_pu_bacteria 2935713505 2935713769 240
655 iso_pu_bacteria 2935722832 2935724388 240
656 iso_pu_bacteria 2935732158 2935733254 240
657 iso_pu_bacteria 2935741537 2935742633 240
658 iso_pu_bacteria 2935750917 2935751181 240
659 iso_pu_bacteria 2935760218 2935760295 240
660 iso_pu_bacteria 2935769743 2935770008 240
661 iso_pu_bacteria 2935777560 2935784783 240
662 iso_pu_bacteria 2935785616 2935785750 240
663 iso_pu_bacteria 2935793552 2935794322 240
664 iso_pu_bacteria 2935801545 2935802112 240
665 iso_pu_bacteria 2935810662 2935810934 240
666 iso_pu_bacteria 2935819856 2935822779 240
667 iso_pu_bacteria 2935827899 2935828517 240
668 iso_pu_bacteria 2935837841 2935839893 240
669 iso_pu_bacteria 2935847175 2935848361 240
670 iso_pu_bacteria 2935855204 2935856121 240
671 iso_pu_bacteria 2935864058 2935865935 240
672 iso_pu_bacteria 2935873716 2935877740 240
673 iso_pu_bacteria 2935908558 2935909836 240
674 iso_pu_bacteria 2935916978 2935917560 240
675 iso_pu_bacteria 2935926038 2935927316 240
676 iso_pu_bacteria 2935934488 2935936839 240
677 iso_pu_bacteria 2935942939 2935944858 240
678 iso_pu_bacteria 2935951376 2935953295 240
679 iso_pu_bacteria 2935959822 2935961204 240
680 iso_pu_bacteria 2935967501 2935970135 240
681 iso_pu_bacteria 2935975950 2935980436 240
682 iso_pu_bacteria 2935984226 2935986703 240
683 iso_pu_bacteria 2935992306 2935992685 240
684 iso_pu_bacteria 2936002035 2936002557 240
685 iso_pu_bacteria 2936011229 2936014874 240
686 iso_pu_bacteria 2936019824 2936022145 240
687 iso_pu_bacteria 2936028420 2936032833 240
688 iso_pu_bacteria 2936037263 2936037646 240
689 iso_pu_bacteria 2936046547 2936050615 240
690 iso_pu_bacteria 2936055302 2936059609 240
691 iso_pu_bacteria 2940556831 2940558017 240
692 iso_pu_bacteria 2941531003 2941536832 240
693 iso_pu_bacteria 2941538514 2941540767 240
694 iso_pu_bacteria 3005506211 3005507305 240
695 iso_pu_bacteria 3005710791 3005715605 240
696 iso_pu_bacteria 8016522445 8016528904 240
697 iso_pu_bacteria 8016530956 8016534098 240
698 iso_pu_bacteria 8016539877 8016547327 240
699 iso_pu_bacteria 8016548790 8016554816 240
700 iso_pu_bacteria 8016557553 8016563179 240
701 iso_pu_bacteria 8016566248 8016572440 240
702 iso_pu_bacteria 8016583857 8016593882 240
703 iso_pu_bacteria 8016595262 8016600935 240
704 iso_pu_bacteria 8016613128 8016615377 240
705 iso_pu_bacteria 8016630954 8016639414 240
706 iso_pu_bacteria 8017057580 8017064632 240
707 iso_pu_bacteria 8019538911 8019545802 240
708 iso_pu_bacteria 8019547302 8019552919 240
709 iso_pu_bacteria 8019576017 8019583998 240
710 iso_pu_bacteria 8019586578 8019591805 240
711 iso_pu_bacteria 8019597564 8019599532 240
712 iso_pu_bacteria 8019619141 8019619569 240
713 iso_pu_bacteria 8019638758 8019646352 240
714 iso_pu_bacteria 8019648815 8019649102 240
715 iso_pu_bacteria 8019678201 8019685228 240
716 iso_pu_bacteria 8019687851 8019690838 240
717 iso_pu_bacteria 8055742211 8055745341 240
718 iso_pu_bacteria 8056967851 8056968806 240
719 3300003354 JGI25160J50197_1000826 JGI25160J50197_100082614 241
720 3300005455 Ga0070663_100312237 Ga0070663_1003122372 241
721 3300006042 Ga0075368_10098687 Ga0075368_100986871 241
722 3300006051 Ga0075364_10165551 Ga0075364_101655512 241
723 3300006186 Ga0075369_10011058 Ga0075369_100110582 241
724 3300006195 Ga0075366_10132388 Ga0075366_101323882 241
725 3300025302 Ga0207426_1000402 Ga0207426_10004027 241
726 3300046542 Ga0495597_0014749 Ga0495597_0014749_1037_1828 241
727 3300048928 Ga0496125_0013222 Ga0496125_0013222_2466_3266 241
728 3300050491 nmdc:mga00v17_117832_c1 nmdc:mga00v17_117832_c1_421_1221 241
729 3300050492 nmdc:mga0yw44_184330_c1 nmdc:mga0yw44_184330_c1_338_1138 241
730 3300003215 JGI25153J46596_10006320 JGI25153J46596_100063203 242
731 3300005983 Ga0081540_1009188 Ga0081540_10091881 242
732 3300025295 Ga0209564_1014503 Ga0209564_10145032 242
733 3300046524 Ga0495648_0200028 Ga0495648_0200028_150_950 242
734 3300053087 Ga0500643_000046 Ga0500643_000046_110775_111575 242
735 3300053094 Ga0500566_0070023 Ga0500566_0070023_82_882 242
736 3300053104 Ga0500556_0107655 Ga0500556_0107655_52_852 242
737 3300053105 Ga0500557_000054 Ga0500557_000054_14988_15788 242
738 3300053121 Ga0500607_062768 Ga0500607_062768_698_1498 242
739 3300053122 Ga0500608_099352 Ga0500608_099352_504_1304 242
740 3300053136 Ga0500559_0175459 Ga0500559_0175459_44_844 242
741 3300053155 Ga0500620_004187 Ga0500620_004187_163_963 242
742 3300053156 Ga0500622_0012955 Ga0500622_0012955_2263_3063 242
743 3300053160 Ga0500633_0021962 Ga0500633_0021962_700_1500 242
744 3300053177 Ga0500636_0001429 Ga0500636_0001429_11123_11923 242
745 3300053729 Ga0500625_011807 Ga0500625_011807_1152_1952 242
746 3300053737 Ga0500601_000722 Ga0500601_000722_2225_3025 242
747 3300055283 Ga0500661_002049 Ga0500661_002049_1592_2392 242
748 3300005334 Ga0068869_100586891 Ga0068869_1005868911 243
749 3300005548 Ga0070665_100046083 Ga0070665_1000460833 243
750 3300025909 Ga0207705_10033323 Ga0207705_100333233 243
751 3300025939 Ga0207665_10245607 Ga0207665_102456072 243
752 3300025942 Ga0207689_10504276 Ga0207689_105042761 243
753 3300028379 Ga0268266_10028226 Ga0268266_100282262 243
754 3300037471 Ga0395905_0002238 Ga0395905_0002238_3033_3833 243
755 3300046460 Ga0495638_0012296 Ga0495638_0012296_1585_2415 243
756 3300046507 Ga0495606_0121737 Ga0495606_0121737_285_1085 243
757 3300048912 Ga0496109_0531469 Ga0496109_0531469_247_1047 243
758 3300048919 Ga0496116_0255484 Ga0496116_0255484_29_826 243
759 3300048929 Ga0496126_0113540 Ga0496126_0113540_1083_1883 243
760 3300053086 Ga0500578_0217792 Ga0500578_0217792_184_981 243
761 3300053094 Ga0500566_0000381 Ga0500566_0000381_9695_10495 243
762 3300053111 Ga0500572_000074 Ga0500572_000074_14865_15644 243
763 3300053130 Ga0500642_0000136 Ga0500642_0000136_1493_2284 243
764 3300053130 Ga0500642_0040912 Ga0500642_0040912_475_1275 243
765 3300053134 Ga0500658_0026826 Ga0500658_0026826_35_865 243
766 3300053136 Ga0500559_0000780 Ga0500559_0000780_4428_5207 243
767 3300053136 Ga0500559_0013121 Ga0500559_0013121_1036_1836 243
768 3300001904 JGI24736J21556_1010478 JGI24736J21556_10104782 244
769 3300001979 JGI24740J21852_10053524 JGI24740J21852_100535241 244
770 3300001989 JGI24739J22299_10045881 JGI24739J22299_100458812 244
771 3300001990 JGI24737J22298_10041879 JGI24737J22298_100418792 244
772 3300002075 JGI24738J21930_10021365 JGI24738J21930_100213652 244
773 3300003215 JGI25153J46596_10002640 JGI25153J46596_100026406 244
774 3300003215 JGI25153J46596_10008296 JGI25153J46596_100082962 244
775 3300003354 JGI25160J50197_1012801 JGI25160J50197_10128012 244
776 3300005262 Ga0065165_1000953 Ga0065165_10009536 244
777 3300005262 Ga0065165_1002778 Ga0065165_10027789 244
778 3300005262 Ga0065165_1016141 Ga0065165_10161412 244
779 3300005328 Ga0070676_10083914 Ga0070676_100839142 244
780 3300005335 Ga0070666_10086242 Ga0070666_100862422 244
781 3300005339 Ga0070660_100111058 Ga0070660_1001110582 244
782 3300005347 Ga0070668_100138585 Ga0070668_1001385852 244
783 3300005353 Ga0070669_100058680 Ga0070669_1000586805 244
784 3300005366 Ga0070659_100088026 Ga0070659_1000880262 244
785 3300005367 Ga0070667_100056373 Ga0070667_1000563732 244
786 3300005455 Ga0070663_100021296 Ga0070663_1000212964 244
787 3300005455 Ga0070663_100079555 Ga0070663_1000795552 244
788 3300005457 Ga0070662_100023894 Ga0070662_1000238941 244
789 3300005457 Ga0070662_100089686 Ga0070662_1000896862 244
790 3300005518 Ga0070699_100384408 Ga0070699_1003844082 244
791 3300005539 Ga0068853_100147807 Ga0068853_1001478072 244
792 3300005563 Ga0068855_100150914 Ga0068855_1001509142 244
793 3300005614 Ga0068856_100327042 Ga0068856_1003270422 244
794 3300005614 Ga0068856_100477409 Ga0068856_1004774091 244
795 3300005616 Ga0068852_100073636 Ga0068852_1000736362 244
796 3300005616 Ga0068852_100328306 Ga0068852_1003283062 244
797 3300005719 Ga0068861_100009251 Ga0068861_1000092515 244
798 3300005841 Ga0068863_100202527 Ga0068863_1002025272 244
799 3300005843 Ga0068860_100034329 Ga0068860_1000343295 244
800 3300005844 Ga0068862_100013908 Ga0068862_1000139084 244
801 3300005844 Ga0068862_100112279 Ga0068862_1001122792 244
802 3300005844 Ga0068862_100194527 Ga0068862_1001945272 244
803 3300006038 Ga0075365_10094729 Ga0075365_100947292 244
804 3300006038 Ga0075365_10133614 Ga0075365_101336142 244
805 3300006042 Ga0075368_10018440 Ga0075368_100184402 244
806 3300006048 Ga0075363_100061669 Ga0075363_1000616692 244
807 3300006177 Ga0075362_10169015 Ga0075362_101690151 244
808 3300006195 Ga0075366_10069715 Ga0075366_100697152 244
809 3300006353 Ga0075370_10012524 Ga0075370_100125242 244
810 3300009093 Ga0105240_10465850 Ga0105240_104658501 244
811 3300009174 Ga0105241_10143174 Ga0105241_101431742 244
812 3300009177 Ga0105248_10039164 Ga0105248_100391642 244
813 3300009545 Ga0105237_10059464 Ga0105237_100594642 244
814 3300009545 Ga0105237_10430544 Ga0105237_104305442 244
815 3300009551 Ga0105238_10202980 Ga0105238_102029802 244
816 3300009553 Ga0105249_10019015 Ga0105249_100190155 244
817 3300010375 Ga0105239_10381665 Ga0105239_103816652 244
818 3300010375 Ga0105239_10383971 Ga0105239_103839712 244
819 3300011119 Ga0105246_10121974 Ga0105246_101219742 244
820 3300013306 Ga0163162_10194801 Ga0163162_101948012 244
821 3300014325 Ga0163163_10546596 Ga0163163_105465962 244
822 3300025230 Ga0209563_102799 Ga0209563_1027993 244
823 3300025258 Ga0209129_1001101 Ga0209129_100110113 244
824 3300025273 Ga0209673_1001062 Ga0209673_10010624 244
825 3300025294 Ga0209025_1032697 Ga0209025_10326972 244
826 3300025295 Ga0209564_1014785 Ga0209564_10147852 244
827 3300025297 Ga0209758_1000345 Ga0209758_100034575 244
828 3300025297 Ga0209758_1008345 Ga0209758_10083453 244
829 3300025299 Ga0209256_1001095 Ga0209256_100109533 244
830 3300025302 Ga0207426_1000400 Ga0207426_10004008 244
831 3300025302 Ga0207426_1000736 Ga0207426_100073641 244
832 3300025302 Ga0207426_1007160 Ga0207426_10071602 244
833 3300025903 Ga0207680_10076672 Ga0207680_100766722 244
834 3300025904 Ga0207647_10041918 Ga0207647_100419182 244
835 3300025907 Ga0207645_10074877 Ga0207645_100748772 244
836 3300025911 Ga0207654_10183398 Ga0207654_101833982 244
837 3300025914 Ga0207671_10036677 Ga0207671_100366772 244
838 3300025919 Ga0207657_10152968 Ga0207657_101529682 244
839 3300025920 Ga0207649_10388049 Ga0207649_103880492 244
840 3300025924 Ga0207694_10358970 Ga0207694_103589702 244
841 3300025931 Ga0207644_10063340 Ga0207644_100633402 244
842 3300025933 Ga0207706_10042418 Ga0207706_100424183 244
843 3300025934 Ga0207686_10203467 Ga0207686_102034672 244
844 3300025935 Ga0207709_10223642 Ga0207709_102236422 244
845 3300025941 Ga0207711_10055022 Ga0207711_100550224 244
846 3300025942 Ga0207689_10016221 Ga0207689_100162211 244
847 3300025949 Ga0207667_10250852 Ga0207667_102508522 244
848 3300025961 Ga0207712_10006823 Ga0207712_100068236 244
849 3300025981 Ga0207640_10239367 Ga0207640_102393672 244
850 3300025986 Ga0207658_10184508 Ga0207658_101845082 244
851 3300026041 Ga0207639_10200816 Ga0207639_102008162 244
852 3300026078 Ga0207702_10479389 Ga0207702_104793891 244
853 3300026088 Ga0207641_10056865 Ga0207641_100568652 244
854 3300026089 Ga0207648_10258308 Ga0207648_102583082 244
855 3300026116 Ga0207674_10174349 Ga0207674_101743492 244
856 3300026142 Ga0207698_10088361 Ga0207698_100883612 244
857 3300027866 Ga0209813_10069552 Ga0209813_100695522 244
858 3300028379 Ga0268266_10208603 Ga0268266_102086031 244
859 3300028380 Ga0268265_10009598 Ga0268265_100095986 244
860 3300028380 Ga0268265_10128860 Ga0268265_101288602 244
861 3300033180 Ga0307510_10021632 Ga0307510_100216324 244
862 3300033180 Ga0307510_10130945 Ga0307510_101309452 244
863 3300046454 Ga0495592_0314512 Ga0495592_0314512_44_856 244
864 3300046457 Ga0495590_0075855 Ga0495590_0075855_348_1160 244
865 3300046459 Ga0495629_0279900 Ga0495629_0279900_269_1069 244
866 3300046462 Ga0495651_0035403 Ga0495651_0035403_2531_3331 244
867 3300046474 Ga0495605_0058583 Ga0495605_0058583_724_1524 244
868 3300046491 Ga0495584_0085316 Ga0495584_0085316_11_811 244
869 3300046507 Ga0495606_0154064 Ga0495606_0154064_85_885 244
870 3300046511 Ga0495608_0059301 Ga0495608_0059301_1695_2495 244
871 3300046512 Ga0495610_0030536 Ga0495610_0030536_919_1719 244
872 3300046513 Ga0495616_0055497 Ga0495616_0055497_23_823 244
873 3300046515 Ga0495620_0049015 Ga0495620_0049015_562_1374 244
874 3300046515 Ga0495620_0077440 Ga0495620_0077440_226_1026 244
875 3300046522 Ga0495643_0009325 Ga0495643_0009325_3585_4385 244
876 3300046524 Ga0495648_0049617 Ga0495648_0049617_1354_2166 244
877 3300046529 Ga0495652_0070348 Ga0495652_0070348_309_1109 244
878 3300046529 Ga0495652_0200162 Ga0495652_0200162_73_885 244
879 3300046536 Ga0495587_0174020 Ga0495587_0174020_103_903 244
880 3300046538 Ga0495609_0102151 Ga0495609_0102151_123_935 244
881 3300046557 Ga0495622_0013881 Ga0495622_0013881_2221_3021 244
882 3300046557 Ga0495622_0051770 Ga0495622_0051770_861_1673 244
883 3300046616 Ga0495668_0072194 Ga0495668_0072194_992_1792 244
884 3300046660 Ga0495625_0279754 Ga0495625_0279754_74_874 244
885 3300046665 Ga0495661_0118917 Ga0495661_0118917_596_1396 244
886 3300046674 Ga0495588_0077068 Ga0495588_0077068_350_1150 244
887 3300046675 Ga0495657_0025122 Ga0495657_0025122_2094_2894 244
888 3300046689 Ga0495613_0007936 Ga0495613_0007936_911_1711 244
889 3300046690 Ga0495624_0038078 Ga0495624_0038078_1427_2227 244
890 3300046690 Ga0495624_0270335 Ga0495624_0270335_92_904 244
891 3300046809 Ga0495600_0013037 Ga0495600_0013037_2068_2868 244
892 3300047317 Ga0495604_0038952 Ga0495604_0038952_865_1665 244
893 3300047321 Ga0495676_0094977 Ga0495676_0094977_809_1609 244
894 3300047321 Ga0495676_0307600 Ga0495676_0307600_215_1027 244
895 3300047443 Ga0495687_009909 Ga0495687_009909_4042_4842 244
896 3300047472 Ga0495686_0066313 Ga0495686_0066313_646_1548 244
897 3300048903 Ga0496100_0193011 Ga0496100_0193011_26_817 244
898 3300048904 Ga0496101_0052058 Ga0496101_0052058_565_1356 244
899 3300048905 Ga0496102_0045731 Ga0496102_0045731_1852_2652 244
900 3300048905 Ga0496102_0304408 Ga0496102_0304408_377_1168 244
901 3300048905 Ga0496102_0411624 Ga0496102_0411624_306_1106 244
902 3300048905 Ga0496102_0458890 Ga0496102_0458890_199_987 244
903 3300048906 Ga0496103_0013040 Ga0496103_0013040_2026_2826 244
904 3300048906 Ga0496103_0198439 Ga0496103_0198439_462_1253 244
905 3300048907 Ga0496104_0028633 Ga0496104_0028633_2614_3414 244
906 3300048907 Ga0496104_0041567 Ga0496104_0041567_2289_3080 244
907 3300048907 Ga0496104_0069427 Ga0496104_0069427_1811_2611 244
908 3300048908 Ga0496105_0014940 Ga0496105_0014940_192_992 244
909 3300048908 Ga0496105_0033632 Ga0496105_0033632_1849_2640 244
910 3300048908 Ga0496105_0081982 Ga0496105_0081982_1347_2147 244
911 3300048908 Ga0496105_0143377 Ga0496105_0143377_892_1692 244
912 3300048909 Ga0496106_0097872 Ga0496106_0097872_295_1086 244
913 3300048909 Ga0496106_0307330 Ga0496106_0307330_16_816 244
914 3300048910 Ga0496107_0104865 Ga0496107_0104865_78_878 244
915 3300048911 Ga0496108_0054477 Ga0496108_0054477_248_1048 244
916 3300048912 Ga0496109_0418734 Ga0496109_0418734_309_1109 244
917 3300048913 Ga0496110_0106873 Ga0496110_0106873_857_1648 244
918 3300048913 Ga0496110_0234521 Ga0496110_0234521_168_968 244
919 3300048913 Ga0496110_0556462 Ga0496110_0556462_29_829 244
920 3300048913 Ga0496110_0592077 Ga0496110_0592077_41_841 244
921 3300048914 Ga0496111_0066281 Ga0496111_0066281_1262_2062 244
922 3300048915 Ga0496112_0084499 Ga0496112_0084499_2071_2871 244
923 3300048915 Ga0496112_0585805 Ga0496112_0585805_34_825 244
924 3300048916 Ga0496113_0064474 Ga0496113_0064474_559_1359 244
925 3300048916 Ga0496113_0150197 Ga0496113_0150197_37_837 244
926 3300048916 Ga0496113_0242777 Ga0496113_0242777_172_963 244
927 3300048919 Ga0496116_0048297 Ga0496116_0048297_223_1014 244
928 3300048919 Ga0496116_0072039 Ga0496116_0072039_982_1782 244
929 3300048920 Ga0496117_0091177 Ga0496117_0091177_827_1627 244
930 3300048921 Ga0496118_0106169 Ga0496118_0106169_734_1534 244
931 3300048921 Ga0496118_0126991 Ga0496118_0126991_525_1325 244
932 3300048921 Ga0496118_0207637 Ga0496118_0207637_188_976 244
933 3300048921 Ga0496118_0269996 Ga0496118_0269996_135_926 244
934 3300048922 Ga0496119_0005991 Ga0496119_0005991_9710_10510 244
935 3300048923 Ga0496120_0024687 Ga0496120_0024687_850_1650 244
936 3300048923 Ga0496120_0070716 Ga0496120_0070716_138_929 244
937 3300048924 Ga0496121_0132225 Ga0496121_0132225_702_1493 244
938 3300048927 Ga0496124_0017619 Ga0496124_0017619_2214_3005 244
939 3300048927 Ga0496124_0271568 Ga0496124_0271568_133_933 244
940 3300048928 Ga0496125_0141482 Ga0496125_0141482_695_1495 244
941 3300048929 Ga0496126_0067381 Ga0496126_0067381_2096_2989 244
942 3300048929 Ga0496126_0215921 Ga0496126_0215921_617_1417 244
943 3300048929 Ga0496126_0368243 Ga0496126_0368243_148_948 244
944 3300049460 Ga0495682_0027421 Ga0495682_0027421_1048_1860 244
945 3300050492 nmdc:mga0yw44_240269_c1 nmdc:mga0yw44_240269_c1_75_875 244
946 3300050493 nmdc:mga0k408_191336_c1 nmdc:mga0k408_191336_c1_97_897 244
947 3300050495 nmdc:mga04h51_82851_c1 nmdc:mga04h51_82851_c1_242_1042 244
948 3300050496 nmdc:mga07m45_205883_c1 nmdc:mga07m45_205883_c1_271_1062 244
949 3300050496 nmdc:mga07m45_39541_c1 nmdc:mga07m45_39541_c1_492_1292 244
950 3300050516 nmdc:mga0sz30_17972_c1 nmdc:mga0sz30_17972_c1_1897_2697 244
951 3300053083 Ga0495655_0039111 Ga0495655_0039111_205_1005 244
952 3300053119 Ga0500595_025862 Ga0500595_025862_970_1782 244
953 3300053730 Ga0500645_023914 Ga0500645_023914_893_1693 244
954 3300053731 Ga0500609_003116 Ga0500609_003116_1040_1834 244
955 iso_pu_bacteria 2903727486 2903730529 244
956 iso_pu_bacteria 2935883170 2935883737 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

39

176

0.96

PF12872

OST-HTH

OST-HTH/LOTUS domain

196

265

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dim-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide synthetase from anaerococcus prevotii 0.8694 96 142
5yaa-assembly4.cif.gz_D crystal structure of marf1 nyn domain from mus musculus 0.8091 8 148
6fdl-assembly2.cif.gz_B crystal structure of the nyn domain of human marf1 0.8017 8 149
6fdl-assembly1.cif.gz_A crystal structure of the nyn domain of human marf1 0.7992 8 149
5yaa-assembly4.cif.gz_D crystal structure of marf1 nyn domain from mus musculus 0.7648 8 148
ID Description Score Start End Superfamily
af_Q9FJ91_216_314_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9001 53 145 3.40.50.1010
2czgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8738 96 142 3.40.50.20
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8669 96 126 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8499 97 126 3.50.50.60
af_Q57905_62_208_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8442 8 143 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A434DGT3-F1-model_v4 NYN domain-containing protein 0.9504 1 141 GO:0004540
AF-A0A7X0KP36-F1-model_v4 NYN domain-containing protein 0.9492 1 140 GO:0004540
AF-A0A7C3H1K2-F1-model_v4 NYN domain-containing protein 0.9442 4 143 GO:0004540
AF-F0XZS7-F1-model_v4 NYN domain-containing protein 0.9432 10 142 GO:0004540
AF-A0A350KQV8-F1-model_v4 deleted 0.9431 3 146

Feature Viewer

pLDDT pTM Quality
78.1 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map