F486670

General Info

Members Datasets Scaffolds Average Seq Length
953 715 490 355

Family's Representative Sequence

Representative Sequence 3300053099|Ga0500654_089088|Ga0500654_089088_150_1214
Length 348
Sequence MNILVTGGAGFIGSALCRHLVSTGENVLNVDKLTYAGNLASLWSIENCPNYRFVNADICNEAAMIELMRREEIDRVIHLAAETHVDRSIDGPAQFIETNIVGTFRLLQATLKYWRELPDQAARKFRFHHVSTDEVFGDLPFDQTPYAPSSPYSASKAASDHLVRAWHQTFGLPIVMSNCSNNYGPYHFPEKLIPLVILNALDEKPLPIYGAGSNVRDWLYVEDHARALALIAGVGAIGESYNIGGGCERTNLAVVQAICDILDRVKPRNHPRSYRELITFVDDRPGHDRRYAMNTSKIESHLGWKPQESFETGLAQTIAWYLDNEWWWKPIREGTYGGSRLGRLAAAQ

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2511231022 Pseudomonas sp. GM79 Isolate Nodule
10 2511231023 Pseudomonas sp. GM80 Isolate Nodule
11 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
27 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
28 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
29 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
35 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
36 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
37 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
38 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
39 2643221607 Rhizobium sp. Root73 Isolate Unclassified
40 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
41 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
42 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
43 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
44 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
45 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
46 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
47 2643221718 Rhizobium sp. Root268 Isolate Unclassified
48 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
49 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
50 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
51 2738543024 Aminobacter sp. AP02 Isolate Unclassified
52 2751185800 Brucella pituitosa AA2 Isolate Unclassified
53 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
54 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
55 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
56 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
57 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
58 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
59 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
60 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
61 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
62 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
63 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
64 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
65 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
66 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
67 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
68 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
69 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
70 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
71 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
72 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
73 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
74 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
75 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
76 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
77 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
78 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
79 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
80 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
81 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
82 2854911287 Brucella lupini LUP21 Isolate Unclassified
83 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
84 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
85 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
86 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
87 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
88 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
89 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
90 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
91 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
92 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
93 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
94 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
95 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
96 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
97 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
98 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
99 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
100 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
101 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
102 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
103 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
104 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
105 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
106 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
107 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
108 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
109 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
110 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
111 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
112 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
113 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
114 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
115 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
116 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
117 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
118 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
119 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
120 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
121 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
122 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
123 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
124 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
125 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
126 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
127 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
128 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
129 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
130 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
131 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
132 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
133 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
134 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
135 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
136 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
137 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
138 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
139 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
140 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
141 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
142 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
143 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
144 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
145 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
146 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
147 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
148 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
149 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
150 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
151 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
152 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
153 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
154 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
155 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
156 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
157 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
158 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
159 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
160 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
161 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
162 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
163 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
164 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
165 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
166 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
167 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
168 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
169 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
170 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
171 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
172 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
173 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
174 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
175 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
176 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
177 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
178 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
179 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
180 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
181 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
182 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
183 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
184 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
185 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
186 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
187 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
188 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
189 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
190 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
191 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
192 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
193 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
194 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
195 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
196 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
197 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
198 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
199 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
200 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
201 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
202 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
203 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
204 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
205 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
206 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
207 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
208 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
209 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
210 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
211 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
212 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
213 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
214 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
215 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
216 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
217 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
218 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
219 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
220 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
221 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
222 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
223 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
224 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
225 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
226 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
227 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
228 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
229 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
230 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
231 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
232 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
233 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
234 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
235 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
236 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
237 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
238 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
239 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
240 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
241 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
242 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
243 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
244 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
245 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
246 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
247 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
248 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
249 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
250 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
251 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
252 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
253 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
254 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
255 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
256 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
257 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
258 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
259 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
260 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
261 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
262 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
263 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
264 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
265 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
266 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
267 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
268 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
269 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
270 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
271 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
272 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
273 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
274 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
275 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
276 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
277 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
278 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
279 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
280 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
281 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
282 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
283 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
284 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
285 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
286 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
287 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
288 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
289 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
290 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
291 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
292 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
293 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
294 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
295 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
296 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
297 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
298 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
299 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
300 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
301 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
302 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
303 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
304 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
305 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
306 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
307 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
308 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
309 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
310 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
311 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
312 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
313 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
314 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
315 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
316 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
317 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
318 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
319 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
320 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
321 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
322 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
323 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
324 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
325 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
326 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
327 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
328 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
329 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
330 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
331 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
332 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
333 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
334 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
335 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
336 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
337 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
338 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
339 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
340 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
341 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
342 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
343 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
344 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
345 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
346 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
347 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
348 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
349 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
350 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
351 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
352 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
353 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
354 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
355 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
356 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
357 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
358 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
359 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
360 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
361 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
362 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
363 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
364 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
365 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
366 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
367 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
368 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
369 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
370 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
371 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
372 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
373 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
374 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
375 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
376 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
377 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
378 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
379 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
380 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
381 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
382 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
383 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
384 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
385 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
386 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
387 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
388 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
389 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
390 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
391 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
392 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
393 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
394 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
395 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
396 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
397 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
398 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
399 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
400 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
401 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
402 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
403 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
404 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
405 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
406 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
407 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
408 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
409 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
410 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
411 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
412 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
413 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
414 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
415 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
416 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
417 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
418 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
419 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
420 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
421 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
422 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
423 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
424 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
425 3004167301 Mesorhizobium loti 582 Isolate Unclassified
426 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
427 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
428 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
429 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
430 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
431 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
432 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
433 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
434 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
435 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
436 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
437 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
438 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
439 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
440 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
441 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
442 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
443 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
444 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
445 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
446 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
447 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
448 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
449 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
450 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
451 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
452 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
453 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
454 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
455 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
456 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
457 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
458 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
459 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
460 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
461 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
462 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
463 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
464 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
465 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
466 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
467 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
468 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
469 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
470 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
471 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
472 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
473 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
474 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
475 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
476 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
477 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
478 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
479 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
480 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
481 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
482 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
483 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
484 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
485 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
486 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
487 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
488 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
489 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
490 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
491 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
492 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
493 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
494 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
495 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
496 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
497 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
498 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
499 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
500 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
501 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
502 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
503 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
504 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
505 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
506 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
507 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
508 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
509 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
510 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
511 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
512 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
513 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
514 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
515 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
516 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
517 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
518 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
519 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
520 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
521 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
522 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
523 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
524 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
525 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
526 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
527 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
528 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
529 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
530 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
531 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
532 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
569 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
570 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
573 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
574 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
575 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
576 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
577 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
578 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
579 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
580 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
581 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
582 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
583 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
584 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
585 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
586 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
587 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
588 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
589 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
590 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
591 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
592 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
593 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
594 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
595 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
596 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
597 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
598 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
599 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
600 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
601 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
602 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
603 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
604 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
605 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
606 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
607 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
608 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
609 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
610 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
611 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
612 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
613 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
614 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
615 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
616 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
617 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
618 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
619 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
620 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
621 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
622 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
623 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
624 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
625 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
626 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
627 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
628 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
629 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
630 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
631 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
632 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
633 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
634 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
635 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
636 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
637 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
638 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
639 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
640 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
641 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
642 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
643 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
644 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
645 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
646 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
647 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
648 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
649 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
650 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
651 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
652 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
653 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
654 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
655 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
656 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
657 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
658 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
659 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
660 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
661 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
666 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
673 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
674 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
675 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
676 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
677 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
678 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
679 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
680 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
681 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
682 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
683 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
684 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
685 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
686 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
687 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
688 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
689 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
690 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
691 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
692 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
693 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
694 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
695 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
696 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
697 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
698 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
699 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
700 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
701 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
702 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
703 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
704 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
705 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
706 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
707 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
708 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
709 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
710 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
711 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
712 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
713 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
714 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
715 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.1
Metatranscriptomes 0.31
Isolates 48.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 41.87
Rhizoplane 2.2
Rhizosphere 40.61
Stem 0
Stem Tuber 0.1
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002450 3300001915 Bacteria 4815
2 JGI24741J21665_1005105 3300001915 Bacteria 2803
3 JGI24740J21852_10001757 3300001979 Bacteria 9953
4 JGI24740J21852_10005092 3300001979 Bacteria 5581
5 JGI24739J22299_10004177 3300001989 Bacteria 5523
6 JGI24737J22298_10004791 3300001990 Bacteria 4701
7 JGI24737J22298_10023171 3300001990 Bacteria 1970
8 JGI24735J21928_10004301 3300002067 Bacteria 4792
9 JGI25156J39149_1012079 3300002705 Bacteria 1922
10 JGI25157J39369_1001893 3300002741 Bacteria 6404
11 JGI25165J46597_1000007 3300003214 Bacteria 518996
12 JGI25165J46597_1000016 3300003214 Bacteria 377866
13 rootH2_10004299 3300003320 Bacteria 15634
14 Ga0006562J51391_1012741 3300003578 Bacteria 5060
15 Ga0055525_1000248 3300003759 Bacteria 54342
16 Ga0055542_1000040 3300003762 Bacteria 214035
17 Ga0055542_1001081 3300003762 Bacteria 16610
18 Ga0055529_1000037 3300003763 Bacteria 237307
19 Ga0055530_10000027 3300003791 Bacteria 129838
20 Ga0055530_10000142 3300003791 Bacteria 64055
21 Ga0055531_10000013 3300003794 Bacteria 187583
22 Ga0065165_1006759 3300005262 Bacteria 5873
23 Ga0065712_10072921 3300005290 Bacteria 4565
24 Ga0065715_10091015 3300005293 Bacteria 6201
25 Ga0065715_10099558 3300005293 Bacteria 3395
26 Ga0070658_10006678 3300005327 Bacteria 9350
27 Ga0070658_10048232 3300005327 Bacteria 3447
28 Ga0070658_10106655 3300005327 Bacteria 2318
29 Ga0070676_10195749 3300005328 Bacteria 1322
30 Ga0070683_100044731 3300005329 Bacteria 4084
31 Ga0070683_100131466 3300005329 Bacteria 2369
32 Ga0070670_100002432 3300005331 Bacteria 15352
33 Ga0070666_10193878 3300005335 Bacteria 1428
34 Ga0070680_100000186 3300005336 Bacteria 40260
35 Ga0070682_100134670 3300005337 Bacteria 1676
36 Ga0068868_100136189 3300005338 Bacteria 2013
37 Ga0070660_100008068 3300005339 Bacteria 7359
38 Ga0070660_100033802 3300005339 Bacteria 3858
39 Ga0070660_100136626 3300005339 Bacteria 1964
40 Ga0070661_100000003 3300005344 Bacteria 254653
41 Ga0070661_100006247 3300005344 Bacteria 8219
42 Ga0070661_100034074 3300005344 Bacteria 3692
43 Ga0070661_100156527 3300005344 Bacteria 1724
44 Ga0070669_100000746 3300005353 Bacteria 23697
45 Ga0070675_100056869 3300005354 Bacteria 3225
46 Ga0070671_100055836 3300005355 Bacteria 3286
47 Ga0070674_100001650 3300005356 Bacteria 12034
48 Ga0070667_100008595 3300005367 Bacteria 8465
49 Ga0070667_100099362 3300005367 Bacteria 2512
50 Ga0070663_100005513 3300005455 Bacteria 7523
51 Ga0070663_100026992 3300005455 Bacteria 3895
52 Ga0070663_100035759 3300005455 Bacteria 3448
53 Ga0070678_100000022 3300005456 Bacteria 49544
54 Ga0070662_100047007 3300005457 Bacteria 3102
55 Ga0070662_100080937 3300005457 Bacteria 2419
56 Ga0070679_100000001 3300005530 Bacteria 764811
57 Ga0068853_100000154 3300005539 Bacteria 47200
58 Ga0068853_100072234 3300005539 Bacteria 3006
59 Ga0070672_100091097 3300005543 Bacteria 2460
60 Ga0070672_100143992 3300005543 Bacteria 1968
61 Ga0070665_100371346 3300005548 Bacteria 1437
62 Ga0070664_100000796 3300005564 Bacteria 24295
63 Ga0070664_100016274 3300005564 Bacteria 6096
64 Ga0070664_100263370 3300005564 Bacteria 1551
65 Ga0068857_100018908 3300005577 Bacteria 6045
66 Ga0068857_100025223 3300005577 Bacteria 5235
67 Ga0068857_100026804 3300005577 Bacteria 5081
68 Ga0068857_100037312 3300005577 Bacteria 4304
69 Ga0068857_100145520 3300005577 Bacteria 2144
70 Ga0068854_100051750 3300005578 Bacteria 2943
71 Ga0068856_100050455 3300005614 Bacteria 4102
72 Ga0068856_100185613 3300005614 Bacteria 2093
73 Ga0068852_100000441 3300005616 Bacteria 27471
74 Ga0068852_100003115 3300005616 Bacteria 11550
75 Ga0068852_100064145 3300005616 Bacteria 3201
76 Ga0068852_100146390 3300005616 Bacteria 2191
77 Ga0068852_100375279 3300005616 Bacteria 1394
78 Ga0068859_100009057 3300005617 Bacteria 10053
79 Ga0068864_100003909 3300005618 Bacteria 12272
80 Ga0068863_100004332 3300005841 Bacteria 13985
81 Ga0081539_10001682 3300005985 Bacteria 35728
82 Ga0081539_10018674 3300005985 Bacteria 4795
83 Ga0075365_10009204 3300006038 Bacteria 5664
84 Ga0075367_10071034 3300006178 Bacteria 2094
85 Ga0075366_10016389 3300006195 Bacteria 4258
86 Ga0097621_100116235 3300006237 Bacteria 2265
87 Ga0097621_100124021 3300006237 Bacteria 2193
88 Ga0097621_100391249 3300006237 Bacteria 1243
89 Ga0068871_100128587 3300006358 Bacteria 2146
90 Ga0075429_100017762 3300006880 Bacteria 6152
91 Ga0097620_100009057 3300006931 Bacteria 10053
92 Ga0079104_1000826 3300006946 Bacteria 25791
93 Ga0079104_1002768 3300006946 Bacteria 8881
94 Ga0079104_1012509 3300006946 Bacteria 2661
95 Ga0099826_10009423 3300006948 Bacteria 7294
96 Ga0105251_10038616 3300009011 Bacteria 2338
97 Ga0105240_10103281 3300009093 Bacteria 3463
98 Ga0105240_10173766 3300009093 Bacteria 2549
99 Ga0105240_10179728 3300009093 Bacteria 2498
100 Ga0105240_10205709 3300009093 Bacteria 2304
101 Ga0105240_10227656 3300009093 Bacteria 2168
102 Ga0111539_10075856 3300009094 Bacteria 3960
103 Ga0105243_10000223 3300009148 Bacteria 65335
104 Ga0105241_10020972 3300009174 Bacteria 4829
105 Ga0105248_10057642 3300009177 Bacteria 4360
106 Ga0105237_10016505 3300009545 Bacteria 7671
107 Ga0105237_10089008 3300009545 Bacteria 3077
108 Ga0105237_10181391 3300009545 Bacteria 2105
109 Ga0105238_10000553 3300009551 Bacteria 39106
110 Ga0105238_10001439 3300009551 Bacteria 23916
111 Ga0105238_10027815 3300009551 Bacteria 5762
112 Ga0105238_10047071 3300009551 Bacteria 4350
113 Ga0105238_10143519 3300009551 Bacteria 2364
114 Ga0105238_10303877 3300009551 Bacteria 1579
115 Ga0105249_10133589 3300009553 Bacteria 2372
116 Ga0123341_1001979 3300009765 Bacteria 16294
117 Ga0105239_10012177 3300010375 Bacteria 9590
118 Ga0105239_10029463 3300010375 Bacteria 6035
119 Ga0105239_10136509 3300010375 Bacteria 2731
120 Ga0105239_10255978 3300010375 Bacteria 1967
121 Ga0105246_10133197 3300011119 Bacteria 1859
122 Ga0157373_10028796 3300013100 Bacteria 4005
123 Ga0157373_10127141 3300013100 Bacteria 1792
124 Ga0157371_10000029 3300013102 Bacteria 252131
125 Ga0157371_10067790 3300013102 Bacteria 2525
126 Ga0157370_10003257 3300013104 Bacteria 19131
127 Ga0157370_10159343 3300013104 Bacteria 2100
128 Ga0157369_10004424 3300013105 Bacteria 16590
129 Ga0157369_10137160 3300013105 Bacteria 2589
130 Ga0157374_10141406 3300013296 Bacteria 2336
131 Ga0157378_10379960 3300013297 Bacteria 1387
132 Ga0157372_10001077 3300013307 Bacteria 29756
133 Ga0157372_10087848 3300013307 Bacteria 3529
134 Ga0157372_10251536 3300013307 Bacteria 2051
135 Ga0157375_10122204 3300013308 Bacteria 2715
136 Ga0163163_10015924 3300014325 Bacteria 6966
137 Ga0182008_10012092 3300014497 Bacteria 4565
138 Ga0163161_10012090 3300017792 Bacteria 5987
139 Ga0206354_11549322 3300020081 Bacteria 3713
140 Ga0206353_11308154 3300020082 Bacteria 21393
141 Ga0214542_1018879 3300021321 Bacteria 5657
142 Ga0214543_1000023 3300021327 Bacteria 240412
143 Ga0213873_10000016 3300021358 Bacteria 124829
144 Ga0213876_10000056 3300021384 Bacteria 135017
145 Ga0213876_10002301 3300021384 Bacteria 11275
146 Ga0228711_1000011 3300022739 Bacteria 133208
147 Ga0228711_1001389 3300022739 Bacteria 35374
148 Ga0228710_1000283 3300022740 Bacteria 56899
149 Ga0228710_1000488 3300022740 Bacteria 50439
150 Ga0209563_100066 3300025230 Bacteria 257382
151 Ga0209646_1014694 3300025246 Bacteria 1176
152 Ga0209026_1000005 3300025250 Bacteria 731387
153 Ga0209148_1000011 3300025254 Bacteria 1196503
154 Ga0209148_1000057 3300025254 Bacteria 360463
155 Ga0209759_1000106 3300025256 Bacteria 149959
156 Ga0209233_1000026 3300025261 Bacteria 678466
157 Ga0209233_1000068 3300025261 Bacteria 377969
158 Ga0209455_1000006 3300025272 Bacteria 1196503
159 Ga0209455_1000939 3300025272 Bacteria 14926
160 Ga0209050_1000014 3300025298 Bacteria 774327
161 Ga0209257_1000019 3300025304 Bacteria 774261
162 Ga0209257_1008677 3300025304 Bacteria 5687
163 Ga0209257_1031397 3300025304 Bacteria 1699
164 Ga0207713_1000499 3300025735 Bacteria 40375
165 Ga0207680_10094394 3300025903 Bacteria 1910
166 Ga0207647_10023556 3300025904 Bacteria 4071
167 Ga0207705_10015675 3300025909 Bacteria 5442
168 Ga0207705_10057056 3300025909 Bacteria 2816
169 Ga0207705_10073691 3300025909 Bacteria 2477
170 Ga0207705_10147681 3300025909 Bacteria 1760
171 Ga0207705_10243340 3300025909 Bacteria 1371
172 Ga0207654_10004342 3300025911 Bacteria 7144
173 Ga0207707_10012400 3300025912 Bacteria 7409
174 Ga0207707_10014294 3300025912 Bacteria 6914
175 Ga0207695_10019825 3300025913 Bacteria 7730
176 Ga0207695_10020644 3300025913 Bacteria 7541
177 Ga0207695_10031594 3300025913 Bacteria 5804
178 Ga0207695_10174866 3300025913 Bacteria 2070
179 Ga0207695_10326714 3300025913 Bacteria 1423
180 Ga0207671_10014184 3300025914 Bacteria 6309
181 Ga0207671_10061848 3300025914 Bacteria 2779
182 Ga0207671_10176902 3300025914 Bacteria 1659
183 Ga0207671_10262303 3300025914 Bacteria 1360
184 Ga0207660_10000583 3300025917 Bacteria 24569
185 Ga0207660_10014782 3300025917 Bacteria 5144
186 Ga0207657_10020622 3300025919 Bacteria 6222
187 Ga0207657_10027579 3300025919 Bacteria 5200
188 Ga0207657_10029633 3300025919 Bacteria 4979
189 Ga0207649_10000027 3300025920 Bacteria 161926
190 Ga0207649_10075697 3300025920 Bacteria 2164
191 Ga0207649_10086321 3300025920 Bacteria 2045
192 Ga0207649_10172995 3300025920 Bacteria 1506
193 Ga0207652_10000003 3300025921 Bacteria 502441
194 Ga0207652_10022644 3300025921 Bacteria 5200
195 Ga0207681_10007717 3300025923 Bacteria 6588
196 Ga0207694_10006256 3300025924 Bacteria 9093
197 Ga0207694_10023456 3300025924 Bacteria 4684
198 Ga0207694_10221304 3300025924 Bacteria 1544
199 Ga0207650_10016078 3300025925 Bacteria 5224
200 Ga0207659_10042615 3300025926 Bacteria 3183
201 Ga0207644_10029681 3300025931 Bacteria 3796
202 Ga0207690_10006446 3300025932 Bacteria 6957
203 Ga0207690_10096055 3300025932 Bacteria 2106
204 Ga0207706_10008815 3300025933 Bacteria 9283
205 Ga0207706_10129621 3300025933 Bacteria 2218
206 Ga0207706_10144291 3300025933 Bacteria 2094
207 Ga0207709_10000078 3300025935 Bacteria 169141
208 Ga0207669_10000238 3300025937 Bacteria 24974
209 Ga0207691_10033075 3300025940 Bacteria 4817
210 Ga0207679_10011182 3300025945 Bacteria 5798
211 Ga0207679_10033862 3300025945 Bacteria 3598
212 Ga0207679_10243921 3300025945 Bacteria 1524
213 Ga0207651_10038443 3300025960 Bacteria 3146
214 Ga0207668_10050235 3300025972 Bacteria 2873
215 Ga0207640_10009903 3300025981 Bacteria 5350
216 Ga0207658_10037584 3300025986 Bacteria 3480
217 Ga0207658_10129133 3300025986 Bacteria 2028
218 Ga0207658_10200210 3300025986 Bacteria 1667
219 Ga0207639_10001385 3300026041 Bacteria 16367
220 Ga0207639_10054194 3300026041 Bacteria 3064
221 Ga0207639_10066396 3300026041 Bacteria 2804
222 Ga0207639_10107301 3300026041 Bacteria 2268
223 Ga0207678_10006171 3300026067 Bacteria 10658
224 Ga0207678_10053498 3300026067 Bacteria 3479
225 Ga0207678_10063538 3300026067 Bacteria 3173
226 Ga0207678_10072194 3300026067 Bacteria 2958
227 Ga0207678_10088203 3300026067 Bacteria 2651
228 Ga0207702_10001669 3300026078 Bacteria 21923
229 Ga0207702_10097275 3300026078 Bacteria 2590
230 Ga0207648_10342618 3300026089 Bacteria 1346
231 Ga0207674_10000527 3300026116 Bacteria 50282
232 Ga0207674_10003782 3300026116 Bacteria 18464
233 Ga0207674_10010400 3300026116 Bacteria 10543
234 Ga0207674_10013932 3300026116 Bacteria 8894
235 Ga0207674_10110307 3300026116 Bacteria 2727
236 Ga0207683_10000156 3300026121 Bacteria 57349
237 Ga0207698_10001183 3300026142 Bacteria 15223
238 Ga0207698_10003925 3300026142 Bacteria 9006
239 Ga0207698_10006046 3300026142 Bacteria 7525
240 Ga0207698_10024445 3300026142 Bacteria 4240
241 Ga0207698_10221087 3300026142 Bacteria 1712
242 Ga0209281_1000087 3300027111 Bacteria 246142
243 Ga0209281_1000188 3300027111 Bacteria 141823
244 Ga0209281_1000540 3300027111 Bacteria 47571
245 Ga0209282_1000008 3300027666 Bacteria 248526
246 Ga0209282_1000146 3300027666 Bacteria 41317
247 Ga0268266_10087622 3300028379 Bacteria 2724
248 Ga0268266_10257650 3300028379 Bacteria 1616
249 Ga0268266_10287677 3300028379 Bacteria 1530
250 Ga0268265_10016619 3300028380 Bacteria 5061
251 Ga0265327_10027576 3300031251 Bacteria 3266
252 Ga0307509_10196271 3300031507 Bacteria 1862
253 Ga0307508_10001382 3300031616 Bacteria 27344
254 Ga0265314_10007209 3300031711 Bacteria 9675
255 Ga0307405_10037450 3300031731 Bacteria 2915
256 Ga0307413_10157133 3300031824 Bacteria 1593
257 Ga0307406_10006765 3300031901 Bacteria 6341
258 Ga0307412_10001051 3300031911 Bacteria 15766
259 Ga0315914_1000011 3300031967 Bacteria 170175
260 Ga0315914_1000607 3300031967 Bacteria 47230
261 Ga0307409_100204643 3300031995 Bacteria 1769
262 Ga0307416_100019710 3300032002 Bacteria 4791
263 Ga0307414_10174952 3300032004 Bacteria 1720
264 Ga0307411_10061005 3300032005 Bacteria 2508
265 Ga0307415_100020749 3300032126 Bacteria 4019
266 Ga0315913_1000008 3300033430 Bacteria 155397
267 Ga0315913_1000148 3300033430 Bacteria 47230
268 Ga0315915_1000009 3300033464 Bacteria 252178
269 Ga0315915_1000878 3300033464 Bacteria 33983
270 Ga0395899_0003376 3300037312 Bacteria 12668
271 Ga0395899_0098463 3300037312 Bacteria 2113
272 Ga0395900_0008329 3300037418 Bacteria 10675
273 Ga0395900_0120776 3300037418 Bacteria 2688
274 Ga0395900_0195831 3300037418 Bacteria 2047
275 Ga0395900_0450817 3300037418 Bacteria 1243
276 Ga0395898_0001663 3300037466 Bacteria 29815
277 Ga0395898_0235720 3300037466 Bacteria 1745
278 Ga0395905_0031616 3300037471 Bacteria 4982
279 Ga0395905_0117362 3300037471 Bacteria 2501
280 Ga0395905_0217179 3300037471 Bacteria 1790
281 Ga0436364_0970437 3300037853 Bacteria 1786
282 Ga0395901_0000372 3300038443 Bacteria 53814
283 Ga0395901_0002785 3300038443 Bacteria 17636
284 Ga0395901_0010289 3300038443 Bacteria 9473
285 Ga0395901_0082499 3300038443 Bacteria 3359
286 Ga0395901_0224191 3300038443 Bacteria 1964
287 Ga0395901_0281945 3300038443 Bacteria 1726
288 Ga0436365_0594533 3300039437 Bacteria 37835
289 Ga0436365_1928389 3300039437 Bacteria 11281
290 Ga0436362_0580304 3300039453 Bacteria 124869
291 Ga0439436_0014023 3300041404 Bacteria 2422
292 Ga0439461_0000209 3300041410 Bacteria 8274
293 Ga0439465_0000006 3300041413 Bacteria 54247
294 Ga0439465_0001197 3300041413 Bacteria 8346
295 Ga0439431_0002900 3300041997 Bacteria 3774
296 Ga0439445_0000142 3300042004 Bacteria 12656
297 Ga0439445_0002994 3300042004 Bacteria 3780
298 Ga0439432_000032 3300042006 Bacteria 45434
299 Ga0439457_008018 3300042014 Bacteria 2506
300 Ga0439434_0006903 3300042435 Bacteria 3317
301 Ga0439434_0013465 3300042435 Bacteria 2429
302 Ga0495627_006779 3300046453 Bacteria 4456
303 Ga0495591_001464 3300046458 Bacteria 14612
304 Ga0495638_0000228 3300046460 Bacteria 76924
305 Ga0495605_0003598 3300046474 Bacteria 9188
306 Ga0495585_0004039 3300046492 Bacteria 9662
307 Ga0495585_0015907 3300046492 Bacteria 4365
308 Ga0495607_0071256 3300046501 Bacteria 1938
309 Ga0495583_0008508 3300046506 Bacteria 6261
310 Ga0495606_0000092 3300046507 Bacteria 152369
311 Ga0495606_0004650 3300046507 Bacteria 13575
312 Ga0495606_0065472 3300046507 Bacteria 2309
313 Ga0495610_0000993 3300046512 Bacteria 26157
314 Ga0495620_0011614 3300046515 Bacteria 4586
315 Ga0495643_0032991 3300046522 Bacteria 2869
316 Ga0495648_0000097 3300046524 Bacteria 109887
317 Ga0495663_0002482 3300046525 Bacteria 5551
318 Ga0495654_0061632 3300046530 Bacteria 1800
319 Ga0495640_0177756 3300046533 Bacteria 1358
320 Ga0495609_0013679 3300046538 Bacteria 3829
321 Ga0495597_0069119 3300046542 Bacteria 1525
322 Ga0495668_0075821 3300046616 Bacteria 1847
323 Ga0495611_0008661 3300046648 Bacteria 4305
324 Ga0495625_0000595 3300046660 Bacteria 52588
325 Ga0495625_0006059 3300046660 Bacteria 10852
326 Ga0495625_0012455 3300046660 Bacteria 6892
327 Ga0495625_0029675 3300046660 Bacteria 4087
328 Ga0495625_0111488 3300046660 Bacteria 1869
329 Ga0495625_0177164 3300046660 Bacteria 1420
330 Ga0495635_0256089 3300046663 Bacteria 1179
331 Ga0495588_0031210 3300046674 Bacteria 2681
332 Ga0495669_0077778 3300046684 Bacteria 1519
333 Ga0495670_0000012 3300046691 Bacteria 170426
334 Ga0495670_0043555 3300046691 Bacteria 2240
335 Ga0495671_0009590 3300046692 Bacteria 5404
336 Ga0495649_0004449 3300046694 Bacteria 9157
337 Ga0495649_0019283 3300046694 Bacteria 3833
338 Ga0495600_0022170 3300046809 Bacteria 4075
339 Ga0495660_0003741 3300046810 Bacteria 9340
340 Ga0495604_0017865 3300047317 Bacteria 5674
341 Ga0495683_0004038 3300047323 Bacteria 8425
342 Ga0495687_078529 3300047443 Bacteria 1300
343 Ga0495677_0033158 3300047445 Bacteria 1882
344 Ga0495673_0004461 3300047469 Bacteria 8754
345 Ga0495681_0005906 3300047470 Bacteria 8121
346 Ga0495681_0015144 3300047470 Bacteria 4375
347 Ga0495681_0048345 3300047470 Bacteria 2017
348 Ga0496102_0000316 3300048905 Bacteria 60628
349 Ga0496103_0002263 3300048906 Bacteria 12170
350 Ga0496104_0003225 3300048907 Bacteria 14039
351 Ga0496106_0078020 3300048909 Bacteria 2541
352 Ga0496107_0035157 3300048910 Bacteria 3592
353 Ga0496107_0078254 3300048910 Bacteria 2409
354 Ga0496108_0000667 3300048911 Bacteria 26467
355 Ga0496108_0034127 3300048911 Bacteria 4227
356 Ga0496110_0028096 3300048913 Bacteria 4828
357 Ga0496110_0072177 3300048913 Bacteria 3062
358 Ga0496111_0045357 3300048914 Bacteria 3162
359 Ga0496111_0092344 3300048914 Bacteria 2219
360 Ga0496112_0198437 3300048915 Bacteria 1967
361 Ga0496113_0020775 3300048916 Bacteria 4623
362 Ga0496114_0006408 3300048917 Bacteria 9269
363 Ga0496114_0031109 3300048917 Bacteria 4391
364 Ga0496115_0000229 3300048918 Bacteria 51160
365 Ga0496116_0001542 3300048919 Bacteria 25521
366 Ga0496117_0000142 3300048920 Bacteria 157953
367 Ga0496118_0000115 3300048921 Bacteria 146533
368 Ga0496118_0063461 3300048921 Bacteria 2718
369 Ga0496119_0007297 3300048922 Bacteria 10001
370 Ga0496120_0024786 3300048923 Bacteria 3734
371 Ga0496120_0026517 3300048923 Bacteria 3577
372 Ga0496120_0063620 3300048923 Bacteria 2051
373 Ga0496121_0000193 3300048924 Bacteria 136526
374 Ga0496122_0006078 3300048925 Bacteria 14069
375 Ga0496122_0006225 3300048925 Bacteria 13819
376 Ga0496122_0009761 3300048925 Bacteria 10026
377 Ga0496122_0097595 3300048925 Bacteria 1977
378 Ga0496123_0017711 3300048926 Bacteria 5713
379 Ga0496123_0059999 3300048926 Bacteria 2455
380 Ga0496124_0000146 3300048927 Bacteria 146468
381 Ga0496124_0007021 3300048927 Bacteria 12067
382 Ga0496125_0000463 3300048928 Bacteria 72745
383 Ga0496125_0000986 3300048928 Bacteria 44353
384 Ga0496125_0001751 3300048928 Bacteria 30112
385 Ga0496125_0002760 3300048928 Bacteria 22221
386 Ga0496125_0068897 3300048928 Bacteria 2780
387 Ga0496126_0000174 3300048929 Bacteria 146468
388 Ga0496126_0020377 3300048929 Bacteria 6503
389 Ga0496126_0197159 3300048929 Bacteria 1702
390 Ga0501031_0000015 3300049568 Bacteria 113809
391 Ga0501031_0183532 3300049568 Bacteria 1366
392 Ga0501032_0000008 3300049569 Bacteria 240313
393 Ga0501032_0010277 3300049569 Bacteria 6753
394 Ga0501032_0086080 3300049569 Bacteria 2089
395 Ga0501032_0145849 3300049569 Bacteria 1558
396 Ga0501033_0000012 3300049570 Bacteria 241599
397 Ga0501033_0003186 3300049570 Bacteria 13610
398 Ga0501033_0017715 3300049570 Bacteria 5380
399 Ga0501033_0030491 3300049570 Bacteria 4053
400 Ga0501033_0035397 3300049570 Bacteria 3743
401 Ga0501033_0128961 3300049570 Bacteria 1833
402 Ga0501034_0000035 3300049571 Bacteria 241623
403 Ga0501034_0080406 3300049571 Bacteria 3262
404 Ga0501036_0000006 3300049572 Bacteria 241623
405 Ga0501036_0019824 3300049572 Bacteria 5647
406 Ga0501036_0039993 3300049572 Bacteria 3966
407 Ga0501036_0132851 3300049572 Bacteria 2100
408 Ga0501036_0251631 3300049572 Bacteria 1481
409 Ga0501037_0000123 3300049573 Bacteria 72229
410 Ga0501037_0001036 3300049573 Bacteria 20557
411 Ga0501037_0038301 3300049573 Bacteria 3533
412 Ga0501037_0154800 3300049573 Bacteria 1636
413 Ga0501038_0000007 3300049574 Bacteria 210775
414 Ga0501038_0060779 3300049574 Bacteria 3233
415 Ga0501038_0162396 3300049574 Bacteria 1814
416 Ga0501038_0212349 3300049574 Bacteria 1547
417 Ga0501039_0000012 3300049575 Bacteria 241623
418 Ga0501039_0171728 3300049575 Bacteria 1704
419 Ga0501043_0000022 3300049579 Bacteria 154467
420 Ga0501043_0000721 3300049579 Bacteria 29311
421 Ga0501043_0038486 3300049579 Bacteria 3760
422 Ga0501043_0068498 3300049579 Bacteria 2786
423 Ga0501043_0109654 3300049579 Bacteria 2167
424 Ga0501046_0070073 3300049580 Bacteria 2727
425 Ga0501047_0015479 3300049581 Bacteria 7268
426 Ga0501047_0031523 3300049581 Bacteria 5112
427 Ga0501047_0042916 3300049581 Bacteria 4369
428 Ga0501047_0102975 3300049581 Bacteria 2734
429 Ga0501047_0166749 3300049581 Bacteria 2073
430 Ga0501047_0172851 3300049581 Bacteria 2029
431 Ga0501068_0006056 3300049584 Bacteria 6648
432 Ga0501069_0000035 3300049585 Bacteria 88215
433 Ga0501069_0023685 3300049585 Bacteria 3347
434 Ga0501070_0000295 3300049586 Bacteria 46538
435 Ga0501070_0013018 3300049586 Bacteria 7010
436 Ga0501070_0041426 3300049586 Bacteria 3837
437 Ga0501070_0099596 3300049586 Bacteria 2405
438 Ga0501070_0224047 3300049586 Bacteria 1542
439 Ga0501070_0434643 3300049586 Bacteria 1059
440 Ga0501071_0019898 3300049587 Bacteria 4662
441 Ga0501074_0000714 3300049590 Bacteria 20800
442 Ga0501074_0009731 3300049590 Bacteria 6980
443 Ga0501080_0000395 3300049742 Bacteria 33650
444 Ga0501080_0044488 3300049742 Bacteria 4133
445 Ga0501080_0062876 3300049742 Bacteria 3455
446 Ga0501080_0064651 3300049742 Bacteria 3403
447 Ga0501080_0130576 3300049742 Bacteria 2326
448 Ga0501080_0134478 3300049742 Bacteria 2289
449 Ga0501080_0159357 3300049742 Bacteria 2085
450 Ga0501083_0000104 3300049744 Bacteria 57084
451 Ga0501035_0000035 3300049822 Bacteria 166916
452 Ga0501035_0000139 3300049822 Bacteria 88322
453 Ga0501035_0009219 3300049822 Bacteria 9176
454 Ga0501035_0018313 3300049822 Bacteria 6452
455 Ga0501035_0041654 3300049822 Bacteria 4146
456 Ga0501035_0077359 3300049822 Bacteria 2940
457 Ga0501035_0171302 3300049822 Bacteria 1875
458 Ga0501035_0258739 3300049822 Bacteria 1476
459 Ga0501044_0000015 3300049823 Bacteria 241623
460 Ga0501044_0000315 3300049823 Bacteria 61159
461 Ga0501044_0000433 3300049823 Bacteria 51535
462 Ga0501044_0012206 3300049823 Bacteria 9299
463 Ga0501044_0025938 3300049823 Bacteria 6210
464 Ga0501044_0063336 3300049823 Bacteria 3778
465 Ga0501044_0118783 3300049823 Bacteria 2646
466 Ga0501044_0143043 3300049823 Bacteria 2379
467 Ga0501044_0396793 3300049823 Bacteria 1293
468 nmdc:mga0yw44_11399_c1 3300050492 Bacteria 4586
469 nmdc:mga0yw44_17437_c1 3300050492 Bacteria 3907
470 nmdc:mga0yw44_204118_c1 3300050492 Bacteria 1306
471 nmdc:mga0yw44_6415_c1 3300050492 Bacteria 5682
472 nmdc:mga0k408_46564_c1 3300050493 Bacteria 2505
473 nmdc:mga08y16_199150_c1 3300050511 Bacteria 2076
474 nmdc:mga0n895_267723_c1 3300050512 Bacteria 1733
475 Ga0495601_0086059 3300053077 Bacteria 2020
476 Ga0500610_0016204 3300053079 Bacteria 3546
477 Ga0500566_0000637 3300053094 Bacteria 19566
478 Ga0500654_089088 3300053099 Bacteria 1387
479 Ga0500593_000549 3300053117 Bacteria 14569
480 Ga0500607_067589 3300053121 Bacteria 1852
481 Ga0500642_0001338 3300053130 Bacteria 7047
482 Ga0500658_0000474 3300053134 Bacteria 17136
483 Ga0500658_0001895 3300053134 Bacteria 8205
484 Ga0500658_0005949 3300053134 Bacteria 4536
485 Ga0500559_0023986 3300053136 Bacteria 2592
486 Ga0500568_0000005 3300053139 Bacteria 614296
487 Ga0500590_000026 3300053148 Bacteria 36766
488 Ga0500620_000185 3300053155 Bacteria 12781
489 Ga0500634_0000009 3300053161 Bacteria 144333
490 Ga0500645_000975 3300053730 Bacteria 16250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2871444079 2871448039 281
2 3300049590 Ga0501074_0009731 Ga0501074_0009731_5995_6969 310
3 3300049822 Ga0501035_0171302 Ga0501035_0171302_878_1858 321
4 3300053134 Ga0500658_0000474 Ga0500658_0000474_1378_2343 321
5 3300049586 Ga0501070_0434643 Ga0501070_0434643_47_1036 324
6 3300053161 Ga0500634_0000009 Ga0500634_0000009_56361_57356 329
7 iso_pu_bacteria 2885334103 2885334356 329
8 3300046663 Ga0495635_0256089 Ga0495635_0256089_150_1166 331
9 3300047470 Ga0495681_0005906 Ga0495681_0005906_966_1961 331
10 3300053077 Ga0495601_0086059 Ga0495601_0086059_983_1999 331
11 iso_pu_bacteria 2937980651 2937983893 331
12 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007399 333
13 3300009551 Ga0105238_10143519 Ga0105238_101435192 333
14 3300025261 Ga0209233_1000026 Ga0209233_1000026398 333
15 3300025913 Ga0207695_10019825 Ga0207695_100198252 333
16 3300025913 Ga0207695_10031594 Ga0207695_100315947 333
17 3300025924 Ga0207694_10221304 Ga0207694_102213042 333
18 3300009174 Ga0105241_10020972 Ga0105241_100209722 335
19 3300010375 Ga0105239_10136509 Ga0105239_101365092 335
20 3300013102 Ga0157371_10000029 Ga0157371_10000029204 335
21 3300013105 Ga0157369_10137160 Ga0157369_101371602 335
22 3300031507 Ga0307509_10196271 Ga0307509_101962712 335
23 3300031616 Ga0307508_10001382 Ga0307508_100013828 335
24 3300046460 Ga0495638_0000228 Ga0495638_0000228_48869_49963 335
25 3300046660 Ga0495625_0177164 Ga0495625_0177164_100_1194 335
26 3300053134 Ga0500658_0001895 Ga0500658_0001895_6583_7677 335
27 3300005339 Ga0070660_100033802 Ga0070660_1000338022 336
28 3300005539 Ga0068853_100000154 Ga0068853_10000015433 336
29 3300005577 Ga0068857_100026804 Ga0068857_1000268043 336
30 3300009093 Ga0105240_10179728 Ga0105240_101797282 336
31 3300009551 Ga0105238_10000553 Ga0105238_1000055322 336
32 3300013104 Ga0157370_10003257 Ga0157370_1000325716 336
33 3300013105 Ga0157369_10004424 Ga0157369_100044243 336
34 3300013307 Ga0157372_10001077 Ga0157372_1000107714 336
35 3300025919 Ga0207657_10029633 Ga0207657_100296332 336
36 3300026041 Ga0207639_10001385 Ga0207639_100013853 336
37 3300026116 Ga0207674_10010400 Ga0207674_100104003 336
38 iso_pu_bacteria 2906378014 2906382619 336
39 iso_pu_bacteria 2924710171 2924714831 340
40 3300009551 Ga0105238_10027815 Ga0105238_100278152 341
41 3300025924 Ga0207694_10023456 Ga0207694_100234562 341
42 3300037418 Ga0395900_0450817 Ga0395900_0450817_169_1197 341
43 iso_pu_bacteria 2961127735 2961135545 341
44 3300013307 Ga0157372_10251536 Ga0157372_102515363 344
45 3300053099 Ga0500654_089088 Ga0500654_089088_150_1214 344
46 iso_pu_bacteria 2643221623 2644131440 344
47 iso_pu_bacteria 2889914905 2889918471 344
48 3300037853 Ga0436364_0970437 Ga0436364_0970437_689_1735 345
49 iso_pu_bacteria 2837678835 2837680696 345
50 iso_pu_bacteria 2508501122 2509109320 346
51 iso_pu_bacteria 2509276018 2509370922 346
52 iso_pu_bacteria 2509276019 2509377813 346
53 iso_pu_bacteria 2509276022 2509397963 346
54 iso_pu_bacteria 2510065057 2510303851 346
55 iso_pu_bacteria 2510065059 2510316533 346
56 iso_pu_bacteria 2511231027 2511389226 346
57 iso_pu_bacteria 2511231052 2511498025 346
58 iso_pu_bacteria 2512047086 2512529182 346
59 iso_pu_bacteria 2512875016 2512929566 346
60 iso_pu_bacteria 2512875024 2512964354 346
61 iso_pu_bacteria 2513237086 2513583789 346
62 iso_pu_bacteria 2513237089 2513604899 346
63 iso_pu_bacteria 2513237091 2513617312 346
64 iso_pu_bacteria 2513237156 2513983747 346
65 iso_pu_bacteria 2513237160 2514006609 346
66 iso_pu_bacteria 2516653046 2516896330 346
67 iso_pu_bacteria 2517487022 2517565775 346
68 iso_pu_bacteria 2551306084 2551676191 346
69 iso_pu_bacteria 2551306085 2551685658 346
70 iso_pu_bacteria 2551306086 2551695185 346
71 iso_pu_bacteria 2551306087 2551698456 346
72 iso_pu_bacteria 2558860100 2558860819 346
73 iso_pu_bacteria 2582581283 2585168645 346
74 iso_pu_bacteria 2582581306 2585270477 346
75 iso_pu_bacteria 2582581865 2585386315 346
76 iso_pu_bacteria 2588253730 2588515137 346
77 iso_pu_bacteria 2643221564 2643839897 346
78 iso_pu_bacteria 2643221595 2643989084 346
79 iso_pu_bacteria 2643221607 2644049894 346
80 iso_pu_bacteria 2643221627 2644152270 346
81 iso_pu_bacteria 2643221636 2644203320 346
82 iso_pu_bacteria 2643221686 2644485132 346
83 iso_pu_bacteria 2643221689 2644497670 346
84 iso_pu_bacteria 2687453392 2688600368 346
85 iso_pu_bacteria 2756170246 2756673068 346
86 iso_pu_bacteria 2791355123 2792753164 346
87 iso_pu_bacteria 2802428858 2802720566 346
88 iso_pu_bacteria 2802428859 2802726661 346
89 iso_pu_bacteria 2802428860 2802732595 346
90 iso_pu_bacteria 2802428861 2802739716 346
91 iso_pu_bacteria 2802428862 2802746077 346
92 iso_pu_bacteria 2802428863 2802748807 346
93 iso_pu_bacteria 2838074704 2838078978 346
94 iso_pu_bacteria 2841734538 2841734989 346
95 iso_pu_bacteria 2842871566 2842873166 346
96 iso_pu_bacteria 2844002411 2844005518 346
97 iso_pu_bacteria 2844009547 2844015684 346
98 iso_pu_bacteria 2850079185 2850085070 346
99 iso_pu_bacteria 2855825444 2855828844 346
100 iso_pu_bacteria 2855839649 2855843968 346
101 iso_pu_bacteria 2856314179 2856318210 346
102 iso_pu_bacteria 2856328259 2856328663 346
103 iso_pu_bacteria 2856334872 2856337462 346
104 iso_pu_bacteria 2857367948 2857368453 346
105 iso_pu_bacteria 2858800743 2858806789 346
106 iso_pu_bacteria 2869162929 2869168737 346
107 iso_pu_bacteria 2869169390 2869173539 346
108 iso_pu_bacteria 2869234852 2869241231 346
109 iso_pu_bacteria 2869242130 2869246481 346
110 iso_pu_bacteria 2869249662 2869249783 346
111 iso_pu_bacteria 2869256925 2869259390 346
112 iso_pu_bacteria 2869264136 2869270515 346
113 iso_pu_bacteria 2869271264 2869278563 346
114 iso_pu_bacteria 2871451962 2871456867 346
115 iso_pu_bacteria 2871459585 2871466023 346
116 iso_pu_bacteria 2871466892 2871470102 346
117 iso_pu_bacteria 2871474448 2871478144 346
118 iso_pu_bacteria 2871481445 2871487513 346
119 iso_pu_bacteria 2874109183 2874113160 346
120 iso_pu_bacteria 2874116593 2874123149 346
121 iso_pu_bacteria 2874131515 2874135858 346
122 iso_pu_bacteria 2874162495 2874166630 346
123 iso_pu_bacteria 2874168670 2874174227 346
124 iso_pu_bacteria 2876363079 2876366874 346
125 iso_pu_bacteria 2876386047 2876387399 346
126 iso_pu_bacteria 2876399893 2876403986 346
127 iso_pu_bacteria 2876406927 2876413914 346
128 iso_pu_bacteria 2876420981 2876422789 346
129 iso_pu_bacteria 2878035449 2878037522 346
130 iso_pu_bacteria 2878738818 2878744309 346
131 iso_pu_bacteria 2878774303 2878780609 346
132 iso_pu_bacteria 2878781027 2878782439 346
133 iso_pu_bacteria 2878788777 2878792792 346
134 iso_pu_bacteria 2881155292 2881157678 346
135 iso_pu_bacteria 2881853255 2881855869 346
136 iso_pu_bacteria 2882632389 2882636918 346
137 iso_pu_bacteria 2885305155 2885311994 346
138 iso_pu_bacteria 2885342637 2885347755 346
139 iso_pu_bacteria 2885350715 2885352264 346
140 iso_pu_bacteria 2888337043 2888341749 346
141 iso_pu_bacteria 2889790730 2889792011 346
142 iso_pu_bacteria 2896384573 2896386280 346
143 iso_pu_bacteria 2903448605 2903453661 346
144 iso_pu_bacteria 2903513507 2903519314 346
145 iso_pu_bacteria 2903521522 2903524741 346
146 iso_pu_bacteria 2903528002 2903531016 346
147 iso_pu_bacteria 2906363423 2906369111 346
148 iso_pu_bacteria 2906393657 2906397201 346
149 iso_pu_bacteria 2906401398 2906401845 346
150 iso_pu_bacteria 2906408224 2906409951 346
151 iso_pu_bacteria 2906414383 2906418247 346
152 iso_pu_bacteria 2906427513 2906434716 346
153 iso_pu_bacteria 2915980308 2915981951 346
154 iso_pu_bacteria 2915986958 2915993483 346
155 iso_pu_bacteria 2915993759 2915994623 346
156 iso_pu_bacteria 2916000859 2916007172 346
157 iso_pu_bacteria 2916007675 2916010258 346
158 iso_pu_bacteria 2916014648 2916016174 346
159 iso_pu_bacteria 2916021584 2916022823 346
160 iso_pu_bacteria 2916035215 2916036156 346
161 iso_pu_bacteria 2916041962 2916044413 346
162 iso_pu_bacteria 2916061851 2916064398 346
163 iso_pu_bacteria 2916068649 2916068995 346
164 iso_pu_bacteria 2916076590 2916081740 346
165 iso_pu_bacteria 2920760137 2920762013 346
166 iso_pu_bacteria 2921201388 2921203398 346
167 iso_pu_bacteria 2921208531 2921210529 346
168 iso_pu_bacteria 2921237296 2921238649 346
169 iso_pu_bacteria 2921244191 2921245491 346
170 iso_pu_bacteria 2921250672 2921251912 346
171 iso_pu_bacteria 2921257292 2921262301 346
172 iso_pu_bacteria 2921282425 2921282491 346
173 iso_pu_bacteria 2921289301 2921289357 346
174 iso_pu_bacteria 2922151315 2922153513 346
175 iso_pu_bacteria 2922172374 2922178113 346
176 iso_pu_bacteria 2922178524 2922184345 346
177 iso_pu_bacteria 2924144063 2924145863 346
178 iso_pu_bacteria 2924150972 2924152607 346
179 iso_pu_bacteria 2924165586 2924170141 346
180 iso_pu_bacteria 2924179722 2924182129 346
181 iso_pu_bacteria 2924186466 2924190632 346
182 iso_pu_bacteria 2924193448 2924199483 346
183 iso_pu_bacteria 2924200457 2924205154 346
184 iso_pu_bacteria 2924207177 2924208348 346
185 iso_pu_bacteria 2924214083 2924215837 346
186 iso_pu_bacteria 2924221636 2924225372 346
187 iso_pu_bacteria 2924228884 2924229195 346
188 iso_pu_bacteria 2924718760 2924719299 346
189 iso_pu_bacteria 2924733363 2924736065 346
190 iso_pu_bacteria 2924741084 2924742130 346
191 iso_pu_bacteria 2924748358 2924753069 346
192 iso_pu_bacteria 2924762789 2924764377 346
193 iso_pu_bacteria 2924776078 2924782227 346
194 iso_pu_bacteria 2937002841 2937007161 346
195 iso_pu_bacteria 2937009748 2937015865 346
196 iso_pu_bacteria 2937016420 2937022668 346
197 iso_pu_bacteria 2937023124 2937024186 346
198 iso_pu_bacteria 2937029754 2937031508 346
199 iso_pu_bacteria 2937036028 2937037368 346
200 iso_pu_bacteria 2937049772 2937053012 346
201 iso_pu_bacteria 2937056579 2937062749 346
202 iso_pu_bacteria 2937063883 2937066661 346
203 iso_pu_bacteria 2937071275 2937072112 346
204 iso_pu_bacteria 2937078374 2937083554 346
205 iso_pu_bacteria 2937084907 2937091690 346
206 iso_pu_bacteria 2937091812 2937098674 346
207 iso_pu_bacteria 2937106411 2937107866 346
208 iso_pu_bacteria 2937113482 2937114380 346
209 iso_pu_bacteria 2937119839 2937122766 346
210 iso_pu_bacteria 2937126314 2937132176 346
211 iso_pu_bacteria 2937822353 2937828439 346
212 iso_pu_bacteria 2937836603 2937838592 346
213 iso_pu_bacteria 2937868953 2937874433 346
214 iso_pu_bacteria 2957375807 2957379290 346
215 iso_pu_bacteria 2957388812 2957390411 346
216 iso_pu_bacteria 2957395598 2957401117 346
217 iso_pu_bacteria 2957408893 2957409755 346
218 iso_pu_bacteria 2957415311 2957420624 346
219 iso_pu_bacteria 2957422303 2957425792 346
220 iso_pu_bacteria 2957437181 2957438443 346
221 iso_pu_bacteria 2957443900 2957448820 346
222 iso_pu_bacteria 2957450854 2957452032 346
223 iso_pu_bacteria 2957457609 2957462923 346
224 iso_pu_bacteria 2957464669 2957467422 346
225 iso_pu_bacteria 2957471148 2957477756 346
226 iso_pu_bacteria 2957484790 2957488117 346
227 iso_pu_bacteria 2957491536 2957497505 346
228 iso_pu_bacteria 2957498199 2957501545 346
229 iso_pu_bacteria 2957505466 2957511114 346
230 iso_pu_bacteria 2958064165 2958066168 346
231 iso_pu_bacteria 2958071322 2958074576 346
232 iso_pu_bacteria 2958108152 2958114939 346
233 iso_pu_bacteria 2958122699 2958125946 346
234 iso_pu_bacteria 2958158011 2958158830 346
235 iso_pu_bacteria 2960584000 2960589982 346
236 iso_pu_bacteria 2960591022 2960594498 346
237 iso_pu_bacteria 2960597568 2960598603 346
238 iso_pu_bacteria 2960610863 2960615458 346
239 iso_pu_bacteria 2960617483 2960622938 346
240 iso_pu_bacteria 2960624210 2960630433 346
241 iso_pu_bacteria 2960631154 2960632396 346
242 iso_pu_bacteria 2960637947 2960641912 346
243 iso_pu_bacteria 2960645483 2960648217 346
244 iso_pu_bacteria 2960652885 2960657965 346
245 iso_pu_bacteria 2960660292 2960664642 346
246 iso_pu_bacteria 2960667422 2960667806 346
247 iso_pu_bacteria 2960674078 2960678203 346
248 iso_pu_bacteria 2960680706 2960682016 346
249 iso_pu_bacteria 2960687367 2960693853 346
250 iso_pu_bacteria 2960693952 2960697965 346
251 iso_pu_bacteria 2961136820 2961144598 346
252 iso_pu_bacteria 2961183825 2961190488 346
253 iso_pu_bacteria 2963644680 2963649667 346
254 iso_pu_bacteria 2964607997 2964613290 346
255 iso_pu_bacteria 2964615318 2964615936 346
256 iso_pu_bacteria 2964621998 2964627491 346
257 iso_pu_bacteria 2964643177 2964648442 346
258 iso_pu_bacteria 2964649959 2964656056 346
259 iso_pu_bacteria 2964656573 2964659165 346
260 iso_pu_bacteria 2964663802 2964670631 346
261 iso_pu_bacteria 2964670856 2964673707 346
262 iso_pu_bacteria 2964678106 2964684894 346
263 iso_pu_bacteria 2964685014 2964688399 346
264 iso_pu_bacteria 2964691889 2964697957 346
265 iso_pu_bacteria 2964698721 2964703951 346
266 iso_pu_bacteria 2964705432 2964709490 346
267 iso_pu_bacteria 2964712639 2964714285 346
268 iso_pu_bacteria 2964719344 2964724552 346
269 iso_pu_bacteria 2965025482 2965026284 346
270 iso_pu_bacteria 2965032056 2965036927 346
271 iso_pu_bacteria 2965040258 2965040453 346
272 iso_pu_bacteria 2965047637 2965048277 346
273 iso_pu_bacteria 2965089291 2965089492 346
274 iso_pu_bacteria 2965102966 2965106434 346
275 iso_pu_bacteria 2967664464 2967666862 346
276 iso_pu_bacteria 2967671571 2967674063 346
277 iso_pu_bacteria 2967686174 2967692736 346
278 iso_pu_bacteria 2967693043 2967693742 346
279 iso_pu_bacteria 2967699805 2967705174 346
280 iso_pu_bacteria 2967706974 2967710980 346
281 iso_pu_bacteria 2967714385 2967715521 346
282 iso_pu_bacteria 2967728569 2967732291 346
283 iso_pu_bacteria 2967735183 2967736087 346
284 iso_pu_bacteria 2967742019 2967747095 346
285 iso_pu_bacteria 2967755722 2967762123 346
286 iso_pu_bacteria 2967762386 2967768280 346
287 iso_pu_bacteria 2967769361 2967775422 346
288 iso_pu_bacteria 2968083720 2968087025 346
289 iso_pu_bacteria 2968138860 2968140204 346
290 iso_pu_bacteria 2970019648 2970022953 346
291 iso_pu_bacteria 2970026789 2970031264 346
292 iso_pu_bacteria 2970033650 2970037940 346
293 iso_pu_bacteria 2970040964 2970042061 346
294 iso_pu_bacteria 2970047711 2970053226 346
295 iso_pu_bacteria 2970054988 2970055448 346
296 iso_pu_bacteria 2970061556 2970062196 346
297 iso_pu_bacteria 2970068827 2970071650 346
298 iso_pu_bacteria 2970076120 2970080646 346
299 iso_pu_bacteria 2970082768 2970088706 346
300 iso_pu_bacteria 2970088815 2970092303 346
301 iso_pu_bacteria 2970095765 2970100480 346
302 iso_pu_bacteria 2970102677 2970103580 346
303 iso_pu_bacteria 2970109326 2970114674 346
304 iso_pu_bacteria 2970116247 2970116577 346
305 iso_pu_bacteria 2970122695 2970127139 346
306 iso_pu_bacteria 2970129317 2970130541 346
307 iso_pu_bacteria 2970136068 2970138504 346
308 iso_pu_bacteria 2970143518 2970145965 346
309 iso_pu_bacteria 2970149975 2970155132 346
310 iso_pu_bacteria 2970156795 2970157345 346
311 iso_pu_bacteria 2970164137 2970165786 346
312 iso_pu_bacteria 2970170962 2970177581 346
313 iso_pu_bacteria 2970177841 2970180359 346
314 iso_pu_bacteria 2970184632 2970186045 346
315 iso_pu_bacteria 2970191845 2970192129 346
316 iso_pu_bacteria 2970489779 2970494690 346
317 iso_pu_bacteria 2970510686 2970514550 346
318 iso_pu_bacteria 2970524798 2970529197 346
319 iso_pu_bacteria 2970547951 2970550692 346
320 iso_pu_bacteria 2970619444 2970621262 346
321 iso_pu_bacteria 2970627176 2970628184 346
322 iso_pu_bacteria 2977516862 2977518110 346
323 iso_pu_bacteria 2977523885 2977528307 346
324 iso_pu_bacteria 2977530762 2977536743 346
325 iso_pu_bacteria 2977537788 2977538917 346
326 iso_pu_bacteria 2977544691 2977551565 346
327 iso_pu_bacteria 2977558990 2977561928 346
328 iso_pu_bacteria 2977572785 2977579352 346
329 iso_pu_bacteria 2977579622 2977580894 346
330 iso_pu_bacteria 2977851361 2977852668 346
331 iso_pu_bacteria 2977872689 2977874953 346
332 iso_pu_bacteria 2977898635 2977903801 346
333 iso_pu_bacteria 2977907340 2977913656 346
334 iso_pu_bacteria 2977915119 2977918054 346
335 iso_pu_bacteria 2977935797 2977940452 346
336 iso_pu_bacteria 2977950692 2977955961 346
337 iso_pu_bacteria 2977957713 2977959071 346
338 iso_pu_bacteria 2977986579 2977989348 346
339 iso_pu_bacteria 2979764755 2979768903 346
340 iso_pu_bacteria 2979772303 2979776370 346
341 iso_pu_bacteria 2987645492 2987646441 346
342 iso_pu_bacteria 2987666974 2987672777 346
343 iso_pu_bacteria 2987673487 2987680181 346
344 iso_pu_bacteria 2996386984 2996391928 346
345 iso_pu_bacteria 3000135777 3000142102 346
346 iso_pu_bacteria 3004167301 3004171170 346
347 iso_pu_bacteria 3004195979 3004200719 346
348 iso_pu_bacteria 3004211236 3004213917 346
349 iso_pu_bacteria 3004218560 3004223508 346
350 iso_pu_bacteria 3004232784 3004233180 346
351 iso_pu_bacteria 3004239961 3004245905 346
352 iso_pu_bacteria 3004248173 3004250726 346
353 iso_pu_bacteria 3004268573 3004273246 346
354 iso_pu_bacteria 3004334049 3004339133 346
355 iso_pu_bacteria 637000159 637079314 346
356 iso_pu_bacteria 648276728 648737578 346
357 iso_pu_bacteria 649633066 649874829 346
358 iso_pu_bacteria 8003992118 8003996540 346
359 iso_pu_bacteria 8003999396 8004004258 346
360 iso_pu_bacteria 8004300914 8004305031 346
361 iso_pu_bacteria 8004312739 8004314069 346
362 iso_pu_bacteria 8004361976 8004362678 346
363 iso_pu_bacteria 8004633249 8004635863 346
364 iso_pu_bacteria 8004695233 8004700801 346
365 iso_pu_bacteria 8004727605 8004734554 346
366 iso_pu_bacteria 2511231022 2511360594 347
367 iso_pu_bacteria 2511231023 2511370031 347
368 iso_pu_bacteria 2513237305 2514422879 347
369 iso_pu_bacteria 2517487022 2517565859 347
370 iso_pu_bacteria 2657244999 2657686231 347
371 iso_pu_bacteria 2721755686 2723577664 347
372 iso_pu_bacteria 2751185800 2753357641 347
373 iso_pu_bacteria 2758568016 2758639848 347
374 iso_pu_bacteria 2765235802 2765465093 347
375 iso_pu_bacteria 2767802442 2770196459 347
376 iso_pu_bacteria 2775506902 2776267522 347
377 iso_pu_bacteria 2775506904 2776283168 347
378 iso_pu_bacteria 2802428863 2802752522 347
379 iso_pu_bacteria 2802429268 2804755072 347
380 iso_pu_bacteria 2826581358 2826582876 347
381 iso_pu_bacteria 2837651117 2837652426 347
382 iso_pu_bacteria 2838074704 2838078529 347
383 iso_pu_bacteria 2839993093 2839993565 347
384 iso_pu_bacteria 2840764183 2840764460 347
385 iso_pu_bacteria 2842815866 2842820863 347
386 iso_pu_bacteria 2842849001 2842851434 347
387 iso_pu_bacteria 2854911287 2854914462 347
388 iso_pu_bacteria 2856364286 2856364893 347
389 iso_pu_bacteria 2857349434 2857354851 347
390 iso_pu_bacteria 2869285874 2869289658 347
391 iso_pu_bacteria 2871429161 2871431724 347
392 iso_pu_bacteria 2874146452 2874155402 347
393 iso_pu_bacteria 2874155637 2874162259 347
394 iso_pu_bacteria 2876369609 2876377162 347
395 iso_pu_bacteria 2876392853 2876398841 347
396 iso_pu_bacteria 2876413966 2876420747 347
397 iso_pu_bacteria 2878745973 2878748330 347
398 iso_pu_bacteria 2881147464 2881154934 347
399 iso_pu_bacteria 2881161766 2881163054 347
400 iso_pu_bacteria 2889010040 2889013236 347
401 iso_pu_bacteria 2894652903 2894653175 347
402 iso_pu_bacteria 2896384573 2896389371 347
403 iso_pu_bacteria 2903492973 2903506007 347
404 iso_pu_bacteria 2904578770 2904579761 347
405 iso_pu_bacteria 2904659560 2904665373 347
406 iso_pu_bacteria 2906308376 2906311947 347
407 iso_pu_bacteria 2915650412 2915651353 347
408 iso_pu_bacteria 2916061851 2916068145 347
409 iso_pu_bacteria 2919063839 2919067582 347
410 iso_pu_bacteria 2919119836 2919120571 347
411 iso_pu_bacteria 2928521798 2928525086 347
412 iso_pu_bacteria 2937813078 2937818230 347
413 iso_pu_bacteria 2957375807 2957379375 347
414 iso_pu_bacteria 2958130278 2958134031 347
415 iso_pu_bacteria 2958179912 2958183677 347
416 iso_pu_bacteria 2960631154 2960635284 347
417 iso_pu_bacteria 2961077736 2961081643 347
418 iso_pu_bacteria 2961114664 2961120373 347
419 iso_pu_bacteria 2968091066 2968095678 347
420 iso_pu_bacteria 2968110612 2968116840 347
421 iso_pu_bacteria 2968117919 2968118565 347
422 iso_pu_bacteria 2977843712 2977851326 347
423 iso_pu_bacteria 2977942078 2977946634 347
424 iso_pu_bacteria 2987636660 2987643453 347
425 iso_pu_bacteria 2987652177 2987653000 347
426 iso_pu_bacteria 2989771324 2989774653 347
427 iso_pu_bacteria 2996310559 2996311644 347
428 iso_pu_bacteria 2996336353 2996340087 347
429 iso_pu_bacteria 3002141150 3002142752 347
430 iso_pu_bacteria 3003930520 3003935817 347
431 iso_pu_bacteria 3004203850 3004206998 347
432 iso_pu_bacteria 8004387939 8004391536 347
433 iso_pu_bacteria 8004714634 8004716905 347
434 iso_pu_bacteria 8024486573 8024487632 347
435 3300025972 Ga0207668_10050235 Ga0207668_100502353 348
436 3300026067 Ga0207678_10072194 Ga0207678_100721942 348
437 iso_pu_bacteria 2643221622 2644126120 348
438 iso_pu_bacteria 2643221637 2644210899 348
439 iso_pu_bacteria 2643221718 2644654433 348
440 iso_pu_bacteria 2937843397 2937845494 348
441 3300005293 Ga0065715_10099558 Ga0065715_100995583 349
442 3300005367 Ga0070667_100099362 Ga0070667_1000993623 349
443 3300005543 Ga0070672_100143992 Ga0070672_1001439922 349
444 3300005616 Ga0068852_100375279 Ga0068852_1003752792 349
445 3300006237 Ga0097621_100116235 Ga0097621_1001162353 349
446 3300006358 Ga0068871_100128587 Ga0068871_1001285872 349
447 3300013308 Ga0157375_10122204 Ga0157375_101222043 349
448 3300017792 Ga0163161_10012090 Ga0163161_100120906 349
449 3300025903 Ga0207680_10094394 Ga0207680_100943943 349
450 3300025986 Ga0207658_10200210 Ga0207658_102002102 349
451 3300026142 Ga0207698_10221087 Ga0207698_102210872 349
452 3300032004 Ga0307414_10174952 Ga0307414_101749522 349
453 3300048910 Ga0496107_0035157 Ga0496107_0035157_34_1083 349
454 3300048913 Ga0496110_0072177 Ga0496110_0072177_1710_2759 349
455 3300048917 Ga0496114_0006408 Ga0496114_0006408_6338_7387 349
456 3300049569 Ga0501032_0010277 Ga0501032_0010277_3076_4143 349
457 3300049570 Ga0501033_0017715 Ga0501033_0017715_904_1971 349
458 3300049573 Ga0501037_0001036 Ga0501037_0001036_8862_9929 349
459 3300049579 Ga0501043_0000022 Ga0501043_0000022_10629_11696 349
460 3300049584 Ga0501068_0006056 Ga0501068_0006056_2597_3664 349
461 3300049585 Ga0501069_0000035 Ga0501069_0000035_10611_11678 349
462 3300049586 Ga0501070_0000295 Ga0501070_0000295_10629_11696 349
463 3300049587 Ga0501071_0019898 Ga0501071_0019898_2562_3629 349
464 3300049590 Ga0501074_0000714 Ga0501074_0000714_6713_7780 349
465 3300049742 Ga0501080_0000395 Ga0501080_0000395_21569_22636 349
466 3300049744 Ga0501083_0000104 Ga0501083_0000104_45389_46456 349
467 3300049822 Ga0501035_0000139 Ga0501035_0000139_76627_77694 349
468 3300049823 Ga0501044_0000433 Ga0501044_0000433_10629_11696 349
469 iso_pu_bacteria 2582581306 2585270103 349
470 iso_pu_bacteria 2582581865 2585391251 349
471 iso_pu_bacteria 2879163058 2879165023 349
472 iso_pu_bacteria 2928968154 2928970169 349
473 3300003320 rootH2_10004299 rootH2_100042994 350
474 3300003762 Ga0055542_1001081 Ga0055542_10010814 350
475 3300005327 Ga0070658_10048232 Ga0070658_100482324 350
476 3300005616 Ga0068852_100146390 Ga0068852_1001463902 350
477 3300006038 Ga0075365_10009204 Ga0075365_100092046 350
478 3300006946 Ga0079104_1002768 Ga0079104_10027687 350
479 3300006946 Ga0079104_1012509 Ga0079104_10125092 350
480 3300009093 Ga0105240_10205709 Ga0105240_102057093 350
481 3300009093 Ga0105240_10227656 Ga0105240_102276562 350
482 3300009094 Ga0111539_10075856 Ga0111539_100758563 350
483 3300009551 Ga0105238_10303877 Ga0105238_103038772 350
484 3300009553 Ga0105249_10133589 Ga0105249_101335892 350
485 3300010375 Ga0105239_10012177 Ga0105239_100121774 350
486 3300010375 Ga0105239_10255978 Ga0105239_102559782 350
487 3300013296 Ga0157374_10141406 Ga0157374_101414062 350
488 3300021321 Ga0214542_1018879 Ga0214542_10188793 350
489 3300021327 Ga0214543_1000023 Ga0214543_1000023150 350
490 3300022739 Ga0228711_1000011 Ga0228711_10000118 350
491 3300022740 Ga0228710_1000283 Ga0228710_100028343 350
492 3300025254 Ga0209148_1000057 Ga0209148_1000057345 350
493 3300025272 Ga0209455_1000939 Ga0209455_100093912 350
494 3300025904 Ga0207647_10023556 Ga0207647_100235564 350
495 3300025909 Ga0207705_10057056 Ga0207705_100570563 350
496 3300025913 Ga0207695_10174866 Ga0207695_101748663 350
497 3300025914 Ga0207671_10262303 Ga0207671_102623031 350
498 3300025920 Ga0207649_10075697 Ga0207649_100756973 350
499 3300027111 Ga0209281_1000087 Ga0209281_100008749 350
500 3300027111 Ga0209281_1000188 Ga0209281_100018866 350
501 3300027666 Ga0209282_1000008 Ga0209282_100000850 350
502 3300031711 Ga0265314_10007209 Ga0265314_1000720910 350
503 3300031967 Ga0315914_1000011 Ga0315914_1000011123 350
504 3300033430 Ga0315913_1000008 Ga0315913_1000008107 350
505 3300033464 Ga0315915_1000009 Ga0315915_1000009166 350
506 3300046507 Ga0495606_0065472 Ga0495606_0065472_883_1977 350
507 3300046522 Ga0495643_0032991 Ga0495643_0032991_1279_2373 350
508 3300046542 Ga0495597_0069119 Ga0495597_0069119_348_1442 350
509 3300046660 Ga0495625_0111488 Ga0495625_0111488_68_1162 350
510 3300047443 Ga0495687_078529 Ga0495687_078529_150_1244 350
511 3300047470 Ga0495681_0048345 Ga0495681_0048345_288_1382 350
512 3300048915 Ga0496112_0198437 Ga0496112_0198437_763_1833 350
513 3300048923 Ga0496120_0026517 Ga0496120_0026517_1099_2169 350
514 3300048929 Ga0496126_0020377 Ga0496126_0020377_1301_2371 350
515 3300049570 Ga0501033_0030491 Ga0501033_0030491_2172_3242 350
516 3300049581 Ga0501047_0166749 Ga0501047_0166749_733_1800 350
517 3300049742 Ga0501080_0130576 Ga0501080_0130576_415_1482 350
518 3300049742 Ga0501080_0134478 Ga0501080_0134478_242_1312 350
519 3300049822 Ga0501035_0258739 Ga0501035_0258739_193_1263 350
520 3300049823 Ga0501044_0000315 Ga0501044_0000315_32535_33602 350
521 3300049823 Ga0501044_0143043 Ga0501044_0143043_687_1757 350
522 3300049823 Ga0501044_0396793 Ga0501044_0396793_72_1127 350
523 3300050492 nmdc:mga0yw44_11399_c1 nmdc:mga0yw44_11399_c1_207_1277 350
524 3300050492 nmdc:mga0yw44_17437_c1 nmdc:mga0yw44_17437_c1_163_1239 350
525 3300050492 nmdc:mga0yw44_6415_c1 nmdc:mga0yw44_6415_c1_4420_5490 350
526 3300050511 nmdc:mga08y16_199150_c1 nmdc:mga08y16_199150_c1_258_1325 350
527 3300053079 Ga0500610_0016204 Ga0500610_0016204_1375_2469 350
528 3300053117 Ga0500593_000549 Ga0500593_000549_3937_5004 350
529 3300053139 Ga0500568_0000005 Ga0500568_0000005_425831_426895 350
530 3300053155 Ga0500620_000185 Ga0500620_000185_7414_8508 350
531 iso_pu_bacteria 2599185359 2600225625 350
532 iso_pu_bacteria 2818991466 2819714062 350
533 iso_pu_bacteria 2885427238 2885428425 350
534 iso_pu_bacteria 2928526807 2928528621 350
535 3300001915 JGI24741J21665_1005105 JGI24741J21665_10051052 351
536 3300001979 JGI24740J21852_10005092 JGI24740J21852_100050925 351
537 3300003578 Ga0006562J51391_1012741 Ga0006562J51391_10127414 351
538 3300003759 Ga0055525_1000248 Ga0055525_100024842 351
539 3300003762 Ga0055542_1000040 Ga0055542_100004073 351
540 3300003763 Ga0055529_1000037 Ga0055529_1000037148 351
541 3300005290 Ga0065712_10072921 Ga0065712_100729213 351
542 3300005293 Ga0065715_10091015 Ga0065715_100910152 351
543 3300005328 Ga0070676_10195749 Ga0070676_101957491 351
544 3300005329 Ga0070683_100131466 Ga0070683_1001314662 351
545 3300005336 Ga0070680_100000186 Ga0070680_10000018619 351
546 3300005338 Ga0068868_100136189 Ga0068868_1001361892 351
547 3300005339 Ga0070660_100008068 Ga0070660_1000080682 351
548 3300005344 Ga0070661_100000003 Ga0070661_10000000369 351
549 3300005353 Ga0070669_100000746 Ga0070669_1000007463 351
550 3300005356 Ga0070674_100001650 Ga0070674_1000016504 351
551 3300005455 Ga0070663_100035759 Ga0070663_1000357593 351
552 3300005456 Ga0070678_100000022 Ga0070678_10000002215 351
553 3300005530 Ga0070679_100000001 Ga0070679_100000001424 351
554 3300005564 Ga0070664_100263370 Ga0070664_1002633702 351
555 3300005577 Ga0068857_100145520 Ga0068857_1001455202 351
556 3300005614 Ga0068856_100185613 Ga0068856_1001856132 351
557 3300005616 Ga0068852_100003115 Ga0068852_1000031155 351
558 3300005616 Ga0068852_100064145 Ga0068852_1000641453 351
559 3300005985 Ga0081539_10001682 Ga0081539_100016827 351
560 3300006178 Ga0075367_10071034 Ga0075367_100710342 351
561 3300006195 Ga0075366_10016389 Ga0075366_100163894 351
562 3300006237 Ga0097621_100391249 Ga0097621_1003912491 351
563 3300006946 Ga0079104_1000826 Ga0079104_100082617 351
564 3300006948 Ga0099826_10009423 Ga0099826_100094236 351
565 3300009011 Ga0105251_10038616 Ga0105251_100386162 351
566 3300009093 Ga0105240_10173766 Ga0105240_101737663 351
567 3300009148 Ga0105243_10000223 Ga0105243_1000022333 351
568 3300009545 Ga0105237_10089008 Ga0105237_100890083 351
569 3300009545 Ga0105237_10181391 Ga0105237_101813912 351
570 3300009551 Ga0105238_10001439 Ga0105238_100014392 351
571 3300009551 Ga0105238_10047071 Ga0105238_100470714 351
572 3300009765 Ga0123341_1001979 Ga0123341_10019796 351
573 3300011119 Ga0105246_10133197 Ga0105246_101331972 351
574 3300013100 Ga0157373_10028796 Ga0157373_100287964 351
575 3300013104 Ga0157370_10159343 Ga0157370_101593432 351
576 3300013307 Ga0157372_10087848 Ga0157372_100878484 351
577 3300020081 Ga0206354_11549322 Ga0206354_115493222 351
578 3300020082 Ga0206353_11308154 Ga0206353_113081545 351
579 3300022739 Ga0228711_1001389 Ga0228711_100138922 351
580 3300022740 Ga0228710_1000488 Ga0228710_100048831 351
581 3300025230 Ga0209563_100066 Ga0209563_10006625 351
582 3300025254 Ga0209148_1000011 Ga0209148_1000011970 351
583 3300025272 Ga0209455_1000006 Ga0209455_1000006222 351
584 3300025735 Ga0207713_1000499 Ga0207713_100049921 351
585 3300025911 Ga0207654_10004342 Ga0207654_100043422 351
586 3300025912 Ga0207707_10014294 Ga0207707_100142944 351
587 3300025913 Ga0207695_10020644 Ga0207695_100206442 351
588 3300025914 Ga0207671_10061848 Ga0207671_100618482 351
589 3300025917 Ga0207660_10000583 Ga0207660_1000058318 351
590 3300025919 Ga0207657_10020622 Ga0207657_100206225 351
591 3300025920 Ga0207649_10000027 Ga0207649_10000027123 351
592 3300025921 Ga0207652_10000003 Ga0207652_1000000320 351
593 3300025923 Ga0207681_10007717 Ga0207681_100077174 351
594 3300025924 Ga0207694_10006256 Ga0207694_1000625610 351
595 3300025933 Ga0207706_10144291 Ga0207706_101442911 351
596 3300025935 Ga0207709_10000078 Ga0207709_1000007833 351
597 3300025937 Ga0207669_10000238 Ga0207669_1000023815 351
598 3300025945 Ga0207679_10243921 Ga0207679_102439212 351
599 3300025960 Ga0207651_10038443 Ga0207651_100384434 351
600 3300026041 Ga0207639_10054194 Ga0207639_100541942 351
601 3300026041 Ga0207639_10066396 Ga0207639_100663962 351
602 3300026067 Ga0207678_10088203 Ga0207678_100882032 351
603 3300026078 Ga0207702_10001669 Ga0207702_100016693 351
604 3300026116 Ga0207674_10110307 Ga0207674_101103073 351
605 3300026121 Ga0207683_10000156 Ga0207683_1000015646 351
606 3300026142 Ga0207698_10001183 Ga0207698_1000118311 351
607 3300026142 Ga0207698_10006046 Ga0207698_100060466 351
608 3300027111 Ga0209281_1000540 Ga0209281_100054028 351
609 3300027666 Ga0209282_1000146 Ga0209282_100014614 351
610 3300028379 Ga0268266_10087622 Ga0268266_100876222 351
611 3300031251 Ga0265327_10027576 Ga0265327_100275763 351
612 3300031824 Ga0307413_10157133 Ga0307413_101571332 351
613 3300031901 Ga0307406_10006765 Ga0307406_100067654 351
614 3300031967 Ga0315914_1000607 Ga0315914_100060730 351
615 3300033430 Ga0315913_1000148 Ga0315913_100014827 351
616 3300033464 Ga0315915_1000878 Ga0315915_100087817 351
617 3300037471 Ga0395905_0117362 Ga0395905_0117362_1194_2327 351
618 3300037471 Ga0395905_0217179 Ga0395905_0217179_241_1395 351
619 3300038443 Ga0395901_0010289 Ga0395901_0010289_7987_9141 351
620 3300046453 Ga0495627_006779 Ga0495627_006779_607_1689 351
621 3300046458 Ga0495591_001464 Ga0495591_001464_6600_7682 351
622 3300046474 Ga0495605_0003598 Ga0495605_0003598_1509_2591 351
623 3300046492 Ga0495585_0004039 Ga0495585_0004039_6660_7742 351
624 3300046492 Ga0495585_0015907 Ga0495585_0015907_562_1644 351
625 3300046501 Ga0495607_0071256 Ga0495607_0071256_87_1169 351
626 3300046507 Ga0495606_0004650 Ga0495606_0004650_6599_7681 351
627 3300046512 Ga0495610_0000993 Ga0495610_0000993_6667_7749 351
628 3300046515 Ga0495620_0011614 Ga0495620_0011614_2989_4071 351
629 3300046530 Ga0495654_0061632 Ga0495654_0061632_156_1238 351
630 3300046538 Ga0495609_0013679 Ga0495609_0013679_2580_3662 351
631 3300046660 Ga0495625_0006059 Ga0495625_0006059_7935_9017 351
632 3300046660 Ga0495625_0012455 Ga0495625_0012455_956_2038 351
633 3300046674 Ga0495588_0031210 Ga0495588_0031210_1229_2305 351
634 3300046691 Ga0495670_0043555 Ga0495670_0043555_964_2040 351
635 3300046692 Ga0495671_0009590 Ga0495671_0009590_2804_3886 351
636 3300046694 Ga0495649_0004449 Ga0495649_0004449_1478_2560 351
637 3300046694 Ga0495649_0019283 Ga0495649_0019283_97_1152 351
638 3300046809 Ga0495600_0022170 Ga0495600_0022170_1683_2759 351
639 3300046810 Ga0495660_0003741 Ga0495660_0003741_7931_9013 351
640 3300047317 Ga0495604_0017865 Ga0495604_0017865_4410_5486 351
641 3300047445 Ga0495677_0033158 Ga0495677_0033158_530_1585 351
642 3300047469 Ga0495673_0004461 Ga0495673_0004461_1074_2156 351
643 3300048923 Ga0496120_0024786 Ga0496120_0024786_1135_2274 351
644 3300048923 Ga0496120_0063620 Ga0496120_0063620_589_1644 351
645 3300048925 Ga0496122_0006078 Ga0496122_0006078_12850_13926 351
646 3300048925 Ga0496122_0006225 Ga0496122_0006225_572_1645 351
647 3300048928 Ga0496125_0000986 Ga0496125_0000986_12295_13371 351
648 3300048928 Ga0496125_0001751 Ga0496125_0001751_17125_18195 351
649 3300049568 Ga0501031_0183532 Ga0501031_0183532_279_1352 351
650 3300049569 Ga0501032_0086080 Ga0501032_0086080_124_1206 351
651 3300049569 Ga0501032_0145849 Ga0501032_0145849_303_1376 351
652 3300049570 Ga0501033_0003186 Ga0501033_0003186_11911_12984 351
653 3300049570 Ga0501033_0035397 Ga0501033_0035397_1057_2130 351
654 3300049570 Ga0501033_0128961 Ga0501033_0128961_169_1251 351
655 3300049571 Ga0501034_0080406 Ga0501034_0080406_1108_2181 351
656 3300049572 Ga0501036_0019824 Ga0501036_0019824_3791_4873 351
657 3300049572 Ga0501036_0039993 Ga0501036_0039993_2302_3375 351
658 3300049572 Ga0501036_0132851 Ga0501036_0132851_807_1880 351
659 3300049572 Ga0501036_0251631 Ga0501036_0251631_66_1139 351
660 3300049573 Ga0501037_0038301 Ga0501037_0038301_1440_2522 351
661 3300049573 Ga0501037_0154800 Ga0501037_0154800_164_1237 351
662 3300049574 Ga0501038_0060779 Ga0501038_0060779_1064_2146 351
663 3300049574 Ga0501038_0162396 Ga0501038_0162396_658_1731 351
664 3300049574 Ga0501038_0212349 Ga0501038_0212349_15_1088 351
665 3300049575 Ga0501039_0171728 Ga0501039_0171728_312_1385 351
666 3300049579 Ga0501043_0038486 Ga0501043_0038486_140_1213 351
667 3300049579 Ga0501043_0068498 Ga0501043_0068498_397_1470 351
668 3300049579 Ga0501043_0109654 Ga0501043_0109654_39_1112 351
669 3300049580 Ga0501046_0070073 Ga0501046_0070073_1261_2334 351
670 3300049581 Ga0501047_0015479 Ga0501047_0015479_235_1308 351
671 3300049581 Ga0501047_0042916 Ga0501047_0042916_1896_2969 351
672 3300049581 Ga0501047_0102975 Ga0501047_0102975_51_1124 351
673 3300049581 Ga0501047_0172851 Ga0501047_0172851_280_1362 351
674 3300049585 Ga0501069_0023685 Ga0501069_0023685_226_1299 351
675 3300049586 Ga0501070_0013018 Ga0501070_0013018_1786_2859 351
676 3300049586 Ga0501070_0099596 Ga0501070_0099596_281_1354 351
677 3300049586 Ga0501070_0224047 Ga0501070_0224047_185_1258 351
678 3300049742 Ga0501080_0044488 Ga0501080_0044488_1761_2834 351
679 3300049742 Ga0501080_0062876 Ga0501080_0062876_294_1367 351
680 3300049742 Ga0501080_0064651 Ga0501080_0064651_2114_3175 351
681 3300049742 Ga0501080_0159357 Ga0501080_0159357_203_1276 351
682 3300049822 Ga0501035_0009219 Ga0501035_0009219_177_1250 351
683 3300049822 Ga0501035_0018313 Ga0501035_0018313_3358_4431 351
684 3300049822 Ga0501035_0041654 Ga0501035_0041654_2155_3228 351
685 3300049822 Ga0501035_0077359 Ga0501035_0077359_477_1550 351
686 3300049823 Ga0501044_0012206 Ga0501044_0012206_173_1246 351
687 3300049823 Ga0501044_0025938 Ga0501044_0025938_641_1723 351
688 3300049823 Ga0501044_0063336 Ga0501044_0063336_1400_2473 351
689 3300049823 Ga0501044_0118783 Ga0501044_0118783_1447_2520 351
690 3300050492 nmdc:mga0yw44_204118_c1 nmdc:mga0yw44_204118_c1_53_1150 351
691 3300050493 nmdc:mga0k408_46564_c1 nmdc:mga0k408_46564_c1_261_1316 351
692 3300050512 nmdc:mga0n895_267723_c1 nmdc:mga0n895_267723_c1_40_1098 351
693 3300053121 Ga0500607_067589 Ga0500607_067589_169_1245 351
694 3300053148 Ga0500590_000026 Ga0500590_000026_5046_6122 351
695 3300053730 Ga0500645_000975 Ga0500645_000975_1510_2565 351
696 iso_pu_bacteria 2513237088 2513595224 351
697 iso_pu_bacteria 2979793036 2979799238 351
698 iso_pu_bacteria 3003930520 3003930720 351
699 3300005985 Ga0081539_10018674 Ga0081539_100186744 352
700 3300021358 Ga0213873_10000016 Ga0213873_10000016119 352
701 3300021384 Ga0213876_10000056 Ga0213876_1000005619 352
702 3300021384 Ga0213876_10002301 Ga0213876_100023017 352
703 3300025304 Ga0209257_1031397 Ga0209257_10313972 352
704 3300031911 Ga0307412_10001051 Ga0307412_1000105110 352
705 3300032005 Ga0307411_10061005 Ga0307411_100610053 352
706 3300032126 Ga0307415_100020749 Ga0307415_1000207494 352
707 3300039437 Ga0436365_0594533 Ga0436365_0594533_18009_19073 352
708 3300039437 Ga0436365_1928389 Ga0436365_1928389_6504_7574 352
709 3300039453 Ga0436362_0580304 Ga0436362_0580304_105043_106107 352
710 3300041404 Ga0439436_0014023 Ga0439436_0014023_551_1609 352
711 3300041410 Ga0439461_0000209 Ga0439461_0000209_5236_6294 352
712 3300041413 Ga0439465_0000006 Ga0439465_0000006_17015_18073 352
713 3300041413 Ga0439465_0001197 Ga0439465_0001197_5237_6295 352
714 3300041997 Ga0439431_0002900 Ga0439431_0002900_1169_2227 352
715 3300042004 Ga0439445_0000142 Ga0439445_0000142_11414_12472 352
716 3300042004 Ga0439445_0002994 Ga0439445_0002994_1004_2062 352
717 3300042006 Ga0439432_000032 Ga0439432_000032_39919_40977 352
718 3300042014 Ga0439457_008018 Ga0439457_008018_455_1513 352
719 3300042435 Ga0439434_0006903 Ga0439434_0006903_546_1604 352
720 3300042435 Ga0439434_0013465 Ga0439434_0013465_1156_2214 352
721 3300046506 Ga0495583_0008508 Ga0495583_0008508_4248_5306 352
722 3300046507 Ga0495606_0000092 Ga0495606_0000092_14074_15132 352
723 3300046524 Ga0495648_0000097 Ga0495648_0000097_13103_14161 352
724 3300046525 Ga0495663_0002482 Ga0495663_0002482_2334_3392 352
725 3300046648 Ga0495611_0008661 Ga0495611_0008661_2274_3332 352
726 3300046660 Ga0495625_0000595 Ga0495625_0000595_14772_15830 352
727 3300047323 Ga0495683_0004038 Ga0495683_0004038_1057_2115 352
728 3300047470 Ga0495681_0015144 Ga0495681_0015144_1316_2374 352
729 3300048905 Ga0496102_0000316 Ga0496102_0000316_44011_45069 352
730 3300048906 Ga0496103_0002263 Ga0496103_0002263_7642_8700 352
731 3300048907 Ga0496104_0003225 Ga0496104_0003225_7807_8865 352
732 3300048917 Ga0496114_0031109 Ga0496114_0031109_204_1262 352
733 3300048918 Ga0496115_0000229 Ga0496115_0000229_45277_46335 352
734 3300048919 Ga0496116_0001542 Ga0496116_0001542_19009_20067 352
735 3300048920 Ga0496117_0000142 Ga0496117_0000142_45209_46267 352
736 3300048921 Ga0496118_0000115 Ga0496118_0000115_45777_46835 352
737 3300048922 Ga0496119_0007297 Ga0496119_0007297_6479_7537 352
738 3300048924 Ga0496121_0000193 Ga0496121_0000193_46450_47508 352
739 3300048925 Ga0496122_0009761 Ga0496122_0009761_3047_4105 352
740 3300048927 Ga0496124_0000146 Ga0496124_0000146_99634_100692 352
741 3300048928 Ga0496125_0000463 Ga0496125_0000463_3087_4145 352
742 3300048929 Ga0496126_0000174 Ga0496126_0000174_45777_46835 352
743 3300049568 Ga0501031_0000015 Ga0501031_0000015_110701_111777 352
744 3300049569 Ga0501032_0000008 Ga0501032_0000008_96083_97159 352
745 3300049570 Ga0501033_0000012 Ga0501033_0000012_144466_145542 352
746 3300049571 Ga0501034_0000035 Ga0501034_0000035_144465_145541 352
747 3300049572 Ga0501036_0000006 Ga0501036_0000006_144465_145541 352
748 3300049573 Ga0501037_0000123 Ga0501037_0000123_1630_2706 352
749 3300049574 Ga0501038_0000007 Ga0501038_0000007_96083_97159 352
750 3300049575 Ga0501039_0000012 Ga0501039_0000012_144465_145541 352
751 3300049579 Ga0501043_0000721 Ga0501043_0000721_27098_28174 352
752 3300049581 Ga0501047_0031523 Ga0501047_0031523_1907_2983 352
753 3300049586 Ga0501070_0041426 Ga0501070_0041426_1502_2578 352
754 3300049822 Ga0501035_0000035 Ga0501035_0000035_69758_70834 352
755 3300049823 Ga0501044_0000015 Ga0501044_0000015_96083_97159 352
756 3300053094 Ga0500566_0000637 Ga0500566_0000637_18054_19112 352
757 3300053130 Ga0500642_0001338 Ga0500642_0001338_1760_2818 352
758 3300053134 Ga0500658_0005949 Ga0500658_0005949_2056_3114 352
759 iso_pu_bacteria 2738543024 2739306186 352
760 iso_pu_bacteria 2847670302 2847672053 352
761 iso_pu_bacteria 2856320880 2856326678 352
762 iso_pu_bacteria 2869278585 2869280204 352
763 iso_pu_bacteria 2874139085 2874144316 352
764 iso_pu_bacteria 2906328253 2906331526 352
765 iso_pu_bacteria 2922158528 2922165347 352
766 iso_pu_bacteria 2924726620 2924729784 352
767 iso_pu_bacteria 2996341866 2996348467 352
768 iso_pu_bacteria 8002285264 8002290650 352
769 3300003791 Ga0055530_10000027 Ga0055530_10000027108 353
770 3300003791 Ga0055530_10000142 Ga0055530_100001427 353
771 3300003794 Ga0055531_10000013 Ga0055531_1000001355 353
772 3300005262 Ga0065165_1006759 Ga0065165_10067594 353
773 3300025246 Ga0209646_1014694 Ga0209646_10146941 353
774 3300025298 Ga0209050_1000014 Ga0209050_1000014108 353
775 3300025304 Ga0209257_1000019 Ga0209257_1000019584 353
776 3300025304 Ga0209257_1008677 Ga0209257_10086777 353
777 3300031995 Ga0307409_100204643 Ga0307409_1002046432 353
778 3300046691 Ga0495670_0000012 Ga0495670_0000012_85000_86061 353
779 3300048928 Ga0496125_0002760 Ga0496125_0002760_2616_3713 353
780 3300048929 Ga0496126_0197159 Ga0496126_0197159_159_1220 353
781 iso_pu_bacteria 2513237090 2513608183 353
782 iso_pu_bacteria 2599185301 2599938726 353
783 iso_pu_bacteria 2888350351 2888350889 353
784 iso_pu_bacteria 2889016732 2889021916 353
785 iso_pu_bacteria 2922130491 2922136172 353
786 iso_pu_bacteria 2922185730 2922192996 353
787 iso_pu_bacteria 2937848649 2937850611 353
788 iso_pu_bacteria 2937891427 2937895425 353
789 iso_pu_bacteria 2938014810 2938019059 353
790 iso_pu_bacteria 2958100919 2958103997 353
791 iso_pu_bacteria 2958172287 2958176639 353
792 iso_pu_bacteria 2965119406 2965123509 353
793 iso_pu_bacteria 2977922695 2977927700 353
794 iso_pu_bacteria 2977971508 2977977794 353
795 iso_pu_bacteria 2979710463 2979717362 353
796 iso_pu_bacteria 8004640170 8004646131 353
797 3300002705 JGI25156J39149_1012079 JGI25156J39149_10120792 354
798 3300002741 JGI25157J39369_1001893 JGI25157J39369_10018932 354
799 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016143 354
800 3300005327 Ga0070658_10006678 Ga0070658_100066787 354
801 3300005578 Ga0068854_100051750 Ga0068854_1000517502 354
802 3300005616 Ga0068852_100000441 Ga0068852_1000004419 354
803 3300009093 Ga0105240_10103281 Ga0105240_101032813 354
804 3300009545 Ga0105237_10016505 Ga0105237_100165057 354
805 3300010375 Ga0105239_10029463 Ga0105239_100294633 354
806 3300013297 Ga0157378_10379960 Ga0157378_103799602 354
807 3300014497 Ga0182008_10012092 Ga0182008_100120921 354
808 3300025250 Ga0209026_1000005 Ga0209026_1000005251 354
809 3300025256 Ga0209759_1000106 Ga0209759_1000106134 354
810 3300025261 Ga0209233_1000068 Ga0209233_1000068144 354
811 3300025909 Ga0207705_10015675 Ga0207705_100156752 354
812 3300025913 Ga0207695_10326714 Ga0207695_103267142 354
813 3300025914 Ga0207671_10014184 Ga0207671_100141844 354
814 3300025981 Ga0207640_10009903 Ga0207640_100099032 354
815 3300026142 Ga0207698_10003925 Ga0207698_100039256 354
816 3300037312 Ga0395899_0003376 Ga0395899_0003376_8278_9342 354
817 3300037418 Ga0395900_0195831 Ga0395900_0195831_558_1622 354
818 3300037466 Ga0395898_0001663 Ga0395898_0001663_8478_9542 354
819 3300037471 Ga0395905_0031616 Ga0395905_0031616_1158_2222 354
820 3300038443 Ga0395901_0002785 Ga0395901_0002785_8400_9464 354
821 3300046616 Ga0495668_0075821 Ga0495668_0075821_283_1365 354
822 3300046660 Ga0495625_0029675 Ga0495625_0029675_681_1763 354
823 3300048911 Ga0496108_0000667 Ga0496108_0000667_10618_11688 354
824 3300048921 Ga0496118_0063461 Ga0496118_0063461_68_1171 354
825 3300048925 Ga0496122_0097595 Ga0496122_0097595_355_1419 354
826 3300048926 Ga0496123_0017711 Ga0496123_0017711_350_1414 354
827 3300048926 Ga0496123_0059999 Ga0496123_0059999_54_1118 354
828 3300048927 Ga0496124_0007021 Ga0496124_0007021_9259_10323 354
829 3300048928 Ga0496125_0068897 Ga0496125_0068897_71_1135 354
830 iso_pu_bacteria 2503198000 2503203529 354
831 iso_pu_bacteria 2508501123 2509118141 354
832 iso_pu_bacteria 2871488783 2871492832 354
833 iso_pu_bacteria 2878753008 2878756762 354
834 iso_pu_bacteria 2881845957 2881851586 354
835 iso_pu_bacteria 2881861095 2881868840 354
836 iso_pu_bacteria 2882912400 2882919276 354
837 iso_pu_bacteria 2885318864 2885320698 354
838 iso_pu_bacteria 2903492973 2903496436 354
839 iso_pu_bacteria 2924784321 2924788352 354
840 iso_pu_bacteria 2937877337 2937877646 354
841 iso_pu_bacteria 2937972304 2937977717 354
842 iso_pu_bacteria 2958034702 2958036075 354
843 iso_pu_bacteria 2958041894 2958047499 354
844 iso_pu_bacteria 2958084443 2958084753 354
845 iso_pu_bacteria 2961170736 2961173052 354
846 iso_pu_bacteria 2967996073 2967998263 354
847 iso_pu_bacteria 2968003550 2968006311 354
848 iso_pu_bacteria 2968016561 2968022289 354
849 iso_pu_bacteria 2970469710 2970474878 354
850 iso_pu_bacteria 2970503327 2970505646 354
851 iso_pu_bacteria 2970593180 2970594804 354
852 iso_pu_bacteria 2977821940 2977825942 354
853 iso_pu_bacteria 2977828996 2977837139 354
854 iso_pu_bacteria 2979808191 2979810367 354
855 iso_pu_bacteria 2996348954 2996354289 354
856 iso_pu_bacteria 3004275668 3004280957 354
857 iso_pu_bacteria 8004374579 8004378350 354
858 3300001915 JGI24741J21665_1002450 JGI24741J21665_10024503 355
859 3300001979 JGI24740J21852_10001757 JGI24740J21852_100017572 355
860 3300001989 JGI24739J22299_10004177 JGI24739J22299_100041776 355
861 3300001990 JGI24737J22298_10004791 JGI24737J22298_100047914 355
862 3300001990 JGI24737J22298_10023171 JGI24737J22298_100231712 355
863 3300002067 JGI24735J21928_10004301 JGI24735J21928_100043013 355
864 3300005327 Ga0070658_10106655 Ga0070658_101066552 355
865 3300005329 Ga0070683_100044731 Ga0070683_1000447312 355
866 3300005331 Ga0070670_100002432 Ga0070670_10000243213 355
867 3300005335 Ga0070666_10193878 Ga0070666_101938781 355
868 3300005337 Ga0070682_100134670 Ga0070682_1001346701 355
869 3300005339 Ga0070660_100136626 Ga0070660_1001366263 355
870 3300005344 Ga0070661_100006247 Ga0070661_1000062474 355
871 3300005344 Ga0070661_100034074 Ga0070661_1000340743 355
872 3300005344 Ga0070661_100156527 Ga0070661_1001565272 355
873 3300005354 Ga0070675_100056869 Ga0070675_1000568692 355
874 3300005355 Ga0070671_100055836 Ga0070671_1000558362 355
875 3300005367 Ga0070667_100008595 Ga0070667_1000085957 355
876 3300005455 Ga0070663_100005513 Ga0070663_1000055133 355
877 3300005455 Ga0070663_100026992 Ga0070663_1000269924 355
878 3300005457 Ga0070662_100047007 Ga0070662_1000470072 355
879 3300005457 Ga0070662_100080937 Ga0070662_1000809373 355
880 3300005539 Ga0068853_100072234 Ga0068853_1000722343 355
881 3300005543 Ga0070672_100091097 Ga0070672_1000910973 355
882 3300005548 Ga0070665_100371346 Ga0070665_1003713462 355
883 3300005564 Ga0070664_100000796 Ga0070664_10000079611 355
884 3300005564 Ga0070664_100016274 Ga0070664_1000162743 355
885 3300005577 Ga0068857_100018908 Ga0068857_1000189084 355
886 3300005577 Ga0068857_100025223 Ga0068857_1000252232 355
887 3300005577 Ga0068857_100037312 Ga0068857_1000373122 355
888 3300005614 Ga0068856_100050455 Ga0068856_1000504554 355
889 3300005617 Ga0068859_100009057 Ga0068859_1000090578 355
890 3300005618 Ga0068864_100003909 Ga0068864_1000039097 355
891 3300005841 Ga0068863_100004332 Ga0068863_1000043323 355
892 3300006237 Ga0097621_100124021 Ga0097621_1001240212 355
893 3300006880 Ga0075429_100017762 Ga0075429_1000177624 355
894 3300006931 Ga0097620_100009057 Ga0097620_1000090578 355
895 3300009177 Ga0105248_10057642 Ga0105248_100576423 355
896 3300013100 Ga0157373_10127141 Ga0157373_101271412 355
897 3300013102 Ga0157371_10067790 Ga0157371_100677903 355
898 3300014325 Ga0163163_10015924 Ga0163163_100159244 355
899 3300025909 Ga0207705_10073691 Ga0207705_100736912 355
900 3300025909 Ga0207705_10147681 Ga0207705_101476812 355
901 3300025909 Ga0207705_10243340 Ga0207705_102433402 355
902 3300025912 Ga0207707_10012400 Ga0207707_100124003 355
903 3300025914 Ga0207671_10176902 Ga0207671_101769022 355
904 3300025917 Ga0207660_10014782 Ga0207660_100147823 355
905 3300025919 Ga0207657_10027579 Ga0207657_100275794 355
906 3300025920 Ga0207649_10086321 Ga0207649_100863212 355
907 3300025920 Ga0207649_10172995 Ga0207649_101729952 355
908 3300025921 Ga0207652_10022644 Ga0207652_100226446 355
909 3300025925 Ga0207650_10016078 Ga0207650_100160784 355
910 3300025926 Ga0207659_10042615 Ga0207659_100426153 355
911 3300025931 Ga0207644_10029681 Ga0207644_100296813 355
912 3300025932 Ga0207690_10006446 Ga0207690_100064462 355
913 3300025932 Ga0207690_10096055 Ga0207690_100960552 355
914 3300025933 Ga0207706_10008815 Ga0207706_100088156 355
915 3300025933 Ga0207706_10129621 Ga0207706_101296212 355
916 3300025940 Ga0207691_10033075 Ga0207691_100330754 355
917 3300025945 Ga0207679_10011182 Ga0207679_100111826 355
918 3300025945 Ga0207679_10033862 Ga0207679_100338622 355
919 3300025986 Ga0207658_10037584 Ga0207658_100375844 355
920 3300025986 Ga0207658_10129133 Ga0207658_101291332 355
921 3300026041 Ga0207639_10107301 Ga0207639_101073012 355
922 3300026067 Ga0207678_10006171 Ga0207678_100061715 355
923 3300026067 Ga0207678_10053498 Ga0207678_100534982 355
924 3300026067 Ga0207678_10063538 Ga0207678_100635382 355
925 3300026078 Ga0207702_10097275 Ga0207702_100972753 355
926 3300026089 Ga0207648_10342618 Ga0207648_103426182 355
927 3300026116 Ga0207674_10000527 Ga0207674_1000052728 355
928 3300026116 Ga0207674_10003782 Ga0207674_100037822 355
929 3300026116 Ga0207674_10013932 Ga0207674_100139324 355
930 3300026142 Ga0207698_10024445 Ga0207698_100244454 355
931 3300028379 Ga0268266_10257650 Ga0268266_102576502 355
932 3300028379 Ga0268266_10287677 Ga0268266_102876771 355
933 3300028380 Ga0268265_10016619 Ga0268265_100166194 355
934 3300031731 Ga0307405_10037450 Ga0307405_100374502 355
935 3300032002 Ga0307416_100019710 Ga0307416_1000197103 355
936 3300037312 Ga0395899_0098463 Ga0395899_0098463_258_1325 355
937 3300037418 Ga0395900_0008329 Ga0395900_0008329_1505_2575 355
938 3300037418 Ga0395900_0120776 Ga0395900_0120776_357_1499 355
939 3300037466 Ga0395898_0235720 Ga0395898_0235720_446_1516 355
940 3300038443 Ga0395901_0000372 Ga0395901_0000372_35478_36548 355
941 3300038443 Ga0395901_0082499 Ga0395901_0082499_2045_3187 355
942 3300038443 Ga0395901_0224191 Ga0395901_0224191_825_1892 355
943 3300038443 Ga0395901_0281945 Ga0395901_0281945_282_1352 355
944 3300046533 Ga0495640_0177756 Ga0495640_0177756_12_1139 355
945 3300046684 Ga0495669_0077778 Ga0495669_0077778_59_1129 355
946 3300048909 Ga0496106_0078020 Ga0496106_0078020_387_1454 355
947 3300048910 Ga0496107_0078254 Ga0496107_0078254_162_1229 355
948 3300048911 Ga0496108_0034127 Ga0496108_0034127_1016_2083 355
949 3300048913 Ga0496110_0028096 Ga0496110_0028096_1269_2339 355
950 3300048914 Ga0496111_0045357 Ga0496111_0045357_1226_2293 355
951 3300048914 Ga0496111_0092344 Ga0496111_0092344_976_2046 355
952 3300048916 Ga0496113_0020775 Ga0496113_0020775_564_1631 355
953 3300053136 Ga0500559_0023986 Ga0500559_0023986_1147_2247 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

244

0.95

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

317

0.91

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

172

0.89

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

117

0.8

PF07993

NAD_binding_4

Male sterility protein

5

185

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

234

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9701 5 341
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9657 5 341
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9609 5 341
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9565 5 341
2hun-assembly1.cif.gz_B crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3 0.9542 5 341
ID Description Score Start End Superfamily
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 6 317 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9435 6 254 3.40.50.720
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 6 317 3.40.50.720
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 4 321 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9344 6 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A662ZRW6-F1-model_v4 deleted 0.9863 175 333
AF-A0A6B3LHK5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9854 31 194
AF-A0A257R3E1-F1-model_v4 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) 0.985 6 261 GO:0008460
GO:0009225
GO:0016491
AF-A0A829WI90-F1-model_v4 dTDP-glucose 4,6-dehydratase 0.9844 6 204
AF-A0A4P5SKD6-F1-model_v4 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) 0.983 4 333 GO:0008460
GO:0009225

Feature Viewer

pLDDT pTM Quality
91.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map