F486672

General Info

Members Datasets Scaffolds Average Seq Length
953 702 374 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221634|2644194209
Length 469
Sequence AFFKNELDGLHTEGRYRVFADLERHRGSFPRATRHTADGPKDVTVWCSNDYLGMGQNPKVIEAMKNAIDHCGAGAGGTRNISGTTHYHVLLERELADLHGKEAALVFTSGYVSNWAALGTLGAKIPGLVIFSDALNHASMIEGIRYAKCDKVIWKHNDIQDLEAKLAAADPKAPKLIAFESVYSMDGDIAPIKEICDLADKYGAMTYLDEVHAVGMYGPRGGGIAEREGLMDRLTVIEGTLGKAFGVMGGYIAASTALCDFIRSFASGFIFTTALPPALAAGAVASIQHLKVSPFERARHQERVRALRALLDKRGIPHMPNPSHIVPVMVGDAAKCKWISDLLLDNCGVYVQPINYPTVPKKTERLRITPTPLHTDAXARQLRRLRPADQLSDGAEEDRAPAHHADAAAHRCRYRASGRGAALALGALRAGQARRLAWLIHTAIRRLCQWCLPTKLTCQLGWHEHLPQK

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
30 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
33 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516143018 Ensifer sp. BR816 Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
39 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
45 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
58 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
59 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
60 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
61 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
62 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
63 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
64 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
65 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
66 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
67 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
68 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
69 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
70 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
71 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
72 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
73 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
74 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
75 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
76 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
77 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
78 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
79 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
80 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
81 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
82 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
83 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
84 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
85 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
86 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
87 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
88 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
89 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
90 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
91 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
92 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
93 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221557 Ensifer sp. Root558 Isolate Unclassified
96 2643221558 Rhizobium sp. Root149 Isolate Unclassified
97 2643221568 Rhizobium sp. Root564 Isolate Unclassified
98 2643221582 Rhizobium sp. Root651 Isolate Unclassified
99 2643221610 Ensifer sp. Root74 Isolate Unclassified
100 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
101 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
102 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
103 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
104 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
105 2643221668 Ensifer sp. Root423 Isolate Unclassified
106 2643221675 Ensifer sp. Root1298 Isolate Unclassified
107 2643221680 Ensifer sp. Root1312 Isolate Unclassified
108 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
109 2643221688 Rhizobium sp. Root482 Isolate Unclassified
110 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
111 2643221693 Rhizobium sp. Root491 Isolate Unclassified
112 2643221718 Rhizobium sp. Root268 Isolate Unclassified
113 2643221719 Rhizobium sp. Root274 Isolate Unclassified
114 2643221723 Ensifer sp. Root278 Isolate Unclassified
115 2643221726 Ensifer sp. Root954 Isolate Unclassified
116 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
117 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
118 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
119 2718217882 Rhizobium sp. N741 Isolate Nodule
120 2718217927 Rhizobium sp. N324 Isolate Nodule
121 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
122 2718218009 Rhizobium sp. N561 Isolate Nodule
123 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
124 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
125 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
126 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
127 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2718218423 Rhizobium sp. N941 Isolate Nodule
132 2721755514 Rhizobium sp. N6212 Isolate Nodule
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
136 2721755809 Rhizobium sp. N541 Isolate Nodule
137 2721755810 Rhizobium sp. N871 Isolate Nodule
138 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
139 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
140 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
141 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
142 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
143 2728369365 Rhizobium sp. N1341 Isolate Nodule
144 2728369397 Rhizobium sp. N1314 Isolate Nodule
145 2738541293 Rhizobium sp. GV031 Isolate Unclassified
146 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
147 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
148 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
149 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
150 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
151 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
152 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
153 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
154 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
155 2791355262 Rhizobium sp. M1 Isolate Nodule
156 2791355263 Rhizobium chutanense C5 Isolate Nodule
157 2791355264 Rhizobium sp. S9 Isolate Nodule
158 2791355265 Rhizobium sp. H4 Isolate Nodule
159 2791355266 Rhizobium sp. L43 Isolate Nodule
160 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
161 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
162 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
163 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
164 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
165 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
166 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
167 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
168 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
169 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
170 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
171 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
172 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
173 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
174 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
175 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
176 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
177 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
178 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
179 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
180 2838048938 Rhizobium pisi 27/80 Isolate Nodule
181 2838061910 Rhizobium phaseoli L15 Isolate Nodule
182 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
183 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
184 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
185 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
186 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
187 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
188 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
189 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
190 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
191 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
192 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
193 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
194 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
195 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
196 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
197 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
198 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
199 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
200 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
201 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
202 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
203 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
204 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
205 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
206 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
207 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
208 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
209 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
210 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
211 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
212 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
213 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
214 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
215 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
216 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
217 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
218 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
219 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
220 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
221 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
222 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
223 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
224 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
225 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
226 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
227 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
228 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
229 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
230 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
231 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
232 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
233 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
234 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
235 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
236 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
237 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
238 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
239 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
240 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
241 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
242 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
243 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
244 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
245 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
246 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
247 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
248 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
249 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
250 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
251 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
252 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
253 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
254 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
255 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
256 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
257 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
258 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
259 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
260 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
261 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
262 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
263 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
264 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
265 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
266 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
267 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
268 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
269 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
270 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
271 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
272 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
273 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
274 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
275 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
276 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
277 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
278 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
279 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
280 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
281 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
282 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
283 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
284 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
285 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
286 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
287 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
288 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
289 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
290 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
291 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
292 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
293 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
294 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
295 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
296 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
297 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
298 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
299 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
300 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
301 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
302 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
303 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
304 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
305 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
306 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
307 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
308 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
309 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
310 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
311 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
312 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
313 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
314 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
315 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
316 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
317 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
318 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
319 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
320 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
321 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
322 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
323 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
324 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
325 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
326 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
327 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
328 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
329 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
330 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
331 2933599457 Rhizobium phaseoli M3 Isolate Nodule
332 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
333 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
334 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
335 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
336 2936381700 Rhizobium chutanense C16 Isolate Unclassified
337 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
338 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
339 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
340 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
341 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
342 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
343 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
344 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
345 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
346 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
347 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
348 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
349 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
350 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
351 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
352 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
353 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
354 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
355 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
356 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
357 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
358 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
359 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
360 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
361 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
362 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
363 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
364 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
365 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
366 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
367 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
368 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
369 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
370 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
371 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
372 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
373 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
374 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
375 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
376 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
377 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
378 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
379 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
380 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
381 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
382 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
383 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
384 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
385 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
386 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
387 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
388 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
389 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
390 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
391 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
392 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
393 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
394 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
395 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
396 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
397 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
398 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
399 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
400 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
401 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
402 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
403 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
404 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
405 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
406 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
407 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
408 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
409 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
410 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
411 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
412 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
413 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
414 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
415 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
416 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
417 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
418 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
419 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
420 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
421 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
422 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
423 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
424 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
425 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
426 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
427 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
428 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
429 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
430 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
431 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
432 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
433 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
434 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
435 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
436 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
437 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
438 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
439 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
440 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
441 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
442 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
443 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
444 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
445 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
446 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
447 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
448 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
449 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
450 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
451 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
452 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
453 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
454 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
455 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
456 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
457 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
458 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
459 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
460 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
461 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
462 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
463 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
464 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
465 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
466 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
467 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
468 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
469 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
470 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
471 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
472 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
473 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
474 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
475 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
476 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
477 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
478 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
479 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
480 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
481 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
482 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
483 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
484 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
485 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
486 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
487 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
488 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
489 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
490 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
491 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
492 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
493 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
494 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
495 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
496 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
497 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
498 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
499 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
500 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
501 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
502 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
503 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
504 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
505 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
506 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
507 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
508 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
509 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
510 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
511 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
512 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
513 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
514 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
515 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
516 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
517 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
518 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
519 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
520 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
521 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
522 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
523 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
524 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
525 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
526 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
527 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
528 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
529 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
530 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
531 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
532 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
533 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
534 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
535 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
536 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
537 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
538 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
539 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
540 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
541 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
542 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
543 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
544 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
545 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
546 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
547 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
548 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
549 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
550 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
551 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
552 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
553 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
554 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
555 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
557 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
558 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
567 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
568 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
569 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
570 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
572 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
573 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
574 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
575 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
576 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
577 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
578 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
579 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
580 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
581 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
582 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
583 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
584 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
585 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
586 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
587 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
588 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
589 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
590 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
591 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
592 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
593 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
594 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
595 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
596 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
597 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
598 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
599 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
600 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
601 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
602 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
603 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
604 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
605 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
606 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
607 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
608 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
609 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
610 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
611 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
612 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
613 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
614 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
616 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
617 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
619 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
622 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
627 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
628 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
629 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
630 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
631 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
632 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
633 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
634 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
635 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
636 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
637 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
638 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
640 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
641 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
642 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
643 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
644 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
645 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
646 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
647 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
648 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
649 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
650 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
651 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
652 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
658 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
659 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
660 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
661 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
662 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
663 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
664 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
665 8005275841 Rhizobium sp. N4311 Isolate Nodule
666 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
667 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
668 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
669 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
670 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
671 8005395548 Rhizobium sp. R339 Isolate Nodule
672 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
673 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
674 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
675 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
676 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
677 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
678 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
679 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
680 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
681 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
682 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
683 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
684 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
685 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
686 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
687 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
688 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
689 8018176218 Rhizobium sp. N122 Isolate Nodule
690 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
691 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
692 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
693 8024501048 Rhizobium sp. H4 Isolate Nodule
694 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
695 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
696 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
697 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
698 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
699 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
700 8056382006 Rhizobium croatiense 13T Isolate Nodule
701 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
702 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.41
Metatranscriptomes 0.84
Isolates 60.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 12.8
Nodule 46.38
Rhizoplane 1.15
Rhizosphere 22.98
Stem 0
Stem Tuber 0
Unclassified 16.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000066 3300001979 Bacteria 34178
2 JGI25156J39149_1000033 3300002705 Bacteria 114688
3 JGI25162J39368_1002799 3300002737 Bacteria 6147
4 JGI25162J39368_1003551 3300002737 Bacteria 4394
5 JGI25154J39366_1000058 3300002738 Bacteria 107363
6 JGI25158J39367_1000028 3300002739 Bacteria 33872
7 JGI25158J39367_1005781 3300002739 Bacteria 1800
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25152J39213_1000862 3300002773 Bacteria 14971
10 JGI25152J39213_1003891 3300002773 Bacteria 4908
11 JGI25152J39213_1007403 3300002773 Bacteria 2847
12 JGI25152J39213_1012349 3300002773 Bacteria 1840
13 JGI25150J39212_1000181 3300002774 Bacteria 35419
14 JGI25150J39212_1002835 3300002774 Bacteria 4193
15 JGI25159J45721_1000050 3300002987 Bacteria 57206
16 JGI25159J45721_1001206 3300002987 Bacteria 10999
17 JGI25151J46595_10000081 3300003187 Bacteria 131317
18 JGI25151J46595_10009736 3300003187 Bacteria 4528
19 JGI25151J46595_10046770 3300003187 Bacteria 1512
20 JGI25406J46586_10007946 3300003203 Bacteria 4826
21 JGI25165J46597_1000509 3300003214 Bacteria 37163
22 JGI25165J46597_1000514 3300003214 Bacteria 36799
23 JGI25165J46597_1002614 3300003214 Bacteria 5446
24 JGI25160J50197_1000097 3300003354 Bacteria 87619
25 JGI25160J50197_1003171 3300003354 Bacteria 7466
26 JGI25161J50226_1000155 3300003374 Bacteria 47660
27 JGI25161J50226_1003425 3300003374 Bacteria 3629
28 JGI25161J50226_1004951 3300003374 Bacteria 2694
29 Ga0006562J51391_1013127 3300003578 Bacteria 1480
30 Ga0055526_1000756 3300003771 Bacteria 24169
31 Ga0055526_1001632 3300003771 Bacteria 15747
32 Ga0055526_1003400 3300003771 Bacteria 10130
33 Ga0055526_1013140 3300003771 Bacteria 3533
34 Ga0055524_1001434 3300003775 Bacteria 13695
35 Ga0055524_1002281 3300003775 Bacteria 10014
36 Ga0055524_1006172 3300003775 Bacteria 5234
37 Ga0055536_1002648 3300003781 Bacteria 9945
38 Ga0055536_1010015 3300003781 Bacteria 3830
39 Ga0055528_1001269 3300003790 Bacteria 15941
40 Ga0055528_1001563 3300003790 Bacteria 13736
41 Ga0055528_1019037 3300003790 Bacteria 2298
42 Ga0055540_1005283 3300003792 Bacteria 5493
43 Ga0055540_1006447 3300003792 Bacteria 4657
44 Ga0055540_1012448 3300003792 Bacteria 2669
45 Ga0055531_10000744 3300003794 Bacteria 27459
46 Ga0055543_1000543 3300004625 Bacteria 21152
47 Ga0065165_1000427 3300005262 Bacteria 66083
48 Ga0065165_1014049 3300005262 Bacteria 3131
49 Ga0065165_1020239 3300005262 Bacteria 2348
50 Ga0070670_100000326 3300005331 Bacteria 40332
51 Ga0070691_10008826 3300005341 Bacteria 4615
52 Ga0070695_100040141 3300005545 Bacteria 2962
53 Ga0070665_100003569 3300005548 Bacteria 16491
54 Ga0070665_100049643 3300005548 Bacteria 4210
55 Ga0068855_100088629 3300005563 Bacteria 3574
56 Ga0070664_100019889 3300005564 Bacteria 5526
57 Ga0068856_100012528 3300005614 Bacteria 8209
58 Ga0068856_100050913 3300005614 Bacteria 4084
59 Ga0068851_10040779 3300005834 Bacteria 2334
60 Ga0081540_1020420 3300005983 Bacteria 3985
61 Ga0081539_10001994 3300005985 Bacteria 31016
62 Ga0081539_10012572 3300005985 Bacteria 6501
63 Ga0075365_10000538 3300006038 Bacteria 14556
64 Ga0075368_10016002 3300006042 Bacteria 2789
65 Ga0075369_10020761 3300006186 Bacteria 2691
66 Ga0075370_10018881 3300006353 Bacteria 3744
67 Ga0075431_100000522 3300006847 Bacteria 32229
68 Ga0079104_1000101 3300006946 Bacteria 125456
69 Ga0079104_1001906 3300006946 Bacteria 12584
70 Ga0079104_1003928 3300006946 Bacteria 6638
71 Ga0099826_10000067 3300006948 Bacteria 56132
72 Ga0105240_10000013 3300009093 Bacteria 483458
73 Ga0105243_10008956 3300009148 Bacteria 7650
74 Ga0105237_10000714 3300009545 Bacteria 45945
75 Ga0123341_1000020 3300009765 Bacteria 79523
76 Ga0157373_10009912 3300013100 Bacteria 7023
77 Ga0157373_10093115 3300013100 Bacteria 2122
78 Ga0157371_10000195 3300013102 Bacteria 89727
79 Ga0157370_10000209 3300013104 Bacteria 74351
80 Ga0157370_10001395 3300013104 Bacteria 29952
81 Ga0157370_10148180 3300013104 Bacteria 2185
82 Ga0157369_10042259 3300013105 Bacteria 4973
83 Ga0157369_10042952 3300013105 Bacteria 4929
84 Ga0157369_10083234 3300013105 Bacteria 3422
85 Ga0157369_10109902 3300013105 Bacteria 2931
86 Ga0171463_1004 3300013249 Bacteria 437207
87 Ga0163162_10060866 3300013306 Bacteria 3812
88 Ga0157372_10103374 3300013307 Bacteria 3255
89 Ga0182007_10010973 3300015262 Bacteria 3549
90 Ga0183363_1024 3300015690 Bacteria 54122
91 Ga0214544_1002560 3300021320 Bacteria 38129
92 Ga0214542_1000008 3300021321 Bacteria 278895
93 Ga0214542_1025941 3300021321 Bacteria 2956
94 Ga0214543_1000031 3300021327 Bacteria 206436
95 Ga0214543_1000053 3300021327 Bacteria 141797
96 Ga0228711_1003012 3300022739 Bacteria 26140
97 Ga0228710_1003154 3300022740 Bacteria 26273
98 Ga0209435_100009 3300025206 Bacteria 476614
99 Ga0209436_100296 3300025208 Bacteria 23018
100 Ga0209436_100651 3300025208 Bacteria 14802
101 Ga0209437_100057 3300025233 Bacteria 362922
102 Ga0209437_100107 3300025233 Bacteria 218656
103 Ga0207425_1000034 3300025245 Bacteria 227886
104 Ga0207425_1003822 3300025245 Bacteria 4693
105 Ga0207425_1008225 3300025245 Bacteria 2686
106 Ga0209646_1000018 3300025246 Bacteria 476716
107 Ga0209026_1000068 3300025250 Bacteria 207601
108 Ga0209677_100297 3300025253 Bacteria 32532
109 Ga0209759_1000007 3300025256 Bacteria 476614
110 Ga0209129_1000094 3300025258 Bacteria 172051
111 Ga0209129_1000653 3300025258 Bacteria 23204
112 Ga0209129_1000935 3300025258 Bacteria 17616
113 Ga0209129_1000970 3300025258 Bacteria 17236
114 Ga0209129_1002548 3300025258 Bacteria 8818
115 Ga0209233_1000072 3300025261 Bacteria 363074
116 Ga0209233_1000134 3300025261 Bacteria 202535
117 Ga0209233_1000440 3300025261 Bacteria 28932
118 Ga0209673_1000158 3300025273 Bacteria 143067
119 Ga0209673_1000584 3300025273 Bacteria 57616
120 Ga0209130_1000009 3300025284 Bacteria 498952
121 Ga0209130_1000027 3300025284 Bacteria 327700
122 Ga0209676_1007498 3300025292 Bacteria 5099
123 Ga0209676_1021483 3300025292 Bacteria 2166
124 Ga0209025_1000184 3300025294 Bacteria 155611
125 Ga0209025_1000245 3300025294 Bacteria 127801
126 Ga0209025_1000617 3300025294 Bacteria 63860
127 Ga0209025_1000706 3300025294 Bacteria 56897
128 Ga0209025_1000765 3300025294 Bacteria 53466
129 Ga0209025_1005057 3300025294 Bacteria 10982
130 Ga0209025_1013471 3300025294 Bacteria 5133
131 Ga0209025_1014351 3300025294 Bacteria 4881
132 Ga0209564_1000111 3300025295 Bacteria 212210
133 Ga0209564_1000675 3300025295 Bacteria 50429
134 Ga0209564_1001140 3300025295 Bacteria 31141
135 Ga0209564_1001469 3300025295 Bacteria 23854
136 Ga0209564_1005362 3300025295 Bacteria 7353
137 Ga0209564_1013299 3300025295 Bacteria 3511
138 Ga0209564_1018796 3300025295 Bacteria 2614
139 Ga0209758_1000159 3300025297 Bacteria 155588
140 Ga0209758_1000323 3300025297 Bacteria 92123
141 Ga0209758_1001909 3300025297 Bacteria 22693
142 Ga0209758_1002600 3300025297 Bacteria 18055
143 Ga0209758_1013397 3300025297 Bacteria 4474
144 Ga0209050_1002021 3300025298 Bacteria 18884
145 Ga0209050_1012841 3300025298 Bacteria 3792
146 Ga0209256_1000132 3300025299 Bacteria 160806
147 Ga0209256_1001025 3300025299 Bacteria 32812
148 Ga0209256_1001314 3300025299 Bacteria 26601
149 Ga0209256_1002722 3300025299 Bacteria 13703
150 Ga0209256_1006316 3300025299 Bacteria 6339
151 Ga0209256_1010379 3300025299 Bacteria 3911
152 Ga0209256_1016266 3300025299 Bacteria 2547
153 Ga0207426_1000041 3300025302 Bacteria 433536
154 Ga0207426_1000072 3300025302 Bacteria 327700
155 Ga0207426_1002067 3300025302 Bacteria 13950
156 Ga0209051_1000402 3300025303 Bacteria 60065
157 Ga0209051_1000493 3300025303 Bacteria 50978
158 Ga0209051_1016485 3300025303 Bacteria 3340
159 Ga0209051_1019186 3300025303 Bacteria 2995
160 Ga0209051_1032470 3300025303 Bacteria 1991
161 Ga0209257_1006579 3300025304 Bacteria 7411
162 Ga0209257_1018065 3300025304 Bacteria 2737
163 Ga0207695_10000044 3300025913 Bacteria 440819
164 Ga0207671_10000364 3300025914 Bacteria 64550
165 Ga0207650_10000151 3300025925 Bacteria 83229
166 Ga0207709_10007084 3300025935 Bacteria 6264
167 Ga0207661_10029918 3300025944 Bacteria 4188
168 Ga0207667_10131072 3300025949 Bacteria 2582
169 Ga0207702_10033297 3300026078 Bacteria 4304
170 Ga0209281_1000028 3300027111 Bacteria 440027
171 Ga0209281_1000596 3300027111 Bacteria 41157
172 Ga0209281_1000760 3300027111 Bacteria 30959
173 Ga0209371_1000037 3300027312 Bacteria 367074
174 Ga0209371_1001945 3300027312 Bacteria 12553
175 Ga0209371_1001958 3300027312 Bacteria 12473
176 Ga0209282_1000267 3300027666 Bacteria 26143
177 Ga0209282_1000803 3300027666 Bacteria 16024
178 Ga0268266_10002491 3300028379 Bacteria 19661
179 Ga0307515_10000434 3300028794 Bacteria 100265
180 Ga0307515_10002407 3300028794 Bacteria 40813
181 Ga0307515_10130503 3300028794 Bacteria 2772
182 Ga0268256_1000039 3300030500 Bacteria 354969
183 Ga0268256_1000890 3300030500 Bacteria 20629
184 Ga0268256_1002013 3300030500 Bacteria 11008
185 Ga0307513_10001773 3300031456 Bacteria 30712
186 Ga0307513_10101893 3300031456 Bacteria 2892
187 Ga0307408_100013679 3300031548 Bacteria 5390
188 Ga0307406_10030232 3300031901 Bacteria 3287
189 Ga0307412_10003953 3300031911 Bacteria 8260
190 Ga0307412_10111939 3300031911 Bacteria 1951
191 Ga0315914_1000965 3300031967 Bacteria 40741
192 Ga0315913_1000276 3300033430 Bacteria 40740
193 Ga0315915_1000499 3300033464 Bacteria 40728
194 Ga0373927_0000074 3300035695 Bacteria 72943
195 Ga0395905_0000836 3300037471 Bacteria 40186
196 Ga0395905_0012177 3300037471 Bacteria 8283
197 Ga0400483_057556 3300039062 Bacteria 7499
198 Ga0400483_168905 3300039062 Bacteria 7467
199 Ga0436360_0088138 3300039438 Bacteria 1514
200 Ga0451791_0145945 3300041451 Bacteria 2034
201 Ga0451833_0204696 3300041491 Bacteria 2355
202 Ga0451854_27941 3300041510 Bacteria 1616
203 Ga0452268_27494 3300041907 Bacteria 2122
204 Ga0439449_0008526 3300042007 Bacteria 3894
205 Ga0451577_0294211 3300042876 Bacteria 1471
206 Ga0466968_0038503 3300044735 Bacteria 2009
207 Ga0451576_0000040 3300045051 Bacteria 349778
208 Ga0495638_0036762 3300046460 Bacteria 3117
209 Ga0495605_0000575 3300046474 Bacteria 29803
210 Ga0495606_0001739 3300046507 Bacteria 27980
211 Ga0495610_0000915 3300046512 Bacteria 27419
212 Ga0495632_0001194 3300046519 Bacteria 22047
213 Ga0495625_0002177 3300046660 Bacteria 21760
214 Ga0495657_0110878 3300046675 Bacteria 1738
215 Ga0495589_0068106 3300046794 Bacteria 1742
216 Ga0495600_0024445 3300046809 Bacteria 3888
217 Ga0495604_0127223 3300047317 Bacteria 1835
218 Ga0495686_0000007 3300047472 Bacteria 732622
219 Ga0495686_0000922 3300047472 Bacteria 36620
220 Ga0496114_0137941 3300048917 Bacteria 2110
221 Ga0496116_0000380 3300048919 Bacteria 65998
222 Ga0496116_0004572 3300048919 Bacteria 13124
223 Ga0496116_0007357 3300048919 Bacteria 9783
224 Ga0496116_0036635 3300048919 Bacteria 3429
225 Ga0496116_0071482 3300048919 Bacteria 2197
226 Ga0496117_0000031 3300048920 Bacteria 381048
227 Ga0496117_0001675 3300048920 Bacteria 30978
228 Ga0496117_0002447 3300048920 Bacteria 23390
229 Ga0496117_0003875 3300048920 Bacteria 17001
230 Ga0496117_0017954 3300048920 Bacteria 5889
231 Ga0496118_0002290 3300048921 Bacteria 26056
232 Ga0496118_0002502 3300048921 Bacteria 24644
233 Ga0496118_0033542 3300048921 Bacteria 4210
234 Ga0496120_0002700 3300048923 Bacteria 17386
235 Ga0496120_0010575 3300048923 Bacteria 6422
236 Ga0496120_0049174 3300048923 Bacteria 2421
237 Ga0496121_0000034 3300048924 Bacteria 377095
238 Ga0496121_0002365 3300048924 Bacteria 29031
239 Ga0496121_0002652 3300048924 Bacteria 26846
240 Ga0496121_0015989 3300048924 Bacteria 7781
241 Ga0496121_0041943 3300048924 Bacteria 3989
242 Ga0496121_0049082 3300048924 Bacteria 3583
243 Ga0496121_0075661 3300048924 Bacteria 2688
244 Ga0496122_0000023 3300048925 Bacteria 381035
245 Ga0496122_0000068 3300048925 Bacteria 226155
246 Ga0496122_0000777 3300048925 Bacteria 61385
247 Ga0496122_0003156 3300048925 Bacteria 22048
248 Ga0496122_0006273 3300048925 Bacteria 13725
249 Ga0496122_0017400 3300048925 Bacteria 6725
250 Ga0496122_0050827 3300048925 Bacteria 3157
251 Ga0496123_0000059 3300048926 Bacteria 226155
252 Ga0496123_0000519 3300048926 Bacteria 66923
253 Ga0496123_0034170 3300048926 Bacteria 3646
254 Ga0496123_0061871 3300048926 Bacteria 2402
255 Ga0496124_0000130 3300048927 Bacteria 156467
256 Ga0496124_0000781 3300048927 Bacteria 51927
257 Ga0496124_0000909 3300048927 Bacteria 47773
258 Ga0496124_0001790 3300048927 Bacteria 29882
259 Ga0496124_0007537 3300048927 Bacteria 11548
260 Ga0496124_0010851 3300048927 Bacteria 9172
261 Ga0496124_0017090 3300048927 Bacteria 6858
262 Ga0496124_0070613 3300048927 Bacteria 2896
263 Ga0496125_0000790 3300048928 Bacteria 51640
264 Ga0496125_0006012 3300048928 Bacteria 13278
265 Ga0496125_0027907 3300048928 Bacteria 5107
266 Ga0496125_0169248 3300048928 Bacteria 1471
267 Ga0496126_0000293 3300048929 Bacteria 106340
268 Ga0496126_0000466 3300048929 Bacteria 80395
269 Ga0496126_0085072 3300048929 Bacteria 2788
270 Ga0501031_0022019 3300049568 Bacteria 4153
271 Ga0501031_0148361 3300049568 Bacteria 1532
272 Ga0501032_0002318 3300049569 Bacteria 14925
273 Ga0501032_0003148 3300049569 Bacteria 12688
274 Ga0501032_0015324 3300049569 Bacteria 5411
275 Ga0501032_0070420 3300049569 Bacteria 2332
276 Ga0501032_0089793 3300049569 Bacteria 2039
277 Ga0501032_0091545 3300049569 Bacteria 2017
278 Ga0501033_0000361 3300049570 Bacteria 43373
279 Ga0501033_0001947 3300049570 Bacteria 17975
280 Ga0501033_0015427 3300049570 Bacteria 5796
281 Ga0501033_0097621 3300049570 Bacteria 2146
282 Ga0501033_0106782 3300049570 Bacteria 2039
283 Ga0501034_0000609 3300049571 Bacteria 56233
284 Ga0501034_0001008 3300049571 Bacteria 40385
285 Ga0501034_0011247 3300049571 Bacteria 9290
286 Ga0501034_0015694 3300049571 Bacteria 7780
287 Ga0501034_0040554 3300049571 Bacteria 4712
288 Ga0501034_0046731 3300049571 Bacteria 4374
289 Ga0501034_0064534 3300049571 Bacteria 3675
290 Ga0501034_0073714 3300049571 Bacteria 3422
291 Ga0501034_0082589 3300049571 Bacteria 3215
292 Ga0501034_0107243 3300049571 Bacteria 2785
293 Ga0501034_0108720 3300049571 Bacteria 2764
294 Ga0501034_0253335 3300049571 Bacteria 1704
295 Ga0501036_0015146 3300049572 Bacteria 6439
296 Ga0501036_0095725 3300049572 Bacteria 2510
297 Ga0501037_0006238 3300049573 Bacteria 8719
298 Ga0501037_0019279 3300049573 Bacteria 5029
299 Ga0501037_0097203 3300049573 Bacteria 2127
300 Ga0501038_0000187 3300049574 Bacteria 53566
301 Ga0501038_0000362 3300049574 Bacteria 39190
302 Ga0501038_0000394 3300049574 Bacteria 37908
303 Ga0501038_0011745 3300049574 Bacteria 7990
304 Ga0501038_0133052 3300049574 Bacteria 2039
305 Ga0501038_0145272 3300049574 Bacteria 1937
306 Ga0501039_0000932 3300049575 Bacteria 21347
307 Ga0501039_0002217 3300049575 Bacteria 14363
308 Ga0501039_0079326 3300049575 Bacteria 2554
309 Ga0501040_0103038 3300049576 Bacteria 1992
310 Ga0501043_0001876 3300049579 Bacteria 18021
311 Ga0501043_0002292 3300049579 Bacteria 16231
312 Ga0501043_0006291 3300049579 Bacteria 9534
313 Ga0501043_0022843 3300049579 Bacteria 4905
314 Ga0501046_0001124 3300049580 Bacteria 26161
315 Ga0501046_0042889 3300049580 Bacteria 3605
316 Ga0501047_0011027 3300049581 Bacteria 8551
317 Ga0501047_0024402 3300049581 Bacteria 5804
318 Ga0501047_0092159 3300049581 Bacteria 2908
319 Ga0501047_0133404 3300049581 Bacteria 2363
320 Ga0501047_0171304 3300049581 Bacteria 2039
321 Ga0501047_0177056 3300049581 Bacteria 2000
322 Ga0501067_0000083 3300049583 Bacteria 54765
323 Ga0501067_0001189 3300049583 Bacteria 14130
324 Ga0501067_0072724 3300049583 Bacteria 1905
325 Ga0501068_0005450 3300049584 Bacteria 6963
326 Ga0501068_0044245 3300049584 Bacteria 2680
327 Ga0501068_0045393 3300049584 Bacteria 2647
328 Ga0501069_0001984 3300049585 Bacteria 10236
329 Ga0501070_0002177 3300049586 Bacteria 17230
330 Ga0501070_0104134 3300049586 Bacteria 2347
331 Ga0501071_0034352 3300049587 Bacteria 3609
332 Ga0501073_0000021 3300049589 Bacteria 135534
333 Ga0501073_0018399 3300049589 Bacteria 5049
334 Ga0501073_0020835 3300049589 Bacteria 4728
335 Ga0501073_0027887 3300049589 Bacteria 4035
336 Ga0501074_0017685 3300049590 Bacteria 5178
337 Ga0501077_0000045 3300049593 Bacteria 62973
338 Ga0501079_0028105 3300049741 Bacteria 4315
339 Ga0501079_0059105 3300049741 Bacteria 2958
340 Ga0501080_0000394 3300049742 Bacteria 33653
341 Ga0501080_0047648 3300049742 Bacteria 3990
342 Ga0501083_0013576 3300049744 Bacteria 5695
343 Ga0501083_0023153 3300049744 Bacteria 4309
344 Ga0501035_0000398 3300049822 Bacteria 49830
345 Ga0501035_0001173 3300049822 Bacteria 27300
346 Ga0501035_0005409 3300049822 Bacteria 12071
347 Ga0501035_0006142 3300049822 Bacteria 11308
348 Ga0501035_0148053 3300049822 Bacteria 2039
349 Ga0501044_0025589 3300049823 Bacteria 6256
350 Ga0501044_0186360 3300049823 Bacteria 2039
351 Ga0501045_0026526 3300049824 Bacteria 4168
352 nmdc:mga0yw44_14554_c1 3300050492 Bacteria 4182
353 nmdc:mga0yw44_25318_c1 3300050492 Bacteria 3372
354 nmdc:mga09592_94243_c1 3300050508 Bacteria 2560
355 nmdc:mga0sz30_630_c1 3300050516 Bacteria 13067
356 Ga0500618_000241 3300053125 Bacteria 43403
357 Ga0500618_000464 3300053125 Bacteria 26377
358 Ga0500559_0003811 3300053136 Bacteria 7302
359 Ga0500568_0000082 3300053139 Bacteria 92308
360 Ga0500568_0000640 3300053139 Bacteria 25250
361 Ga0500573_0000126 3300053140 Bacteria 29747
362 Ga0500590_001068 3300053148 Bacteria 10750
363 Ga0500616_0000986 3300053153 Bacteria 30745
364 Ga0500624_000493 3300053157 Bacteria 11543
365 Ga0500634_0068893 3300053161 Bacteria 1857
366 Ga0500636_0000032 3300053177 Bacteria 74084
367 Ga0587084_008216 3300059477 Bacteria 1317
368 Ga0587077_014599 3300059493 Bacteria 1295
369 Ga0587088_010398 3300059508 Bacteria 1362
370 Ga0587090_005326 3300059510 Bacteria 1607
371 Ga0587072_004545 3300059643 Bacteria 2024
372 Ga0501082_0010865 3300060353 Bacteria 7841
373 Ga0501082_0015259 3300060353 Bacteria 6617
374 Ga0501082_0024006 3300060353 Bacteria 5259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0137941 Ga0496114_0137941_1071_2084 320
2 3300049742 Ga0501080_0047648 Ga0501080_0047648_2815_3972 380
3 3300046794 Ga0495589_0068106 Ga0495589_0068106_489_1703 381
4 3300003775 Ga0055524_1002281 Ga0055524_10022813 387
5 3300025258 Ga0209129_1000653 Ga0209129_100065314 387
6 3300025302 Ga0207426_1002067 Ga0207426_10020673 387
7 3300048919 Ga0496116_0071482 Ga0496116_0071482_841_2055 387
8 3300048925 Ga0496122_0050827 Ga0496122_0050827_793_2007 387
9 3300049589 Ga0501073_0027887 Ga0501073_0027887_665_1942 389
10 iso_pu_bacteria 2510461076 2510897003 389
11 iso_pu_bacteria 2515154113 2515639147 391
12 iso_pu_bacteria 2515154113 2515639562 391
13 3300046507 Ga0495606_0001739 Ga0495606_0001739_2613_3875 392
14 3300002773 JGI25152J39213_1003891 JGI25152J39213_10038914 393
15 iso_pu_bacteria 2585427590 2585821421 394
16 iso_pu_bacteria 2585427590 2585824111 394
17 iso_pu_bacteria 2643221634 2644194209 394
18 3300048927 Ga0496124_0000909 Ga0496124_0000909_7711_8913 395
19 3300005341 Ga0070691_10008826 Ga0070691_100088263 396
20 iso_pu_bacteria 2643221686 2644484355 396
21 iso_pu_bacteria 8018127388 8018134203 397
22 iso_pu_bacteria 2891048133 2891050523 398
23 iso_pu_bacteria 2995392953 2995395333 398
24 iso_pu_bacteria 2508501122 2509109408 399
25 iso_pu_bacteria 2509276019 2509378282 399
26 iso_pu_bacteria 2509276021 2509389541 399
27 iso_pu_bacteria 2509276021 2509391672 399
28 iso_pu_bacteria 2509276033 2509446044 399
29 iso_pu_bacteria 2509276033 2509446045 399
30 iso_pu_bacteria 2510065019 2510135108 399
31 iso_pu_bacteria 2510065057 2510306901 399
32 iso_pu_bacteria 2510917026 2511171203 399
33 iso_pu_bacteria 2510917028 2511184302 399
34 iso_pu_bacteria 2510917030 2511198179 399
35 iso_pu_bacteria 2511231052 2511503139 399
36 iso_pu_bacteria 2512047086 2512534420 399
37 iso_pu_bacteria 2512875024 2512963788 399
38 iso_pu_bacteria 2512875026 2512973777 399
39 iso_pu_bacteria 2513237084 2513571477 399
40 iso_pu_bacteria 2513237085 2513580679 399
41 iso_pu_bacteria 2513237086 2513587055 399
42 iso_pu_bacteria 2513237089 2513606755 399
43 iso_pu_bacteria 2513237091 2513616890 399
44 iso_pu_bacteria 2513237093 2513630322 399
45 iso_pu_bacteria 2513237103 2513713700 399
46 iso_pu_bacteria 2513237103 2513714266 399
47 iso_pu_bacteria 2513237104 2513722252 399
48 iso_pu_bacteria 2513237138 2513868401 399
49 iso_pu_bacteria 2513237140 2513886293 399
50 iso_pu_bacteria 2513237143 2513903424 399
51 iso_pu_bacteria 2513237146 2513929087 399
52 iso_pu_bacteria 2513237156 2513987455 399
53 iso_pu_bacteria 2513237160 2514008366 399
54 iso_pu_bacteria 2515075009 2515114261 399
55 iso_pu_bacteria 2515154107 2515610881 399
56 iso_pu_bacteria 2515154114 2515644900 399
57 iso_pu_bacteria 2515154114 2515646429 399
58 iso_pu_bacteria 2515154134 2515741424 399
59 iso_pu_bacteria 2516143018 2516205448 399
60 iso_pu_bacteria 2516653046 2516894567 399
61 iso_pu_bacteria 2516653077 2517037878 399
62 iso_pu_bacteria 2516653077 2517042152 399
63 iso_pu_bacteria 2516653085 2517078144 399
64 iso_pu_bacteria 2517093000 2517096913 399
65 iso_pu_bacteria 2517287029 2517408006 399
66 iso_pu_bacteria 2517287029 2517408670 399
67 iso_pu_bacteria 2517487022 2517571221 399
68 iso_pu_bacteria 2524023207 2524453275 399
69 iso_pu_bacteria 2529292951 2530647467 399
70 iso_pu_bacteria 2534681796 2535518903 399
71 iso_pu_bacteria 2537561587 2537874562 399
72 iso_pu_bacteria 2551306084 2551681280 399
73 iso_pu_bacteria 2551306085 2551688846 399
74 iso_pu_bacteria 2551306086 2551693701 399
75 iso_pu_bacteria 2551306087 2551699003 399
76 iso_pu_bacteria 2551306089 2551709200 399
77 iso_pu_bacteria 2551306090 2551721953 399
78 iso_pu_bacteria 2551306091 2551729492 399
79 iso_pu_bacteria 2551306092 2551738606 399
80 iso_pu_bacteria 2551306093 2551743714 399
81 iso_pu_bacteria 2554235003 2554248776 399
82 iso_pu_bacteria 2558860100 2558867234 399
83 iso_pu_bacteria 2558860100 2558868458 399
84 iso_pu_bacteria 2558860242 2559295864 399
85 iso_pu_bacteria 2558860242 2559298122 399
86 iso_pu_bacteria 2558860983 2561467014 399
87 iso_pu_bacteria 2582581283 2585166861 399
88 iso_pu_bacteria 2582581283 2585169300 399
89 iso_pu_bacteria 2582581294 2585201853 399
90 iso_pu_bacteria 2582581298 2585223807 399
91 iso_pu_bacteria 2582581304 2585257476 399
92 iso_pu_bacteria 2582581306 2585266784 399
93 iso_pu_bacteria 2582581308 2585280603 399
94 iso_pu_bacteria 2582581315 2585327975 399
95 iso_pu_bacteria 2582581316 2585334278 399
96 iso_pu_bacteria 2582581865 2585387825 399
97 iso_pu_bacteria 2585427526 2585526210 399
98 iso_pu_bacteria 2585427527 2585531538 399
99 iso_pu_bacteria 2585427528 2585543592 399
100 iso_pu_bacteria 2585427529 2585549030 399
101 iso_pu_bacteria 2585427530 2585551516 399
102 iso_pu_bacteria 2585427593 2585842020 399
103 iso_pu_bacteria 2585427594 2585844691 399
104 iso_pu_bacteria 2585427608 2585902728 399
105 iso_pu_bacteria 2585427633 2585997668 399
106 iso_pu_bacteria 2585427634 2586002256 399
107 iso_pu_bacteria 2599185156 2599335000 399
108 iso_pu_bacteria 2599185170 2599420264 399
109 iso_pu_bacteria 2599185210 2599603345 399
110 iso_pu_bacteria 2599185236 2599720223 399
111 iso_pu_bacteria 2599185352 2600193542 399
112 iso_pu_bacteria 2600254933 2600373330 399
113 iso_pu_bacteria 2600255279 2601610749 399
114 iso_pu_bacteria 2600255308 2601747523 399
115 iso_pu_bacteria 2615840624 2616296430 399
116 iso_pu_bacteria 2615840626 2616306853 399
117 iso_pu_bacteria 2615840698 2616557705 399
118 iso_pu_bacteria 2643221557 2643808234 399
119 iso_pu_bacteria 2643221558 2643813652 399
120 iso_pu_bacteria 2643221568 2643854990 399
121 iso_pu_bacteria 2643221582 2643921389 399
122 iso_pu_bacteria 2643221610 2644068577 399
123 iso_pu_bacteria 2643221634 2644195241 399
124 iso_pu_bacteria 2643221636 2644201541 399
125 iso_pu_bacteria 2643221637 2644209348 399
126 iso_pu_bacteria 2643221643 2644240601 399
127 iso_pu_bacteria 2643221653 2644299991 399
128 iso_pu_bacteria 2643221668 2644379668 399
129 iso_pu_bacteria 2643221675 2644419646 399
130 iso_pu_bacteria 2643221680 2644453003 399
131 iso_pu_bacteria 2643221688 2644492374 399
132 iso_pu_bacteria 2643221689 2644499914 399
133 iso_pu_bacteria 2643221693 2644521442 399
134 iso_pu_bacteria 2643221718 2644652876 399
135 iso_pu_bacteria 2643221719 2644658217 399
136 iso_pu_bacteria 2643221723 2644677260 399
137 iso_pu_bacteria 2643221726 2644688968 399
138 iso_pu_bacteria 2657244999 2657682580 399
139 iso_pu_bacteria 2667528174 2671113598 399
140 iso_pu_bacteria 2690316117 2692320137 399
141 iso_pu_bacteria 2718217882 2719182846 399
142 iso_pu_bacteria 2718217882 2719184091 399
143 iso_pu_bacteria 2718217927 2719387540 399
144 iso_pu_bacteria 2718217997 2719667185 399
145 iso_pu_bacteria 2718218009 2719729664 399
146 iso_pu_bacteria 2718218009 2719733563 399
147 iso_pu_bacteria 2718218199 2720493605 399
148 iso_pu_bacteria 2718218232 2720615061 399
149 iso_pu_bacteria 2718218233 2720621854 399
150 iso_pu_bacteria 2718218235 2720633204 399
151 iso_pu_bacteria 2718218269 2720776901 399
152 iso_pu_bacteria 2718218363 2721143914 399
153 iso_pu_bacteria 2718218363 2721148958 399
154 iso_pu_bacteria 2718218365 2721156602 399
155 iso_pu_bacteria 2718218365 2721160356 399
156 iso_pu_bacteria 2718218366 2721161289 399
157 iso_pu_bacteria 2718218366 2721165771 399
158 iso_pu_bacteria 2718218423 2721401174 399
159 iso_pu_bacteria 2721755514 2722837242 399
160 iso_pu_bacteria 2721755514 2722841941 399
161 iso_pu_bacteria 2721755556 2723028501 399
162 iso_pu_bacteria 2721755684 2723562105 399
163 iso_pu_bacteria 2721755685 2723568807 399
164 iso_pu_bacteria 2721755809 2724039988 399
165 iso_pu_bacteria 2721755810 2724040818 399
166 iso_pu_bacteria 2721755810 2724046319 399
167 iso_pu_bacteria 2721755819 2724091508 399
168 iso_pu_bacteria 2721755822 2724106072 399
169 iso_pu_bacteria 2721755823 2724111877 399
170 iso_pu_bacteria 2724679232 2725947363 399
171 iso_pu_bacteria 2728369352 2730109437 399
172 iso_pu_bacteria 2728369365 2730162231 399
173 iso_pu_bacteria 2728369365 2730166081 399
174 iso_pu_bacteria 2728369397 2730295363 399
175 iso_pu_bacteria 2728369397 2730299988 399
176 iso_pu_bacteria 2738541293 2738803917 399
177 iso_pu_bacteria 2738541317 2738947524 399
178 iso_pu_bacteria 2765235942 2766062640 399
179 iso_pu_bacteria 2775507049 2776915367 399
180 iso_pu_bacteria 2775507266 2778173635 399
181 iso_pu_bacteria 2791355082 2792582066 399
182 iso_pu_bacteria 2791355091 2792622076 399
183 iso_pu_bacteria 2791355092 2792628667 399
184 iso_pu_bacteria 2791355253 2793281141 399
185 iso_pu_bacteria 2791355259 2793313525 399
186 iso_pu_bacteria 2791355262 2793332113 399
187 iso_pu_bacteria 2791355263 2793338681 399
188 iso_pu_bacteria 2791355263 2793340839 399
189 iso_pu_bacteria 2791355264 2793346483 399
190 iso_pu_bacteria 2791355265 2793353993 399
191 iso_pu_bacteria 2791355266 2793359516 399
192 iso_pu_bacteria 2802428858 2802721551 399
193 iso_pu_bacteria 2802428859 2802728437 399
194 iso_pu_bacteria 2802428860 2802734436 399
195 iso_pu_bacteria 2802428861 2802741075 399
196 iso_pu_bacteria 2802428862 2802747191 399
197 iso_pu_bacteria 2802428863 2802753899 399
198 iso_pu_bacteria 2802429268 2804753530 399
199 iso_pu_bacteria 2802429605 2805926092 399
200 iso_pu_bacteria 2802429606 2805937041 399
201 iso_pu_bacteria 2808606387 2808988312 399
202 iso_pu_bacteria 2818991272 2819243678 399
203 iso_pu_bacteria 2818991439 2819560874 399
204 iso_pu_bacteria 2818991448 2819611124 399
205 iso_pu_bacteria 2818991453 2819638946 399
206 iso_pu_bacteria 2818991461 2819687120 399
207 iso_pu_bacteria 2821123053 2821128617 399
208 iso_pu_bacteria 2838029111 2838030812 399
209 iso_pu_bacteria 2838035591 2838040471 399
210 iso_pu_bacteria 2838068647 2838072712 399
211 iso_pu_bacteria 2838074704 2838078344 399
212 iso_pu_bacteria 2838675328 2838678763 399
213 iso_pu_bacteria 2838686498 2838690110 399
214 iso_pu_bacteria 2838714209 2838718148 399
215 iso_pu_bacteria 2838719591 2838723060 399
216 iso_pu_bacteria 2838724970 2838728215 399
217 iso_pu_bacteria 2838736955 2838741634 399
218 iso_pu_bacteria 2838742623 2838744781 399
219 iso_pu_bacteria 2841840854 2841845532 399
220 iso_pu_bacteria 2841846520 2841850617 399
221 iso_pu_bacteria 2841851746 2841857912 399
222 iso_pu_bacteria 2841859092 2841863131 399
223 iso_pu_bacteria 2842110456 2842116288 399
224 iso_pu_bacteria 2842124991 2842128873 399
225 iso_pu_bacteria 2842130223 2842133655 399
226 iso_pu_bacteria 2842140634 2842145235 399
227 iso_pu_bacteria 2842152218 2842155433 399
228 iso_pu_bacteria 2842163707 2842166526 399
229 iso_pu_bacteria 2842170452 2842174610 399
230 iso_pu_bacteria 2842175837 2842179269 399
231 iso_pu_bacteria 2842180545 2842184624 399
232 iso_pu_bacteria 2842187318 2842190572 399
233 iso_pu_bacteria 2842211629 2842215104 399
234 iso_pu_bacteria 2842224351 2842227825 399
235 iso_pu_bacteria 2842229732 2842232207 399
236 iso_pu_bacteria 2842271015 2842274130 399
237 iso_pu_bacteria 2842285085 2842288383 399
238 iso_pu_bacteria 2842402390 2842406271 399
239 iso_pu_bacteria 2842409023 2842412856 399
240 iso_pu_bacteria 2842415677 2842419265 399
241 iso_pu_bacteria 2842422224 2842426190 399
242 iso_pu_bacteria 2842447887 2842453796 399
243 iso_pu_bacteria 2842475841 2842477544 399
244 iso_pu_bacteria 2842482326 2842488014 399
245 iso_pu_bacteria 2842502639 2842504583 399
246 iso_pu_bacteria 2842515876 2842520131 399
247 iso_pu_bacteria 2842521101 2842524172 399
248 iso_pu_bacteria 2842521101 2842524344 399
249 iso_pu_bacteria 2842922631 2842926189 399
250 iso_pu_bacteria 2844454524 2844457192 399
251 iso_pu_bacteria 2847417321 2847420655 399
252 iso_pu_bacteria 2848992105 2848995486 399
253 iso_pu_bacteria 2850079185 2850082468 399
254 iso_pu_bacteria 2854896431 2854897016 399
255 iso_pu_bacteria 2854916844 2854917164 399
256 iso_pu_bacteria 2855825444 2855827186 399
257 iso_pu_bacteria 2855839649 2855842580 399
258 iso_pu_bacteria 2855872281 2855878014 399
259 iso_pu_bacteria 2857516855 2857521133 399
260 iso_pu_bacteria 2857531043 2857534230 399
261 iso_pu_bacteria 2858800743 2858803391 399
262 iso_pu_bacteria 2891373044 2891373731 399
263 iso_pu_bacteria 2896384573 2896388047 399
264 iso_pu_bacteria 2899792073 2899795230 399
265 iso_pu_bacteria 2899803654 2899808151 399
266 iso_pu_bacteria 2899845264 2899848254 399
267 iso_pu_bacteria 2913295892 2913300005 399
268 iso_pu_bacteria 2913308742 2913312432 399
269 iso_pu_bacteria 2915980308 2915984941 399
270 iso_pu_bacteria 2915986958 2915988858 399
271 iso_pu_bacteria 2915993759 2915996940 399
272 iso_pu_bacteria 2916000859 2916004059 399
273 iso_pu_bacteria 2916007675 2916008458 399
274 iso_pu_bacteria 2916014648 2916020929 399
275 iso_pu_bacteria 2916021584 2916026994 399
276 iso_pu_bacteria 2916028427 2916033608 399
277 iso_pu_bacteria 2916035215 2916039539 399
278 iso_pu_bacteria 2916041962 2916045490 399
279 iso_pu_bacteria 2916048683 2916051159 399
280 iso_pu_bacteria 2916055098 2916057530 399
281 iso_pu_bacteria 2916061851 2916066848 399
282 iso_pu_bacteria 2916076590 2916082369 399
283 iso_pu_bacteria 2919114240 2919118594 399
284 iso_pu_bacteria 2919166419 2919170676 399
285 iso_pu_bacteria 2919171160 2919175902 399
286 iso_pu_bacteria 2920760137 2920760526 399
287 iso_pu_bacteria 2920822456 2920825765 399
288 iso_pu_bacteria 2921201388 2921208332 399
289 iso_pu_bacteria 2921208531 2921212423 399
290 iso_pu_bacteria 2921237296 2921241068 399
291 iso_pu_bacteria 2921244191 2921249563 399
292 iso_pu_bacteria 2921250672 2921255612 399
293 iso_pu_bacteria 2921257292 2921262151 399
294 iso_pu_bacteria 2921263974 2921270604 399
295 iso_pu_bacteria 2921282425 2921284117 399
296 iso_pu_bacteria 2921289301 2921290823 399
297 iso_pu_bacteria 2921296804 2921297108 399
298 iso_pu_bacteria 2924144063 2924150133 399
299 iso_pu_bacteria 2924150972 2924154122 399
300 iso_pu_bacteria 2924158325 2924160255 399
301 iso_pu_bacteria 2924165586 2924169302 399
302 iso_pu_bacteria 2924172951 2924175915 399
303 iso_pu_bacteria 2924179722 2924181662 399
304 iso_pu_bacteria 2924186466 2924192233 399
305 iso_pu_bacteria 2924193448 2924195310 399
306 iso_pu_bacteria 2924200457 2924205998 399
307 iso_pu_bacteria 2924207177 2924209428 399
308 iso_pu_bacteria 2924214083 2924218642 399
309 iso_pu_bacteria 2924221636 2924222731 399
310 iso_pu_bacteria 2924228884 2924233108 399
311 iso_pu_bacteria 2926754445 2926755124 399
312 iso_pu_bacteria 2926760298 2926762284 399
313 iso_pu_bacteria 2929138655 2929141771 399
314 iso_pu_bacteria 2933006813 2933010717 399
315 iso_pu_bacteria 2933011516 2933015608 399
316 iso_pu_bacteria 2933586486 2933592505 399
317 iso_pu_bacteria 2933594066 2933597651 399
318 iso_pu_bacteria 2935901341 2935903802 399
319 iso_pu_bacteria 2936367885 2936369746 399
320 iso_pu_bacteria 2936375103 2936378935 399
321 iso_pu_bacteria 2936996657 2936997640 399
322 iso_pu_bacteria 2937002841 2937008661 399
323 iso_pu_bacteria 2937009748 2937013398 399
324 iso_pu_bacteria 2937016420 2937020264 399
325 iso_pu_bacteria 2937023124 2937024686 399
326 iso_pu_bacteria 2937029754 2937034288 399
327 iso_pu_bacteria 2937036028 2937040954 399
328 iso_pu_bacteria 2937042894 2937044165 399
329 iso_pu_bacteria 2937049772 2937050731 399
330 iso_pu_bacteria 2937056579 2937063314 399
331 iso_pu_bacteria 2937063883 2937067917 399
332 iso_pu_bacteria 2937071275 2937075608 399
333 iso_pu_bacteria 2937078374 2937083086 399
334 iso_pu_bacteria 2937084907 2937086757 399
335 iso_pu_bacteria 2937091812 2937093992 399
336 iso_pu_bacteria 2937098957 2937103291 399
337 iso_pu_bacteria 2937106411 2937111623 399
338 iso_pu_bacteria 2937113482 2937118006 399
339 iso_pu_bacteria 2937119839 2937121814 399
340 iso_pu_bacteria 2937126314 2937127909 399
341 iso_pu_bacteria 2937843397 2937846934 399
342 iso_pu_bacteria 2941499720 2941501171 399
343 iso_pu_bacteria 2957375807 2957380408 399
344 iso_pu_bacteria 2957382221 2957383781 399
345 iso_pu_bacteria 2957388812 2957394365 399
346 iso_pu_bacteria 2957395598 2957398175 399
347 iso_pu_bacteria 2957402308 2957404016 399
348 iso_pu_bacteria 2957408893 2957409926 399
349 iso_pu_bacteria 2957415311 2957417922 399
350 iso_pu_bacteria 2957430029 2957431543 399
351 iso_pu_bacteria 2957437181 2957443213 399
352 iso_pu_bacteria 2957443900 2957447552 399
353 iso_pu_bacteria 2957450854 2957455580 399
354 iso_pu_bacteria 2957457609 2957458416 399
355 iso_pu_bacteria 2957464669 2957469889 399
356 iso_pu_bacteria 2957471148 2957471813 399
357 iso_pu_bacteria 2957478035 2957480063 399
358 iso_pu_bacteria 2957484790 2957485532 399
359 iso_pu_bacteria 2957491536 2957493658 399
360 iso_pu_bacteria 2957498199 2957502151 399
361 iso_pu_bacteria 2957505466 2957512054 399
362 iso_pu_bacteria 2958064165 2958065389 399
363 iso_pu_bacteria 2960584000 2960586794 399
364 iso_pu_bacteria 2960591022 2960595792 399
365 iso_pu_bacteria 2960597568 2960599317 399
366 iso_pu_bacteria 2960603979 2960608013 399
367 iso_pu_bacteria 2960610863 2960612098 399
368 iso_pu_bacteria 2960617483 2960618248 399
369 iso_pu_bacteria 2960624210 2960627397 399
370 iso_pu_bacteria 2960631154 2960634840 399
371 iso_pu_bacteria 2960637947 2960640766 399
372 iso_pu_bacteria 2960645483 2960649553 399
373 iso_pu_bacteria 2960652885 2960655474 399
374 iso_pu_bacteria 2960660292 2960663514 399
375 iso_pu_bacteria 2960667422 2960671825 399
376 iso_pu_bacteria 2960674078 2960674982 399
377 iso_pu_bacteria 2960680706 2960685496 399
378 iso_pu_bacteria 2960687367 2960693754 399
379 iso_pu_bacteria 2960693952 2960700005 399
380 iso_pu_bacteria 2964607997 2964609331 399
381 iso_pu_bacteria 2964615318 2964621105 399
382 iso_pu_bacteria 2964621998 2964628813 399
383 iso_pu_bacteria 2964628898 2964630355 399
384 iso_pu_bacteria 2964636051 2964641969 399
385 iso_pu_bacteria 2964643177 2964645325 399
386 iso_pu_bacteria 2964649959 2964656184 399
387 iso_pu_bacteria 2964656573 2964657204 399
388 iso_pu_bacteria 2964663802 2964667946 399
389 iso_pu_bacteria 2964670856 2964671849 399
390 iso_pu_bacteria 2964678106 2964679275 399
391 iso_pu_bacteria 2964685014 2964690824 399
392 iso_pu_bacteria 2964691889 2964695310 399
393 iso_pu_bacteria 2964698721 2964702573 399
394 iso_pu_bacteria 2964705432 2964709336 399
395 iso_pu_bacteria 2964712639 2964719162 399
396 iso_pu_bacteria 2964719344 2964722500 399
397 iso_pu_bacteria 2967664464 2967668166 399
398 iso_pu_bacteria 2967671571 2967673554 399
399 iso_pu_bacteria 2967678726 2967682725 399
400 iso_pu_bacteria 2967686174 2967691063 399
401 iso_pu_bacteria 2967693043 2967699424 399
402 iso_pu_bacteria 2967714385 2967718215 399
403 iso_pu_bacteria 2967721400 2967725337 399
404 iso_pu_bacteria 2967728569 2967733453 399
405 iso_pu_bacteria 2967735183 2967736726 399
406 iso_pu_bacteria 2967742019 2967746656 399
407 iso_pu_bacteria 2967748971 2967749958 399
408 iso_pu_bacteria 2967755722 2967757979 399
409 iso_pu_bacteria 2967762386 2967762766 399
410 iso_pu_bacteria 2967769361 2967774877 399
411 iso_pu_bacteria 2967775926 2967778459 399
412 iso_pu_bacteria 2970019648 2970023418 399
413 iso_pu_bacteria 2970026789 2970032318 399
414 iso_pu_bacteria 2970033650 2970038327 399
415 iso_pu_bacteria 2970040964 2970047683 399
416 iso_pu_bacteria 2970054988 2970061118 399
417 iso_pu_bacteria 2970061556 2970064867 399
418 iso_pu_bacteria 2970068827 2970073130 399
419 iso_pu_bacteria 2970076120 2970079709 399
420 iso_pu_bacteria 2970082768 2970086455 399
421 iso_pu_bacteria 2970088815 2970091299 399
422 iso_pu_bacteria 2970095765 2970099493 399
423 iso_pu_bacteria 2970102677 2970106793 399
424 iso_pu_bacteria 2970109326 2970115919 399
425 iso_pu_bacteria 2970116247 2970122365 399
426 iso_pu_bacteria 2970122695 2970127483 399
427 iso_pu_bacteria 2970129317 2970135493 399
428 iso_pu_bacteria 2970136068 2970138282 399
429 iso_pu_bacteria 2970143518 2970148271 399
430 iso_pu_bacteria 2970149975 2970156724 399
431 iso_pu_bacteria 2970156795 2970159130 399
432 iso_pu_bacteria 2970164137 2970167979 399
433 iso_pu_bacteria 2970170962 2970176769 399
434 iso_pu_bacteria 2970177841 2970184151 399
435 iso_pu_bacteria 2970184632 2970185767 399
436 iso_pu_bacteria 2970191845 2970198138 399
437 iso_pu_bacteria 2977516862 2977520255 399
438 iso_pu_bacteria 2977523885 2977524595 399
439 iso_pu_bacteria 2977530762 2977535950 399
440 iso_pu_bacteria 2977537788 2977541509 399
441 iso_pu_bacteria 2977544691 2977551015 399
442 iso_pu_bacteria 2977551784 2977553382 399
443 iso_pu_bacteria 2977558990 2977565248 399
444 iso_pu_bacteria 2977565890 2977571541 399
445 iso_pu_bacteria 2977572785 2977576466 399
446 iso_pu_bacteria 2977579622 2977585621 399
447 iso_pu_bacteria 2978969890 2978972512 399
448 iso_pu_bacteria 2979089926 2979092446 399
449 iso_pu_bacteria 2979095461 2979100163 399
450 iso_pu_bacteria 2979100975 2979104417 399
451 iso_pu_bacteria 2984509177 2984513787 399
452 iso_pu_bacteria 2984518228 2984522635 399
453 iso_pu_bacteria 2984537506 2984541941 399
454 iso_pu_bacteria 2984587000 2984590766 399
455 iso_pu_bacteria 2984601300 2984601371 399
456 iso_pu_bacteria 2989349275 2989350774 399
457 iso_pu_bacteria 2989771324 2989771424 399
458 iso_pu_bacteria 2989776772 2989779967 399
459 iso_pu_bacteria 3003930520 3003930799 399
460 iso_pu_bacteria 3005409236 3005409520 399
461 iso_pu_bacteria 3005416602 3005417929 399
462 iso_pu_bacteria 3005445848 3005449539 399
463 iso_pu_bacteria 3005452660 3005457032 399
464 iso_pu_bacteria 639633055 639645558 399
465 iso_pu_bacteria 639633055 639650262 399
466 iso_pu_bacteria 648276728 648737020 399
467 iso_pu_bacteria 8003570095 8003573864 399
468 iso_pu_bacteria 8003992118 8003995162 399
469 iso_pu_bacteria 8003999396 8004002880 399
470 iso_pu_bacteria 8005246636 8005249111 399
471 iso_pu_bacteria 8005289223 8005294056 399
472 iso_pu_bacteria 8005314921 8005316096 399
473 iso_pu_bacteria 8005376324 8005381709 399
474 iso_pu_bacteria 8005460587 8005464953 399
475 iso_pu_bacteria 8005484373 8005490176 399
476 iso_pu_bacteria 8005542996 8005546553 399
477 iso_pu_bacteria 8005556819 8005560994 399
478 iso_pu_bacteria 8005563573 8005565619 399
479 iso_pu_bacteria 8005658619 8005660710 399
480 iso_pu_bacteria 8005682033 8005687584 399
481 iso_pu_bacteria 8005688590 8005693214 399
482 iso_pu_bacteria 8018127388 8018129492 399
483 iso_pu_bacteria 8018150411 8018154488 399
484 iso_pu_bacteria 8018163183 8018165270 399
485 iso_pu_bacteria 8024486573 8024490735 399
486 iso_pu_bacteria 8049293176 8049296094 399
487 iso_pu_bacteria 8054460903 8054463675 399
488 iso_pu_bacteria 8054558443 8054558863 399
489 iso_pu_bacteria 8055431914 8055435652 399
490 iso_pu_bacteria 8056875544 8056878139 399
491 3300006847 Ga0075431_100000522 Ga0075431_10000052217 400
492 3300050508 nmdc:mga09592_94243_c1 nmdc:mga09592_94243_c1_401_1615 400
493 iso_pu_bacteria 2516653077 2517042736 400
494 iso_pu_bacteria 2852387548 2852391565 400
495 iso_pu_bacteria 2919100787 2919105267 400
496 iso_pu_bacteria 2919408235 2919410945 400
497 iso_pu_bacteria 2923556063 2923559606 400
498 iso_pu_bacteria 2936381700 2936388214 400
499 iso_pu_bacteria 8005301065 8005307302 400
500 iso_pu_bacteria 8005314921 8005318057 400
501 iso_pu_bacteria 8005645114 8005646834 400
502 iso_pu_bacteria 8056375014 8056375831 400
503 3300005545 Ga0070695_100040141 Ga0070695_1000401412 401
504 3300047472 Ga0495686_0000007 Ga0495686_0000007_280243_281463 401
505 3300049569 Ga0501032_0002318 Ga0501032_0002318_4758_5978 401
506 3300049569 Ga0501032_0070420 Ga0501032_0070420_1090_2310 401
507 3300049571 Ga0501034_0011247 Ga0501034_0011247_3687_4907 401
508 3300049571 Ga0501034_0082589 Ga0501034_0082589_218_1438 401
509 3300049574 Ga0501038_0011745 Ga0501038_0011745_1060_2280 401
510 3300049575 Ga0501039_0079326 Ga0501039_0079326_205_1425 401
511 3300049579 Ga0501043_0006291 Ga0501043_0006291_2788_4008 401
512 3300049581 Ga0501047_0011027 Ga0501047_0011027_4612_5832 401
513 3300049581 Ga0501047_0024402 Ga0501047_0024402_2143_3363 401
514 3300049583 Ga0501067_0000083 Ga0501067_0000083_28655_29875 401
515 3300049583 Ga0501067_0072724 Ga0501067_0072724_342_1562 401
516 3300049584 Ga0501068_0005450 Ga0501068_0005450_5438_6658 401
517 3300049589 Ga0501073_0000021 Ga0501073_0000021_105534_106754 401
518 3300049589 Ga0501073_0018399 Ga0501073_0018399_488_1708 401
519 3300049593 Ga0501077_0000045 Ga0501077_0000045_21856_23076 401
520 3300049744 Ga0501083_0013576 Ga0501083_0013576_3471_4691 401
521 3300060353 Ga0501082_0024006 Ga0501082_0024006_2958_4178 401
522 3300013306 Ga0163162_10060866 Ga0163162_100608663 402
523 3300039438 Ga0436360_0088138 Ga0436360_0088138_42_1265 402
524 3300042876 Ga0451577_0294211 Ga0451577_0294211_236_1450 402
525 3300044735 Ga0466968_0038503 Ga0466968_0038503_251_1468 402
526 3300045051 Ga0451576_0000040 Ga0451576_0000040_104936_106150 402
527 3300049568 Ga0501031_0148361 Ga0501031_0148361_156_1376 402
528 3300049569 Ga0501032_0015324 Ga0501032_0015324_3488_4708 402
529 3300049570 Ga0501033_0001947 Ga0501033_0001947_1447_2667 402
530 3300049571 Ga0501034_0040554 Ga0501034_0040554_1236_2456 402
531 3300049571 Ga0501034_0073714 Ga0501034_0073714_700_1929 402
532 3300049572 Ga0501036_0015146 Ga0501036_0015146_1670_2890 402
533 3300049573 Ga0501037_0006238 Ga0501037_0006238_3219_4439 402
534 3300049574 Ga0501038_0000362 Ga0501038_0000362_33761_34981 402
535 3300049575 Ga0501039_0002217 Ga0501039_0002217_11401_12621 402
536 3300049579 Ga0501043_0002292 Ga0501043_0002292_3423_4643 402
537 3300049580 Ga0501046_0001124 Ga0501046_0001124_23653_24873 402
538 3300049581 Ga0501047_0092159 Ga0501047_0092159_453_1673 402
539 3300049583 Ga0501067_0001189 Ga0501067_0001189_4058_5278 402
540 3300049584 Ga0501068_0045393 Ga0501068_0045393_216_1436 402
541 3300049585 Ga0501069_0001984 Ga0501069_0001984_8487_9707 402
542 3300049586 Ga0501070_0104134 Ga0501070_0104134_83_1309 402
543 3300049590 Ga0501074_0017685 Ga0501074_0017685_550_1770 402
544 3300049741 Ga0501079_0028105 Ga0501079_0028105_1385_2605 402
545 3300049742 Ga0501080_0000394 Ga0501080_0000394_31114_32334 402
546 3300049744 Ga0501083_0023153 Ga0501083_0023153_2354_3574 402
547 3300049822 Ga0501035_0006142 Ga0501035_0006142_1448_2668 402
548 3300049823 Ga0501044_0025589 Ga0501044_0025589_4584_5804 402
549 3300053139 Ga0500568_0000082 Ga0500568_0000082_41067_42281 402
550 3300060353 Ga0501082_0010865 Ga0501082_0010865_4879_6099 402
551 3300060353 Ga0501082_0015259 Ga0501082_0015259_3912_5141 402
552 3300001979 JGI24740J21852_10000066 JGI24740J21852_100000664 403
553 3300002705 JGI25156J39149_1000033 JGI25156J39149_100003366 403
554 3300002737 JGI25162J39368_1002799 JGI25162J39368_10027997 403
555 3300002737 JGI25162J39368_1003551 JGI25162J39368_10035513 403
556 3300002738 JGI25154J39366_1000058 JGI25154J39366_100005850 403
557 3300002739 JGI25158J39367_1000028 JGI25158J39367_10000285 403
558 3300002739 JGI25158J39367_1005781 JGI25158J39367_10057812 403
559 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009117 403
560 3300002773 JGI25152J39213_1000862 JGI25152J39213_10008627 403
561 3300002773 JGI25152J39213_1007403 JGI25152J39213_10074032 403
562 3300002773 JGI25152J39213_1012349 JGI25152J39213_10123493 403
563 3300002774 JGI25150J39212_1000181 JGI25150J39212_100018112 403
564 3300002774 JGI25150J39212_1002835 JGI25150J39212_10028351 403
565 3300002987 JGI25159J45721_1000050 JGI25159J45721_100005019 403
566 3300002987 JGI25159J45721_1001206 JGI25159J45721_10012064 403
567 3300003187 JGI25151J46595_10000081 JGI25151J46595_1000008112 403
568 3300003187 JGI25151J46595_10009736 JGI25151J46595_100097363 403
569 3300003187 JGI25151J46595_10046770 JGI25151J46595_100467701 403
570 3300003203 JGI25406J46586_10007946 JGI25406J46586_100079466 403
571 3300003214 JGI25165J46597_1000509 JGI25165J46597_100050916 403
572 3300003214 JGI25165J46597_1000514 JGI25165J46597_100051425 403
573 3300003214 JGI25165J46597_1002614 JGI25165J46597_10026144 403
574 3300003354 JGI25160J50197_1000097 JGI25160J50197_100009730 403
575 3300003354 JGI25160J50197_1003171 JGI25160J50197_10031716 403
576 3300003374 JGI25161J50226_1000155 JGI25161J50226_100015514 403
577 3300003374 JGI25161J50226_1003425 JGI25161J50226_10034255 403
578 3300003374 JGI25161J50226_1004951 JGI25161J50226_10049511 403
579 3300003578 Ga0006562J51391_1013127 Ga0006562J51391_10131271 403
580 3300003771 Ga0055526_1000756 Ga0055526_100075621 403
581 3300003771 Ga0055526_1001632 Ga0055526_100163215 403
582 3300003771 Ga0055526_1003400 Ga0055526_10034002 403
583 3300003771 Ga0055526_1013140 Ga0055526_10131403 403
584 3300003775 Ga0055524_1001434 Ga0055524_10014342 403
585 3300003775 Ga0055524_1006172 Ga0055524_10061721 403
586 3300003781 Ga0055536_1002648 Ga0055536_10026488 403
587 3300003781 Ga0055536_1010015 Ga0055536_10100153 403
588 3300003790 Ga0055528_1001269 Ga0055528_10012692 403
589 3300003790 Ga0055528_1001563 Ga0055528_10015632 403
590 3300003790 Ga0055528_1019037 Ga0055528_10190372 403
591 3300003792 Ga0055540_1005283 Ga0055540_10052831 403
592 3300003792 Ga0055540_1006447 Ga0055540_10064472 403
593 3300003792 Ga0055540_1012448 Ga0055540_10124481 403
594 3300003794 Ga0055531_10000744 Ga0055531_1000074424 403
595 3300004625 Ga0055543_1000543 Ga0055543_100054311 403
596 3300005262 Ga0065165_1000427 Ga0065165_100042728 403
597 3300005262 Ga0065165_1014049 Ga0065165_10140492 403
598 3300005262 Ga0065165_1020239 Ga0065165_10202392 403
599 3300005331 Ga0070670_100000326 Ga0070670_10000032610 403
600 3300005548 Ga0070665_100003569 Ga0070665_10000356910 403
601 3300005548 Ga0070665_100049643 Ga0070665_1000496433 403
602 3300005563 Ga0068855_100088629 Ga0068855_1000886293 403
603 3300005564 Ga0070664_100019889 Ga0070664_1000198894 403
604 3300005614 Ga0068856_100012528 Ga0068856_1000125289 403
605 3300005614 Ga0068856_100050913 Ga0068856_1000509132 403
606 3300005834 Ga0068851_10040779 Ga0068851_100407793 403
607 3300005983 Ga0081540_1020420 Ga0081540_10204204 403
608 3300005985 Ga0081539_10001994 Ga0081539_1000199429 403
609 3300005985 Ga0081539_10012572 Ga0081539_100125724 403
610 3300006038 Ga0075365_10000538 Ga0075365_100005387 403
611 3300006042 Ga0075368_10016002 Ga0075368_100160022 403
612 3300006186 Ga0075369_10020761 Ga0075369_100207611 403
613 3300006353 Ga0075370_10018881 Ga0075370_100188812 403
614 3300006946 Ga0079104_1000101 Ga0079104_100010188 403
615 3300006946 Ga0079104_1001906 Ga0079104_10019068 403
616 3300006946 Ga0079104_1003928 Ga0079104_10039287 403
617 3300006948 Ga0099826_10000067 Ga0099826_1000006710 403
618 3300009093 Ga0105240_10000013 Ga0105240_1000001395 403
619 3300009148 Ga0105243_10008956 Ga0105243_100089564 403
620 3300009545 Ga0105237_10000714 Ga0105237_100007143 403
621 3300009765 Ga0123341_1000020 Ga0123341_100002073 403
622 3300013100 Ga0157373_10009912 Ga0157373_100099126 403
623 3300013100 Ga0157373_10093115 Ga0157373_100931152 403
624 3300013102 Ga0157371_10000195 Ga0157371_1000019563 403
625 3300013104 Ga0157370_10000209 Ga0157370_1000020945 403
626 3300013104 Ga0157370_10001395 Ga0157370_1000139517 403
627 3300013104 Ga0157370_10148180 Ga0157370_101481802 403
628 3300013105 Ga0157369_10042259 Ga0157369_100422594 403
629 3300013105 Ga0157369_10042952 Ga0157369_100429522 403
630 3300013105 Ga0157369_10083234 Ga0157369_100832343 403
631 3300013105 Ga0157369_10109902 Ga0157369_101099021 403
632 3300013249 Ga0171463_1004 Ga0171463_100433 403
633 3300013307 Ga0157372_10103374 Ga0157372_101033745 403
634 3300015262 Ga0182007_10010973 Ga0182007_100109732 403
635 3300015690 Ga0183363_1024 Ga0183363_102433 403
636 3300021320 Ga0214544_1002560 Ga0214544_100256022 403
637 3300021321 Ga0214542_1000008 Ga0214542_1000008258 403
638 3300021321 Ga0214542_1025941 Ga0214542_10259413 403
639 3300021327 Ga0214543_1000031 Ga0214543_1000031189 403
640 3300021327 Ga0214543_1000053 Ga0214543_100005316 403
641 3300022739 Ga0228711_1003012 Ga0228711_10030128 403
642 3300022740 Ga0228710_1003154 Ga0228710_10031548 403
643 3300025206 Ga0209435_100009 Ga0209435_100009375 403
644 3300025208 Ga0209436_100296 Ga0209436_10029612 403
645 3300025208 Ga0209436_100651 Ga0209436_1006518 403
646 3300025233 Ga0209437_100057 Ga0209437_10005791 403
647 3300025233 Ga0209437_100107 Ga0209437_10010755 403
648 3300025245 Ga0207425_1000034 Ga0207425_1000034212 403
649 3300025245 Ga0207425_1003822 Ga0207425_10038224 403
650 3300025245 Ga0207425_1008225 Ga0207425_10082251 403
651 3300025246 Ga0209646_1000018 Ga0209646_1000018375 403
652 3300025250 Ga0209026_1000068 Ga0209026_1000068117 403
653 3300025253 Ga0209677_100297 Ga0209677_10029734 403
654 3300025256 Ga0209759_1000007 Ga0209759_1000007375 403
655 3300025258 Ga0209129_1000094 Ga0209129_1000094157 403
656 3300025258 Ga0209129_1000935 Ga0209129_10009359 403
657 3300025258 Ga0209129_1000970 Ga0209129_10009703 403
658 3300025258 Ga0209129_1002548 Ga0209129_100254812 403
659 3300025261 Ga0209233_1000072 Ga0209233_1000072114 403
660 3300025261 Ga0209233_1000134 Ga0209233_100013491 403
661 3300025261 Ga0209233_1000440 Ga0209233_10004409 403
662 3300025273 Ga0209673_1000158 Ga0209673_100015839 403
663 3300025273 Ga0209673_1000584 Ga0209673_10005847 403
664 3300025284 Ga0209130_1000009 Ga0209130_1000009384 403
665 3300025284 Ga0209130_1000027 Ga0209130_100002730 403
666 3300025292 Ga0209676_1007498 Ga0209676_10074982 403
667 3300025292 Ga0209676_1021483 Ga0209676_10214832 403
668 3300025294 Ga0209025_1000184 Ga0209025_100018413 403
669 3300025294 Ga0209025_1000245 Ga0209025_100024525 403
670 3300025294 Ga0209025_1000617 Ga0209025_100061711 403
671 3300025294 Ga0209025_1000706 Ga0209025_100070647 403
672 3300025294 Ga0209025_1000765 Ga0209025_100076536 403
673 3300025294 Ga0209025_1005057 Ga0209025_10050576 403
674 3300025294 Ga0209025_1013471 Ga0209025_10134713 403
675 3300025294 Ga0209025_1014351 Ga0209025_10143513 403
676 3300025295 Ga0209564_1000111 Ga0209564_100011132 403
677 3300025295 Ga0209564_1000675 Ga0209564_100067542 403
678 3300025295 Ga0209564_1001140 Ga0209564_100114014 403
679 3300025295 Ga0209564_1001469 Ga0209564_100146910 403
680 3300025295 Ga0209564_1005362 Ga0209564_10053625 403
681 3300025295 Ga0209564_1013299 Ga0209564_10132992 403
682 3300025295 Ga0209564_1018796 Ga0209564_10187963 403
683 3300025297 Ga0209758_1000159 Ga0209758_100015913 403
684 3300025297 Ga0209758_1000323 Ga0209758_100032344 403
685 3300025297 Ga0209758_1001909 Ga0209758_100190913 403
686 3300025297 Ga0209758_1002600 Ga0209758_10026006 403
687 3300025297 Ga0209758_1013397 Ga0209758_10133973 403
688 3300025298 Ga0209050_1002021 Ga0209050_10020216 403
689 3300025298 Ga0209050_1012841 Ga0209050_10128412 403
690 3300025299 Ga0209256_1000132 Ga0209256_1000132124 403
691 3300025299 Ga0209256_1001025 Ga0209256_100102534 403
692 3300025299 Ga0209256_1001314 Ga0209256_100131422 403
693 3300025299 Ga0209256_1002722 Ga0209256_10027222 403
694 3300025299 Ga0209256_1006316 Ga0209256_10063162 403
695 3300025299 Ga0209256_1010379 Ga0209256_10103794 403
696 3300025299 Ga0209256_1016266 Ga0209256_10162661 403
697 3300025302 Ga0207426_1000041 Ga0207426_1000041322 403
698 3300025302 Ga0207426_1000072 Ga0207426_1000072285 403
699 3300025303 Ga0209051_1000402 Ga0209051_100040230 403
700 3300025303 Ga0209051_1000493 Ga0209051_100049363 403
701 3300025303 Ga0209051_1016485 Ga0209051_10164852 403
702 3300025303 Ga0209051_1019186 Ga0209051_10191861 403
703 3300025303 Ga0209051_1032470 Ga0209051_10324702 403
704 3300025304 Ga0209257_1006579 Ga0209257_10065795 403
705 3300025304 Ga0209257_1018065 Ga0209257_10180652 403
706 3300025913 Ga0207695_10000044 Ga0207695_1000004452 403
707 3300025914 Ga0207671_10000364 Ga0207671_1000036467 403
708 3300025925 Ga0207650_10000151 Ga0207650_1000015178 403
709 3300025935 Ga0207709_10007084 Ga0207709_100070845 403
710 3300025944 Ga0207661_10029918 Ga0207661_100299184 403
711 3300025949 Ga0207667_10131072 Ga0207667_101310723 403
712 3300026078 Ga0207702_10033297 Ga0207702_100332972 403
713 3300027111 Ga0209281_1000028 Ga0209281_1000028134 403
714 3300027111 Ga0209281_1000596 Ga0209281_100059620 403
715 3300027111 Ga0209281_1000760 Ga0209281_100076012 403
716 3300027312 Ga0209371_1000037 Ga0209371_100003758 403
717 3300027312 Ga0209371_1001945 Ga0209371_100194511 403
718 3300027312 Ga0209371_1001958 Ga0209371_10019583 403
719 3300027666 Ga0209282_1000267 Ga0209282_100026716 403
720 3300027666 Ga0209282_1000803 Ga0209282_10008034 403
721 3300028379 Ga0268266_10002491 Ga0268266_1000249112 403
722 3300028794 Ga0307515_10000434 Ga0307515_10000434100 403
723 3300028794 Ga0307515_10002407 Ga0307515_1000240711 403
724 3300028794 Ga0307515_10130503 Ga0307515_101305033 403
725 3300030500 Ga0268256_1000039 Ga0268256_1000039251 403
726 3300030500 Ga0268256_1000890 Ga0268256_10008907 403
727 3300030500 Ga0268256_1002013 Ga0268256_10020133 403
728 3300031456 Ga0307513_10001773 Ga0307513_1000177329 403
729 3300031456 Ga0307513_10101893 Ga0307513_101018932 403
730 3300031548 Ga0307408_100013679 Ga0307408_1000136793 403
731 3300031901 Ga0307406_10030232 Ga0307406_100302322 403
732 3300031911 Ga0307412_10003953 Ga0307412_100039532 403
733 3300031911 Ga0307412_10111939 Ga0307412_101119392 403
734 3300031967 Ga0315914_1000965 Ga0315914_100096519 403
735 3300033430 Ga0315913_1000276 Ga0315913_100027616 403
736 3300033464 Ga0315915_1000499 Ga0315915_100049916 403
737 3300035695 Ga0373927_0000074 Ga0373927_0000074_21332_22588 403
738 3300037471 Ga0395905_0000836 Ga0395905_0000836_29051_30265 403
739 3300037471 Ga0395905_0012177 Ga0395905_0012177_2316_3530 403
740 3300039062 Ga0400483_057556 Ga0400483_057556_1665_2879 403
741 3300039062 Ga0400483_168905 Ga0400483_168905_4773_5987 403
742 3300041451 Ga0451791_0145945 Ga0451791_0145945_713_1927 403
743 3300041491 Ga0451833_0204696 Ga0451833_0204696_994_2208 403
744 3300041510 Ga0451854_27941 Ga0451854_27941_355_1572 403
745 3300041907 Ga0452268_27494 Ga0452268_27494_467_1735 403
746 3300042007 Ga0439449_0008526 Ga0439449_0008526_699_1919 403
747 3300046460 Ga0495638_0036762 Ga0495638_0036762_399_1613 403
748 3300046474 Ga0495605_0000575 Ga0495605_0000575_17587_18801 403
749 3300046512 Ga0495610_0000915 Ga0495610_0000915_11790_13004 403
750 3300046519 Ga0495632_0001194 Ga0495632_0001194_7915_9129 403
751 3300046660 Ga0495625_0002177 Ga0495625_0002177_12907_14121 403
752 3300046675 Ga0495657_0110878 Ga0495657_0110878_448_1662 403
753 3300046809 Ga0495600_0024445 Ga0495600_0024445_113_1327 403
754 3300047317 Ga0495604_0127223 Ga0495604_0127223_69_1283 403
755 3300047472 Ga0495686_0000922 Ga0495686_0000922_18341_19603 403
756 3300048919 Ga0496116_0000380 Ga0496116_0000380_25189_26406 403
757 3300048919 Ga0496116_0004572 Ga0496116_0004572_1342_2556 403
758 3300048919 Ga0496116_0007357 Ga0496116_0007357_845_2062 403
759 3300048919 Ga0496116_0036635 Ga0496116_0036635_2143_3357 403
760 3300048920 Ga0496117_0000031 Ga0496117_0000031_73160_74377 403
761 3300048920 Ga0496117_0001675 Ga0496117_0001675_3423_4667 403
762 3300048920 Ga0496117_0002447 Ga0496117_0002447_5071_6285 403
763 3300048920 Ga0496117_0003875 Ga0496117_0003875_10705_11919 403
764 3300048920 Ga0496117_0017954 Ga0496117_0017954_3272_4489 403
765 3300048921 Ga0496118_0002290 Ga0496118_0002290_5117_6361 403
766 3300048921 Ga0496118_0002502 Ga0496118_0002502_12191_13408 403
767 3300048921 Ga0496118_0033542 Ga0496118_0033542_1291_2508 403
768 3300048923 Ga0496120_0002700 Ga0496120_0002700_16157_17374 403
769 3300048923 Ga0496120_0010575 Ga0496120_0010575_96_1313 403
770 3300048923 Ga0496120_0049174 Ga0496120_0049174_543_1757 403
771 3300048924 Ga0496121_0000034 Ga0496121_0000034_323326_324543 403
772 3300048924 Ga0496121_0002365 Ga0496121_0002365_18486_19760 403
773 3300048924 Ga0496121_0002652 Ga0496121_0002652_16674_17891 403
774 3300048924 Ga0496121_0015989 Ga0496121_0015989_296_1510 403
775 3300048924 Ga0496121_0041943 Ga0496121_0041943_474_1718 403
776 3300048924 Ga0496121_0049082 Ga0496121_0049082_73_1287 403
777 3300048924 Ga0496121_0075661 Ga0496121_0075661_1349_2566 403
778 3300048925 Ga0496122_0000023 Ga0496122_0000023_73160_74377 403
779 3300048925 Ga0496122_0000068 Ga0496122_0000068_208773_209990 403
780 3300048925 Ga0496122_0000777 Ga0496122_0000777_35619_36833 403
781 3300048925 Ga0496122_0003156 Ga0496122_0003156_16730_17944 403
782 3300048925 Ga0496122_0006273 Ga0496122_0006273_850_2067 403
783 3300048925 Ga0496122_0017400 Ga0496122_0017400_3722_4936 403
784 3300048926 Ga0496123_0000059 Ga0496123_0000059_16166_17383 403
785 3300048926 Ga0496123_0000519 Ga0496123_0000519_36628_37842 403
786 3300048926 Ga0496123_0034170 Ga0496123_0034170_2039_3253 403
787 3300048926 Ga0496123_0061871 Ga0496123_0061871_132_1346 403
788 3300048927 Ga0496124_0000130 Ga0496124_0000130_83768_84985 403
789 3300048927 Ga0496124_0000781 Ga0496124_0000781_36091_37305 403
790 3300048927 Ga0496124_0001790 Ga0496124_0001790_18018_19232 403
791 3300048927 Ga0496124_0007537 Ga0496124_0007537_7336_8550 403
792 3300048927 Ga0496124_0010851 Ga0496124_0010851_2810_4027 403
793 3300048927 Ga0496124_0017090 Ga0496124_0017090_1012_2226 403
794 3300048927 Ga0496124_0070613 Ga0496124_0070613_719_1936 403
795 3300048928 Ga0496125_0000790 Ga0496125_0000790_22655_23869 403
796 3300048928 Ga0496125_0006012 Ga0496125_0006012_2394_3608 403
797 3300048928 Ga0496125_0027907 Ga0496125_0027907_3825_5039 403
798 3300048928 Ga0496125_0169248 Ga0496125_0169248_13_1230 403
799 3300048929 Ga0496126_0000293 Ga0496126_0000293_13094_14311 403
800 3300048929 Ga0496126_0000466 Ga0496126_0000466_51333_52547 403
801 3300048929 Ga0496126_0085072 Ga0496126_0085072_902_2131 403
802 3300049568 Ga0501031_0022019 Ga0501031_0022019_557_1771 403
803 3300049569 Ga0501032_0003148 Ga0501032_0003148_3800_5014 403
804 3300049569 Ga0501032_0089793 Ga0501032_0089793_615_1829 403
805 3300049569 Ga0501032_0091545 Ga0501032_0091545_584_1834 403
806 3300049570 Ga0501033_0000361 Ga0501033_0000361_15981_17195 403
807 3300049570 Ga0501033_0015427 Ga0501033_0015427_3175_4389 403
808 3300049570 Ga0501033_0097621 Ga0501033_0097621_554_1768 403
809 3300049570 Ga0501033_0106782 Ga0501033_0106782_211_1425 403
810 3300049571 Ga0501034_0000609 Ga0501034_0000609_18145_19359 403
811 3300049571 Ga0501034_0001008 Ga0501034_0001008_34608_35822 403
812 3300049571 Ga0501034_0015694 Ga0501034_0015694_6358_7572 403
813 3300049571 Ga0501034_0046731 Ga0501034_0046731_618_1925 403
814 3300049571 Ga0501034_0064534 Ga0501034_0064534_2273_3487 403
815 3300049571 Ga0501034_0107243 Ga0501034_0107243_211_1425 403
816 3300049571 Ga0501034_0108720 Ga0501034_0108720_1407_2627 403
817 3300049571 Ga0501034_0253335 Ga0501034_0253335_226_1440 403
818 3300049572 Ga0501036_0095725 Ga0501036_0095725_115_1365 403
819 3300049573 Ga0501037_0019279 Ga0501037_0019279_3338_4552 403
820 3300049573 Ga0501037_0097203 Ga0501037_0097203_13_1227 403
821 3300049574 Ga0501038_0000187 Ga0501038_0000187_7625_8839 403
822 3300049574 Ga0501038_0000394 Ga0501038_0000394_3294_4508 403
823 3300049574 Ga0501038_0133052 Ga0501038_0133052_615_1829 403
824 3300049574 Ga0501038_0145272 Ga0501038_0145272_105_1355 403
825 3300049575 Ga0501039_0000932 Ga0501039_0000932_12072_13286 403
826 3300049576 Ga0501040_0103038 Ga0501040_0103038_561_1775 403
827 3300049579 Ga0501043_0001876 Ga0501043_0001876_3119_4333 403
828 3300049579 Ga0501043_0022843 Ga0501043_0022843_661_1875 403
829 3300049580 Ga0501046_0042889 Ga0501046_0042889_1079_2293 403
830 3300049581 Ga0501047_0133404 Ga0501047_0133404_246_1460 403
831 3300049581 Ga0501047_0171304 Ga0501047_0171304_211_1425 403
832 3300049581 Ga0501047_0177056 Ga0501047_0177056_559_1773 403
833 3300049584 Ga0501068_0044245 Ga0501068_0044245_964_2178 403
834 3300049586 Ga0501070_0002177 Ga0501070_0002177_342_1637 403
835 3300049587 Ga0501071_0034352 Ga0501071_0034352_789_2003 403
836 3300049589 Ga0501073_0020835 Ga0501073_0020835_2489_3703 403
837 3300049741 Ga0501079_0059105 Ga0501079_0059105_33_1247 403
838 3300049822 Ga0501035_0000398 Ga0501035_0000398_42112_43407 403
839 3300049822 Ga0501035_0001173 Ga0501035_0001173_10508_11722 403
840 3300049822 Ga0501035_0005409 Ga0501035_0005409_7827_9041 403
841 3300049822 Ga0501035_0148053 Ga0501035_0148053_615_1829 403
842 3300049823 Ga0501044_0186360 Ga0501044_0186360_211_1425 403
843 3300049824 Ga0501045_0026526 Ga0501045_0026526_1599_2813 403
844 3300050492 nmdc:mga0yw44_14554_c1 nmdc:mga0yw44_14554_c1_2930_4147 403
845 3300050492 nmdc:mga0yw44_25318_c1 nmdc:mga0yw44_25318_c1_635_1849 403
846 3300050516 nmdc:mga0sz30_630_c1 nmdc:mga0sz30_630_c1_8072_9289 403
847 3300053125 Ga0500618_000241 Ga0500618_000241_21345_22559 403
848 3300053125 Ga0500618_000464 Ga0500618_000464_16858_18072 403
849 3300053136 Ga0500559_0003811 Ga0500559_0003811_5079_6293 403
850 3300053139 Ga0500568_0000640 Ga0500568_0000640_12742_13956 403
851 3300053140 Ga0500573_0000126 Ga0500573_0000126_12182_13396 403
852 3300053148 Ga0500590_001068 Ga0500590_001068_3333_4667 403
853 3300053153 Ga0500616_0000986 Ga0500616_0000986_12481_13695 403
854 3300053157 Ga0500624_000493 Ga0500624_000493_15_1232 403
855 3300053161 Ga0500634_0068893 Ga0500634_0068893_269_1540 403
856 3300053177 Ga0500636_0000032 Ga0500636_0000032_19388_20605 403
857 3300059477 Ga0587084_008216 Ga0587084_008216_85_1302 403
858 3300059493 Ga0587077_014599 Ga0587077_014599_21_1235 403
859 3300059508 Ga0587088_010398 Ga0587088_010398_95_1312 403
860 3300059510 Ga0587090_005326 Ga0587090_005326_95_1312 403
861 3300059643 Ga0587072_004545 Ga0587072_004545_115_1332 403
862 iso_pu_bacteria 2510917022 2511132026 403
863 iso_pu_bacteria 2582581307 2585271538 403
864 iso_pu_bacteria 2585427528 2585540637 403
865 iso_pu_bacteria 2585427531 2585563222 403
866 iso_pu_bacteria 2585427593 2585838906 403
867 iso_pu_bacteria 2585427609 2585907440 403
868 iso_pu_bacteria 2585428125 2587982566 403
869 iso_pu_bacteria 2617270742 2617384957 403
870 iso_pu_bacteria 2718217997 2719669429 403
871 iso_pu_bacteria 2718218199 2720494445 403
872 iso_pu_bacteria 2718218232 2720610782 403
873 iso_pu_bacteria 2718218233 2720616660 403
874 iso_pu_bacteria 2718218235 2720628016 403
875 iso_pu_bacteria 2718218269 2720771596 403
876 iso_pu_bacteria 2721755556 2723030858 403
877 iso_pu_bacteria 2721755684 2723563360 403
878 iso_pu_bacteria 2721755685 2723571350 403
879 iso_pu_bacteria 2721755819 2724087145 403
880 iso_pu_bacteria 2721755822 2724100856 403
881 iso_pu_bacteria 2721755823 2724108098 403
882 iso_pu_bacteria 2728369352 2730105324 403
883 iso_pu_bacteria 2838016132 2838018459 403
884 iso_pu_bacteria 2838022645 2838024138 403
885 iso_pu_bacteria 2838048938 2838053691 403
886 iso_pu_bacteria 2838061910 2838062447 403
887 iso_pu_bacteria 2838068647 2838071998 403
888 iso_pu_bacteria 2838668709 2838672939 403
889 iso_pu_bacteria 2838680041 2838684015 403
890 iso_pu_bacteria 2838694306 2838698544 403
891 iso_pu_bacteria 2838701080 2838705583 403
892 iso_pu_bacteria 2838707686 2838711659 403
893 iso_pu_bacteria 2841864319 2841867893 403
894 iso_pu_bacteria 2842077413 2842081460 403
895 iso_pu_bacteria 2842118031 2842121763 403
896 iso_pu_bacteria 2842146304 2842149913 403
897 iso_pu_bacteria 2842156927 2842161008 403
898 iso_pu_bacteria 2842192696 2842195008 403
899 iso_pu_bacteria 2842198810 2842201732 403
900 iso_pu_bacteria 2842205361 2842207285 403
901 iso_pu_bacteria 2842237096 2842240778 403
902 iso_pu_bacteria 2842243621 2842246622 403
903 iso_pu_bacteria 2842250916 2842255263 403
904 iso_pu_bacteria 2842257432 2842261276 403
905 iso_pu_bacteria 2842264693 2842269037 403
906 iso_pu_bacteria 2842278818 2842281004 403
907 iso_pu_bacteria 2842291075 2842295117 403
908 iso_pu_bacteria 2842304105 2842306011 403
909 iso_pu_bacteria 2842311132 2842311285 403
910 iso_pu_bacteria 2842317721 2842320986 403
911 iso_pu_bacteria 2842341865 2842346715 403
912 iso_pu_bacteria 2842363717 2842366397 403
913 iso_pu_bacteria 2842370503 2842374865 403
914 iso_pu_bacteria 2842377471 2842381516 403
915 iso_pu_bacteria 2842384541 2842388586 403
916 iso_pu_bacteria 2842395702 2842396082 403
917 iso_pu_bacteria 2842395702 2842396903 403
918 iso_pu_bacteria 2842422224 2842425630 403
919 iso_pu_bacteria 2842428310 2842433270 403
920 iso_pu_bacteria 2842434925 2842439696 403
921 iso_pu_bacteria 2842441272 2842446225 403
922 iso_pu_bacteria 2842447887 2842448906 403
923 iso_pu_bacteria 2842462802 2842467420 403
924 iso_pu_bacteria 2842469257 2842474085 403
925 iso_pu_bacteria 2842489311 2842491038 403
926 iso_pu_bacteria 2842495871 2842498376 403
927 iso_pu_bacteria 2933570622 2933572515 403
928 iso_pu_bacteria 2933599457 2933603148 403
929 iso_pu_bacteria 2935894831 2935897807 403
930 iso_pu_bacteria 2936381700 2936385848 403
931 iso_pu_bacteria 3005416602 3005421753 403
932 iso_pu_bacteria 650716007 650741078 403
933 iso_pu_bacteria 8005275841 8005282293 403
934 iso_pu_bacteria 8005282627 8005286875 403
935 iso_pu_bacteria 8005282627 8005287533 403
936 iso_pu_bacteria 8005301065 8005305841 403
937 iso_pu_bacteria 8005314921 8005319547 403
938 iso_pu_bacteria 8005395548 8005400933 403
939 iso_pu_bacteria 8005430974 8005433711 403
940 iso_pu_bacteria 8005430974 8005435979 403
941 iso_pu_bacteria 8005497431 8005497547 403
942 iso_pu_bacteria 8005619151 8005623280 403
943 iso_pu_bacteria 8005668836 8005668952 403
944 iso_pu_bacteria 8005695170 8005695594 403
945 iso_pu_bacteria 8005695170 8005697001 403
946 iso_pu_bacteria 8018176218 8018177022 403
947 iso_pu_bacteria 8023680758 8023686369 403
948 iso_pu_bacteria 8024479707 8024484226 403
949 iso_pu_bacteria 8024501048 8024502451 403
950 iso_pu_bacteria 8046767195 8046768159 403
951 iso_pu_bacteria 8056375014 8056378479 403
952 iso_pu_bacteria 8056382006 8056383931 403
953 iso_pu_bacteria 8057575449 8057581480 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

41

384

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9797 1 397
2bwo-assembly2.cif.gz_D 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa 0.9785 1 393
5txt-assembly2.cif.gz_D structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9764 47 395
5txt-assembly3.cif.gz_E structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9761 47 395
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9725 1 397
ID Description Score Start End Superfamily
af_O18680_387_483_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9866 298 385 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9838 300 385 3.90.1150.10
af_Q8I4X1_515_606_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9823 300 387 3.90.1150.10
af_I1JW06_395_456_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9763 327 387 3.90.1150.10
af_P09950_130_384_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9745 62 293 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A537RIS6-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9886 86 200 GO:0008483
GO:0009058
GO:0030170
AF-A0A2W4ZVT4-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9885 101 394 GO:0003870
GO:0006782
GO:0030170
AF-F6RYA6-F1-model_v4 Aminolevulinic acid synthase 1 0.9884 162 252 GO:0009058
GO:0016746
GO:0030170
AF-A0A0L0FH53-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9882 59 396 GO:0003870
GO:0005739
GO:0006782
GO:0030170
AF-A0A845S274-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9877 134 397 GO:0003870
GO:0006782
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.79 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map