F486629

General Info

Members Datasets Scaffolds Average Seq Length
952 373 789 349

Family's Representative Sequence

Representative Sequence 3300042147|Ga0450910_000024|Ga0450910_000024_353_1399
Length 348
Sequence MARNGGITMKTALQHSKTGKTHRRLLGSSILALSLFGALGVAHGQSTSAAQPTANKSGVTHTTPSPFGALKHIKAGLLDVAYAETGPADGPVVILLHGWPYDIHSYDEVAPLLAAKGYRVLMPYARGYGDTHFLSEKTLRNGQPAALASDVIDFMDALKIKQAVLGGYDWGARSADIVAALWPERVKALVAVSGYLIGNQAAGQNPLPPKAELQWWYQFYFATDRGRAGYEKNTHDFAKLIWQLASPKWAFDDAEITVFNYRWRLGLVQGETRYDALEQKLATAPPISVPTITLEGDANGAPHPAPEDYAKRFTGKYEFRLISGGIGHNLPQEDPQAFAKAVIDADHL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
21 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
22 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
23 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
24 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
25 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
26 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
27 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
28 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
29 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
30 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
31 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
32 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
33 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
34 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
35 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
36 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
37 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
38 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
39 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
40 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
41 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
42 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
43 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
44 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
45 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
46 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
47 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
48 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
49 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
50 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
51 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
52 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
53 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
54 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
55 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
56 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
57 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
58 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
59 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
60 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
61 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
62 2643221556 Massilia sp. Root1485 Isolate Unclassified
63 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
64 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
65 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
66 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
67 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
68 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
69 2643221684 Massilia sp. Root133 Isolate Unclassified
70 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
71 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
72 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
73 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
74 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
75 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
76 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
77 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
78 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
79 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
80 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
81 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
82 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
83 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
84 2773857670 Pseudomonas sp. 478 Isolate Unclassified
85 2773857673 Pseudomonas sp. 443 Isolate Unclassified
86 2784132063 Pseudomonas sp. 424 Isolate Unclassified
87 2784132072 Pseudomonas sp. 460 Isolate Unclassified
88 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
89 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
90 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
91 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
92 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
93 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
94 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
95 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
96 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
97 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
98 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
99 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
100 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
101 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
102 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
103 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
104 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
105 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
106 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
107 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
108 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
109 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
110 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
111 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
112 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
113 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
114 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
115 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
116 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
117 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
118 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
119 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
120 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
121 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
122 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
123 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
124 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
125 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
126 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
127 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
128 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
129 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
130 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
131 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
132 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
133 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
134 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
135 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
136 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
137 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
138 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
139 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
140 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
141 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
142 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
143 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
146 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
147 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
148 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
149 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
153 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
161 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
162 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
163 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
164 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
165 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
166 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
186 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
223 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
234 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
235 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
236 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
237 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
238 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
239 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
240 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
241 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
360 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
361 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
362 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
363 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
364 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
365 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
366 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
367 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
368 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
369 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
370 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
371 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
372 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
373 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.88
Metatranscriptomes 0
Isolates 17.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 2.42
Rhizoplane 5.46
Rhizosphere 75.74
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1678 2124908027 Bacteria 5178
2 SwRhRL2b_contig_2455006 2162886007 Bacteria 7159
3 JGI25162J39368_1000013 3300002737 Bacteria 343384
4 JGI25163J39215_1000157 3300002771 Bacteria 26769
5 JGI25164J39214_1000005 3300002772 Bacteria 343384
6 JGI25165J46597_1000099 3300003214 Bacteria 158550
7 Ga0055536_1000013 3300003781 Bacteria 240693
8 Ga0055536_1000088 3300003781 Bacteria 79565
9 Ga0055536_1000262 3300003781 Bacteria 41063
10 Ga0055530_10000016 3300003791 Bacteria 146874
11 Ga0055530_10000087 3300003791 Bacteria 79565
12 Ga0055530_10000103 3300003791 Bacteria 72498
13 Ga0055530_10001656 3300003791 Bacteria 15860
14 Ga0055530_10002474 3300003791 Bacteria 11850
15 Ga0055530_10022040 3300003791 Bacteria 1863
16 Ga0055540_1000008 3300003792 Bacteria 309635
17 Ga0055540_1000048 3300003792 Bacteria 146874
18 Ga0055531_10000182 3300003794 Bacteria 70786
19 Ga0055531_10002226 3300003794 Bacteria 13163
20 Ga0065714_10003199 3300005288 Bacteria 10790
21 Ga0065714_10008363 3300005288 Bacteria 3198
22 Ga0065714_10068620 3300005288 Bacteria 4627
23 Ga0065714_10077065 3300005288 Bacteria 2717
24 Ga0065704_10005347 3300005289 Bacteria 2923
25 Ga0065704_10093687 3300005289 Bacteria 2583
26 Ga0070669_100013571 3300005353 Bacteria 5792
27 Ga0070669_100027628 3300005353 Bacteria 4084
28 Ga0068853_100008887 3300005539 Bacteria 8084
29 Ga0068855_100115595 3300005563 Bacteria 3075
30 Ga0070664_100000024 3300005564 Bacteria 94521
31 Ga0068851_10038578 3300005834 Bacteria 2397
32 Ga0075364_10028129 3300006051 Bacteria 3597
33 Ga0075432_10000700 3300006058 Bacteria 10339
34 Ga0075432_10005082 3300006058 Bacteria 4481
35 Ga0075432_10028232 3300006058 Bacteria 1935
36 Ga0075432_10061129 3300006058 Bacteria 1341
37 Ga0075362_10032169 3300006177 Bacteria 2274
38 Ga0075369_10032178 3300006186 Bacteria 2218
39 Ga0075434_100000694 3300006871 Bacteria 26302
40 Ga0079104_1000094 3300006946 Bacteria 130202
41 Ga0079104_1000537 3300006946 Bacteria 40039
42 Ga0079104_1001585 3300006946 Bacteria 14849
43 Ga0079104_1002557 3300006946 Bacteria 9593
44 Ga0079104_1015347 3300006946 Bacteria 2272
45 Ga0099826_10037688 3300006948 Bacteria 3406
46 Ga0075435_100036120 3300007076 Bacteria 3925
47 Ga0105251_10000363 3300009011 Bacteria 44493
48 Ga0105251_10003033 3300009011 Bacteria 12511
49 Ga0105251_10007455 3300009011 Bacteria 6739
50 Ga0105251_10033401 3300009011 Bacteria 2555
51 Ga0105251_10037418 3300009011 Bacteria 2382
52 Ga0105251_10127775 3300009011 Bacteria 1153
53 Ga0105244_10000449 3300009036 Bacteria 37516
54 Ga0105244_10022163 3300009036 Bacteria 3498
55 Ga0105244_10027757 3300009036 Bacteria 3047
56 Ga0105244_10029457 3300009036 Bacteria 2933
57 Ga0105244_10037921 3300009036 Bacteria 2516
58 Ga0105244_10065924 3300009036 Bacteria 1813
59 Ga0105250_10000015 3300009092 Bacteria 262683
60 Ga0105250_10000155 3300009092 Bacteria 59663
61 Ga0105250_10013848 3300009092 Bacteria 3321
62 Ga0105250_10022004 3300009092 Bacteria 2572
63 Ga0105250_10061001 3300009092 Bacteria 1516
64 Ga0105240_10094827 3300009093 Bacteria 3639
65 Ga0105243_10000060 3300009148 Bacteria 128124
66 Ga0105242_10067130 3300009176 Bacteria 2964
67 Ga0105242_10142055 3300009176 Bacteria 2084
68 Ga0105237_10000042 3300009545 Bacteria 181280
69 Ga0105246_10000723 3300011119 Bacteria 18714
70 Ga0105246_10027075 3300011119 Bacteria 3753
71 Ga0157345_1000122 3300012498 Bacteria 15294
72 Ga0157373_10000374 3300013100 Bacteria 35786
73 Ga0157373_10000874 3300013100 Bacteria 23320
74 Ga0157373_10010544 3300013100 Bacteria 6801
75 Ga0157373_10012407 3300013100 Bacteria 6266
76 Ga0157373_10045459 3300013100 Bacteria 3134
77 Ga0157373_10075534 3300013100 Bacteria 2377
78 Ga0157371_10003129 3300013102 Bacteria 15287
79 Ga0157371_10003297 3300013102 Bacteria 14774
80 Ga0157370_10009404 3300013104 Bacteria 10449
81 Ga0157370_10011916 3300013104 Bacteria 9066
82 Ga0157370_10022555 3300013104 Bacteria 6264
83 Ga0157370_10035411 3300013104 Bacteria 4852
84 Ga0157370_10057151 3300013104 Bacteria 3711
85 Ga0157370_10138035 3300013104 Bacteria 2272
86 Ga0157370_10147558 3300013104 Bacteria 2190
87 Ga0157369_10001093 3300013105 Bacteria 33888
88 Ga0157369_10002233 3300013105 Bacteria 23310
89 Ga0157369_10002926 3300013105 Bacteria 20415
90 Ga0157369_10030798 3300013105 Bacteria 5914
91 Ga0157369_10269774 3300013105 Bacteria 1773
92 Ga0163162_10000137 3300013306 Bacteria 66670
93 Ga0163162_10007127 3300013306 Bacteria 10850
94 Ga0163162_10458734 3300013306 Bacteria 1406
95 Ga0157372_10001800 3300013307 Bacteria 23279
96 Ga0157375_10000050 3300013308 Bacteria 134913
97 Ga0157375_10047614 3300013308 Bacteria 4189
98 Ga0182008_10000496 3300014497 Bacteria 29685
99 Ga0182008_10001714 3300014497 Bacteria 14388
100 Ga0182008_10002492 3300014497 Bacteria 11504
101 Ga0182008_10003801 3300014497 Bacteria 8973
102 Ga0182008_10004088 3300014497 Bacteria 8606
103 Ga0182008_10008762 3300014497 Bacteria 5498
104 Ga0182008_10012414 3300014497 Bacteria 4496
105 Ga0182008_10067814 3300014497 Bacteria 1755
106 Ga0182008_10078557 3300014497 Bacteria 1623
107 Ga0182006_1000396 3300015261 Bacteria 35562
108 Ga0182006_1001125 3300015261 Bacteria 17007
109 Ga0182006_1010118 3300015261 Bacteria 4200
110 Ga0182006_1015839 3300015261 Bacteria 3225
111 Ga0182006_1017555 3300015261 Bacteria 3038
112 Ga0182007_10000303 3300015262 Bacteria 31833
113 Ga0182007_10000394 3300015262 Bacteria 27020
114 Ga0182007_10003110 3300015262 Bacteria 7987
115 Ga0182005_1001258 3300015265 Bacteria 10431
116 Ga0182005_1007476 3300015265 Bacteria 3275
117 Ga0182005_1008300 3300015265 Bacteria 3066
118 Ga0182005_1010822 3300015265 Bacteria 2616
119 Ga0163161_10000054 3300017792 Bacteria 117153
120 Ga0163161_10002749 3300017792 Bacteria 12506
121 Ga0163161_10016214 3300017792 Bacteria 5200
122 Ga0163161_10042217 3300017792 Bacteria 3280
123 Ga0163161_10122984 3300017792 Bacteria 1951
124 Ga0209760_100035 3300025207 Bacteria 132204
125 Ga0209563_102378 3300025230 Bacteria 4284
126 Ga0207427_100018 3300025231 Bacteria 530735
127 Ga0209437_100031 3300025233 Bacteria 530871
128 Ga0209233_1000012 3300025261 Bacteria 1019519
129 Ga0209675_1009989 3300025291 Bacteria 3288
130 Ga0209676_1000002 3300025292 Bacteria 1732948
131 Ga0209676_1000003 3300025292 Bacteria 1454178
132 Ga0209676_1000050 3300025292 Bacteria 398350
133 Ga0209676_1000113 3300025292 Bacteria 207931
134 Ga0209676_1002427 3300025292 Bacteria 13272
135 Ga0209676_1005636 3300025292 Bacteria 6457
136 Ga0209676_1008145 3300025292 Bacteria 4743
137 Ga0209050_1000004 3300025298 Bacteria 1600040
138 Ga0209050_1000006 3300025298 Bacteria 1359702
139 Ga0209050_1000013 3300025298 Bacteria 811408
140 Ga0209050_1000126 3300025298 Bacteria 188438
141 Ga0209050_1000321 3300025298 Bacteria 96465
142 Ga0209050_1001041 3300025298 Bacteria 34372
143 Ga0209051_1000001 3300025303 Bacteria 1732974
144 Ga0209051_1000007 3300025303 Bacteria 811408
145 Ga0209051_1000052 3300025303 Bacteria 283346
146 Ga0209257_1000029 3300025304 Bacteria 695617
147 Ga0209257_1000155 3300025304 Bacteria 182928
148 Ga0209257_1000256 3300025304 Bacteria 123057
149 Ga0207696_1000017 3300025711 Bacteria 491130
150 Ga0207696_1000223 3300025711 Bacteria 82090
151 Ga0207696_1001477 3300025711 Bacteria 12721
152 Ga0207696_1006322 3300025711 Bacteria 4784
153 Ga0207696_1012781 3300025711 Bacteria 2955
154 Ga0207655_1000070 3300025728 Bacteria 239196
155 Ga0207655_1000076 3300025728 Bacteria 226359
156 Ga0207655_1002401 3300025728 Bacteria 15260
157 Ga0207655_1004390 3300025728 Bacteria 10017
158 Ga0207655_1006108 3300025728 Bacteria 8041
159 Ga0207655_1008249 3300025728 Bacteria 6637
160 Ga0207655_1018119 3300025728 Bacteria 3755
161 Ga0207655_1024886 3300025728 Bacteria 2922
162 Ga0207713_1000073 3300025735 Bacteria 181519
163 Ga0207713_1001910 3300025735 Bacteria 15777
164 Ga0207713_1002185 3300025735 Bacteria 14501
165 Ga0207713_1004432 3300025735 Bacteria 9102
166 Ga0207713_1006184 3300025735 Bacteria 7346
167 Ga0207713_1009642 3300025735 Bacteria 5417
168 Ga0207713_1019313 3300025735 Bacteria 3340
169 Ga0207713_1024366 3300025735 Bacteria 2824
170 Ga0207713_1025331 3300025735 Bacteria 2743
171 Ga0207695_10068337 3300025913 Bacteria 3640
172 Ga0207671_10000474 3300025914 Bacteria 54456
173 Ga0207649_10000010 3300025920 Bacteria 284354
174 Ga0207681_10005164 3300025923 Bacteria 8018
175 Ga0207681_10059355 3300025923 Bacteria 2622
176 Ga0207706_10009243 3300025933 Bacteria 9058
177 Ga0207686_10024380 3300025934 Bacteria 3506
178 Ga0207709_10000004 3300025935 Bacteria 825156
179 Ga0207679_10000022 3300025945 Bacteria 219036
180 Ga0207639_10068990 3300026041 Bacteria 2757
181 Ga0209281_1000046 3300027111 Bacteria 327042
182 Ga0209281_1000143 3300027111 Bacteria 174070
183 Ga0209281_1000212 3300027111 Bacteria 130216
184 Ga0209281_1005093 3300027111 Bacteria 3732
185 Ga0207428_10022576 3300027907 Bacteria 5307
186 Ga0207428_10047480 3300027907 Bacteria 3447
187 Ga0207428_10061117 3300027907 Bacteria 2984
188 Ga0207428_10075095 3300027907 Bacteria 2650
189 Ga0207428_10085594 3300027907 Bacteria 2454
190 Ga0307511_10032874 3300030521 Bacteria 4594
191 Ga0316178_1159482 3300030735 Bacteria 22902
192 Ga0307408_100021029 3300031548 Bacteria 4410
193 Ga0307408_100035970 3300031548 Bacteria 3477
194 Ga0307412_10001360 3300031911 Bacteria 13591
195 Ga0307412_10045661 3300031911 Bacteria 2865
196 Ga0307416_100299513 3300032002 Bacteria 1597
197 Ga0307414_10004343 3300032004 Bacteria 7695
198 Ga0307414_10271898 3300032004 Bacteria 1419
199 Ga0307411_10006051 3300032005 Bacteria 6015
200 Ga0307411_10129347 3300032005 Bacteria 1843
201 Ga0373941_0021623 3300035115 Bacteria 1818
202 Ga0373942_0016077 3300035207 Bacteria 1832
203 Ga0373931_0016616 3300035691 Bacteria 3626
204 Ga0237819_00218 3300038705 Bacteria 20786
205 Ga0237819_00520 3300038705 Bacteria 12904
206 Ga0439438_000109 3300041405 Bacteria 38057
207 Ga0439438_000129 3300041405 Bacteria 34152
208 Ga0439438_000587 3300041405 Bacteria 16488
209 Ga0439438_002048 3300041405 Bacteria 8783
210 Ga0439438_002096 3300041405 Bacteria 8608
211 Ga0439438_005891 3300041405 Bacteria 4432
212 Ga0439447_000131 3300041407 Bacteria 25696
213 Ga0439447_000152 3300041407 Bacteria 23926
214 Ga0439447_001180 3300041407 Bacteria 9514
215 Ga0439447_023297 3300041407 Bacteria 1614
216 Ga0439466_0000118 3300041411 Bacteria 30812
217 Ga0439466_0001046 3300041411 Bacteria 10684
218 Ga0439466_0004195 3300041411 Bacteria 5559
219 Ga0439466_0022937 3300041411 Bacteria 2198
220 Ga0439466_0041876 3300041411 Bacteria 1526
221 Ga0439431_0000018 3300041997 Bacteria 26379
222 Ga0439445_0000461 3300042004 Bacteria 8252
223 Ga0439432_010385 3300042006 Bacteria 3226
224 Ga0439432_010607 3300042006 Bacteria 3185
225 Ga0439432_011068 3300042006 Bacteria 3110
226 Ga0439451_000604 3300042009 Bacteria 6809
227 Ga0439452_000045 3300042010 Bacteria 131508
228 Ga0439452_000046 3300042010 Bacteria 130842
229 Ga0439452_001850 3300042010 Bacteria 8181
230 Ga0439452_004581 3300042010 Bacteria 4603
231 Ga0439452_011795 3300042010 Bacteria 2503
232 Ga0439452_018562 3300042010 Bacteria 1850
233 Ga0439452_031424 3300042010 Bacteria 1303
234 Ga0439456_002046 3300042013 Bacteria 4057
235 Ga0439456_005303 3300042013 Bacteria 2617
236 Ga0439456_007189 3300042013 Bacteria 2283
237 Ga0439463_006639 3300042016 Bacteria 2865
238 Ga0450911_000095 3300042115 Bacteria 35787
239 Ga0450911_000212 3300042115 Bacteria 22778
240 Ga0450911_001378 3300042115 Bacteria 5682
241 Ga0450902_001250 3300042137 Bacteria 3422
242 Ga0450902_008530 3300042137 Bacteria 1602
243 Ga0450902_017532 3300042137 Bacteria 1171
244 Ga0450903_004432 3300042138 Bacteria 2392
245 Ga0450903_014349 3300042138 Bacteria 1254
246 Ga0450903_014665 3300042138 Bacteria 1239
247 Ga0450904_002992 3300042139 Bacteria 1897
248 Ga0450906_000046 3300042145 Bacteria 19736
249 Ga0450907_000010 3300042146 Bacteria 95376
250 Ga0450910_000024 3300042147 Bacteria 22666
251 Ga0450908_015220 3300042184 Bacteria 1378
252 Ga0450909_002260 3300042185 Bacteria 2725
253 Ga0439434_0002424 3300042435 Bacteria 5424
254 Ga0439460_0000683 3300042461 Bacteria 7502
255 Ga0466957_0050527 3300044842 Bacteria 2530
256 Ga0495617_000202 3300046452 Bacteria 37705
257 Ga0495617_010496 3300046452 Bacteria 3172
258 Ga0495617_011719 3300046452 Bacteria 2990
259 Ga0495617_018039 3300046452 Bacteria 2385
260 Ga0495617_020166 3300046452 Bacteria 2252
261 Ga0495617_043809 3300046452 Bacteria 1494
262 Ga0495617_057074 3300046452 Bacteria 1294
263 Ga0495627_000133 3300046453 Bacteria 89977
264 Ga0495627_001238 3300046453 Bacteria 15892
265 Ga0495627_001779 3300046453 Bacteria 11547
266 Ga0495627_002212 3300046453 Bacteria 9673
267 Ga0495627_003726 3300046453 Bacteria 6594
268 Ga0495627_004458 3300046453 Bacteria 5853
269 Ga0495603_0001109 3300046455 Bacteria 15640
270 Ga0495603_0011611 3300046455 Bacteria 5329
271 Ga0495603_0062626 3300046455 Bacteria 2196
272 Ga0495590_0000050 3300046457 Bacteria 105727
273 Ga0495590_0000153 3300046457 Bacteria 41540
274 Ga0495590_0003510 3300046457 Bacteria 6402
275 Ga0495590_0026640 3300046457 Bacteria 2029
276 Ga0495590_0028305 3300046457 Bacteria 1965
277 Ga0495591_000074 3300046458 Bacteria 114062
278 Ga0495591_000143 3300046458 Bacteria 76321
279 Ga0495591_000151 3300046458 Bacteria 73402
280 Ga0495591_000197 3300046458 Bacteria 61590
281 Ga0495591_000263 3300046458 Bacteria 49869
282 Ga0495591_000427 3300046458 Bacteria 34759
283 Ga0495591_003910 3300046458 Bacteria 7507
284 Ga0495591_004299 3300046458 Bacteria 7025
285 Ga0495591_006614 3300046458 Bacteria 5085
286 Ga0495591_007409 3300046458 Bacteria 4669
287 Ga0495591_015129 3300046458 Bacteria 2736
288 Ga0495591_022016 3300046458 Bacteria 2067
289 Ga0495591_045336 3300046458 Bacteria 1226
290 Ga0495629_0155964 3300046459 Bacteria 1586
291 Ga0495638_0001241 3300046460 Bacteria 24034
292 Ga0495638_0002344 3300046460 Bacteria 15537
293 Ga0495638_0002439 3300046460 Bacteria 15177
294 Ga0495638_0004078 3300046460 Bacteria 11193
295 Ga0495638_0004350 3300046460 Bacteria 10733
296 Ga0495638_0005769 3300046460 Bacteria 9117
297 Ga0495638_0018266 3300046460 Bacteria 4660
298 Ga0495638_0072499 3300046460 Bacteria 2104
299 Ga0495638_0076991 3300046460 Bacteria 2031
300 Ga0495638_0084145 3300046460 Bacteria 1925
301 Ga0495653_0010904 3300046463 Bacteria 7440
302 Ga0495653_0059353 3300046463 Bacteria 2904
303 Ga0495650_0000389 3300046471 Bacteria 75118
304 Ga0495650_0001924 3300046471 Bacteria 18400
305 Ga0495650_0003496 3300046471 Bacteria 11408
306 Ga0495650_0003955 3300046471 Bacteria 10421
307 Ga0495650_0018292 3300046471 Bacteria 3485
308 Ga0495650_0020877 3300046471 Bacteria 3181
309 Ga0495650_0047979 3300046471 Bacteria 1782
310 Ga0495605_0000091 3300046474 Bacteria 115482
311 Ga0495605_0000102 3300046474 Bacteria 107430
312 Ga0495605_0000505 3300046474 Bacteria 33476
313 Ga0495605_0000577 3300046474 Bacteria 29725
314 Ga0495605_0000586 3300046474 Bacteria 29236
315 Ga0495605_0000642 3300046474 Bacteria 26793
316 Ga0495605_0021805 3300046474 Bacteria 3388
317 Ga0495605_0028777 3300046474 Bacteria 2866
318 Ga0495605_0029306 3300046474 Bacteria 2835
319 Ga0495605_0029685 3300046474 Bacteria 2809
320 Ga0495605_0084480 3300046474 Bacteria 1480
321 Ga0495639_0000090 3300046475 Bacteria 44069
322 Ga0495639_0008700 3300046475 Bacteria 4352
323 Ga0495639_0042598 3300046475 Bacteria 2048
324 Ga0495584_0000014 3300046491 Bacteria 172880
325 Ga0495584_0000141 3300046491 Bacteria 50024
326 Ga0495584_0001912 3300046491 Bacteria 11990
327 Ga0495584_0007519 3300046491 Bacteria 5679
328 Ga0495584_0012709 3300046491 Bacteria 4297
329 Ga0495584_0014767 3300046491 Bacteria 3978
330 Ga0495584_0097597 3300046491 Bacteria 1484
331 Ga0495585_0000012 3300046492 Bacteria 203064
332 Ga0495585_0000016 3300046492 Bacteria 175433
333 Ga0495585_0005502 3300046492 Bacteria 7972
334 Ga0495585_0011397 3300046492 Bacteria 5262
335 Ga0495585_0018710 3300046492 Bacteria 3995
336 Ga0495585_0020154 3300046492 Bacteria 3837
337 Ga0495585_0059869 3300046492 Bacteria 2097
338 Ga0495585_0061018 3300046492 Bacteria 2074
339 Ga0495585_0064639 3300046492 Bacteria 2006
340 Ga0495585_0080733 3300046492 Bacteria 1762
341 Ga0495594_0002272 3300046499 Bacteria 10015
342 Ga0495594_0024491 3300046499 Bacteria 3242
343 Ga0495596_0000050 3300046500 Bacteria 87493
344 Ga0495596_0004400 3300046500 Bacteria 6876
345 Ga0495596_0012042 3300046500 Bacteria 3712
346 Ga0495607_0000018 3300046501 Bacteria 167673
347 Ga0495607_0000259 3300046501 Bacteria 56558
348 Ga0495607_0000271 3300046501 Bacteria 55714
349 Ga0495607_0002455 3300046501 Bacteria 15063
350 Ga0495607_0006011 3300046501 Bacteria 8606
351 Ga0495607_0010355 3300046501 Bacteria 6273
352 Ga0495607_0013254 3300046501 Bacteria 5410
353 Ga0495607_0017563 3300046501 Bacteria 4588
354 Ga0495607_0020272 3300046501 Bacteria 4206
355 Ga0495607_0025447 3300046501 Bacteria 3680
356 Ga0495607_0052799 3300046501 Bacteria 2352
357 Ga0495607_0054011 3300046501 Bacteria 2316
358 Ga0495583_0000131 3300046506 Bacteria 125393
359 Ga0495583_0000244 3300046506 Bacteria 89766
360 Ga0495583_0001087 3300046506 Bacteria 30092
361 Ga0495583_0001205 3300046506 Bacteria 27737
362 Ga0495583_0001483 3300046506 Bacteria 23474
363 Ga0495583_0002942 3300046506 Bacteria 13720
364 Ga0495583_0013915 3300046506 Bacteria 4460
365 Ga0495606_0000238 3300046507 Bacteria 96877
366 Ga0495606_0000315 3300046507 Bacteria 83545
367 Ga0495606_0000706 3300046507 Bacteria 51756
368 Ga0495606_0000883 3300046507 Bacteria 44862
369 Ga0495606_0001185 3300046507 Bacteria 36734
370 Ga0495606_0001862 3300046507 Bacteria 26483
371 Ga0495606_0002361 3300046507 Bacteria 22160
372 Ga0495606_0007650 3300046507 Bacteria 9586
373 Ga0495606_0013616 3300046507 Bacteria 6413
374 Ga0495606_0045271 3300046507 Bacteria 2918
375 Ga0495606_0060016 3300046507 Bacteria 2437
376 Ga0495610_0000568 3300046512 Bacteria 36829
377 Ga0495610_0004740 3300046512 Bacteria 9924
378 Ga0495610_0006577 3300046512 Bacteria 7947
379 Ga0495610_0010956 3300046512 Bacteria 5584
380 Ga0495616_0000041 3300046513 Bacteria 122413
381 Ga0495616_0000203 3300046513 Bacteria 49328
382 Ga0495616_0000245 3300046513 Bacteria 44179
383 Ga0495616_0000259 3300046513 Bacteria 42870
384 Ga0495616_0000364 3300046513 Bacteria 35589
385 Ga0495616_0026791 3300046513 Bacteria 3063
386 Ga0495616_0030393 3300046513 Bacteria 2839
387 Ga0495616_0032797 3300046513 Bacteria 2710
388 Ga0495616_0041596 3300046513 Bacteria 2343
389 Ga0495616_0043032 3300046513 Bacteria 2295
390 Ga0495616_0048573 3300046513 Bacteria 2131
391 Ga0495620_0000126 3300046515 Bacteria 62048
392 Ga0495620_0000678 3300046515 Bacteria 21047
393 Ga0495620_0001264 3300046515 Bacteria 15433
394 Ga0495620_0002321 3300046515 Bacteria 11021
395 Ga0495620_0014023 3300046515 Bacteria 4087
396 Ga0495620_0014817 3300046515 Bacteria 3951
397 Ga0495620_0021006 3300046515 Bacteria 3177
398 Ga0495620_0074028 3300046515 Bacteria 1388
399 Ga0495630_0018862 3300046517 Bacteria 5070
400 Ga0495630_0042359 3300046517 Bacteria 3400
401 Ga0495630_0068998 3300046517 Bacteria 2659
402 Ga0495631_0000131 3300046518 Bacteria 50430
403 Ga0495631_0000533 3300046518 Bacteria 25521
404 Ga0495631_0000554 3300046518 Bacteria 25074
405 Ga0495631_0000946 3300046518 Bacteria 18094
406 Ga0495631_0015286 3300046518 Bacteria 3680
407 Ga0495631_0029152 3300046518 Bacteria 2513
408 Ga0495631_0040339 3300046518 Bacteria 2068
409 Ga0495632_0000475 3300046519 Bacteria 38064
410 Ga0495632_0000683 3300046519 Bacteria 30990
411 Ga0495632_0002461 3300046519 Bacteria 14088
412 Ga0495632_0003181 3300046519 Bacteria 11833
413 Ga0495632_0003400 3300046519 Bacteria 11328
414 Ga0495632_0007618 3300046519 Bacteria 6769
415 Ga0495632_0047071 3300046519 Bacteria 2140
416 Ga0495632_0059453 3300046519 Bacteria 1859
417 Ga0495632_0063342 3300046519 Bacteria 1790
418 Ga0495632_0083607 3300046519 Bacteria 1520
419 Ga0495637_0000046 3300046520 Bacteria 108118
420 Ga0495637_0000275 3300046520 Bacteria 40472
421 Ga0495637_0002301 3300046520 Bacteria 10584
422 Ga0495637_0005075 3300046520 Bacteria 6754
423 Ga0495637_0007268 3300046520 Bacteria 5507
424 Ga0495637_0008706 3300046520 Bacteria 4975
425 Ga0495637_0023084 3300046520 Bacteria 2831
426 Ga0495637_0029814 3300046520 Bacteria 2425
427 Ga0495637_0031307 3300046520 Bacteria 2354
428 Ga0495637_0086538 3300046520 Bacteria 1242
429 Ga0495643_0000783 3300046522 Bacteria 35376
430 Ga0495643_0000914 3300046522 Bacteria 31057
431 Ga0495643_0009467 3300046522 Bacteria 6055
432 Ga0495643_0099519 3300046522 Bacteria 1491
433 Ga0495644_0000052 3300046523 Bacteria 55714
434 Ga0495644_0000575 3300046523 Bacteria 15400
435 Ga0495644_0007134 3300046523 Bacteria 4321
436 Ga0495644_0020322 3300046523 Bacteria 2534
437 Ga0495648_0002342 3300046524 Bacteria 17587
438 Ga0495648_0002449 3300046524 Bacteria 17121
439 Ga0495648_0005920 3300046524 Bacteria 10063
440 Ga0495648_0008610 3300046524 Bacteria 8002
441 Ga0495648_0017652 3300046524 Bacteria 5090
442 Ga0495648_0018712 3300046524 Bacteria 4890
443 Ga0495648_0035583 3300046524 Bacteria 3226
444 Ga0495648_0037822 3300046524 Bacteria 3095
445 Ga0495648_0060372 3300046524 Bacteria 2256
446 Ga0495648_0062536 3300046524 Bacteria 2203
447 Ga0495648_0071475 3300046524 Bacteria 2011
448 Ga0495666_0000286 3300046526 Bacteria 22158
449 Ga0495666_0015516 3300046526 Bacteria 3793
450 Ga0495666_0019700 3300046526 Bacteria 3345
451 Ga0495666_0036473 3300046526 Bacteria 2394
452 Ga0495642_0000452 3300046528 Bacteria 21635
453 Ga0495642_0000487 3300046528 Bacteria 20318
454 Ga0495642_0006510 3300046528 Bacteria 4479
455 Ga0495654_0000059 3300046530 Bacteria 137056
456 Ga0495654_0000104 3300046530 Bacteria 95266
457 Ga0495654_0000182 3300046530 Bacteria 61568
458 Ga0495654_0000272 3300046530 Bacteria 47029
459 Ga0495654_0000714 3300046530 Bacteria 25967
460 Ga0495654_0003320 3300046530 Bacteria 9909
461 Ga0495654_0009121 3300046530 Bacteria 5440
462 Ga0495654_0010079 3300046530 Bacteria 5154
463 Ga0495654_0010725 3300046530 Bacteria 4976
464 Ga0495654_0013750 3300046530 Bacteria 4325
465 Ga0495654_0013828 3300046530 Bacteria 4308
466 Ga0495654_0013964 3300046530 Bacteria 4284
467 Ga0495654_0020664 3300046530 Bacteria 3430
468 Ga0495654_0029395 3300046530 Bacteria 2803
469 Ga0495654_0033492 3300046530 Bacteria 2599
470 Ga0495654_0047732 3300046530 Bacteria 2103
471 Ga0495654_0076687 3300046530 Bacteria 1574
472 Ga0495654_0093135 3300046530 Bacteria 1396
473 Ga0495587_0001759 3300046536 Bacteria 14480
474 Ga0495587_0029322 3300046536 Bacteria 3340
475 Ga0495609_0000014 3300046538 Bacteria 326023
476 Ga0495609_0000069 3300046538 Bacteria 128601
477 Ga0495609_0001183 3300046538 Bacteria 17998
478 Ga0495609_0003250 3300046538 Bacteria 9401
479 Ga0495609_0011406 3300046538 Bacteria 4233
480 Ga0495609_0041072 3300046538 Bacteria 2080
481 Ga0495597_0000464 3300046542 Bacteria 34458
482 Ga0495597_0008406 3300046542 Bacteria 5174
483 Ga0495597_0009203 3300046542 Bacteria 4896
484 Ga0495597_0010952 3300046542 Bacteria 4409
485 Ga0495597_0013242 3300046542 Bacteria 3957
486 Ga0495597_0034550 3300046542 Bacteria 2284
487 Ga0495597_0038720 3300046542 Bacteria 2136
488 Ga0495597_0044820 3300046542 Bacteria 1965
489 Ga0495645_0262627 3300046543 Bacteria 1142
490 Ga0495622_0000354 3300046557 Bacteria 32338
491 Ga0495622_0000452 3300046557 Bacteria 26316
492 Ga0495622_0006019 3300046557 Bacteria 5635
493 Ga0495622_0011764 3300046557 Bacteria 4045
494 Ga0495622_0014695 3300046557 Bacteria 3636
495 Ga0495622_0051528 3300046557 Bacteria 1909
496 Ga0495633_0000730 3300046558 Bacteria 29769
497 Ga0495633_0010804 3300046558 Bacteria 4965
498 Ga0495656_0011944 3300046615 Bacteria 3195
499 Ga0495668_0001607 3300046616 Bacteria 21184
500 Ga0495668_0014348 3300046616 Bacteria 4648
501 Ga0495668_0060298 3300046616 Bacteria 2093
502 Ga0495634_0000091 3300046642 Bacteria 72170
503 Ga0495634_0103629 3300046642 Bacteria 1836
504 Ga0495611_0000067 3300046648 Bacteria 72577
505 Ga0495611_0000288 3300046648 Bacteria 34211
506 Ga0495611_0001314 3300046648 Bacteria 12648
507 Ga0495611_0057748 3300046648 Bacteria 1759
508 Ga0495625_0000103 3300046660 Bacteria 136109
509 Ga0495625_0000184 3300046660 Bacteria 98137
510 Ga0495625_0000653 3300046660 Bacteria 49602
511 Ga0495625_0001487 3300046660 Bacteria 28260
512 Ga0495625_0002094 3300046660 Bacteria 22301
513 Ga0495625_0008069 3300046660 Bacteria 9028
514 Ga0495625_0022161 3300046660 Bacteria 4875
515 Ga0495625_0076532 3300046660 Bacteria 2339
516 Ga0495625_0084228 3300046660 Bacteria 2208
517 Ga0495625_0171298 3300046660 Bacteria 1449
518 Ga0495635_0000176 3300046663 Bacteria 40149
519 Ga0495635_0000733 3300046663 Bacteria 21217
520 Ga0495659_0000295 3300046664 Bacteria 19818
521 Ga0495661_0000033 3300046665 Bacteria 168033
522 Ga0495661_0000086 3300046665 Bacteria 113945
523 Ga0495661_0003338 3300046665 Bacteria 11890
524 Ga0495661_0014364 3300046665 Bacteria 5305
525 Ga0495661_0035587 3300046665 Bacteria 3122
526 Ga0495661_0049797 3300046665 Bacteria 2538
527 Ga0495661_0070907 3300046665 Bacteria 2037
528 Ga0495588_0011495 3300046674 Bacteria 4157
529 Ga0495588_0027833 3300046674 Bacteria 2827
530 Ga0495588_0033772 3300046674 Bacteria 2585
531 Ga0495657_0191602 3300046675 Bacteria 1249
532 Ga0495623_0071612 3300046679 Bacteria 2156
533 Ga0495646_0006128 3300046680 Bacteria 7627
534 Ga0495646_0029298 3300046680 Bacteria 3441
535 Ga0495646_0044778 3300046680 Bacteria 2704
536 Ga0495669_0000824 3300046684 Bacteria 13219
537 Ga0495669_0001417 3300046684 Bacteria 9861
538 Ga0495613_0010538 3300046689 Bacteria 6862
539 Ga0495613_0050118 3300046689 Bacteria 3080
540 Ga0495670_0000061 3300046691 Bacteria 48947
541 Ga0495670_0000109 3300046691 Bacteria 36580
542 Ga0495670_0000131 3300046691 Bacteria 32446
543 Ga0495670_0002311 3300046691 Bacteria 9421
544 Ga0495670_0024483 3300046691 Bacteria 2983
545 Ga0495670_0054647 3300046691 Bacteria 2001
546 Ga0495670_0089523 3300046691 Bacteria 1574
547 Ga0495671_0000137 3300046692 Bacteria 64587
548 Ga0495671_0001202 3300046692 Bacteria 17712
549 Ga0495671_0002604 3300046692 Bacteria 11351
550 Ga0495671_0003652 3300046692 Bacteria 9371
551 Ga0495671_0025470 3300046692 Bacteria 3074
552 Ga0495671_0027624 3300046692 Bacteria 2928
553 Ga0495671_0035973 3300046692 Bacteria 2511
554 Ga0495671_0036481 3300046692 Bacteria 2489
555 Ga0495671_0081428 3300046692 Bacteria 1586
556 Ga0495671_0121103 3300046692 Bacteria 1276
557 Ga0495649_0000664 3300046694 Bacteria 28100
558 Ga0495649_0001412 3300046694 Bacteria 18138
559 Ga0495649_0002165 3300046694 Bacteria 14055
560 Ga0495649_0002578 3300046694 Bacteria 12678
561 Ga0495649_0002732 3300046694 Bacteria 12284
562 Ga0495649_0008614 3300046694 Bacteria 6126
563 Ga0495649_0014614 3300046694 Bacteria 4491
564 Ga0495649_0044431 3300046694 Bacteria 2425
565 Ga0495589_0000011 3300046794 Bacteria 250370
566 Ga0495589_0000086 3300046794 Bacteria 86130
567 Ga0495589_0000685 3300046794 Bacteria 22064
568 Ga0495589_0000854 3300046794 Bacteria 19110
569 Ga0495589_0001776 3300046794 Bacteria 12260
570 Ga0495589_0001953 3300046794 Bacteria 11676
571 Ga0495589_0003642 3300046794 Bacteria 8322
572 Ga0495589_0004341 3300046794 Bacteria 7561
573 Ga0495589_0025942 3300046794 Bacteria 2970
574 Ga0495589_0029070 3300046794 Bacteria 2786
575 Ga0495600_0041172 3300046809 Bacteria 3010
576 Ga0495660_0000042 3300046810 Bacteria 167048
577 Ga0495660_0002117 3300046810 Bacteria 12848
578 Ga0495660_0003557 3300046810 Bacteria 9612
579 Ga0495660_0004175 3300046810 Bacteria 8783
580 Ga0495660_0005027 3300046810 Bacteria 7953
581 Ga0495660_0006994 3300046810 Bacteria 6650
582 Ga0495660_0009489 3300046810 Bacteria 5674
583 Ga0495660_0009844 3300046810 Bacteria 5563
584 Ga0495660_0010071 3300046810 Bacteria 5498
585 Ga0495660_0013843 3300046810 Bacteria 4675
586 Ga0495660_0014112 3300046810 Bacteria 4628
587 Ga0495660_0037408 3300046810 Bacteria 2702
588 Ga0495660_0046028 3300046810 Bacteria 2393
589 Ga0495660_0055367 3300046810 Bacteria 2147
590 Ga0495660_0055390 3300046810 Bacteria 2147
591 Ga0495660_0081238 3300046810 Bacteria 1699
592 Ga0495660_0145241 3300046810 Bacteria 1176
593 Ga0495581_0018330 3300047315 Bacteria 4066
594 Ga0495581_0050054 3300047315 Bacteria 2413
595 Ga0495604_0001222 3300047317 Bacteria 21073
596 Ga0495604_0062711 3300047317 Bacteria 2838
597 Ga0495636_0011725 3300047318 Bacteria 3473
598 Ga0495674_0000810 3300047319 Bacteria 29755
599 Ga0495672_0000278 3300047320 Bacteria 71017
600 Ga0495672_0000800 3300047320 Bacteria 33912
601 Ga0495672_0001575 3300047320 Bacteria 22321
602 Ga0495672_0001693 3300047320 Bacteria 21357
603 Ga0495672_0016785 3300047320 Bacteria 4914
604 Ga0495672_0019739 3300047320 Bacteria 4439
605 Ga0495672_0041118 3300047320 Bacteria 2798
606 Ga0495672_0043199 3300047320 Bacteria 2711
607 Ga0495672_0081731 3300047320 Bacteria 1798
608 Ga0495672_0091905 3300047320 Bacteria 1664
609 Ga0495672_0149308 3300047320 Bacteria 1213
610 Ga0495676_0000021 3300047321 Bacteria 166180
611 Ga0495676_0000298 3300047321 Bacteria 40228
612 Ga0495680_0014075 3300047322 Bacteria 6949
613 Ga0495680_0016113 3300047322 Bacteria 6426
614 Ga0495680_0034633 3300047322 Bacteria 4074
615 Ga0495683_0000022 3300047323 Bacteria 163268
616 Ga0495683_0000327 3300047323 Bacteria 39970
617 Ga0495683_0006606 3300047323 Bacteria 6323
618 Ga0495683_0006789 3300047323 Bacteria 6223
619 Ga0495683_0007547 3300047323 Bacteria 5865
620 Ga0495683_0034583 3300047323 Bacteria 2569
621 Ga0495683_0051251 3300047323 Bacteria 2064
622 Ga0495683_0053272 3300047323 Bacteria 2018
623 Ga0495683_0054968 3300047323 Bacteria 1982
624 Ga0495687_000081 3300047443 Bacteria 147362
625 Ga0495687_000463 3300047443 Bacteria 49612
626 Ga0495687_000792 3300047443 Bacteria 33996
627 Ga0495687_001276 3300047443 Bacteria 23704
628 Ga0495675_0007448 3300047444 Bacteria 6740
629 Ga0495677_0000299 3300047445 Bacteria 21740
630 Ga0495677_0020605 3300047445 Bacteria 2390
631 Ga0495679_000106 3300047446 Bacteria 75283
632 Ga0495679_001059 3300047446 Bacteria 16719
633 Ga0495679_001852 3300047446 Bacteria 11430
634 Ga0495679_002135 3300047446 Bacteria 10401
635 Ga0495679_027583 3300047446 Bacteria 1871
636 Ga0495685_028774 3300047447 Bacteria 1911
637 Ga0495673_0000107 3300047469 Bacteria 168920
638 Ga0495673_0000536 3300047469 Bacteria 39335
639 Ga0495673_0000609 3300047469 Bacteria 35569
640 Ga0495673_0002805 3300047469 Bacteria 11898
641 Ga0495673_0003568 3300047469 Bacteria 10224
642 Ga0495673_0004419 3300047469 Bacteria 8797
643 Ga0495673_0005869 3300047469 Bacteria 7339
644 Ga0495673_0008877 3300047469 Bacteria 5605
645 Ga0495673_0010840 3300047469 Bacteria 4932
646 Ga0495673_0025184 3300047469 Bacteria 2860
647 Ga0495673_0048232 3300047469 Bacteria 1878
648 Ga0495681_0000109 3300047470 Bacteria 71558
649 Ga0495681_0000831 3300047470 Bacteria 23816
650 Ga0495681_0001811 3300047470 Bacteria 15712
651 Ga0495681_0002361 3300047470 Bacteria 13549
652 Ga0495681_0002406 3300047470 Bacteria 13399
653 Ga0495681_0003712 3300047470 Bacteria 10586
654 Ga0495681_0005492 3300047470 Bacteria 8475
655 Ga0495681_0005958 3300047470 Bacteria 8084
656 Ga0495681_0007473 3300047470 Bacteria 6973
657 Ga0495681_0013316 3300047470 Bacteria 4779
658 Ga0495681_0027199 3300047470 Bacteria 2963
659 Ga0495681_0027289 3300047470 Bacteria 2956
660 Ga0495681_0027928 3300047470 Bacteria 2912
661 Ga0495681_0029362 3300047470 Bacteria 2814
662 Ga0495681_0058388 3300047470 Bacteria 1788
663 Ga0495686_0000439 3300047472 Bacteria 63587
664 Ga0495686_0000475 3300047472 Bacteria 59699
665 Ga0495686_0035231 3300047472 Bacteria 3218
666 Ga0495686_0036252 3300047472 Bacteria 3166
667 Ga0495686_0172650 3300047472 Bacteria 1257
668 Ga0495593_0000551 3300047673 Bacteria 21278
669 Ga0495593_0034638 3300047673 Bacteria 2745
670 Ga0495593_0048208 3300047673 Bacteria 2264
671 Ga0495593_0082255 3300047673 Bacteria 1664
672 Ga0495602_0029881 3300048088 Bacteria 5179
673 Ga0495626_0000074 3300048091 Bacteria 132552
674 Ga0495626_0000112 3300048091 Bacteria 105221
675 Ga0495626_0000114 3300048091 Bacteria 105174
676 Ga0495626_0000279 3300048091 Bacteria 56185
677 Ga0495626_0000303 3300048091 Bacteria 52202
678 Ga0495626_0000538 3300048091 Bacteria 37687
679 Ga0495626_0000744 3300048091 Bacteria 30072
680 Ga0495626_0001326 3300048091 Bacteria 20109
681 Ga0495626_0001554 3300048091 Bacteria 18009
682 Ga0495626_0002282 3300048091 Bacteria 13636
683 Ga0495626_0005276 3300048091 Bacteria 7632
684 Ga0495626_0006970 3300048091 Bacteria 6359
685 Ga0496102_0158626 3300048905 Bacteria 2128
686 Ga0496103_0069867 3300048906 Bacteria 2196
687 Ga0496105_0042927 3300048908 Bacteria 3729
688 Ga0496106_0264617 3300048909 Bacteria 1376
689 Ga0496110_0247167 3300048913 Bacteria 1623
690 Ga0496111_0136288 3300048914 Bacteria 1818
691 Ga0496116_0000654 3300048919 Bacteria 45317
692 Ga0496116_0000858 3300048919 Bacteria 38019
693 Ga0496116_0001153 3300048919 Bacteria 31191
694 Ga0496116_0001414 3300048919 Bacteria 26960
695 Ga0496116_0048049 3300048919 Bacteria 2867
696 Ga0496116_0111835 3300048919 Bacteria 1603
697 Ga0496117_0000100 3300048920 Bacteria 194307
698 Ga0496117_0004465 3300048920 Bacteria 15406
699 Ga0496117_0007211 3300048920 Bacteria 10952
700 Ga0496117_0009186 3300048920 Bacteria 9261
701 Ga0496117_0012635 3300048920 Bacteria 7424
702 Ga0496117_0030750 3300048920 Bacteria 4113
703 Ga0496117_0058221 3300048920 Bacteria 2678
704 Ga0496118_0006907 3300048921 Bacteria 12283
705 Ga0496118_0012776 3300048921 Bacteria 8020
706 Ga0496118_0024933 3300048921 Bacteria 5147
707 Ga0496118_0033531 3300048921 Bacteria 4210
708 Ga0496118_0035749 3300048921 Bacteria 4027
709 Ga0496118_0040929 3300048921 Bacteria 3676
710 Ga0496118_0078693 3300048921 Bacteria 2331
711 Ga0496119_0008749 3300048922 Bacteria 8831
712 Ga0496119_0019649 3300048922 Bacteria 4963
713 Ga0496120_0005831 3300048923 Bacteria 9647
714 Ga0496120_0006095 3300048923 Bacteria 9351
715 Ga0496121_0000160 3300048924 Bacteria 146354
716 Ga0496121_0001858 3300048924 Bacteria 33891
717 Ga0496121_0002636 3300048924 Bacteria 27038
718 Ga0496121_0010373 3300048924 Bacteria 10524
719 Ga0496121_0013684 3300048924 Bacteria 8698
720 Ga0496121_0048629 3300048924 Bacteria 3607
721 Ga0496121_0158833 3300048924 Bacteria 1655
722 Ga0496122_0000259 3300048925 Bacteria 119366
723 Ga0496122_0001003 3300048925 Bacteria 50005
724 Ga0496122_0006723 3300048925 Bacteria 13087
725 Ga0496122_0007079 3300048925 Bacteria 12600
726 Ga0496122_0009373 3300048925 Bacteria 10334
727 Ga0496122_0035471 3300048925 Bacteria 4056
728 Ga0496122_0040344 3300048925 Bacteria 3711
729 Ga0496122_0091104 3300048925 Bacteria 2077
730 Ga0496122_0120772 3300048925 Bacteria 1690
731 Ga0496123_0000209 3300048926 Bacteria 119480
732 Ga0496123_0000956 3300048926 Bacteria 44795
733 Ga0496123_0004671 3300048926 Bacteria 14198
734 Ga0496123_0010220 3300048926 Bacteria 8327
735 Ga0496123_0013118 3300048926 Bacteria 6989
736 Ga0496123_0043593 3300048926 Bacteria 3079
737 Ga0496123_0176401 3300048926 Bacteria 1121
738 Ga0496124_0000338 3300048927 Bacteria 85856
739 Ga0496124_0000580 3300048927 Bacteria 61729
740 Ga0496124_0000922 3300048927 Bacteria 47468
741 Ga0496124_0005330 3300048927 Bacteria 14521
742 Ga0496124_0021010 3300048927 Bacteria 6020
743 Ga0496124_0034836 3300048927 Bacteria 4411
744 Ga0496124_0039481 3300048927 Bacteria 4092
745 Ga0496124_0052666 3300048927 Bacteria 3456
746 Ga0496124_0172047 3300048927 Bacteria 1676
747 Ga0496125_0000245 3300048928 Bacteria 111310
748 Ga0496125_0000992 3300048928 Bacteria 44258
749 Ga0496125_0009503 3300048928 Bacteria 9982
750 Ga0496125_0020733 3300048928 Bacteria 6161
751 Ga0496125_0069236 3300048928 Bacteria 2770
752 Ga0496125_0096772 3300048928 Bacteria 2190
753 Ga0496126_0002098 3300048929 Bacteria 27910
754 Ga0496126_0102808 3300048929 Bacteria 2497
755 Ga0495678_000343 3300049459 Bacteria 48316
756 Ga0495678_000500 3300049459 Bacteria 38668
757 Ga0495678_001452 3300049459 Bacteria 18640
758 Ga0495678_001593 3300049459 Bacteria 17404
759 Ga0495678_001740 3300049459 Bacteria 16194
760 Ga0495678_008303 3300049459 Bacteria 5254
761 Ga0495678_018542 3300049459 Bacteria 3126
762 Ga0495678_037456 3300049459 Bacteria 1970
763 Ga0495678_039366 3300049459 Bacteria 1907
764 Ga0495678_045100 3300049459 Bacteria 1740
765 Ga0495682_0000087 3300049460 Bacteria 80534
766 Ga0495682_0001800 3300049460 Bacteria 10814
767 Ga0495682_0010633 3300049460 Bacteria 3556
768 Ga0495682_0025414 3300049460 Bacteria 2204
769 Ga0501031_0171835 3300049568 Bacteria 1416
770 Ga0501033_0001473 3300049570 Bacteria 20840
771 Ga0501034_0203873 3300049571 Bacteria 1935
772 Ga0501036_0047672 3300049572 Bacteria 3628
773 Ga0501037_0022938 3300049573 Bacteria 4616
774 Ga0501043_0008605 3300049579 Bacteria 8043
775 Ga0501047_0002073 3300049581 Bacteria 19184
776 Ga0501070_0098534 3300049586 Bacteria 2418
777 Ga0501241_000412 3300049758 Bacteria 9388
778 Ga0501035_0002146 3300049822 Bacteria 19622
779 Ga0501035_0002317 3300049822 Bacteria 18779
780 Ga0501044_0014437 3300049823 Bacteria 8527
781 nmdc:mga03683_15020_c1 3300050489 Bacteria 2880
782 nmdc:mga08y16_65337_c1 3300050511 Bacteria 3798
783 nmdc:mga0n895_936_c1 3300050512 Bacteria 21069
784 nmdc:mga0rr50_36921_c1 3300050513 Bacteria 3523
785 nmdc:mga0a205_123954_c1 3300050515 Bacteria 2484
786 nmdc:mga0sz30_1517_c1 3300050516 Bacteria 4271
787 Ga0500569_020577 3300053109 Bacteria 1733
788 Ga0500658_0000051 3300053134 Bacteria 62135
789 Ga0466962_0063268 3300061719 Bacteria 1766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0001241 Ga0495638_0001241_22848_23894 321
2 3300047470 Ga0495681_0002361 Ga0495681_0002361_4638_5684 321
3 3300049822 Ga0501035_0002317 Ga0501035_0002317_6280_7284 321
4 3300013100 Ga0157373_10000874 Ga0157373_1000087410 322
5 3300014497 Ga0182008_10078557 Ga0182008_100785571 322
6 iso_pu_bacteria 2643221556 2643796604 322
7 iso_pu_bacteria 2643221684 2644472726 322
8 iso_pu_bacteria 8047673197 8047675724 322
9 3300014497 Ga0182008_10067814 Ga0182008_100678142 323
10 3300015261 Ga0182006_1001125 Ga0182006_100112514 323
11 3300015262 Ga0182007_10000303 Ga0182007_1000030328 323
12 3300015265 Ga0182005_1001258 Ga0182005_10012583 323
13 3300025291 Ga0209675_1009989 Ga0209675_10099892 323
14 3300025728 Ga0207655_1008249 Ga0207655_10082495 323
15 3300032004 Ga0307414_10004343 Ga0307414_100043437 323
16 3300032005 Ga0307411_10129347 Ga0307411_101293473 323
17 3300046474 Ga0495605_0021805 Ga0495605_0021805_558_1622 323
18 3300046526 Ga0495666_0015516 Ga0495666_0015516_1314_2378 323
19 3300046794 Ga0495589_0029070 Ga0495589_0029070_1124_2188 323
20 3300047315 Ga0495581_0018330 Ga0495581_0018330_2037_3101 323
21 3300047323 Ga0495683_0054968 Ga0495683_0054968_636_1700 323
22 3300048091 Ga0495626_0000538 Ga0495626_0000538_29349_30413 323
23 3300048909 Ga0496106_0264617 Ga0496106_0264617_74_1138 323
24 3300048924 Ga0496121_0158833 Ga0496121_0158833_263_1327 323
25 3300047443 Ga0495687_000081 Ga0495687_000081_78154_79182 324
26 3300053134 Ga0500658_0000051 Ga0500658_0000051_22936_23937 324
27 3300046515 Ga0495620_0001264 Ga0495620_0001264_3937_4929 325
28 3300046528 Ga0495642_0006510 Ga0495642_0006510_85_1077 325
29 3300014497 Ga0182008_10008762 Ga0182008_100087625 326
30 3300044842 Ga0466957_0050527 Ga0466957_0050527_1153_2145 326
31 3300046458 Ga0495591_000151 Ga0495591_000151_6243_7247 326
32 3300046474 Ga0495605_0000102 Ga0495605_0000102_26660_27652 326
33 3300046501 Ga0495607_0010355 Ga0495607_0010355_1860_2852 326
34 3300046501 Ga0495607_0020272 Ga0495607_0020272_452_1444 326
35 3300046507 Ga0495606_0001185 Ga0495606_0001185_3499_4503 326
36 3300046519 Ga0495632_0000683 Ga0495632_0000683_23724_24728 326
37 3300046522 Ga0495643_0000914 Ga0495643_0000914_9914_10906 326
38 3300046522 Ga0495643_0099519 Ga0495643_0099519_297_1289 326
39 3300046524 Ga0495648_0060372 Ga0495648_0060372_39_1031 326
40 3300046665 Ga0495661_0000033 Ga0495661_0000033_46719_47723 326
41 3300046665 Ga0495661_0003338 Ga0495661_0003338_1144_2136 326
42 3300046694 Ga0495649_0008614 Ga0495649_0008614_2332_3324 326
43 3300046794 Ga0495589_0000086 Ga0495589_0000086_58629_59621 326
44 3300046810 Ga0495660_0000042 Ga0495660_0000042_7153_8145 326
45 3300046810 Ga0495660_0081238 Ga0495660_0081238_39_1031 326
46 3300047320 Ga0495672_0000278 Ga0495672_0000278_43363_44355 326
47 3300047323 Ga0495683_0006789 Ga0495683_0006789_3980_4972 326
48 3300047443 Ga0495687_000463 Ga0495687_000463_46743_47735 326
49 3300047445 Ga0495677_0000299 Ga0495677_0000299_13213_14205 326
50 3300047470 Ga0495681_0013316 Ga0495681_0013316_1642_2646 326
51 3300048091 Ga0495626_0000279 Ga0495626_0000279_28684_29676 326
52 3300048925 Ga0496122_0006723 Ga0496122_0006723_10993_11985 326
53 3300048927 Ga0496124_0039481 Ga0496124_0039481_2818_3810 326
54 3300049571 Ga0501034_0203873 Ga0501034_0203873_377_1369 326
55 3300049572 Ga0501036_0047672 Ga0501036_0047672_1666_2658 326
56 3300061719 Ga0466962_0063268 Ga0466962_0063268_588_1583 326
57 3300013306 Ga0163162_10458734 Ga0163162_104587342 327
58 3300038705 Ga0237819_00520 Ga0237819_00520_11128_12120 327
59 3300046459 Ga0495629_0155964 Ga0495629_0155964_30_1031 327
60 3300046648 Ga0495611_0057748 Ga0495611_0057748_27_1010 327
61 3300006871 Ga0075434_100000694 Ga0075434_1000006948 328
62 3300007076 Ga0075435_100036120 Ga0075435_1000361205 328
63 3300027907 Ga0207428_10085594 Ga0207428_100855943 328
64 3300035115 Ga0373941_0021623 Ga0373941_0021623_303_1355 328
65 3300035207 Ga0373942_0016077 Ga0373942_0016077_180_1232 328
66 3300035691 Ga0373931_0016616 Ga0373931_0016616_1342_2394 328
67 3300050511 nmdc:mga08y16_65337_c1 nmdc:mga08y16_65337_c1_2001_3053 328
68 3300050512 nmdc:mga0n895_936_c1 nmdc:mga0n895_936_c1_10952_12004 328
69 3300050513 nmdc:mga0rr50_36921_c1 nmdc:mga0rr50_36921_c1_1521_2573 328
70 3300050515 nmdc:mga0a205_123954_c1 nmdc:mga0a205_123954_c1_1378_2436 328
71 3300005289 Ga0065704_10005347 Ga0065704_100053473 329
72 3300006946 Ga0079104_1001585 Ga0079104_10015853 329
73 3300027111 Ga0209281_1000143 Ga0209281_100014378 329
74 3300006186 Ga0075369_10032178 Ga0075369_100321781 330
75 3300046810 Ga0495660_0004175 Ga0495660_0004175_4056_5126 330
76 3300049459 Ga0495678_001452 Ga0495678_001452_7682_8815 330
77 3300050516 nmdc:mga0sz30_1517_c1 nmdc:mga0sz30_1517_c1_1012_2067 330
78 3300042009 Ga0439451_000604 Ga0439451_000604_3683_4690 331
79 3300042013 Ga0439456_005303 Ga0439456_005303_101_1108 331
80 3300046453 Ga0495627_002212 Ga0495627_002212_2731_3735 331
81 3300046460 Ga0495638_0018266 Ga0495638_0018266_2320_3387 331
82 3300046471 Ga0495650_0000389 Ga0495650_0000389_70226_71296 331
83 3300046492 Ga0495585_0059869 Ga0495585_0059869_416_1486 331
84 3300046506 Ga0495583_0000244 Ga0495583_0000244_60587_61657 331
85 3300046513 Ga0495616_0043032 Ga0495616_0043032_1004_2074 331
86 3300046518 Ga0495631_0015286 Ga0495631_0015286_936_2006 331
87 3300046519 Ga0495632_0059453 Ga0495632_0059453_405_1475 331
88 3300046520 Ga0495637_0000046 Ga0495637_0000046_36061_37131 331
89 3300046557 Ga0495622_0006019 Ga0495622_0006019_3224_4294 331
90 3300046648 Ga0495611_0000288 Ga0495611_0000288_28220_29290 331
91 3300046660 Ga0495625_0000184 Ga0495625_0000184_60536_61606 331
92 3300047320 Ga0495672_0081731 Ga0495672_0081731_583_1653 331
93 3300047321 Ga0495676_0000021 Ga0495676_0000021_128761_129831 331
94 3300047469 Ga0495673_0025184 Ga0495673_0025184_104_1174 331
95 3300047472 Ga0495686_0035231 Ga0495686_0035231_1080_2150 331
96 3300049459 Ga0495678_018542 Ga0495678_018542_1096_2166 331
97 3300009036 Ga0105244_10037921 Ga0105244_100379212 332
98 3300046460 Ga0495638_0084145 Ga0495638_0084145_223_1278 332
99 3300046501 Ga0495607_0052799 Ga0495607_0052799_388_1443 332
100 3300046538 Ga0495609_0000014 Ga0495609_0000014_193244_194311 332
101 3300046542 Ga0495597_0009203 Ga0495597_0009203_1171_2226 332
102 3300047317 Ga0495604_0001222 Ga0495604_0001222_1672_2739 332
103 iso_pu_bacteria 2675903420 2677896217 332
104 iso_pu_bacteria 2919456309 2919460429 332
105 iso_pu_bacteria 2946006987 2946009516 332
106 3300017792 Ga0163161_10042217 Ga0163161_100422172 333
107 3300046453 Ga0495627_000133 Ga0495627_000133_42972_44045 333
108 3300046513 Ga0495616_0000041 Ga0495616_0000041_65683_66756 333
109 3300046519 Ga0495632_0000475 Ga0495632_0000475_13447_14520 333
110 3300046524 Ga0495648_0035583 Ga0495648_0035583_51_1124 333
111 3300046530 Ga0495654_0000104 Ga0495654_0000104_81143_82216 333
112 3300046660 Ga0495625_0000103 Ga0495625_0000103_54974_56047 333
113 3300046810 Ga0495660_0003557 Ga0495660_0003557_313_1386 333
114 3300047469 Ga0495673_0005869 Ga0495673_0005869_6088_7161 333
115 3300048091 Ga0495626_0000074 Ga0495626_0000074_76508_77581 333
116 3300049459 Ga0495678_000500 Ga0495678_000500_12324_13397 333
117 3300046689 Ga0495613_0050118 Ga0495613_0050118_1290_2306 334
118 iso_pu_bacteria 2808606445 2809215172 334
119 iso_pu_bacteria 2511231031 2511415886 335
120 iso_pu_bacteria 2599185167 2599398505 335
121 iso_pu_bacteria 2599185179 2599450554 335
122 iso_pu_bacteria 2599185190 2599512991 335
123 iso_pu_bacteria 2599185191 2599521641 335
124 iso_pu_bacteria 2599185290 2599891668 335
125 iso_pu_bacteria 2713897148 2715754090 335
126 iso_pu_bacteria 2718217725 2718634394 335
127 iso_pu_bacteria 2738543025 2739312056 335
128 iso_pu_bacteria 2842832357 2842834950 335
129 iso_pu_bacteria 2842843487 2842843881 335
130 iso_pu_bacteria 2919385768 2919387258 335
131 iso_pu_bacteria 2919487758 2919491950 335
132 iso_pu_bacteria 2931390751 2931393762 335
133 iso_pu_bacteria 2969304461 2969307258 335
134 iso_pu_bacteria 2974289157 2974290660 335
135 iso_pu_bacteria 2998139840 2998143150 335
136 iso_pu_bacteria 3007614139 3007615083 335
137 iso_pu_bacteria 3007855910 3007857141 335
138 iso_pu_bacteria 8029995093 8029997633 335
139 iso_pu_bacteria 8056166840 8056168031 335
140 3300017792 Ga0163161_10122984 Ga0163161_101229842 336
141 3300046491 Ga0495584_0000141 Ga0495584_0000141_46950_48020 336
142 3300046507 Ga0495606_0000315 Ga0495606_0000315_5392_6462 336
143 3300046665 Ga0495661_0000086 Ga0495661_0000086_97161_98231 336
144 3300046675 Ga0495657_0191602 Ga0495657_0191602_145_1206 336
145 3300046809 Ga0495600_0041172 Ga0495600_0041172_528_1589 336
146 3300047470 Ga0495681_0005492 Ga0495681_0005492_4284_5354 336
147 3300048925 Ga0496122_0091104 Ga0496122_0091104_408_1427 336
148 3300048926 Ga0496123_0176401 Ga0496123_0176401_14_1033 336
149 iso_pu_bacteria 2908446538 2908449471 336
150 iso_pu_bacteria 3007861166 3007862256 336
151 3300003791 Ga0055530_10022040 Ga0055530_100220402 337
152 3300013102 Ga0157371_10003297 Ga0157371_1000329715 337
153 3300025298 Ga0209050_1001041 Ga0209050_100104117 337
154 3300042006 Ga0439432_011068 Ga0439432_011068_1725_2744 337
155 3300046538 Ga0495609_0000069 Ga0495609_0000069_6105_7175 337
156 3300047446 Ga0495679_000106 Ga0495679_000106_1391_2461 337
157 3300048091 Ga0495626_0000114 Ga0495626_0000114_36811_37881 337
158 3300048919 Ga0496116_0001414 Ga0496116_0001414_15338_16360 337
159 3300048924 Ga0496121_0000160 Ga0496121_0000160_68656_69675 337
160 3300048925 Ga0496122_0001003 Ga0496122_0001003_19913_20932 337
161 3300048926 Ga0496123_0000956 Ga0496123_0000956_23882_24901 337
162 3300048927 Ga0496124_0000922 Ga0496124_0000922_26784_27803 337
163 3300048928 Ga0496125_0000992 Ga0496125_0000992_23289_24308 337
164 iso_pu_bacteria 2511231011 2511298510 337
165 iso_pu_bacteria 2773857673 2774138099 337
166 iso_pu_bacteria 2784132063 2784264806 337
167 iso_pu_bacteria 2818991456 2819654790 337
168 iso_pu_bacteria 2834028612 2834033608 337
169 iso_pu_bacteria 2852657418 2852662270 337
170 iso_pu_bacteria 2904518522 2904521982 337
171 iso_pu_bacteria 2945961074 2945963975 337
172 iso_pu_bacteria 3007395558 3007401695 337
173 3300003791 Ga0055530_10000103 Ga0055530_1000010361 338
174 3300003794 Ga0055531_10002226 Ga0055531_1000222614 338
175 3300025292 Ga0209676_1000113 Ga0209676_100011310 338
176 3300025292 Ga0209676_1008145 Ga0209676_10081454 338
177 3300025298 Ga0209050_1000126 Ga0209050_100012610 338
178 3300025304 Ga0209257_1000155 Ga0209257_100015581 338
179 3300025304 Ga0209257_1000256 Ga0209257_10002565 338
180 3300046492 Ga0495585_0064639 Ga0495585_0064639_256_1281 338
181 3300046526 Ga0495666_0000286 Ga0495666_0000286_1355_2422 338
182 3300046543 Ga0495645_0262627 Ga0495645_0262627_23_1057 338
183 3300046679 Ga0495623_0071612 Ga0495623_0071612_492_1559 338
184 3300047323 Ga0495683_0007547 Ga0495683_0007547_3736_4803 338
185 3300047673 Ga0495593_0000551 Ga0495593_0000551_18553_19620 338
186 iso_pu_bacteria 2512047018 2512323469 338
187 iso_pu_bacteria 2582580891 2583791901 338
188 iso_pu_bacteria 2740892503 2743737160 338
189 iso_pu_bacteria 2923153595 2923156193 338
190 iso_pu_bacteria 8055770955 8055773535 338
191 3300003781 Ga0055536_1000262 Ga0055536_100026217 339
192 3300005353 Ga0070669_100027628 Ga0070669_1000276282 339
193 3300005539 Ga0068853_100008887 Ga0068853_1000088873 339
194 3300005834 Ga0068851_10038578 Ga0068851_100385782 339
195 3300006946 Ga0079104_1002557 Ga0079104_10025572 339
196 3300006946 Ga0079104_1015347 Ga0079104_10153471 339
197 3300009011 Ga0105251_10000363 Ga0105251_1000036321 339
198 3300009092 Ga0105250_10022004 Ga0105250_100220043 339
199 3300012498 Ga0157345_1000122 Ga0157345_10001223 339
200 3300013100 Ga0157373_10000374 Ga0157373_1000037415 339
201 3300013100 Ga0157373_10075534 Ga0157373_100755342 339
202 3300013102 Ga0157371_10003129 Ga0157371_1000312911 339
203 3300013104 Ga0157370_10138035 Ga0157370_101380353 339
204 3300013105 Ga0157369_10001093 Ga0157369_1000109313 339
205 3300013105 Ga0157369_10002233 Ga0157369_100022339 339
206 3300013105 Ga0157369_10030798 Ga0157369_100307986 339
207 3300013105 Ga0157369_10269774 Ga0157369_102697742 339
208 3300013306 Ga0163162_10000137 Ga0163162_1000013732 339
209 3300013308 Ga0157375_10000050 Ga0157375_100000507 339
210 3300014497 Ga0182008_10002492 Ga0182008_100024928 339
211 3300015261 Ga0182006_1000396 Ga0182006_100039621 339
212 3300017792 Ga0163161_10000054 Ga0163161_1000005474 339
213 3300017792 Ga0163161_10016214 Ga0163161_100162143 339
214 3300025292 Ga0209676_1000050 Ga0209676_1000050143 339
215 3300025711 Ga0207696_1006322 Ga0207696_10063223 339
216 3300025728 Ga0207655_1004390 Ga0207655_100439013 339
217 3300025735 Ga0207713_1006184 Ga0207713_10061845 339
218 3300025923 Ga0207681_10005164 Ga0207681_100051643 339
219 3300025933 Ga0207706_10009243 Ga0207706_100092437 339
220 3300026041 Ga0207639_10068990 Ga0207639_100689901 339
221 3300027111 Ga0209281_1005093 Ga0209281_10050933 339
222 3300030735 Ga0316178_1159482 Ga0316178_11594822 339
223 3300031548 Ga0307408_100021029 Ga0307408_1000210294 339
224 3300031911 Ga0307412_10045661 Ga0307412_100456611 339
225 3300032002 Ga0307416_100299513 Ga0307416_1002995131 339
226 3300032005 Ga0307411_10006051 Ga0307411_100060512 339
227 3300041405 Ga0439438_000129 Ga0439438_000129_32707_33741 339
228 3300041405 Ga0439438_000587 Ga0439438_000587_5844_6878 339
229 3300041407 Ga0439447_023297 Ga0439447_023297_417_1451 339
230 3300041411 Ga0439466_0022937 Ga0439466_0022937_263_1297 339
231 3300042006 Ga0439432_010607 Ga0439432_010607_879_1913 339
232 3300042010 Ga0439452_000045 Ga0439452_000045_52124_53158 339
233 3300042010 Ga0439452_018562 Ga0439452_018562_638_1672 339
234 3300042013 Ga0439456_002046 Ga0439456_002046_1232_2266 339
235 3300042016 Ga0439463_006639 Ga0439463_006639_280_1314 339
236 3300042115 Ga0450911_000095 Ga0450911_000095_10195_11229 339
237 3300042138 Ga0450903_014349 Ga0450903_014349_110_1144 339
238 3300042138 Ga0450903_014665 Ga0450903_014665_67_1188 339
239 3300042139 Ga0450904_002992 Ga0450904_002992_159_1193 339
240 3300042145 Ga0450906_000046 Ga0450906_000046_16914_17948 339
241 3300046452 Ga0495617_043809 Ga0495617_043809_238_1266 339
242 3300046453 Ga0495627_001238 Ga0495627_001238_11834_12862 339
243 3300046453 Ga0495627_001779 Ga0495627_001779_8963_9991 339
244 3300046453 Ga0495627_004458 Ga0495627_004458_2080_3108 339
245 3300046458 Ga0495591_000197 Ga0495591_000197_22909_23937 339
246 3300046458 Ga0495591_000263 Ga0495591_000263_34939_35967 339
247 3300046458 Ga0495591_000427 Ga0495591_000427_23278_24345 339
248 3300046458 Ga0495591_004299 Ga0495591_004299_4357_5385 339
249 3300046458 Ga0495591_006614 Ga0495591_006614_3094_4122 339
250 3300046463 Ga0495653_0010904 Ga0495653_0010904_3905_4933 339
251 3300046463 Ga0495653_0059353 Ga0495653_0059353_485_1513 339
252 3300046471 Ga0495650_0018292 Ga0495650_0018292_1644_2672 339
253 3300046474 Ga0495605_0000642 Ga0495605_0000642_15963_16991 339
254 3300046491 Ga0495584_0012709 Ga0495584_0012709_1415_2443 339
255 3300046492 Ga0495585_0011397 Ga0495585_0011397_4136_5164 339
256 3300046492 Ga0495585_0061018 Ga0495585_0061018_99_1127 339
257 3300046500 Ga0495596_0004400 Ga0495596_0004400_5759_6787 339
258 3300046500 Ga0495596_0012042 Ga0495596_0012042_537_1565 339
259 3300046501 Ga0495607_0000271 Ga0495607_0000271_476_1504 339
260 3300046501 Ga0495607_0002455 Ga0495607_0002455_310_1338 339
261 3300046501 Ga0495607_0017563 Ga0495607_0017563_3395_4423 339
262 3300046501 Ga0495607_0054011 Ga0495607_0054011_864_1892 339
263 3300046506 Ga0495583_0001483 Ga0495583_0001483_9321_10388 339
264 3300046506 Ga0495583_0002942 Ga0495583_0002942_753_1781 339
265 3300046507 Ga0495606_0013616 Ga0495606_0013616_4949_5977 339
266 3300046507 Ga0495606_0060016 Ga0495606_0060016_381_1409 339
267 3300046512 Ga0495610_0000568 Ga0495610_0000568_16857_17924 339
268 3300046512 Ga0495610_0010956 Ga0495610_0010956_3154_4182 339
269 3300046513 Ga0495616_0000364 Ga0495616_0000364_12245_13273 339
270 3300046513 Ga0495616_0032797 Ga0495616_0032797_310_1338 339
271 3300046515 Ga0495620_0000126 Ga0495620_0000126_6630_7658 339
272 3300046519 Ga0495632_0003181 Ga0495632_0003181_9057_10085 339
273 3300046520 Ga0495637_0000275 Ga0495637_0000275_8691_9719 339
274 3300046520 Ga0495637_0029814 Ga0495637_0029814_354_1382 339
275 3300046520 Ga0495637_0086538 Ga0495637_0086538_11_1039 339
276 3300046522 Ga0495643_0000783 Ga0495643_0000783_696_1724 339
277 3300046522 Ga0495643_0009467 Ga0495643_0009467_308_1336 339
278 3300046524 Ga0495648_0002449 Ga0495648_0002449_5961_6989 339
279 3300046524 Ga0495648_0037822 Ga0495648_0037822_1014_2042 339
280 3300046524 Ga0495648_0071475 Ga0495648_0071475_380_1408 339
281 3300046530 Ga0495654_0000182 Ga0495654_0000182_12141_13169 339
282 3300046530 Ga0495654_0000714 Ga0495654_0000714_9302_10369 339
283 3300046530 Ga0495654_0009121 Ga0495654_0009121_353_1381 339
284 3300046530 Ga0495654_0010079 Ga0495654_0010079_1540_2568 339
285 3300046530 Ga0495654_0013964 Ga0495654_0013964_1017_2084 339
286 3300046538 Ga0495609_0001183 Ga0495609_0001183_16323_17351 339
287 3300046538 Ga0495609_0003250 Ga0495609_0003250_8053_9081 339
288 3300046557 Ga0495622_0000452 Ga0495622_0000452_16220_17248 339
289 3300046557 Ga0495622_0014695 Ga0495622_0014695_528_1595 339
290 3300046558 Ga0495633_0000730 Ga0495633_0000730_26913_27941 339
291 3300046648 Ga0495611_0000067 Ga0495611_0000067_8573_9601 339
292 3300046660 Ga0495625_0001487 Ga0495625_0001487_10504_11532 339
293 3300046660 Ga0495625_0002094 Ga0495625_0002094_793_1821 339
294 3300046660 Ga0495625_0076532 Ga0495625_0076532_352_1380 339
295 3300046665 Ga0495661_0049797 Ga0495661_0049797_1033_2061 339
296 3300046674 Ga0495588_0011495 Ga0495588_0011495_2846_3913 339
297 3300046691 Ga0495670_0000061 Ga0495670_0000061_8418_9446 339
298 3300046692 Ga0495671_0003652 Ga0495671_0003652_7917_8945 339
299 3300046692 Ga0495671_0027624 Ga0495671_0027624_512_1540 339
300 3300046692 Ga0495671_0036481 Ga0495671_0036481_1426_2454 339
301 3300046694 Ga0495649_0000664 Ga0495649_0000664_11047_12075 339
302 3300046694 Ga0495649_0002165 Ga0495649_0002165_3558_4625 339
303 3300046694 Ga0495649_0014614 Ga0495649_0014614_240_1268 339
304 3300046694 Ga0495649_0044431 Ga0495649_0044431_1016_2044 339
305 3300046794 Ga0495589_0000011 Ga0495589_0000011_190969_191997 339
306 3300046810 Ga0495660_0002117 Ga0495660_0002117_11455_12483 339
307 3300046810 Ga0495660_0009844 Ga0495660_0009844_438_1466 339
308 3300046810 Ga0495660_0010071 Ga0495660_0010071_4150_5178 339
309 3300046810 Ga0495660_0037408 Ga0495660_0037408_1355_2383 339
310 3300046810 Ga0495660_0055367 Ga0495660_0055367_382_1410 339
311 3300047320 Ga0495672_0016785 Ga0495672_0016785_3139_4206 339
312 3300047320 Ga0495672_0019739 Ga0495672_0019739_1691_2719 339
313 3300047320 Ga0495672_0149308 Ga0495672_0149308_60_1088 339
314 3300047321 Ga0495676_0000298 Ga0495676_0000298_1789_2817 339
315 3300047446 Ga0495679_002135 Ga0495679_002135_3152_4180 339
316 3300047469 Ga0495673_0000536 Ga0495673_0000536_28948_30015 339
317 3300047469 Ga0495673_0000609 Ga0495673_0000609_9692_10720 339
318 3300047469 Ga0495673_0010840 Ga0495673_0010840_3466_4494 339
319 3300047470 Ga0495681_0001811 Ga0495681_0001811_756_1784 339
320 3300047470 Ga0495681_0029362 Ga0495681_0029362_381_1409 339
321 3300047472 Ga0495686_0000475 Ga0495686_0000475_43202_44230 339
322 3300048091 Ga0495626_0000303 Ga0495626_0000303_41705_42772 339
323 3300048091 Ga0495626_0002282 Ga0495626_0002282_3111_4139 339
324 3300048091 Ga0495626_0006970 Ga0495626_0006970_427_1455 339
325 3300048919 Ga0496116_0000858 Ga0496116_0000858_30772_31839 339
326 3300048920 Ga0496117_0009186 Ga0496117_0009186_6747_7775 339
327 3300048922 Ga0496119_0008749 Ga0496119_0008749_1310_2338 339
328 3300048923 Ga0496120_0005831 Ga0496120_0005831_7120_8148 339
329 3300048924 Ga0496121_0013684 Ga0496121_0013684_6708_7736 339
330 3300048926 Ga0496123_0013118 Ga0496123_0013118_791_1819 339
331 3300048927 Ga0496124_0052666 Ga0496124_0052666_1418_2446 339
332 3300048927 Ga0496124_0172047 Ga0496124_0172047_471_1505 339
333 3300048928 Ga0496125_0009503 Ga0496125_0009503_7032_8060 339
334 3300049459 Ga0495678_000343 Ga0495678_000343_46982_48010 339
335 3300049459 Ga0495678_001593 Ga0495678_001593_4360_5388 339
336 3300049459 Ga0495678_001740 Ga0495678_001740_14860_15888 339
337 3300049459 Ga0495678_037456 Ga0495678_037456_529_1755 339
338 3300049460 Ga0495682_0001800 Ga0495682_0001800_8005_9033 339
339 3300049460 Ga0495682_0025414 Ga0495682_0025414_292_1320 339
340 3300049568 Ga0501031_0171835 Ga0501031_0171835_259_1290 339
341 3300049570 Ga0501033_0001473 Ga0501033_0001473_5942_6973 339
342 3300049573 Ga0501037_0022938 Ga0501037_0022938_1329_2360 339
343 3300049579 Ga0501043_0008605 Ga0501043_0008605_2129_3160 339
344 3300049581 Ga0501047_0002073 Ga0501047_0002073_4692_5723 339
345 3300049586 Ga0501070_0098534 Ga0501070_0098534_1066_2097 339
346 3300049758 Ga0501241_000412 Ga0501241_000412_1534_2562 339
347 3300049822 Ga0501035_0002146 Ga0501035_0002146_4984_6015 339
348 3300049823 Ga0501044_0014437 Ga0501044_0014437_1960_2991 339
349 iso_pu_bacteria 2511231010 2511292175 339
350 iso_pu_bacteria 2597489887 2597857724 339
351 iso_pu_bacteria 2599185185 2599484350 339
352 iso_pu_bacteria 2599185257 2599802384 339
353 iso_pu_bacteria 2600255318 2601799263 339
354 iso_pu_bacteria 2603880185 2606078507 339
355 iso_pu_bacteria 2603880199 2606130615 339
356 iso_pu_bacteria 2623620443 2624480241 339
357 iso_pu_bacteria 2671180172 2671769998 339
358 iso_pu_bacteria 2713897149 2715758573 339
359 iso_pu_bacteria 2878029506 2878032147 339
360 iso_pu_bacteria 2917699015 2917703178 339
361 iso_pu_bacteria 2919063839 2919068752 339
362 iso_pu_bacteria 2984286254 2984289843 339
363 iso_pu_bacteria 3007718800 3007721968 339
364 3300046520 Ga0495637_0007268 Ga0495637_0007268_4323_5354 340
365 3300046524 Ga0495648_0005920 Ga0495648_0005920_5792_6832 340
366 3300048925 Ga0496122_0120772 Ga0496122_0120772_534_1601 340
367 3300048926 Ga0496123_0004671 Ga0496123_0004671_2548_3615 340
368 iso_pu_bacteria 3005452660 3005457958 340
369 3300002737 JGI25162J39368_1000013 JGI25162J39368_1000013248 341
370 3300002771 JGI25163J39215_1000157 JGI25163J39215_10001574 341
371 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005248 341
372 3300003214 JGI25165J46597_1000099 JGI25165J46597_100009931 341
373 3300006058 Ga0075432_10061129 Ga0075432_100611291 341
374 3300009092 Ga0105250_10000155 Ga0105250_1000015535 341
375 3300013307 Ga0157372_10001800 Ga0157372_100018008 341
376 3300014497 Ga0182008_10000496 Ga0182008_100004968 341
377 3300015261 Ga0182006_1015839 Ga0182006_10158392 341
378 3300015262 Ga0182007_10000394 Ga0182007_1000039422 341
379 3300015265 Ga0182005_1008300 Ga0182005_10083003 341
380 3300025207 Ga0209760_100035 Ga0209760_1000354 341
381 3300025230 Ga0209563_102378 Ga0209563_1023783 341
382 3300025231 Ga0207427_100018 Ga0207427_100018408 341
383 3300025233 Ga0209437_100031 Ga0209437_100031408 341
384 3300025261 Ga0209233_1000012 Ga0209233_1000012405 341
385 3300025711 Ga0207696_1000223 Ga0207696_100022328 341
386 3300025728 Ga0207655_1002401 Ga0207655_100240112 341
387 3300025735 Ga0207713_1009642 Ga0207713_10096421 341
388 3300025735 Ga0207713_1025331 Ga0207713_10253313 341
389 3300027907 Ga0207428_10047480 Ga0207428_100474804 341
390 3300042137 Ga0450902_008530 Ga0450902_008530_243_1307 341
391 3300046457 Ga0495590_0000153 Ga0495590_0000153_23501_24538 341
392 3300046501 Ga0495607_0000259 Ga0495607_0000259_31986_33023 341
393 3300046512 Ga0495610_0004740 Ga0495610_0004740_5605_6645 341
394 3300046513 Ga0495616_0000203 Ga0495616_0000203_24801_25838 341
395 3300046515 Ga0495620_0002321 Ga0495620_0002321_6182_7222 341
396 3300046530 Ga0495654_0020664 Ga0495654_0020664_1516_2556 341
397 3300047470 Ga0495681_0000109 Ga0495681_0000109_23482_24519 341
398 3300047470 Ga0495681_0003712 Ga0495681_0003712_3697_4737 341
399 3300048088 Ga0495602_0029881 Ga0495602_0029881_3404_4447 341
400 3300048919 Ga0496116_0000654 Ga0496116_0000654_6248_7282 341
401 3300048921 Ga0496118_0012776 Ga0496118_0012776_529_1563 341
402 3300048924 Ga0496121_0001858 Ga0496121_0001858_15796_16830 341
403 3300048925 Ga0496122_0035471 Ga0496122_0035471_2305_3339 341
404 3300049460 Ga0495682_0010633 Ga0495682_0010633_2209_3276 341
405 iso_pu_bacteria 2600254931 2600368475 341
406 iso_pu_bacteria 8015687852 8015690405 341
407 3300046492 Ga0495585_0020154 Ga0495585_0020154_1887_2924 342
408 3300046506 Ga0495583_0000131 Ga0495583_0000131_93172_94209 342
409 3300046507 Ga0495606_0002361 Ga0495606_0002361_12197_13264 342
410 3300046520 Ga0495637_0031307 Ga0495637_0031307_998_2074 342
411 3300046530 Ga0495654_0000059 Ga0495654_0000059_121490_122527 342
412 3300046691 Ga0495670_0000109 Ga0495670_0000109_9342_10379 342
413 3300046692 Ga0495671_0081428 Ga0495671_0081428_416_1492 342
414 3300047469 Ga0495673_0008877 Ga0495673_0008877_2560_3597 342
415 3300003781 Ga0055536_1000088 Ga0055536_100008880 343
416 3300003791 Ga0055530_10000087 Ga0055530_1000008780 343
417 3300005563 Ga0068855_100115595 Ga0068855_1001155954 343
418 3300009093 Ga0105240_10094827 Ga0105240_100948273 343
419 3300025292 Ga0209676_1000003 Ga0209676_10000031128 343
420 3300025298 Ga0209050_1000004 Ga0209050_10000041110 343
421 3300025303 Ga0209051_1000052 Ga0209051_1000052146 343
422 3300025913 Ga0207695_10068337 Ga0207695_100683372 343
423 3300042147 Ga0450910_000024 Ga0450910_000024_353_1399 343
424 3300046452 Ga0495617_000202 Ga0495617_000202_8322_9389 343
425 3300046530 Ga0495654_0093135 Ga0495654_0093135_246_1289 343
426 iso_pu_bacteria 3007718800 3007721889 343
427 iso_pu_bacteria 8056172158 8056173937 343
428 3300006058 Ga0075432_10028232 Ga0075432_100282322 344
429 3300027907 Ga0207428_10022576 Ga0207428_100225762 344
430 3300046457 Ga0495590_0003510 Ga0495590_0003510_4952_6019 344
431 3300046458 Ga0495591_000074 Ga0495591_000074_84985_86028 344
432 3300046794 Ga0495589_0000685 Ga0495589_0000685_7062_8114 344
433 3300047446 Ga0495679_001852 Ga0495679_001852_3203_4255 344
434 3300048919 Ga0496116_0111835 Ga0496116_0111835_531_1583 344
435 3300048920 Ga0496117_0000100 Ga0496117_0000100_146130_147182 344
436 3300048921 Ga0496118_0033531 Ga0496118_0033531_602_1654 344
437 3300048922 Ga0496119_0019649 Ga0496119_0019649_42_1094 344
438 3300048923 Ga0496120_0006095 Ga0496120_0006095_4918_5970 344
439 3300048926 Ga0496123_0043593 Ga0496123_0043593_569_1621 344
440 3300048927 Ga0496124_0000338 Ga0496124_0000338_10024_11076 344
441 3300048927 Ga0496124_0034836 Ga0496124_0034836_1326_2369 344
442 3300048928 Ga0496125_0000245 Ga0496125_0000245_60008_61060 344
443 3300053109 Ga0500569_020577 Ga0500569_020577_585_1640 344
444 iso_pu_bacteria 8056569372 8056574119 344
445 3300009036 Ga0105244_10029457 Ga0105244_100294571 345
446 3300009092 Ga0105250_10061001 Ga0105250_100610012 345
447 3300041411 Ga0439466_0000118 Ga0439466_0000118_28132_29184 345
448 iso_pu_bacteria 2600255318 2601799397 345
449 iso_pu_bacteria 2603880185 2606078370 345
450 iso_pu_bacteria 2603880199 2606130478 345
451 iso_pu_bacteria 2623620443 2624480366 345
452 iso_pu_bacteria 2651869719 2652546062 345
453 iso_pu_bacteria 2713897149 2715760078 345
454 iso_pu_bacteria 2878029506 2878032293 345
455 iso_pu_bacteria 2919063839 2919068625 345
456 iso_pu_bacteria 3007419365 3007423240 345
457 3300046460 Ga0495638_0005769 Ga0495638_0005769_1874_2926 346
458 3300046471 Ga0495650_0020877 Ga0495650_0020877_1710_2804 346
459 3300046474 Ga0495605_0028777 Ga0495605_0028777_1617_2711 346
460 3300046507 Ga0495606_0000706 Ga0495606_0000706_373_1467 346
461 3300046513 Ga0495616_0000259 Ga0495616_0000259_1789_2883 346
462 3300046515 Ga0495620_0021006 Ga0495620_0021006_1666_2760 346
463 3300046518 Ga0495631_0000554 Ga0495631_0000554_1684_2778 346
464 3300046530 Ga0495654_0013750 Ga0495654_0013750_1254_2306 346
465 3300046530 Ga0495654_0033492 Ga0495654_0033492_80_1174 346
466 3300046542 Ga0495597_0000464 Ga0495597_0000464_1710_2804 346
467 3300046810 Ga0495660_0013843 Ga0495660_0013843_2542_3636 346
468 3300048091 Ga0495626_0001554 Ga0495626_0001554_14300_15394 346
469 iso_pu_bacteria 2511231004 2511257014 346
470 iso_pu_bacteria 2511231007 2511271201 346
471 iso_pu_bacteria 2599185212 2599612518 346
472 iso_pu_bacteria 2599185311 2599993502 346
473 iso_pu_bacteria 2599185316 2600022105 346
474 iso_pu_bacteria 2599185318 2600035122 346
475 iso_pu_bacteria 2599185319 2600040768 346
476 iso_pu_bacteria 2599185322 2600059385 346
477 iso_pu_bacteria 2599185323 2600063105 346
478 iso_pu_bacteria 2599185325 2600075379 346
479 iso_pu_bacteria 2600254930 2600357554 346
480 iso_pu_bacteria 2623620446 2624492938 346
481 iso_pu_bacteria 2667528176 2671126458 346
482 iso_pu_bacteria 2675903515 2678265461 346
483 iso_pu_bacteria 2744054620 2745005912 346
484 iso_pu_bacteria 2808606377 2808933267 346
485 iso_pu_bacteria 2808606381 2808955359 346
486 iso_pu_bacteria 2808606382 2808957973 346
487 iso_pu_bacteria 2860339153 2860345480 346
488 iso_pu_bacteria 2919697872 2919699793 346
489 iso_pu_bacteria 2931396565 2931402802 346
490 iso_pu_bacteria 3007511990 3007514773 346
491 iso_pu_bacteria 8019775933 8019775935 346
492 iso_pu_bacteria 8056155041 8056157510 346
493 iso_pu_bacteria 2511231008 2511276933 347
494 iso_pu_bacteria 2511231012 2511304943 347
495 iso_pu_bacteria 2511231014 2511312436 347
496 iso_pu_bacteria 2511231015 2511321555 347
497 iso_pu_bacteria 2511231020 2511347871 347
498 iso_pu_bacteria 2511231021 2511360194 347
499 iso_pu_bacteria 2643221565 2643845833 347
500 iso_pu_bacteria 2643221589 2643954451 347
501 iso_pu_bacteria 2643221602 2644023260 347
502 iso_pu_bacteria 2738543004 2739197226 347
503 iso_pu_bacteria 2738543015 2739257919 347
504 iso_pu_bacteria 2791355520 2794595991 347
505 iso_pu_bacteria 2904550169 2904550210 347
506 iso_pu_bacteria 2923586266 2923588693 347
507 iso_pu_bacteria 2939636861 2939638817 347
508 iso_pu_bacteria 8056125926 8056128828 347
509 iso_pu_bacteria 8056177738 8056182575 347
510 3300038705 Ga0237819_00218 Ga0237819_00218_16577_17638 348
511 3300046491 Ga0495584_0000014 Ga0495584_0000014_42520_43575 348
512 3300046519 Ga0495632_0083607 Ga0495632_0083607_246_1304 348
513 3300046520 Ga0495637_0008706 Ga0495637_0008706_2950_4008 348
514 3300046794 Ga0495589_0003642 Ga0495589_0003642_5554_6612 348
515 3300046810 Ga0495660_0006994 Ga0495660_0006994_869_1924 348
516 3300047320 Ga0495672_0000800 Ga0495672_0000800_23141_24208 348
517 3300049459 Ga0495678_008303 Ga0495678_008303_825_1880 348
518 3300049459 Ga0495678_039366 Ga0495678_039366_119_1174 348
519 iso_pu_bacteria 2599185248 2599772255 348
520 iso_pu_bacteria 2599185289 2599885310 348
521 iso_pu_bacteria 2599185291 2599898977 348
522 iso_pu_bacteria 2599185305 2599959963 348
523 iso_pu_bacteria 2599185313 2600006156 348
524 iso_pu_bacteria 2599185315 2600016471 348
525 iso_pu_bacteria 2599185321 2600051677 348
526 iso_pu_bacteria 2599185324 2600071001 348
527 iso_pu_bacteria 2643221650 2644284488 348
528 iso_pu_bacteria 2667528170 2671091593 348
529 iso_pu_bacteria 2825651385 2825651776 348
530 iso_pu_bacteria 2931369376 2931375402 348
531 iso_pu_bacteria 3007619802 3007623586 348
532 3300003781 Ga0055536_1000013 Ga0055536_1000013100 349
533 3300003791 Ga0055530_10001656 Ga0055530_1000165615 349
534 3300003791 Ga0055530_10002474 Ga0055530_1000247412 349
535 3300003792 Ga0055540_1000008 Ga0055540_1000008147 349
536 3300003794 Ga0055531_10000182 Ga0055531_100001824 349
537 3300005288 Ga0065714_10008363 Ga0065714_100083633 349
538 3300005353 Ga0070669_100013571 Ga0070669_1000135714 349
539 3300006946 Ga0079104_1000094 Ga0079104_100009470 349
540 3300006948 Ga0099826_10037688 Ga0099826_100376883 349
541 3300009011 Ga0105251_10033401 Ga0105251_100334012 349
542 3300009011 Ga0105251_10037418 Ga0105251_100374182 349
543 3300009011 Ga0105251_10127775 Ga0105251_101277751 349
544 3300009036 Ga0105244_10022163 Ga0105244_100221633 349
545 3300009092 Ga0105250_10013848 Ga0105250_100138483 349
546 3300009148 Ga0105243_10000060 Ga0105243_1000006074 349
547 3300011119 Ga0105246_10000723 Ga0105246_100007233 349
548 3300025292 Ga0209676_1000002 Ga0209676_10000021425 349
549 3300025298 Ga0209050_1000006 Ga0209050_1000006146 349
550 3300025303 Ga0209051_1000001 Ga0209051_10000011425 349
551 3300025304 Ga0209257_1000029 Ga0209257_1000029146 349
552 3300025711 Ga0207696_1001477 Ga0207696_10014775 349
553 3300025728 Ga0207655_1000076 Ga0207655_1000076131 349
554 3300025735 Ga0207713_1001910 Ga0207713_100191013 349
555 3300025735 Ga0207713_1002185 Ga0207713_10021859 349
556 3300025735 Ga0207713_1004432 Ga0207713_10044324 349
557 3300025923 Ga0207681_10059355 Ga0207681_100593552 349
558 3300025935 Ga0207709_10000004 Ga0207709_1000000472 349
559 3300027111 Ga0209281_1000212 Ga0209281_100021262 349
560 3300046475 Ga0495639_0000090 Ga0495639_0000090_29470_30531 349
561 3300046499 Ga0495594_0002272 Ga0495594_0002272_1356_2417 349
562 3300046530 Ga0495654_0013828 Ga0495654_0013828_2662_3720 349
563 3300046530 Ga0495654_0047732 Ga0495654_0047732_809_1870 349
564 3300046557 Ga0495622_0000354 Ga0495622_0000354_1914_2975 349
565 3300046810 Ga0495660_0005027 Ga0495660_0005027_6807_7856 349
566 3300047469 Ga0495673_0004419 Ga0495673_0004419_7437_8498 349
567 3300048927 Ga0496124_0005330 Ga0496124_0005330_11183_12244 349
568 iso_pu_bacteria 2511231018 2511340723 349
569 iso_pu_bacteria 2511231019 2511346555 349
570 iso_pu_bacteria 2511231156 2511824911 349
571 iso_pu_bacteria 2599185189 2599507417 349
572 iso_pu_bacteria 2599185302 2599941274 349
573 iso_pu_bacteria 2599185303 2599946620 349
574 iso_pu_bacteria 2599185304 2599953206 349
575 iso_pu_bacteria 2599185306 2599966951 349
576 iso_pu_bacteria 2599185308 2599978454 349
577 iso_pu_bacteria 2599185309 2599982542 349
578 iso_pu_bacteria 2599185310 2599989860 349
579 iso_pu_bacteria 2599185312 2599998753 349
580 iso_pu_bacteria 2599185314 2600012621 349
581 iso_pu_bacteria 2599185320 2600047433 349
582 iso_pu_bacteria 2600255296 2601691856 349
583 iso_pu_bacteria 2643221571 2643874193 349
584 iso_pu_bacteria 2643221633 2644189190 349
585 iso_pu_bacteria 2773857670 2774123159 349
586 iso_pu_bacteria 2784132072 2784315435 349
587 iso_pu_bacteria 2808606361 2808858737 349
588 iso_pu_bacteria 2808606376 2808927167 349
589 iso_pu_bacteria 2808606378 2808938888 349
590 iso_pu_bacteria 2808606380 2808949270 349
591 iso_pu_bacteria 2808606383 2808967239 349
592 iso_pu_bacteria 2808606389 2809002051 349
593 iso_pu_bacteria 2842837860 2842839304 349
594 iso_pu_bacteria 2842854478 2842857784 349
595 iso_pu_bacteria 2860867994 2860870579 349
596 iso_pu_bacteria 2913036834 2913039862 349
597 iso_pu_bacteria 2919481497 2919484900 349
598 iso_pu_bacteria 2947233263 2947237785 349
599 iso_pu_bacteria 2988728565 2988728583 349
600 iso_pu_bacteria 8054347763 8054352235 349
601 iso_pu_bacteria 8056143049 8056146337 349
602 iso_pu_bacteria 8056148874 8056154793 349
603 3300009011 Ga0105251_10007455 Ga0105251_100074552 350
604 3300009036 Ga0105244_10027757 Ga0105244_100277573 350
605 3300013100 Ga0157373_10012407 Ga0157373_100124075 350
606 3300013104 Ga0157370_10035411 Ga0157370_100354112 350
607 3300031548 Ga0307408_100035970 Ga0307408_1000359702 350
608 3300041407 Ga0439447_000152 Ga0439447_000152_7981_9045 350
609 3300042137 Ga0450902_001250 Ga0450902_001250_2143_3210 350
610 3300046460 Ga0495638_0004350 Ga0495638_0004350_6726_7790 350
611 3300046474 Ga0495605_0000091 Ga0495605_0000091_20168_21232 350
612 3300046501 Ga0495607_0006011 Ga0495607_0006011_2406_3470 350
613 3300046506 Ga0495583_0013915 Ga0495583_0013915_1360_2424 350
614 3300046530 Ga0495654_0000272 Ga0495654_0000272_10662_11726 350
615 3300046664 Ga0495659_0000295 Ga0495659_0000295_11213_12277 350
616 3300046691 Ga0495670_0000131 Ga0495670_0000131_2528_3592 350
617 3300046694 Ga0495649_0002732 Ga0495649_0002732_3906_4970 350
618 3300046810 Ga0495660_0014112 Ga0495660_0014112_2388_3452 350
619 3300047443 Ga0495687_001276 Ga0495687_001276_17799_18863 350
620 3300047469 Ga0495673_0002805 Ga0495673_0002805_9352_10416 350
621 3300048908 Ga0496105_0042927 Ga0496105_0042927_1099_2163 350
622 3300048919 Ga0496116_0001153 Ga0496116_0001153_11018_12082 350
623 3300048920 Ga0496117_0004465 Ga0496117_0004465_12086_13153 350
624 3300048921 Ga0496118_0035749 Ga0496118_0035749_1922_2986 350
625 3300048925 Ga0496122_0007079 Ga0496122_0007079_7505_8569 350
626 3300005288 Ga0065714_10003199 Ga0065714_1000319910 351
627 3300005288 Ga0065714_10068620 Ga0065714_100686203 351
628 3300005288 Ga0065714_10077065 Ga0065714_100770652 351
629 3300006051 Ga0075364_10028129 Ga0075364_100281292 351
630 3300006058 Ga0075432_10000700 Ga0075432_100007006 351
631 3300006058 Ga0075432_10005082 Ga0075432_100050822 351
632 3300006177 Ga0075362_10032169 Ga0075362_100321692 351
633 3300006946 Ga0079104_1000537 Ga0079104_100053732 351
634 3300009011 Ga0105251_10003033 Ga0105251_100030331 351
635 3300009036 Ga0105244_10065924 Ga0105244_100659242 351
636 3300013104 Ga0157370_10022555 Ga0157370_100225558 351
637 3300014497 Ga0182008_10012414 Ga0182008_100124142 351
638 3300015265 Ga0182005_1007476 Ga0182005_10074763 351
639 3300015265 Ga0182005_1010822 Ga0182005_10108222 351
640 3300017792 Ga0163161_10002749 Ga0163161_100027494 351
641 3300025292 Ga0209676_1005636 Ga0209676_10056365 351
642 3300025298 Ga0209050_1000321 Ga0209050_100032172 351
643 3300025728 Ga0207655_1018119 Ga0207655_10181191 351
644 3300027111 Ga0209281_1000046 Ga0209281_1000046143 351
645 3300027907 Ga0207428_10061117 Ga0207428_100611172 351
646 3300027907 Ga0207428_10075095 Ga0207428_100750952 351
647 3300041405 Ga0439438_002048 Ga0439438_002048_646_1713 351
648 3300041407 Ga0439447_000131 Ga0439447_000131_15207_16274 351
649 3300042006 Ga0439432_010385 Ga0439432_010385_792_1859 351
650 3300042010 Ga0439452_000046 Ga0439452_000046_77236_78303 351
651 3300042013 Ga0439456_007189 Ga0439456_007189_459_1526 351
652 3300042184 Ga0450908_015220 Ga0450908_015220_78_1145 351
653 3300046452 Ga0495617_011719 Ga0495617_011719_1361_2428 351
654 3300046452 Ga0495617_018039 Ga0495617_018039_1151_2218 351
655 3300046452 Ga0495617_057074 Ga0495617_057074_165_1226 351
656 3300046453 Ga0495627_003726 Ga0495627_003726_496_1563 351
657 3300046455 Ga0495603_0062626 Ga0495603_0062626_291_1352 351
658 3300046457 Ga0495590_0000050 Ga0495590_0000050_9713_10780 351
659 3300046457 Ga0495590_0028305 Ga0495590_0028305_122_1189 351
660 3300046458 Ga0495591_000143 Ga0495591_000143_2508_3575 351
661 3300046458 Ga0495591_022016 Ga0495591_022016_52_1119 351
662 3300046458 Ga0495591_045336 Ga0495591_045336_17_1084 351
663 3300046460 Ga0495638_0002344 Ga0495638_0002344_7425_8492 351
664 3300046460 Ga0495638_0004078 Ga0495638_0004078_3991_5058 351
665 3300046460 Ga0495638_0076991 Ga0495638_0076991_23_1090 351
666 3300046471 Ga0495650_0001924 Ga0495650_0001924_1907_2974 351
667 3300046471 Ga0495650_0003955 Ga0495650_0003955_324_1391 351
668 3300046471 Ga0495650_0047979 Ga0495650_0047979_581_1642 351
669 3300046474 Ga0495605_0000505 Ga0495605_0000505_22722_23789 351
670 3300046474 Ga0495605_0000577 Ga0495605_0000577_12965_14032 351
671 3300046474 Ga0495605_0029306 Ga0495605_0029306_58_1119 351
672 3300046474 Ga0495605_0084480 Ga0495605_0084480_103_1170 351
673 3300046475 Ga0495639_0008700 Ga0495639_0008700_1039_2112 351
674 3300046491 Ga0495584_0001912 Ga0495584_0001912_6611_7678 351
675 3300046491 Ga0495584_0007519 Ga0495584_0007519_1159_2226 351
676 3300046491 Ga0495584_0097597 Ga0495584_0097597_250_1317 351
677 3300046492 Ga0495585_0000016 Ga0495585_0000016_160661_161716 351
678 3300046492 Ga0495585_0005502 Ga0495585_0005502_6710_7777 351
679 3300046492 Ga0495585_0018710 Ga0495585_0018710_1132_2193 351
680 3300046492 Ga0495585_0080733 Ga0495585_0080733_602_1663 351
681 3300046499 Ga0495594_0024491 Ga0495594_0024491_1557_2630 351
682 3300046500 Ga0495596_0000050 Ga0495596_0000050_8504_9571 351
683 3300046501 Ga0495607_0000018 Ga0495607_0000018_6654_7721 351
684 3300046501 Ga0495607_0013254 Ga0495607_0013254_2872_3939 351
685 3300046501 Ga0495607_0025447 Ga0495607_0025447_800_1861 351
686 3300046506 Ga0495583_0001205 Ga0495583_0001205_7675_8742 351
687 3300046507 Ga0495606_0000238 Ga0495606_0000238_62812_63879 351
688 3300046507 Ga0495606_0001862 Ga0495606_0001862_19591_20658 351
689 3300046507 Ga0495606_0007650 Ga0495606_0007650_5527_6594 351
690 3300046507 Ga0495606_0045271 Ga0495606_0045271_1768_2829 351
691 3300046513 Ga0495616_0026791 Ga0495616_0026791_180_1241 351
692 3300046513 Ga0495616_0041596 Ga0495616_0041596_817_1884 351
693 3300046513 Ga0495616_0048573 Ga0495616_0048573_265_1332 351
694 3300046515 Ga0495620_0000678 Ga0495620_0000678_13425_14492 351
695 3300046515 Ga0495620_0014023 Ga0495620_0014023_1803_2864 351
696 3300046515 Ga0495620_0014817 Ga0495620_0014817_2480_3547 351
697 3300046515 Ga0495620_0074028 Ga0495620_0074028_126_1193 351
698 3300046518 Ga0495631_0000533 Ga0495631_0000533_22639_23700 351
699 3300046518 Ga0495631_0000946 Ga0495631_0000946_5935_7002 351
700 3300046519 Ga0495632_0007618 Ga0495632_0007618_3096_4163 351
701 3300046519 Ga0495632_0047071 Ga0495632_0047071_1051_2118 351
702 3300046519 Ga0495632_0063342 Ga0495632_0063342_208_1275 351
703 3300046520 Ga0495637_0002301 Ga0495637_0002301_3161_4228 351
704 3300046523 Ga0495644_0000052 Ga0495644_0000052_5566_6633 351
705 3300046523 Ga0495644_0000575 Ga0495644_0000575_7279_8346 351
706 3300046523 Ga0495644_0007134 Ga0495644_0007134_665_1732 351
707 3300046524 Ga0495648_0002342 Ga0495648_0002342_14294_15361 351
708 3300046524 Ga0495648_0017652 Ga0495648_0017652_1031_2098 351
709 3300046524 Ga0495648_0062536 Ga0495648_0062536_282_1349 351
710 3300046526 Ga0495666_0019700 Ga0495666_0019700_1555_2628 351
711 3300046528 Ga0495642_0000487 Ga0495642_0000487_6746_7813 351
712 3300046530 Ga0495654_0010725 Ga0495654_0010725_3106_4173 351
713 3300046530 Ga0495654_0029395 Ga0495654_0029395_1043_2104 351
714 3300046530 Ga0495654_0076687 Ga0495654_0076687_95_1162 351
715 3300046542 Ga0495597_0010952 Ga0495597_0010952_72_1139 351
716 3300046542 Ga0495597_0034550 Ga0495597_0034550_370_1437 351
717 3300046542 Ga0495597_0038720 Ga0495597_0038720_242_1309 351
718 3300046542 Ga0495597_0044820 Ga0495597_0044820_394_1461 351
719 3300046558 Ga0495633_0010804 Ga0495633_0010804_2087_3148 351
720 3300046616 Ga0495668_0001607 Ga0495668_0001607_304_1371 351
721 3300046616 Ga0495668_0014348 Ga0495668_0014348_481_1548 351
722 3300046642 Ga0495634_0103629 Ga0495634_0103629_497_1570 351
723 3300046648 Ga0495611_0001314 Ga0495611_0001314_193_1260 351
724 3300046660 Ga0495625_0000653 Ga0495625_0000653_18589_19656 351
725 3300046660 Ga0495625_0008069 Ga0495625_0008069_5828_6895 351
726 3300046660 Ga0495625_0022161 Ga0495625_0022161_3730_4791 351
727 3300046660 Ga0495625_0084228 Ga0495625_0084228_564_1631 351
728 3300046665 Ga0495661_0014364 Ga0495661_0014364_388_1455 351
729 3300046665 Ga0495661_0070907 Ga0495661_0070907_919_1986 351
730 3300046674 Ga0495588_0027833 Ga0495588_0027833_1221_2294 351
731 3300046684 Ga0495669_0000824 Ga0495669_0000824_8599_9666 351
732 3300046691 Ga0495670_0002311 Ga0495670_0002311_7780_8847 351
733 3300046691 Ga0495670_0024483 Ga0495670_0024483_1051_2118 351
734 3300046691 Ga0495670_0089523 Ga0495670_0089523_174_1241 351
735 3300046692 Ga0495671_0001202 Ga0495671_0001202_11345_12412 351
736 3300046692 Ga0495671_0002604 Ga0495671_0002604_8336_9403 351
737 3300046692 Ga0495671_0025470 Ga0495671_0025470_1686_2753 351
738 3300046694 Ga0495649_0001412 Ga0495649_0001412_9155_10222 351
739 3300046694 Ga0495649_0002578 Ga0495649_0002578_11156_12223 351
740 3300046794 Ga0495589_0000854 Ga0495589_0000854_3804_4871 351
741 3300046794 Ga0495589_0001953 Ga0495589_0001953_5476_6543 351
742 3300046794 Ga0495589_0004341 Ga0495589_0004341_1843_2910 351
743 3300046810 Ga0495660_0009489 Ga0495660_0009489_437_1504 351
744 3300046810 Ga0495660_0046028 Ga0495660_0046028_409_1476 351
745 3300046810 Ga0495660_0145241 Ga0495660_0145241_47_1114 351
746 3300047315 Ga0495581_0050054 Ga0495581_0050054_1043_2116 351
747 3300047320 Ga0495672_0001575 Ga0495672_0001575_8549_9616 351
748 3300047320 Ga0495672_0001693 Ga0495672_0001693_7035_8102 351
749 3300047320 Ga0495672_0043199 Ga0495672_0043199_165_1232 351
750 3300047323 Ga0495683_0000022 Ga0495683_0000022_142716_143783 351
751 3300047323 Ga0495683_0000327 Ga0495683_0000327_1822_2883 351
752 3300047323 Ga0495683_0006606 Ga0495683_0006606_46_1113 351
753 3300047323 Ga0495683_0034583 Ga0495683_0034583_777_1844 351
754 3300047323 Ga0495683_0051251 Ga0495683_0051251_726_1793 351
755 3300047443 Ga0495687_000792 Ga0495687_000792_24623_25690 351
756 3300047446 Ga0495679_001059 Ga0495679_001059_229_1296 351
757 3300047469 Ga0495673_0003568 Ga0495673_0003568_2066_3127 351
758 3300047469 Ga0495673_0048232 Ga0495673_0048232_546_1613 351
759 3300047470 Ga0495681_0002406 Ga0495681_0002406_564_1631 351
760 3300047470 Ga0495681_0005958 Ga0495681_0005958_6132_7193 351
761 3300047470 Ga0495681_0007473 Ga0495681_0007473_3811_4878 351
762 3300047470 Ga0495681_0027289 Ga0495681_0027289_84_1145 351
763 3300047472 Ga0495686_0036252 Ga0495686_0036252_1739_2800 351
764 3300047472 Ga0495686_0172650 Ga0495686_0172650_86_1153 351
765 3300048091 Ga0495626_0000112 Ga0495626_0000112_9265_10332 351
766 3300048091 Ga0495626_0000744 Ga0495626_0000744_20485_21552 351
767 3300048091 Ga0495626_0001326 Ga0495626_0001326_8348_9415 351
768 3300048919 Ga0496116_0048049 Ga0496116_0048049_350_1417 351
769 3300048920 Ga0496117_0058221 Ga0496117_0058221_331_1398 351
770 3300048921 Ga0496118_0024933 Ga0496118_0024933_132_1199 351
771 3300048924 Ga0496121_0002636 Ga0496121_0002636_18902_19969 351
772 3300048925 Ga0496122_0009373 Ga0496122_0009373_490_1557 351
773 3300048926 Ga0496123_0010220 Ga0496123_0010220_2643_3710 351
774 3300048927 Ga0496124_0000580 Ga0496124_0000580_26697_27764 351
775 3300048928 Ga0496125_0096772 Ga0496125_0096772_828_1889 351
776 3300049460 Ga0495682_0000087 Ga0495682_0000087_6218_7285 351
777 3300050489 nmdc:mga03683_15020_c1 nmdc:mga03683_15020_c1_799_1866 351
778 3300003791 Ga0055530_10000016 Ga0055530_1000001628 352
779 3300003792 Ga0055540_1000048 Ga0055540_100004828 352
780 3300005289 Ga0065704_10093687 Ga0065704_100936872 352
781 3300014497 Ga0182008_10001714 Ga0182008_100017145 352
782 3300015261 Ga0182006_1017555 Ga0182006_10175553 352
783 3300015262 Ga0182007_10003110 Ga0182007_100031103 352
784 3300025292 Ga0209676_1002427 Ga0209676_10024274 352
785 3300025298 Ga0209050_1000013 Ga0209050_1000013218 352
786 3300025303 Ga0209051_1000007 Ga0209051_1000007218 352
787 3300041405 Ga0439438_002096 Ga0439438_002096_5134_6204 352
788 3300041407 Ga0439447_001180 Ga0439447_001180_79_1149 352
789 3300041411 Ga0439466_0041876 Ga0439466_0041876_115_1185 352
790 3300042010 Ga0439452_004581 Ga0439452_004581_877_1947 352
791 3300046557 Ga0495622_0051528 Ga0495622_0051528_599_1657 352
792 3300046674 Ga0495588_0033772 Ga0495588_0033772_725_1783 352
793 3300047469 Ga0495673_0000107 Ga0495673_0000107_132126_133193 352
794 3300047470 Ga0495681_0000831 Ga0495681_0000831_19389_20474 352
795 3300047673 Ga0495593_0034638 Ga0495593_0034638_353_1411 352
796 2162886007 SwRhRL2b_contig_2455006 SwRhRL2b_0621.00001600 353
797 3300005564 Ga0070664_100000024 Ga0070664_10000002480 353
798 3300009036 Ga0105244_10000449 Ga0105244_100004497 353
799 3300009092 Ga0105250_10000015 Ga0105250_10000015108 353
800 3300009176 Ga0105242_10067130 Ga0105242_100671302 353
801 3300009176 Ga0105242_10142055 Ga0105242_101420552 353
802 3300009545 Ga0105237_10000042 Ga0105237_10000042105 353
803 3300011119 Ga0105246_10027075 Ga0105246_100270752 353
804 3300013100 Ga0157373_10045459 Ga0157373_100454592 353
805 3300013104 Ga0157370_10057151 Ga0157370_100571513 353
806 3300013104 Ga0157370_10147558 Ga0157370_101475582 353
807 3300013105 Ga0157369_10002926 Ga0157369_100029262 353
808 3300013306 Ga0163162_10007127 Ga0163162_100071273 353
809 3300013308 Ga0157375_10047614 Ga0157375_100476144 353
810 3300025711 Ga0207696_1000017 Ga0207696_100001770 353
811 3300025711 Ga0207696_1012781 Ga0207696_10127813 353
812 3300025728 Ga0207655_1000070 Ga0207655_100007014 353
813 3300025728 Ga0207655_1006108 Ga0207655_100610810 353
814 3300025728 Ga0207655_1024886 Ga0207655_10248862 353
815 3300025735 Ga0207713_1000073 Ga0207713_100007334 353
816 3300025735 Ga0207713_1019313 Ga0207713_10193133 353
817 3300025735 Ga0207713_1024366 Ga0207713_10243663 353
818 3300025914 Ga0207671_10000474 Ga0207671_1000047425 353
819 3300025920 Ga0207649_10000010 Ga0207649_10000010199 353
820 3300025934 Ga0207686_10024380 Ga0207686_100243804 353
821 3300025945 Ga0207679_10000022 Ga0207679_10000022115 353
822 3300030521 Ga0307511_10032874 Ga0307511_100328745 353
823 3300031911 Ga0307412_10001360 Ga0307412_100013603 353
824 3300032004 Ga0307414_10271898 Ga0307414_102718981 353
825 3300042115 Ga0450911_001378 Ga0450911_001378_3593_4666 353
826 3300042138 Ga0450903_004432 Ga0450903_004432_1315_2376 353
827 3300046458 Ga0495591_003910 Ga0495591_003910_4820_5893 353
828 3300046458 Ga0495591_007409 Ga0495591_007409_1012_2085 353
829 3300046460 Ga0495638_0002439 Ga0495638_0002439_8662_9735 353
830 3300046507 Ga0495606_0000883 Ga0495606_0000883_32648_33721 353
831 3300046518 Ga0495631_0040339 Ga0495631_0040339_994_2055 353
832 3300046520 Ga0495637_0005075 Ga0495637_0005075_3909_4982 353
833 3300046524 Ga0495648_0008610 Ga0495648_0008610_1010_2083 353
834 3300046542 Ga0495597_0008406 Ga0495597_0008406_4001_5065 353
835 3300046684 Ga0495669_0001417 Ga0495669_0001417_5915_6976 353
836 3300046794 Ga0495589_0001776 Ga0495589_0001776_995_2068 353
837 3300047318 Ga0495636_0011725 Ga0495636_0011725_2160_3233 353
838 3300047320 Ga0495672_0091905 Ga0495672_0091905_590_1651 353
839 3300047470 Ga0495681_0027928 Ga0495681_0027928_308_1381 353
840 3300048920 Ga0496117_0007211 Ga0496117_0007211_1017_2090 353
841 3300048920 Ga0496117_0030750 Ga0496117_0030750_1245_2318 353
842 3300048921 Ga0496118_0006907 Ga0496118_0006907_10156_11229 353
843 3300048921 Ga0496118_0040929 Ga0496118_0040929_2224_3297 353
844 3300048924 Ga0496121_0010373 Ga0496121_0010373_1002_2075 353
845 3300048924 Ga0496121_0048629 Ga0496121_0048629_1654_2727 353
846 3300048925 Ga0496122_0000259 Ga0496122_0000259_41929_43002 353
847 3300048925 Ga0496122_0040344 Ga0496122_0040344_1007_2080 353
848 3300048926 Ga0496123_0000209 Ga0496123_0000209_41958_43031 353
849 3300048927 Ga0496124_0021010 Ga0496124_0021010_1018_2091 353
850 3300048928 Ga0496125_0020733 Ga0496125_0020733_4207_5268 353
851 3300048928 Ga0496125_0069236 Ga0496125_0069236_1022_2095 353
852 3300048929 Ga0496126_0002098 Ga0496126_0002098_1015_2088 353
853 3300046518 Ga0495631_0000131 Ga0495631_0000131_32997_34076 355
854 3300047322 Ga0495680_0034633 Ga0495680_0034633_1546_2628 355
855 3300013104 Ga0157370_10009404 Ga0157370_100094042 356
856 3300046455 Ga0495603_0011611 Ga0495603_0011611_4097_5176 356
857 3300046475 Ga0495639_0042598 Ga0495639_0042598_587_1666 356
858 3300046518 Ga0495631_0029152 Ga0495631_0029152_417_1619 356
859 3300046538 Ga0495609_0041072 Ga0495609_0041072_653_1732 356
860 3300046557 Ga0495622_0011764 Ga0495622_0011764_2597_3676 356
861 3300046691 Ga0495670_0054647 Ga0495670_0054647_769_1848 356
862 3300046692 Ga0495671_0000137 Ga0495671_0000137_41521_42723 356
863 3300046692 Ga0495671_0121103 Ga0495671_0121103_147_1226 356
864 3300047323 Ga0495683_0053272 Ga0495683_0053272_163_1242 356
865 3300048091 Ga0495626_0005276 Ga0495626_0005276_5141_6343 356
866 3300013104 Ga0157370_10011916 Ga0157370_1001191611 357
867 3300014497 Ga0182008_10003801 Ga0182008_100038015 357
868 3300015261 Ga0182006_1010118 Ga0182006_10101185 357
869 3300046474 Ga0495605_0000586 Ga0495605_0000586_850_2037 357
870 3300046517 Ga0495630_0018862 Ga0495630_0018862_555_1742 357
871 3300046526 Ga0495666_0036473 Ga0495666_0036473_130_1317 357
872 3300046536 Ga0495587_0001759 Ga0495587_0001759_11869_13056 357
873 3300046642 Ga0495634_0000091 Ga0495634_0000091_70132_71319 357
874 3300046663 Ga0495635_0000176 Ga0495635_0000176_37923_39110 357
875 3300046680 Ga0495646_0029298 Ga0495646_0029298_1592_2779 357
876 3300046680 Ga0495646_0044778 Ga0495646_0044778_854_2041 357
877 3300047319 Ga0495674_0000810 Ga0495674_0000810_862_2049 357
878 3300048905 Ga0496102_0158626 Ga0496102_0158626_906_1994 357
879 3300048906 Ga0496103_0069867 Ga0496103_0069867_974_2062 357
880 3300048920 Ga0496117_0012635 Ga0496117_0012635_6210_7298 357
881 3300048921 Ga0496118_0078693 Ga0496118_0078693_135_1223 357
882 3300048929 Ga0496126_0102808 Ga0496126_0102808_87_1175 357
883 3300014497 Ga0182008_10004088 Ga0182008_100040888 358
884 3300041405 Ga0439438_000109 Ga0439438_000109_23692_24783 358
885 3300041405 Ga0439438_005891 Ga0439438_005891_585_1718 358
886 3300041411 Ga0439466_0004195 Ga0439466_0004195_32_1165 358
887 3300041997 Ga0439431_0000018 Ga0439431_0000018_1926_3017 358
888 3300042004 Ga0439445_0000461 Ga0439445_0000461_11_1102 358
889 3300042010 Ga0439452_011795 Ga0439452_011795_854_1945 358
890 3300042010 Ga0439452_031424 Ga0439452_031424_155_1288 358
891 3300042115 Ga0450911_000212 Ga0450911_000212_10580_11671 358
892 3300042137 Ga0450902_017532 Ga0450902_017532_49_1140 358
893 3300046452 Ga0495617_010496 Ga0495617_010496_509_1630 358
894 3300046491 Ga0495584_0014767 Ga0495584_0014767_870_1961 358
895 3300046492 Ga0495585_0000012 Ga0495585_0000012_44974_46065 358
896 3300046512 Ga0495610_0006577 Ga0495610_0006577_4588_5679 358
897 3300046513 Ga0495616_0000245 Ga0495616_0000245_17688_18809 358
898 3300046519 Ga0495632_0003400 Ga0495632_0003400_1692_2783 358
899 3300046530 Ga0495654_0003320 Ga0495654_0003320_4574_5695 358
900 3300046542 Ga0495597_0013242 Ga0495597_0013242_1891_2982 358
901 3300046810 Ga0495660_0055390 Ga0495660_0055390_977_2098 358
902 3300047320 Ga0495672_0041118 Ga0495672_0041118_1207_2328 358
903 3300047470 Ga0495681_0027199 Ga0495681_0027199_875_1966 358
904 3300047472 Ga0495686_0000439 Ga0495686_0000439_11878_12969 358
905 2124908027 MRS2a_Contig_1678 MRS2a_00537460 360
906 3300013100 Ga0157373_10010544 Ga0157373_100105447 360
907 3300041411 Ga0439466_0001046 Ga0439466_0001046_2086_3168 360
908 3300042010 Ga0439452_001850 Ga0439452_001850_6529_7611 360
909 3300042146 Ga0450907_000010 Ga0450907_000010_47684_48766 360
910 3300042185 Ga0450909_002260 Ga0450909_002260_839_1921 360
911 3300042435 Ga0439434_0002424 Ga0439434_0002424_2765_3847 360
912 3300042461 Ga0439460_0000683 Ga0439460_0000683_5387_6532 360
913 3300046452 Ga0495617_020166 Ga0495617_020166_403_1536 360
914 3300046455 Ga0495603_0001109 Ga0495603_0001109_13526_14608 360
915 3300046457 Ga0495590_0026640 Ga0495590_0026640_886_1968 360
916 3300046458 Ga0495591_015129 Ga0495591_015129_876_1958 360
917 3300046460 Ga0495638_0072499 Ga0495638_0072499_73_1155 360
918 3300046471 Ga0495650_0003496 Ga0495650_0003496_10230_11312 360
919 3300046474 Ga0495605_0029685 Ga0495605_0029685_1319_2401 360
920 3300046506 Ga0495583_0001087 Ga0495583_0001087_5087_6169 360
921 3300046513 Ga0495616_0030393 Ga0495616_0030393_1008_2090 360
922 3300046517 Ga0495630_0042359 Ga0495630_0042359_1797_3017 360
923 3300046517 Ga0495630_0068998 Ga0495630_0068998_309_1481 360
924 3300046519 Ga0495632_0002461 Ga0495632_0002461_1011_2093 360
925 3300046520 Ga0495637_0023084 Ga0495637_0023084_875_1957 360
926 3300046523 Ga0495644_0020322 Ga0495644_0020322_623_1705 360
927 3300046524 Ga0495648_0018712 Ga0495648_0018712_2988_4121 360
928 3300046528 Ga0495642_0000452 Ga0495642_0000452_1090_2172 360
929 3300046536 Ga0495587_0029322 Ga0495587_0029322_1904_3076 360
930 3300046538 Ga0495609_0011406 Ga0495609_0011406_1115_2197 360
931 3300046615 Ga0495656_0011944 Ga0495656_0011944_981_2063 360
932 3300046616 Ga0495668_0060298 Ga0495668_0060298_833_1915 360
933 3300046660 Ga0495625_0171298 Ga0495625_0171298_320_1402 360
934 3300046663 Ga0495635_0000733 Ga0495635_0000733_1777_2949 360
935 3300046665 Ga0495661_0035587 Ga0495661_0035587_178_1260 360
936 3300046680 Ga0495646_0006128 Ga0495646_0006128_5706_6878 360
937 3300046689 Ga0495613_0010538 Ga0495613_0010538_4744_5916 360
938 3300046692 Ga0495671_0035973 Ga0495671_0035973_1018_2103 360
939 3300046794 Ga0495589_0025942 Ga0495589_0025942_1477_2559 360
940 3300047317 Ga0495604_0062711 Ga0495604_0062711_751_1923 360
941 3300047322 Ga0495680_0014075 Ga0495680_0014075_2063_3235 360
942 3300047322 Ga0495680_0016113 Ga0495680_0016113_4630_5850 360
943 3300047444 Ga0495675_0007448 Ga0495675_0007448_3026_4198 360
944 3300047445 Ga0495677_0020605 Ga0495677_0020605_1054_2136 360
945 3300047446 Ga0495679_027583 Ga0495679_027583_63_1145 360
946 3300047447 Ga0495685_028774 Ga0495685_028774_755_1837 360
947 3300047470 Ga0495681_0058388 Ga0495681_0058388_82_1164 360
948 3300047673 Ga0495593_0048208 Ga0495593_0048208_425_1645 360
949 3300047673 Ga0495593_0082255 Ga0495593_0082255_62_1234 360
950 3300048913 Ga0496110_0247167 Ga0496110_0247167_502_1584 360
951 3300048914 Ga0496111_0136288 Ga0496111_0136288_79_1161 360
952 3300049459 Ga0495678_045100 Ga0495678_045100_560_1642 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

91

245

0.91

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

93

341

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9803 60 357
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9644 60 357
7jqy-assembly1.cif.gz_B crystal structure of cfl1-d123s from burkholderia cenocepacia 0.8563 67 357
7jqx-assembly1.cif.gz_A crystal structure of cfl1 wild-type from burkholderia cenocepacia 0.845 67 357
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8403 64 183
ID Description Score Start End Superfamily
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9755 61 357 3.40.50.1820
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9659 61 357 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8944 67 153 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8595 78 183 3.40.50.1820
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8281 67 353 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A377XWR7-F1-model_v4 Putative epoxide hydrolase protein (EC 3.8.1.3) 0.988 80 357 GO:0016020
GO:0018785
GO:0046464
GO:0047372
AF-A0A4V2AR43-F1-model_v4 Alpha/beta hydrolase 0.9861 68 273 GO:0016020
GO:0016787
AF-A0A2X3IXZ0-F1-model_v4 Putative epoxide hydrolase protein 0.9856 142 357 GO:0016020
GO:0046464
GO:0047372
AF-A0A528AUY4-F1-model_v4 Alpha/beta hydrolase 0.9846 238 357 GO:0016787
AF-A0A270QK74-F1-model_v4 deleted 0.9843 163 357

Feature Viewer

pLDDT pTM Quality
83.92 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map