F486595

General Info

Members Datasets Scaffolds Average Seq Length
951 411 779 263

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0005553|Ga0495605_0005553_6438_7301
Length 287
Sequence MYQVDRFRSRRQRLQVITLAKKGSSMPTLALPDGDLHYQLDGPLDAPVLLLSNSLGTNLAMWDGQIPVFAEHFRVLRYDTRGHGRSLVSDGPYSIEQHARDVLALMDALKIPRANFCGLSMGGLIGQWLMINAAQRLDRVVLCNTAAKIASPAVWNPRIEMVLREGKEGMLSLREATTSRWFSAQFAATQPAQVARLLDMLANTSPQGYAANCAAVRDADFAAQLGSVQLPVLVVCGNQDPVTTESDGELLKQAIAGAQRMTLSAAHLSNVEASEAFSAQVSAFLRR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2511231023 Pseudomonas sp. GM80 Isolate Nodule
12 2511231031 Pseudomonas sp. GM16 Isolate Nodule
13 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
14 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
15 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
16 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
19 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
20 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
21 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
22 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
23 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
24 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
25 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
26 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
27 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
28 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
29 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
30 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
31 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
32 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
33 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
34 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
35 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
36 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
37 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
38 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
39 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
40 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
41 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
42 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
43 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
44 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
45 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
46 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
47 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
48 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
49 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
50 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
51 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
52 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
53 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
54 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
55 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
56 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
57 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
58 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
59 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
60 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
61 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
62 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
63 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
64 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
65 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
66 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
67 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
68 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
69 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
70 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
71 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
72 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
73 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
74 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
75 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
76 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
77 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
78 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
79 2636415599 Klebsiella variicola DX120E Isolate Unclassified
80 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
81 2643221638 Duganella sp. Root336D2 Isolate Unclassified
82 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
83 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
84 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
85 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
86 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
87 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
88 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
89 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
90 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
91 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
92 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
93 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
94 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
95 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
96 2773857670 Pseudomonas sp. 478 Isolate Unclassified
97 2775507074 Klebsiella sp. D5A Isolate Unclassified
98 2784132063 Pseudomonas sp. 424 Isolate Unclassified
99 2784132072 Pseudomonas sp. 460 Isolate Unclassified
100 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
101 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
102 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
103 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
104 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
105 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
106 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
107 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
108 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
109 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
110 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
111 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
112 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
113 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
114 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
115 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
116 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
117 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
118 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
119 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
120 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
121 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
122 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
123 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
124 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
125 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
126 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
127 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
128 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
129 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
130 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
131 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
132 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
133 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
134 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
135 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
136 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
137 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
138 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
139 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
140 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
141 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
142 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
143 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
144 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
145 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
146 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
147 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
148 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
149 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
150 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
151 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
152 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
153 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
154 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
155 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
156 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
157 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
158 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
159 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
160 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
161 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
162 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
163 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
164 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
165 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
166 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
167 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
168 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
169 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
170 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
171 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
172 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
173 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
176 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
177 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
178 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
179 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
180 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
181 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
182 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
183 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
184 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
185 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
186 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
187 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
188 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
189 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
190 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
191 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
192 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
193 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
194 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
198 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
199 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
202 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
203 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
204 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
205 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
239 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
240 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
251 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
252 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
264 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
265 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
266 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
267 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
268 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
269 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
270 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
271 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
272 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
273 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
276 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
343 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
349 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
350 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
372 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
389 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
390 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
395 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
396 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
397 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
398 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
399 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
400 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
401 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
402 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
403 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
404 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
405 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
406 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
407 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
408 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
409 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
410 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
411 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.91
Metatranscriptomes 0
Isolates 18.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 4
Nodule 1.58
Rhizoplane 7.57
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_26459 2124908027 Bacteria 1663
2 SwRhRL2b_contig_2696906 2162886007 Bacteria 1618
3 JGI25163J39215_1000348 3300002771 Bacteria 15338
4 JGI25164J39214_1000492 3300002772 Bacteria 19394
5 JGI25165J46597_1000934 3300003214 Bacteria 20070
6 rootL2_10085104 3300003322 Bacteria 3432
7 Ga0055526_1010871 3300003771 Bacteria 4180
8 Ga0055536_1000043 3300003781 Bacteria 124663
9 Ga0055536_1001093 3300003781 Bacteria 17061
10 Ga0055530_10000031 3300003791 Bacteria 122117
11 Ga0055530_10000527 3300003791 Bacteria 33197
12 Ga0055540_1000161 3300003792 Bacteria 66740
13 Ga0055540_1000230 3300003792 Bacteria 51911
14 Ga0055540_1001131 3300003792 Bacteria 16636
15 Ga0055531_10001267 3300003794 Bacteria 19127
16 Ga0065714_10003926 3300005288 Bacteria 8412
17 Ga0065714_10007790 3300005288 Bacteria 2759
18 Ga0065714_10026140 3300005288 Bacteria 1528
19 Ga0065714_10065072 3300005288 Bacteria 13234
20 Ga0065714_10069444 3300005288 Bacteria 4226
21 Ga0065714_10070935 3300005288 Bacteria 3725
22 Ga0065714_10073836 3300005288 Bacteria 3124
23 Ga0065704_10001387 3300005289 Bacteria 12943
24 Ga0065704_10095259 3300005289 Bacteria 2497
25 Ga0065704_10142008 3300005289 Bacteria 1508
26 Ga0070683_100000933 3300005329 Bacteria 21733
27 Ga0070670_100001105 3300005331 Bacteria 21435
28 Ga0070670_100009361 3300005331 Bacteria 8361
29 Ga0070661_100000238 3300005344 Bacteria 45456
30 Ga0070669_100000150 3300005353 Bacteria 62681
31 Ga0070709_10005206 3300005434 Bacteria 7035
32 Ga0068853_100005654 3300005539 Bacteria 9830
33 Ga0070665_100251663 3300005548 Bacteria 1767
34 Ga0070664_100000233 3300005564 Bacteria 39884
35 Ga0068854_100008578 3300005578 Bacteria 6578
36 Ga0068851_10000019 3300005834 Bacteria 135877
37 Ga0075364_10294879 3300006051 Bacteria 1104
38 Ga0075432_10006266 3300006058 Bacteria 4043
39 Ga0075436_100076706 3300006914 Bacteria 2315
40 Ga0079104_1028293 3300006946 Bacteria 1425
41 Ga0105251_10000021 3300009011 Bacteria 137955
42 Ga0105251_10000477 3300009011 Bacteria 37930
43 Ga0105251_10003438 3300009011 Bacteria 11486
44 Ga0105251_10003475 3300009011 Bacteria 11417
45 Ga0105251_10009892 3300009011 Bacteria 5583
46 Ga0105251_10017479 3300009011 Bacteria 3842
47 Ga0105244_10004276 3300009036 Bacteria 9893
48 Ga0105244_10004598 3300009036 Bacteria 9449
49 Ga0105244_10010896 3300009036 Bacteria 5483
50 Ga0105244_10021200 3300009036 Bacteria 3598
51 Ga0105244_10026476 3300009036 Bacteria 3138
52 Ga0105244_10041414 3300009036 Bacteria 2387
53 Ga0105244_10072395 3300009036 Bacteria 1717
54 Ga0105244_10093887 3300009036 Bacteria 1474
55 Ga0105250_10000072 3300009092 Bacteria 94689
56 Ga0105250_10000118 3300009092 Bacteria 71419
57 Ga0105250_10002765 3300009092 Bacteria 8620
58 Ga0105250_10003322 3300009092 Bacteria 7656
59 Ga0105250_10065396 3300009092 Bacteria 1466
60 Ga0105247_10051921 3300009101 Bacteria 2526
61 Ga0105243_10001564 3300009148 Bacteria 20004
62 Ga0105243_10239895 3300009148 Bacteria 1612
63 Ga0105242_10000719 3300009176 Bacteria 25890
64 Ga0105248_10438648 3300009177 Bacteria 1471
65 Ga0105237_10005805 3300009545 Bacteria 13845
66 Ga0105246_10001731 3300011119 Bacteria 13039
67 Ga0105246_10002504 3300011119 Bacteria 11115
68 Ga0105246_10027971 3300011119 Bacteria 3701
69 Ga0157345_1000135 3300012498 Bacteria 13608
70 Ga0157373_10001969 3300013100 Bacteria 15573
71 Ga0157373_10007934 3300013100 Bacteria 7896
72 Ga0157373_10008873 3300013100 Bacteria 7443
73 Ga0157373_10031446 3300013100 Bacteria 3821
74 Ga0157373_10031805 3300013100 Bacteria 3799
75 Ga0157373_10070927 3300013100 Bacteria 2462
76 Ga0157373_10178320 3300013100 Bacteria 1496
77 Ga0157373_10312720 3300013100 Bacteria 1116
78 Ga0157371_10000281 3300013102 Bacteria 68624
79 Ga0157371_10019377 3300013102 Bacteria 5020
80 Ga0157371_10501813 3300013102 Bacteria 896
81 Ga0157370_10036138 3300013104 Bacteria 4796
82 Ga0157370_10137734 3300013104 Bacteria 2274
83 Ga0157369_10003643 3300013105 Bacteria 18275
84 Ga0157369_10010141 3300013105 Bacteria 10753
85 Ga0157369_10043869 3300013105 Bacteria 4871
86 Ga0163162_10000835 3300013306 Bacteria 28677
87 Ga0163162_10476875 3300013306 Bacteria 1379
88 Ga0157372_10004247 3300013307 Bacteria 15318
89 Ga0157375_10005491 3300013308 Bacteria 11026
90 Ga0157375_10039221 3300013308 Bacteria 4557
91 Ga0157375_10337200 3300013308 Bacteria 1673
92 Ga0182008_10007260 3300014497 Bacteria 6125
93 Ga0182008_10013392 3300014497 Bacteria 4313
94 Ga0182006_1000736 3300015261 Bacteria 22519
95 Ga0182006_1000816 3300015261 Bacteria 20884
96 Ga0182006_1008689 3300015261 Bacteria 4598
97 Ga0182006_1026599 3300015261 Bacteria 2367
98 Ga0182007_10000110 3300015262 Bacteria 56498
99 Ga0182007_10003838 3300015262 Bacteria 6987
100 Ga0182005_1000627 3300015265 Bacteria 16999
101 Ga0182005_1005224 3300015265 Bacteria 4077
102 Ga0182005_1009143 3300015265 Bacteria 2895
103 Ga0182005_1028956 3300015265 Bacteria 1510
104 Ga0163161_10002537 3300017792 Bacteria 13028
105 Ga0163161_10037516 3300017792 Bacteria 3474
106 Ga0163161_10052017 3300017792 Bacteria 2969
107 Ga0163161_10064796 3300017792 Bacteria 2666
108 Ga0163161_10113280 3300017792 Bacteria 2030
109 Ga0163161_10138446 3300017792 Bacteria 1842
110 Ga0163161_10422888 3300017792 Bacteria 1072
111 Ga0209760_100047 3300025207 Bacteria 107520
112 Ga0207427_100029 3300025231 Bacteria 376678
113 Ga0209437_100009 3300025233 Bacteria 915954
114 Ga0209233_1000032 3300025261 Bacteria 623596
115 Ga0209675_1002348 3300025291 Bacteria 9768
116 Ga0209676_1000016 3300025292 Bacteria 655561
117 Ga0209676_1000033 3300025292 Bacteria 463236
118 Ga0209676_1000080 3300025292 Bacteria 287400
119 Ga0209676_1002060 3300025292 Bacteria 15666
120 Ga0209676_1011697 3300025292 Bacteria 3513
121 Ga0209564_1001361 3300025295 Bacteria 25686
122 Ga0209050_1000036 3300025298 Bacteria 423070
123 Ga0209050_1000117 3300025298 Bacteria 202979
124 Ga0209050_1000187 3300025298 Bacteria 139437
125 Ga0209050_1001134 3300025298 Bacteria 32080
126 Ga0209051_1000077 3300025303 Bacteria 202959
127 Ga0209051_1000094 3300025303 Bacteria 168538
128 Ga0209051_1000131 3300025303 Bacteria 139437
129 Ga0209051_1007856 3300025303 Bacteria 5755
130 Ga0209257_1000173 3300025304 Bacteria 166678
131 Ga0207656_10000026 3300025321 Bacteria 86789
132 Ga0207696_1000005 3300025711 Bacteria 642078
133 Ga0207696_1000083 3300025711 Bacteria 197352
134 Ga0207696_1000111 3300025711 Bacteria 155243
135 Ga0207696_1018769 3300025711 Bacteria 2265
136 Ga0207655_1000063 3300025728 Bacteria 257028
137 Ga0207655_1000435 3300025728 Bacteria 55875
138 Ga0207655_1000893 3300025728 Bacteria 31371
139 Ga0207655_1002166 3300025728 Bacteria 16365
140 Ga0207655_1002478 3300025728 Bacteria 14954
141 Ga0207655_1002832 3300025728 Bacteria 13434
142 Ga0207655_1006801 3300025728 Bacteria 7516
143 Ga0207655_1007688 3300025728 Bacteria 6956
144 Ga0207655_1014097 3300025728 Bacteria 4540
145 Ga0207655_1025566 3300025728 Bacteria 2862
146 Ga0207655_1074812 3300025728 Bacteria 1245
147 Ga0207713_1000002 3300025735 Bacteria 1061749
148 Ga0207713_1000003 3300025735 Bacteria 860698
149 Ga0207713_1000104 3300025735 Bacteria 138310
150 Ga0207713_1000564 3300025735 Bacteria 36882
151 Ga0207713_1001593 3300025735 Bacteria 17743
152 Ga0207713_1002004 3300025735 Bacteria 15301
153 Ga0207713_1002990 3300025735 Bacteria 11815
154 Ga0207713_1003370 3300025735 Bacteria 10952
155 Ga0207713_1005039 3300025735 Bacteria 8397
156 Ga0207713_1018153 3300025735 Bacteria 3491
157 Ga0207713_1065880 3300025735 Bacteria 1358
158 Ga0207710_10141532 3300025900 Bacteria 1161
159 Ga0207699_10028489 3300025906 Bacteria 3105
160 Ga0207671_10000436 3300025914 Bacteria 57399
161 Ga0207649_10000002 3300025920 Bacteria 498633
162 Ga0207681_10000816 3300025923 Bacteria 20490
163 Ga0207650_10000559 3300025925 Bacteria 30251
164 Ga0207650_10000688 3300025925 Bacteria 26557
165 Ga0207706_10005582 3300025933 Bacteria 11722
166 Ga0207686_10005841 3300025934 Bacteria 6603
167 Ga0207709_10000036 3300025935 Bacteria 292568
168 Ga0207679_10000006 3300025945 Bacteria 498868
169 Ga0207639_10002172 3300026041 Bacteria 13210
170 Ga0209281_1004003 3300027111 Bacteria 4567
171 Ga0209281_1014772 3300027111 Bacteria 1645
172 Ga0209281_1014996 3300027111 Bacteria 1626
173 Ga0209981_1004989 3300027378 Bacteria 1755
174 Ga0209996_1001558 3300027395 Bacteria 2792
175 Ga0209968_1006918 3300027526 Bacteria 1712
176 Ga0209983_1001292 3300027665 Bacteria 5572
177 Ga0209974_10028508 3300027876 Bacteria 1849
178 Ga0207428_10038182 3300027907 Bacteria 3905
179 Ga0207428_10097691 3300027907 Bacteria 2273
180 Ga0268266_10011117 3300028379 Bacteria 7837
181 Ga0307511_10181496 3300030521 Bacteria 1133
182 Ga0316178_1175126 3300030735 Bacteria 6677
183 Ga0265340_10100814 3300031247 Bacteria 1342
184 Ga0307509_10045079 3300031507 Bacteria 4760
185 Ga0307408_100009275 3300031548 Bacteria 6487
186 Ga0307408_100047218 3300031548 Bacteria 3083
187 Ga0307408_100331416 3300031548 Bacteria 1285
188 Ga0307405_10000858 3300031731 Bacteria 11988
189 Ga0307405_10034002 3300031731 Bacteria 3029
190 Ga0307405_10042297 3300031731 Bacteria 2772
191 Ga0307405_10062191 3300031731 Bacteria 2363
192 Ga0307406_10605063 3300031901 Bacteria 904
193 Ga0307412_10013149 3300031911 Bacteria 4844
194 Ga0307412_10021104 3300031911 Bacteria 3974
195 Ga0307412_10039547 3300031911 Bacteria 3045
196 Ga0307412_10043688 3300031911 Bacteria 2919
197 Ga0307412_10044907 3300031911 Bacteria 2885
198 Ga0307412_10055324 3300031911 Bacteria 2638
199 Ga0307412_10103333 3300031911 Bacteria 2019
200 Ga0307412_10248558 3300031911 Bacteria 1380
201 Ga0307416_100040799 3300032002 Bacteria 3610
202 Ga0307416_100312825 3300032002 Bacteria 1568
203 Ga0307416_100375485 3300032002 Bacteria 1449
204 Ga0307414_10059779 3300032004 Bacteria 2693
205 Ga0307411_10015552 3300032005 Bacteria 4278
206 Ga0307411_10619895 3300032005 Bacteria 932
207 Ga0307510_10017421 3300033180 Bacteria 8472
208 Ga0307510_10107259 3300033180 Bacteria 2553
209 Ga0237819_02852 3300038705 Bacteria 3285
210 Ga0439438_000786 3300041405 Bacteria 14109
211 Ga0439438_002348 3300041405 Bacteria 8069
212 Ga0439438_003155 3300041405 Bacteria 6762
213 Ga0439438_005775 3300041405 Bacteria 4492
214 Ga0439438_007754 3300041405 Bacteria 3632
215 Ga0439438_008580 3300041405 Bacteria 3375
216 Ga0439447_000985 3300041407 Bacteria 10388
217 Ga0439447_001411 3300041407 Bacteria 8804
218 Ga0439447_006363 3300041407 Bacteria 3842
219 Ga0439447_017819 3300041407 Bacteria 1928
220 Ga0439447_046546 3300041407 Bacteria 1043
221 Ga0439466_0001571 3300041411 Bacteria 8922
222 Ga0439466_0001845 3300041411 Bacteria 8316
223 Ga0439466_0001878 3300041411 Bacteria 8225
224 Ga0439466_0008863 3300041411 Bacteria 3784
225 Ga0439466_0027775 3300041411 Bacteria 1957
226 Ga0439466_0028654 3300041411 Bacteria 1920
227 Ga0439466_0040503 3300041411 Bacteria 1557
228 Ga0439465_0007331 3300041413 Bacteria 3502
229 Ga0439431_0010252 3300041997 Bacteria 2124
230 Ga0439445_0044923 3300042004 Bacteria 1181
231 Ga0439432_000245 3300042006 Bacteria 19526
232 Ga0439432_007140 3300042006 Bacteria 3969
233 Ga0439432_058764 3300042006 Bacteria 1188
234 Ga0439432_063597 3300042006 Bacteria 1133
235 Ga0439432_082494 3300042006 Bacteria 973
236 Ga0439451_001190 3300042009 Bacteria 5124
237 Ga0439451_003397 3300042009 Bacteria 3224
238 Ga0439451_010346 3300042009 Bacteria 1881
239 Ga0439451_022469 3300042009 Bacteria 1271
240 Ga0439452_001036 3300042010 Bacteria 12293
241 Ga0439452_002729 3300042010 Bacteria 6395
242 Ga0439452_004324 3300042010 Bacteria 4792
243 Ga0439452_011394 3300042010 Bacteria 2556
244 Ga0439452_020900 3300042010 Bacteria 1711
245 Ga0439452_030104 3300042010 Bacteria 1341
246 Ga0439456_001777 3300042013 Bacteria 4361
247 Ga0439456_019846 3300042013 Bacteria 1415
248 Ga0439456_031682 3300042013 Bacteria 1133
249 Ga0439463_035129 3300042016 Bacteria 1268
250 Ga0450911_001409 3300042115 Bacteria 5552
251 Ga0450911_001580 3300042115 Bacteria 5148
252 Ga0450919_002784 3300042121 Bacteria 2249
253 Ga0450898_019753 3300042134 Bacteria 1176
254 Ga0450900_006911 3300042136 Bacteria 1385
255 Ga0450902_001140 3300042137 Bacteria 3547
256 Ga0450903_003033 3300042138 Bacteria 2930
257 Ga0450903_005287 3300042138 Bacteria 2165
258 Ga0450904_002190 3300042139 Bacteria 2391
259 Ga0450906_004159 3300042145 Bacteria 3056
260 Ga0450906_012772 3300042145 Bacteria 1554
261 Ga0450907_000173 3300042146 Bacteria 23629
262 Ga0450907_004128 3300042146 Bacteria 2515
263 Ga0450907_013304 3300042146 Bacteria 1370
264 Ga0450910_006877 3300042147 Bacteria 1576
265 Ga0450908_013324 3300042184 Bacteria 1483
266 Ga0450909_004414 3300042185 Bacteria 2006
267 Ga0439434_0001671 3300042435 Bacteria 6428
268 Ga0439460_0032672 3300042461 Bacteria 1491
269 Ga0439440_0001312 3300042993 Bacteria 4519
270 Ga0439440_0010474 3300042993 Bacteria 1939
271 Ga0495617_001213 3300046452 Bacteria 11620
272 Ga0495617_007892 3300046452 Bacteria 3682
273 Ga0495617_017307 3300046452 Bacteria 2434
274 Ga0495617_020800 3300046452 Bacteria 2217
275 Ga0495617_021109 3300046452 Bacteria 2201
276 Ga0495617_035676 3300046452 Bacteria 1669
277 Ga0495617_056969 3300046452 Bacteria 1295
278 Ga0495627_000010 3300046453 Bacteria 381168
279 Ga0495627_001278 3300046453 Bacteria 15487
280 Ga0495627_002406 3300046453 Bacteria 9068
281 Ga0495627_005495 3300046453 Bacteria 5099
282 Ga0495603_0005877 3300046455 Bacteria 7333
283 Ga0495603_0013688 3300046455 Bacteria 4908
284 Ga0495590_0001626 3300046457 Bacteria 9594
285 Ga0495590_0004603 3300046457 Bacteria 5542
286 Ga0495590_0006841 3300046457 Bacteria 4431
287 Ga0495590_0021548 3300046457 Bacteria 2284
288 Ga0495591_000002 3300046458 Bacteria 455013
289 Ga0495591_000452 3300046458 Bacteria 33368
290 Ga0495591_001442 3300046458 Bacteria 14774
291 Ga0495591_001556 3300046458 Bacteria 14002
292 Ga0495591_002486 3300046458 Bacteria 10221
293 Ga0495591_002525 3300046458 Bacteria 10110
294 Ga0495591_003543 3300046458 Bacteria 7996
295 Ga0495591_004698 3300046458 Bacteria 6557
296 Ga0495591_007226 3300046458 Bacteria 4752
297 Ga0495591_007825 3300046458 Bacteria 4468
298 Ga0495591_008402 3300046458 Bacteria 4232
299 Ga0495591_013459 3300046458 Bacteria 2991
300 Ga0495591_029909 3300046458 Bacteria 1649
301 Ga0495638_0005689 3300046460 Bacteria 9183
302 Ga0495638_0006808 3300046460 Bacteria 8254
303 Ga0495638_0007812 3300046460 Bacteria 7637
304 Ga0495638_0032131 3300046460 Bacteria 3367
305 Ga0495638_0046056 3300046460 Bacteria 2741
306 Ga0495653_0015282 3300046463 Bacteria 6256
307 Ga0495650_0003766 3300046471 Bacteria 10820
308 Ga0495650_0004073 3300046471 Bacteria 10221
309 Ga0495650_0005829 3300046471 Bacteria 7848
310 Ga0495650_0019471 3300046471 Bacteria 3338
311 Ga0495650_0026336 3300046471 Bacteria 2707
312 Ga0495650_0028975 3300046471 Bacteria 2530
313 Ga0495650_0032847 3300046471 Bacteria 2316
314 Ga0495650_0049992 3300046471 Bacteria 1731
315 Ga0495650_0056126 3300046471 Bacteria 1599
316 Ga0495582_0016390 3300046473 Bacteria 4060
317 Ga0495605_0005553 3300046474 Bacteria 7335
318 Ga0495605_0008470 3300046474 Bacteria 5814
319 Ga0495605_0010655 3300046474 Bacteria 5138
320 Ga0495605_0022243 3300046474 Bacteria 3350
321 Ga0495605_0037769 3300046474 Bacteria 2427
322 Ga0495605_0104320 3300046474 Bacteria 1299
323 Ga0495605_0130337 3300046474 Bacteria 1134
324 Ga0495639_0000994 3300046475 Bacteria 12799
325 Ga0495584_0001291 3300046491 Bacteria 15247
326 Ga0495584_0002832 3300046491 Bacteria 9681
327 Ga0495584_0009191 3300046491 Bacteria 5096
328 Ga0495584_0010632 3300046491 Bacteria 4726
329 Ga0495584_0017755 3300046491 Bacteria 3619
330 Ga0495584_0022206 3300046491 Bacteria 3221
331 Ga0495584_0067622 3300046491 Bacteria 1795
332 Ga0495585_0007924 3300046492 Bacteria 6458
333 Ga0495585_0011257 3300046492 Bacteria 5299
334 Ga0495585_0017386 3300046492 Bacteria 4154
335 Ga0495585_0019132 3300046492 Bacteria 3952
336 Ga0495585_0076259 3300046492 Bacteria 1821
337 Ga0495594_0006698 3300046499 Bacteria 5925
338 Ga0495594_0058585 3300046499 Bacteria 2129
339 Ga0495594_0123797 3300046499 Bacteria 1462
340 Ga0495596_0001019 3300046500 Bacteria 16647
341 Ga0495607_0000025 3300046501 Bacteria 159379
342 Ga0495607_0000723 3300046501 Bacteria 31710
343 Ga0495607_0003843 3300046501 Bacteria 11330
344 Ga0495607_0005334 3300046501 Bacteria 9236
345 Ga0495607_0009730 3300046501 Bacteria 6489
346 Ga0495607_0016411 3300046501 Bacteria 4778
347 Ga0495607_0024112 3300046501 Bacteria 3797
348 Ga0495607_0039658 3300046501 Bacteria 2811
349 Ga0495607_0063469 3300046501 Bacteria 2089
350 Ga0495607_0069373 3300046501 Bacteria 1973
351 Ga0495607_0070726 3300046501 Bacteria 1948
352 Ga0495607_0074243 3300046501 Bacteria 1888
353 Ga0495583_0001907 3300046506 Bacteria 19301
354 Ga0495583_0008510 3300046506 Bacteria 6260
355 Ga0495583_0008516 3300046506 Bacteria 6258
356 Ga0495583_0018824 3300046506 Bacteria 3623
357 Ga0495583_0029479 3300046506 Bacteria 2684
358 Ga0495583_0035446 3300046506 Bacteria 2381
359 Ga0495583_0098419 3300046506 Bacteria 1250
360 Ga0495606_0000055 3300046507 Bacteria 199348
361 Ga0495606_0001543 3300046507 Bacteria 30359
362 Ga0495606_0011362 3300046507 Bacteria 7270
363 Ga0495606_0011908 3300046507 Bacteria 7035
364 Ga0495606_0016397 3300046507 Bacteria 5650
365 Ga0495606_0016942 3300046507 Bacteria 5530
366 Ga0495606_0020935 3300046507 Bacteria 4802
367 Ga0495606_0031545 3300046507 Bacteria 3682
368 Ga0495606_0035464 3300046507 Bacteria 3408
369 Ga0495606_0058330 3300046507 Bacteria 2481
370 Ga0495606_0101267 3300046507 Bacteria 1753
371 Ga0495606_0227933 3300046507 Bacteria 1046
372 Ga0495610_0004508 3300046512 Bacteria 10261
373 Ga0495610_0008798 3300046512 Bacteria 6475
374 Ga0495610_0010140 3300046512 Bacteria 5880
375 Ga0495610_0016078 3300046512 Bacteria 4325
376 Ga0495610_0023992 3300046512 Bacteria 3300
377 Ga0495610_0049979 3300046512 Bacteria 2043
378 Ga0495610_0095346 3300046512 Bacteria 1341
379 Ga0495616_0003008 3300046513 Bacteria 10938
380 Ga0495616_0006069 3300046513 Bacteria 7361
381 Ga0495616_0007496 3300046513 Bacteria 6533
382 Ga0495616_0009252 3300046513 Bacteria 5776
383 Ga0495616_0009306 3300046513 Bacteria 5756
384 Ga0495616_0012317 3300046513 Bacteria 4857
385 Ga0495616_0025253 3300046513 Bacteria 3176
386 Ga0495616_0029012 3300046513 Bacteria 2924
387 Ga0495620_0001753 3300046515 Bacteria 12769
388 Ga0495620_0002591 3300046515 Bacteria 10455
389 Ga0495620_0007857 3300046515 Bacteria 5755
390 Ga0495620_0008194 3300046515 Bacteria 5619
391 Ga0495620_0008988 3300046515 Bacteria 5336
392 Ga0495620_0014699 3300046515 Bacteria 3970
393 Ga0495620_0021640 3300046515 Bacteria 3119
394 Ga0495620_0022198 3300046515 Bacteria 3064
395 Ga0495620_0031288 3300046515 Bacteria 2440
396 Ga0495620_0034269 3300046515 Bacteria 2296
397 Ga0495630_0032621 3300046517 Bacteria 3882
398 Ga0495630_0075306 3300046517 Bacteria 2543
399 Ga0495631_0003291 3300046518 Bacteria 8883
400 Ga0495631_0019988 3300046518 Bacteria 3133
401 Ga0495631_0023185 3300046518 Bacteria 2879
402 Ga0495631_0090514 3300046518 Bacteria 1317
403 Ga0495632_0003292 3300046519 Bacteria 11535
404 Ga0495632_0005336 3300046519 Bacteria 8522
405 Ga0495632_0009359 3300046519 Bacteria 5914
406 Ga0495632_0010459 3300046519 Bacteria 5494
407 Ga0495632_0013714 3300046519 Bacteria 4612
408 Ga0495632_0017467 3300046519 Bacteria 3957
409 Ga0495632_0027429 3300046519 Bacteria 2983
410 Ga0495637_0000414 3300046520 Bacteria 31478
411 Ga0495637_0002290 3300046520 Bacteria 10607
412 Ga0495637_0002474 3300046520 Bacteria 10205
413 Ga0495637_0005314 3300046520 Bacteria 6585
414 Ga0495637_0014643 3300046520 Bacteria 3695
415 Ga0495637_0021535 3300046520 Bacteria 2954
416 Ga0495637_0093929 3300046520 Bacteria 1179
417 Ga0495643_0006744 3300046522 Bacteria 7511
418 Ga0495643_0010283 3300046522 Bacteria 5762
419 Ga0495643_0013850 3300046522 Bacteria 4811
420 Ga0495643_0017952 3300046522 Bacteria 4123
421 Ga0495643_0021971 3300046522 Bacteria 3648
422 Ga0495643_0027922 3300046522 Bacteria 3167
423 Ga0495643_0150046 3300046522 Bacteria 1155
424 Ga0495643_0186716 3300046522 Bacteria 1003
425 Ga0495644_0001339 3300046523 Bacteria 10077
426 Ga0495644_0002235 3300046523 Bacteria 7743
427 Ga0495644_0003754 3300046523 Bacteria 5977
428 Ga0495644_0011222 3300046523 Bacteria 3452
429 Ga0495648_0001887 3300046524 Bacteria 20035
430 Ga0495648_0006635 3300046524 Bacteria 9379
431 Ga0495648_0007214 3300046524 Bacteria 8929
432 Ga0495648_0013042 3300046524 Bacteria 6166
433 Ga0495648_0016559 3300046524 Bacteria 5309
434 Ga0495648_0024568 3300046524 Bacteria 4100
435 Ga0495648_0032234 3300046524 Bacteria 3441
436 Ga0495648_0036612 3300046524 Bacteria 3162
437 Ga0495648_0048425 3300046524 Bacteria 2616
438 Ga0495648_0092173 3300046524 Bacteria 1692
439 Ga0495648_0121460 3300046524 Bacteria 1403
440 Ga0495666_0010775 3300046526 Bacteria 4560
441 Ga0495666_0024064 3300046526 Bacteria 3011
442 Ga0495666_0050239 3300046526 Bacteria 2005
443 Ga0495642_0000619 3300046528 Bacteria 17900
444 Ga0495642_0018089 3300046528 Bacteria 2756
445 Ga0495654_0000673 3300046530 Bacteria 26934
446 Ga0495654_0001952 3300046530 Bacteria 13616
447 Ga0495654_0023755 3300046530 Bacteria 3172
448 Ga0495654_0027139 3300046530 Bacteria 2938
449 Ga0495654_0027278 3300046530 Bacteria 2929
450 Ga0495654_0037975 3300046530 Bacteria 2410
451 Ga0495654_0093213 3300046530 Bacteria 1395
452 Ga0495654_0097301 3300046530 Bacteria 1359
453 Ga0495654_0098547 3300046530 Bacteria 1348
454 Ga0495654_0128589 3300046530 Bacteria 1139
455 Ga0495654_0179222 3300046530 Bacteria 918
456 Ga0495586_0101788 3300046535 Bacteria 1594
457 Ga0495587_0024092 3300046536 Bacteria 3734
458 Ga0495587_0092887 3300046536 Bacteria 1742
459 Ga0495609_0000066 3300046538 Bacteria 131202
460 Ga0495609_0004568 3300046538 Bacteria 7524
461 Ga0495609_0005438 3300046538 Bacteria 6691
462 Ga0495609_0006429 3300046538 Bacteria 5995
463 Ga0495609_0009498 3300046538 Bacteria 4705
464 Ga0495609_0018559 3300046538 Bacteria 3222
465 Ga0495609_0024012 3300046538 Bacteria 2798
466 Ga0495597_0000011 3300046542 Bacteria 221377
467 Ga0495597_0006542 3300046542 Bacteria 6015
468 Ga0495597_0008888 3300046542 Bacteria 5008
469 Ga0495597_0017098 3300046542 Bacteria 3417
470 Ga0495597_0018718 3300046542 Bacteria 3247
471 Ga0495597_0020226 3300046542 Bacteria 3102
472 Ga0495597_0021958 3300046542 Bacteria 2963
473 Ga0495597_0063893 3300046542 Bacteria 1599
474 Ga0495597_0083324 3300046542 Bacteria 1365
475 Ga0495622_0002561 3300046557 Bacteria 8783
476 Ga0495622_0003892 3300046557 Bacteria 6974
477 Ga0495622_0008562 3300046557 Bacteria 4741
478 Ga0495622_0028987 3300046557 Bacteria 2586
479 Ga0495622_0052332 3300046557 Bacteria 1894
480 Ga0495622_0053763 3300046557 Bacteria 1868
481 Ga0495633_0010318 3300046558 Bacteria 5107
482 Ga0495668_0002481 3300046616 Bacteria 15151
483 Ga0495668_0008255 3300046616 Bacteria 6526
484 Ga0495668_0016122 3300046616 Bacteria 4347
485 Ga0495668_0185858 3300046616 Bacteria 1138
486 Ga0495634_0020607 3300046642 Bacteria 4673
487 Ga0495611_0000416 3300046648 Bacteria 26473
488 Ga0495611_0002365 3300046648 Bacteria 8687
489 Ga0495611_0003356 3300046648 Bacteria 7067
490 Ga0495625_0000055 3300046660 Bacteria 186381
491 Ga0495625_0020483 3300046660 Bacteria 5104
492 Ga0495625_0022411 3300046660 Bacteria 4843
493 Ga0495625_0048103 3300046660 Bacteria 3072
494 Ga0495625_0084289 3300046660 Bacteria 2207
495 Ga0495635_0006025 3300046663 Bacteria 8455
496 Ga0495635_0018177 3300046663 Bacteria 4907
497 Ga0495659_0001059 3300046664 Bacteria 9611
498 Ga0495661_0000105 3300046665 Bacteria 101167
499 Ga0495661_0000139 3300046665 Bacteria 85160
500 Ga0495661_0002061 3300046665 Bacteria 15772
501 Ga0495661_0004967 3300046665 Bacteria 9503
502 Ga0495661_0025126 3300046665 Bacteria 3851
503 Ga0495661_0033064 3300046665 Bacteria 3264
504 Ga0495661_0034528 3300046665 Bacteria 3182
505 Ga0495661_0071314 3300046665 Bacteria 2030
506 Ga0495588_0020609 3300046674 Bacteria 3243
507 Ga0495588_0137198 3300046674 Bacteria 1291
508 Ga0495623_0016125 3300046679 Bacteria 4827
509 Ga0495623_0018191 3300046679 Bacteria 4538
510 Ga0495646_0024731 3300046680 Bacteria 3781
511 Ga0495646_0025218 3300046680 Bacteria 3741
512 Ga0495646_0028629 3300046680 Bacteria 3486
513 Ga0495646_0098588 3300046680 Bacteria 1678
514 Ga0495669_0001111 3300046684 Bacteria 11152
515 Ga0495613_0049064 3300046689 Bacteria 3116
516 Ga0495613_0061840 3300046689 Bacteria 2741
517 Ga0495613_0114868 3300046689 Bacteria 1937
518 Ga0495624_0007174 3300046690 Bacteria 7843
519 Ga0495670_0004140 3300046691 Bacteria 7110
520 Ga0495670_0006986 3300046691 Bacteria 5563
521 Ga0495670_0042577 3300046691 Bacteria 2265
522 Ga0495670_0122357 3300046691 Bacteria 1352
523 Ga0495670_0136191 3300046691 Bacteria 1282
524 Ga0495670_0209178 3300046691 Bacteria 1034
525 Ga0495671_0000516 3300046692 Bacteria 29556
526 Ga0495671_0001535 3300046692 Bacteria 15386
527 Ga0495671_0007630 3300046692 Bacteria 6145
528 Ga0495671_0019851 3300046692 Bacteria 3547
529 Ga0495671_0022087 3300046692 Bacteria 3336
530 Ga0495671_0033881 3300046692 Bacteria 2599
531 Ga0495671_0039276 3300046692 Bacteria 2390
532 Ga0495671_0041552 3300046692 Bacteria 2314
533 Ga0495671_0103258 3300046692 Bacteria 1392
534 Ga0495649_0002480 3300046694 Bacteria 12953
535 Ga0495649_0006308 3300046694 Bacteria 7379
536 Ga0495649_0007497 3300046694 Bacteria 6640
537 Ga0495649_0013971 3300046694 Bacteria 4618
538 Ga0495649_0026961 3300046694 Bacteria 3190
539 Ga0495649_0037742 3300046694 Bacteria 2651
540 Ga0495649_0052219 3300046694 Bacteria 2215
541 Ga0495649_0055807 3300046694 Bacteria 2133
542 Ga0495589_0000411 3300046794 Bacteria 32203
543 Ga0495589_0001524 3300046794 Bacteria 13328
544 Ga0495589_0004506 3300046794 Bacteria 7400
545 Ga0495589_0007367 3300046794 Bacteria 5760
546 Ga0495589_0026347 3300046794 Bacteria 2946
547 Ga0495589_0028987 3300046794 Bacteria 2791
548 Ga0495600_0016472 3300046809 Bacteria 4691
549 Ga0495660_0000142 3300046810 Bacteria 77290
550 Ga0495660_0001119 3300046810 Bacteria 19156
551 Ga0495660_0007548 3300046810 Bacteria 6383
552 Ga0495660_0008985 3300046810 Bacteria 5837
553 Ga0495660_0012251 3300046810 Bacteria 4974
554 Ga0495660_0012502 3300046810 Bacteria 4928
555 Ga0495660_0012787 3300046810 Bacteria 4869
556 Ga0495660_0015928 3300046810 Bacteria 4338
557 Ga0495660_0022738 3300046810 Bacteria 3578
558 Ga0495660_0030871 3300046810 Bacteria 3016
559 Ga0495660_0054092 3300046810 Bacteria 2176
560 Ga0495660_0073726 3300046810 Bacteria 1804
561 Ga0495660_0085657 3300046810 Bacteria 1646
562 Ga0495660_0093750 3300046810 Bacteria 1556
563 Ga0495660_0136063 3300046810 Bacteria 1227
564 Ga0495660_0170688 3300046810 Bacteria 1059
565 Ga0495604_0028278 3300047317 Bacteria 4459
566 Ga0495604_0054701 3300047317 Bacteria 3079
567 Ga0495604_0331762 3300047317 Bacteria 1014
568 Ga0495636_0012249 3300047318 Bacteria 3395
569 Ga0495674_0027626 3300047319 Bacteria 5183
570 Ga0495672_0003642 3300047320 Bacteria 13052
571 Ga0495672_0004056 3300047320 Bacteria 12227
572 Ga0495672_0007887 3300047320 Bacteria 7943
573 Ga0495672_0015575 3300047320 Bacteria 5157
574 Ga0495672_0022571 3300047320 Bacteria 4088
575 Ga0495672_0029531 3300047320 Bacteria 3452
576 Ga0495672_0036108 3300047320 Bacteria 3037
577 Ga0495672_0039705 3300047320 Bacteria 2860
578 Ga0495672_0059273 3300047320 Bacteria 2215
579 Ga0495672_0110292 3300047320 Bacteria 1478
580 Ga0495676_0000013 3300047321 Bacteria 213031
581 Ga0495676_0019443 3300047321 Bacteria 5973
582 Ga0495676_0079116 3300047321 Bacteria 2500
583 Ga0495680_0009030 3300047322 Bacteria 9005
584 Ga0495680_0052857 3300047322 Bacteria 3164
585 Ga0495680_0072207 3300047322 Bacteria 2625
586 Ga0495683_0005515 3300047323 Bacteria 7015
587 Ga0495683_0016832 3300047323 Bacteria 3794
588 Ga0495683_0019268 3300047323 Bacteria 3522
589 Ga0495683_0022825 3300047323 Bacteria 3217
590 Ga0495683_0039481 3300047323 Bacteria 2385
591 Ga0495683_0193713 3300047323 Bacteria 920
592 Ga0495687_004474 3300047443 Bacteria 9414
593 Ga0495687_025436 3300047443 Bacteria 2798
594 Ga0495675_0303601 3300047444 Bacteria 947
595 Ga0495677_0003504 3300047445 Bacteria 6089
596 Ga0495679_000129 3300047446 Bacteria 67544
597 Ga0495679_004672 3300047446 Bacteria 6240
598 Ga0495679_007869 3300047446 Bacteria 4391
599 Ga0495679_007997 3300047446 Bacteria 4347
600 Ga0495679_009193 3300047446 Bacteria 3972
601 Ga0495679_009679 3300047446 Bacteria 3839
602 Ga0495679_016820 3300047446 Bacteria 2635
603 Ga0495679_016840 3300047446 Bacteria 2633
604 Ga0495679_030636 3300047446 Bacteria 1743
605 Ga0495679_069681 3300047446 Bacteria 1015
606 Ga0495673_0000510 3300047469 Bacteria 41036
607 Ga0495673_0000641 3300047469 Bacteria 34387
608 Ga0495673_0001049 3300047469 Bacteria 24312
609 Ga0495673_0003806 3300047469 Bacteria 9745
610 Ga0495673_0004768 3300047469 Bacteria 8399
611 Ga0495673_0006091 3300047469 Bacteria 7162
612 Ga0495673_0008502 3300047469 Bacteria 5767
613 Ga0495673_0009496 3300047469 Bacteria 5383
614 Ga0495673_0010918 3300047469 Bacteria 4914
615 Ga0495673_0013311 3300047469 Bacteria 4325
616 Ga0495673_0013457 3300047469 Bacteria 4292
617 Ga0495673_0014564 3300047469 Bacteria 4085
618 Ga0495673_0014875 3300047469 Bacteria 4030
619 Ga0495673_0022411 3300047469 Bacteria 3096
620 Ga0495673_0025384 3300047469 Bacteria 2846
621 Ga0495673_0026170 3300047469 Bacteria 2792
622 Ga0495673_0029441 3300047469 Bacteria 2591
623 Ga0495673_0036349 3300047469 Bacteria 2260
624 Ga0495673_0039748 3300047469 Bacteria 2132
625 Ga0495673_0041298 3300047469 Bacteria 2077
626 Ga0495681_0001437 3300047470 Bacteria 17881
627 Ga0495681_0004955 3300047470 Bacteria 8985
628 Ga0495681_0005721 3300047470 Bacteria 8274
629 Ga0495681_0007131 3300047470 Bacteria 7202
630 Ga0495681_0007318 3300047470 Bacteria 7072
631 Ga0495681_0015381 3300047470 Bacteria 4331
632 Ga0495681_0018869 3300047470 Bacteria 3785
633 Ga0495681_0038148 3300047470 Bacteria 2358
634 Ga0495681_0105343 3300047470 Bacteria 1227
635 Ga0495681_0155149 3300047470 Bacteria 957
636 Ga0495684_0010506 3300047471 Bacteria 7159
637 Ga0495684_0022241 3300047471 Bacteria 4882
638 Ga0495686_0015573 3300047472 Bacteria 5186
639 Ga0495686_0017332 3300047472 Bacteria 4856
640 Ga0495686_0021878 3300047472 Bacteria 4237
641 Ga0495686_0031136 3300047472 Bacteria 3461
642 Ga0495686_0040447 3300047472 Bacteria 2973
643 Ga0495686_0179017 3300047472 Bacteria 1229
644 Ga0495686_0229606 3300047472 Bacteria 1051
645 Ga0495593_0011041 3300047673 Bacteria 5199
646 Ga0495602_0015548 3300048088 Bacteria 7673
647 Ga0495626_0000056 3300048091 Bacteria 150654
648 Ga0495626_0001149 3300048091 Bacteria 22106
649 Ga0495626_0001346 3300048091 Bacteria 19873
650 Ga0495626_0002001 3300048091 Bacteria 15031
651 Ga0495626_0003528 3300048091 Bacteria 10014
652 Ga0495626_0007781 3300048091 Bacteria 5938
653 Ga0495626_0010537 3300048091 Bacteria 4923
654 Ga0495626_0011028 3300048091 Bacteria 4794
655 Ga0495626_0022037 3300048091 Bacteria 3151
656 Ga0495626_0048137 3300048091 Bacteria 1979
657 Ga0495626_0133578 3300048091 Bacteria 1057
658 Ga0496100_0032875 3300048903 Bacteria 3240
659 Ga0496101_0012768 3300048904 Bacteria 5617
660 Ga0496102_0004463 3300048905 Bacteria 11805
661 Ga0496102_0275671 3300048905 Bacteria 1585
662 Ga0496102_0622638 3300048905 Bacteria 1002
663 Ga0496103_0013756 3300048906 Bacteria 4803
664 Ga0496103_0140729 3300048906 Bacteria 1543
665 Ga0496104_0034402 3300048907 Bacteria 4725
666 Ga0496105_0092973 3300048908 Bacteria 2490
667 Ga0496110_0322043 3300048913 Bacteria 1408
668 Ga0496111_0327545 3300048914 Bacteria 1134
669 Ga0496112_0257867 3300048915 Bacteria 1693
670 Ga0496116_0006411 3300048919 Bacteria 10676
671 Ga0496116_0014738 3300048919 Bacteria 6226
672 Ga0496116_0022706 3300048919 Bacteria 4694
673 Ga0496116_0032094 3300048919 Bacteria 3748
674 Ga0496116_0046236 3300048919 Bacteria 2939
675 Ga0496116_0088988 3300048919 Bacteria 1885
676 Ga0496117_0002789 3300048920 Bacteria 21338
677 Ga0496117_0008857 3300048920 Bacteria 9496
678 Ga0496117_0011214 3300048920 Bacteria 8046
679 Ga0496117_0017405 3300048920 Bacteria 6000
680 Ga0496117_0025548 3300048920 Bacteria 4641
681 Ga0496117_0028665 3300048920 Bacteria 4308
682 Ga0496118_0016084 3300048921 Bacteria 6883
683 Ga0496118_0018336 3300048921 Bacteria 6319
684 Ga0496118_0025463 3300048921 Bacteria 5072
685 Ga0496118_0029625 3300048921 Bacteria 4586
686 Ga0496118_0051207 3300048921 Bacteria 3160
687 Ga0496118_0123217 3300048921 Bacteria 1684
688 Ga0496118_0170014 3300048921 Bacteria 1333
689 Ga0496119_0000011 3300048922 Bacteria 438315
690 Ga0496119_0000570 3300048922 Bacteria 49795
691 Ga0496119_0030527 3300048922 Bacteria 3631
692 Ga0496119_0046829 3300048922 Bacteria 2695
693 Ga0496120_0000306 3300048923 Bacteria 81699
694 Ga0496120_0008512 3300048923 Bacteria 7437
695 Ga0496120_0020768 3300048923 Bacteria 4164
696 Ga0496120_0031599 3300048923 Bacteria 3203
697 Ga0496120_0033638 3300048923 Bacteria 3078
698 Ga0496121_0005089 3300048924 Bacteria 17144
699 Ga0496121_0008265 3300048924 Bacteria 12317
700 Ga0496121_0018914 3300048924 Bacteria 6913
701 Ga0496121_0023351 3300048924 Bacteria 5959
702 Ga0496121_0048821 3300048924 Bacteria 3596
703 Ga0496121_0071713 3300048924 Bacteria 2784
704 Ga0496121_0501650 3300048924 Bacteria 770
705 Ga0496122_0000122 3300048925 Bacteria 181491
706 Ga0496122_0037968 3300048925 Bacteria 3867
707 Ga0496122_0043373 3300048925 Bacteria 3525
708 Ga0496122_0057593 3300048925 Bacteria 2884
709 Ga0496122_0063686 3300048925 Bacteria 2688
710 Ga0496122_0092629 3300048925 Bacteria 2053
711 Ga0496122_0102264 3300048925 Bacteria 1911
712 Ga0496122_0201513 3300048925 Bacteria 1163
713 Ga0496123_0000173 3300048926 Bacteria 130586
714 Ga0496123_0009566 3300048926 Bacteria 8711
715 Ga0496123_0044650 3300048926 Bacteria 3028
716 Ga0496123_0074315 3300048926 Bacteria 2104
717 Ga0496123_0097294 3300048926 Bacteria 1725
718 Ga0496123_0192918 3300048926 Bacteria 1052
719 Ga0496124_0007784 3300048927 Bacteria 11315
720 Ga0496124_0007979 3300048927 Bacteria 11142
721 Ga0496124_0008166 3300048927 Bacteria 10983
722 Ga0496124_0010290 3300048927 Bacteria 9492
723 Ga0496124_0013760 3300048927 Bacteria 7874
724 Ga0496124_0048184 3300048927 Bacteria 3643
725 Ga0496124_0081591 3300048927 Bacteria 2657
726 Ga0496124_0136492 3300048927 Bacteria 1941
727 Ga0496124_0160948 3300048927 Bacteria 1749
728 Ga0496124_0260254 3300048927 Bacteria 1277
729 Ga0496125_0001578 3300048928 Bacteria 32443
730 Ga0496125_0008486 3300048928 Bacteria 10751
731 Ga0496125_0031155 3300048928 Bacteria 4757
732 Ga0496125_0035635 3300048928 Bacteria 4359
733 Ga0496125_0037745 3300048928 Bacteria 4196
734 Ga0496125_0046617 3300048928 Bacteria 3635
735 Ga0496125_0109197 3300048928 Bacteria 2009
736 Ga0496125_0206908 3300048928 Bacteria 1278
737 Ga0496126_0004789 3300048929 Bacteria 15903
738 Ga0496126_0011313 3300048929 Bacteria 9256
739 Ga0496126_0044097 3300048929 Bacteria 4110
740 Ga0496126_0087985 3300048929 Bacteria 2737
741 Ga0495678_000031 3300049459 Bacteria 215528
742 Ga0495678_002391 3300049459 Bacteria 12835
743 Ga0495678_016115 3300049459 Bacteria 3426
744 Ga0495678_018587 3300049459 Bacteria 3120
745 Ga0495678_019146 3300049459 Bacteria 3061
746 Ga0495678_038471 3300049459 Bacteria 1935
747 Ga0495678_054293 3300049459 Bacteria 1534
748 Ga0495678_091212 3300049459 Bacteria 1073
749 Ga0495682_0002255 3300049460 Bacteria 9263
750 Ga0495682_0007653 3300049460 Bacteria 4287
751 Ga0495682_0011864 3300049460 Bacteria 3349
752 Ga0495682_0053676 3300049460 Bacteria 1463
753 Ga0495682_0080369 3300049460 Bacteria 1172
754 Ga0495682_0130893 3300049460 Bacteria 897
755 Ga0501036_0572564 3300049572 Bacteria 938
756 Ga0501037_0118024 3300049573 Bacteria 1909
757 Ga0501038_0050334 3300049574 Bacteria 3600
758 Ga0501040_0075444 3300049576 Unclassified 2330
759 Ga0501042_0027560 3300049578 Bacteria 3996
760 Ga0501042_0131366 3300049578 Unclassified 1805
761 Ga0501048_0042347 3300049582 Bacteria 3260
762 Ga0501071_0114807 3300049587 Bacteria 1992
763 Ga0501072_0164664 3300049588 Bacteria 1769
764 Ga0501075_0010719 3300049591 Bacteria 6453
765 Ga0501076_0086422 3300049592 Unclassified 2521
766 Ga0501076_0294829 3300049592 Unclassified 1329
767 Ga0501079_0032358 3300049741 Bacteria 4020
768 Ga0501080_0149400 3300049742 Bacteria 2160
769 Ga0501081_0573881 3300049743 Unclassified 843
770 Ga0501241_002124 3300049758 Bacteria 3878
771 Ga0500643_002976 3300053087 Bacteria 8393
772 Ga0500650_0086734 3300053098 Bacteria 1465
773 Ga0500572_004600 3300053111 Bacteria 3129
774 Ga0500573_0002559 3300053140 Bacteria 9137
775 Ga0500634_0002065 3300053161 Bacteria 8271
776 Ga0501084_0072561 3300054114 Unclassified 2883
777 Ga0501082_0406445 3300060353 Bacteria 1188
778 Ga0501082_0461427 3300060353 Unclassified 1110
779 Ga0530510_0050452 3300061734 Unclassified 3006

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0042347 Ga0501048_0042347_75_755 225
2 3300060353 Ga0501082_0461427 Ga0501082_0461427_45_725 225
3 3300047469 Ga0495673_0041298 Ga0495673_0041298_1351_2055 234
4 3300048924 Ga0496121_0501650 Ga0496121_0501650_13_732 239
5 3300049743 Ga0501081_0573881 Ga0501081_0573881_100_825 240
6 3300048903 Ga0496100_0032875 Ga0496100_0032875_1038_1817 244
7 3300048904 Ga0496101_0012768 Ga0496101_0012768_3433_4212 244
8 iso_pu_bacteria 2554235234 2555257608 246
9 iso_pu_bacteria 2599185169 2599409582 246
10 iso_pu_bacteria 2600255254 2601521924 246
11 iso_pu_bacteria 2600255255 2601526949 246
12 iso_pu_bacteria 2600255280 2601613779 246
13 iso_pu_bacteria 2600255281 2601618502 246
14 iso_pu_bacteria 2600255287 2601642870 246
15 iso_pu_bacteria 2600255288 2601647741 246
16 iso_pu_bacteria 2600255289 2601651927 246
17 iso_pu_bacteria 2600255290 2601657254 246
18 iso_pu_bacteria 2600255291 2601662691 246
19 iso_pu_bacteria 2600255298 2601695648 246
20 iso_pu_bacteria 2600255299 2601700324 246
21 iso_pu_bacteria 2600255300 2601705051 246
22 iso_pu_bacteria 2600255301 2601710080 246
23 iso_pu_bacteria 2600255302 2601715092 246
24 iso_pu_bacteria 2600255303 2601720675 246
25 iso_pu_bacteria 2600255304 2601725498 246
26 iso_pu_bacteria 2600255305 2601730040 246
27 iso_pu_bacteria 2600255306 2601735057 246
28 iso_pu_bacteria 2600255307 2601739742 246
29 iso_pu_bacteria 2600255309 2601750231 246
30 iso_pu_bacteria 2600255392 2602017484 246
31 iso_pu_bacteria 2602042052 2603660065 246
32 iso_pu_bacteria 2602042053 2603665341 246
33 iso_pu_bacteria 2602042103 2603837424 246
34 iso_pu_bacteria 2602042104 2603842500 246
35 iso_pu_bacteria 2602042105 2603847573 246
36 iso_pu_bacteria 2602042106 2603852644 246
37 iso_pu_bacteria 2602042109 2603866623 246
38 iso_pu_bacteria 2602042110 2603870697 246
39 iso_pu_bacteria 2602042111 2603875632 246
40 iso_pu_bacteria 2603880178 2606047888 246
41 iso_pu_bacteria 2603880184 2606069772 246
42 iso_pu_bacteria 2603880202 2606145607 246
43 iso_pu_bacteria 2603880211 2606175290 246
44 iso_pu_bacteria 2636415599 2637225502 246
45 iso_pu_bacteria 2675903046 2676406730 246
46 iso_pu_bacteria 2775507074 2777022858 246
47 iso_pu_bacteria 2904513164 2904513638 246
48 iso_pu_bacteria 2919108558 2919108806 246
49 iso_pu_bacteria 2969079654 2969082498 246
50 iso_pu_bacteria 2971820967 2971823375 246
51 iso_pu_bacteria 2984559226 2984559556 246
52 iso_pu_bacteria 2984595703 2984597642 246
53 iso_pu_bacteria 8057304971 8057309341 246
54 iso_pu_bacteria 2939607340 2939609135 248
55 iso_pu_bacteria 8055087960 8055090523 248
56 iso_pu_bacteria 8055092621 8055096811 248
57 iso_pu_bacteria 8055097453 8055098680 248
58 3300005289 Ga0065704_10095259 Ga0065704_100952593 250
59 3300009011 Ga0105251_10000021 Ga0105251_100000214 250
60 3300009011 Ga0105251_10000477 Ga0105251_100004777 250
61 3300009036 Ga0105244_10072395 Ga0105244_100723952 250
62 3300009092 Ga0105250_10000072 Ga0105250_1000007253 250
63 3300025711 Ga0207696_1000005 Ga0207696_1000005526 250
64 3300025728 Ga0207655_1000063 Ga0207655_100006355 250
65 3300025728 Ga0207655_1025566 Ga0207655_10255662 250
66 3300025735 Ga0207713_1000002 Ga0207713_1000002768 250
67 3300025735 Ga0207713_1000003 Ga0207713_1000003216 250
68 3300027111 Ga0209281_1004003 Ga0209281_10040032 250
69 3300046458 Ga0495591_002486 Ga0495591_002486_2093_2845 250
70 3300046460 Ga0495638_0005689 Ga0495638_0005689_803_1555 250
71 3300046471 Ga0495650_0004073 Ga0495650_0004073_2972_3739 250
72 3300046515 Ga0495620_0034269 Ga0495620_0034269_1282_2034 250
73 3300046694 Ga0495649_0007497 Ga0495649_0007497_1806_2558 250
74 3300046694 Ga0495649_0037742 Ga0495649_0037742_47_799 250
75 3300047446 Ga0495679_007869 Ga0495679_007869_1003_1755 250
76 3300047446 Ga0495679_069681 Ga0495679_069681_135_887 250
77 3300048907 Ga0496104_0034402 Ga0496104_0034402_650_1417 250
78 3300048908 Ga0496105_0092973 Ga0496105_0092973_388_1155 250
79 3300048920 Ga0496117_0008857 Ga0496117_0008857_2755_3522 250
80 3300048921 Ga0496118_0016084 Ga0496118_0016084_208_975 250
81 3300048922 Ga0496119_0000570 Ga0496119_0000570_38745_39512 250
82 3300048923 Ga0496120_0008512 Ga0496120_0008512_344_1111 250
83 3300048925 Ga0496122_0102264 Ga0496122_0102264_326_1093 250
84 3300048926 Ga0496123_0192918 Ga0496123_0192918_272_1039 250
85 3300048927 Ga0496124_0010290 Ga0496124_0010290_3340_4113 250
86 3300048927 Ga0496124_0048184 Ga0496124_0048184_1295_2062 250
87 3300048928 Ga0496125_0046617 Ga0496125_0046617_2148_2915 250
88 3300048929 Ga0496126_0044097 Ga0496126_0044097_2483_3250 250
89 3300041405 Ga0439438_000786 Ga0439438_000786_1973_2740 252
90 3300003322 rootL2_10085104 rootL2_100851042 253
91 iso_pu_bacteria 2643221638 2644213542 255
92 iso_pu_bacteria 2524023250 2524613639 256
93 3300046453 Ga0495627_000010 Ga0495627_000010_252434_253207 257
94 3300053140 Ga0500573_0002559 Ga0500573_0002559_7158_7931 257
95 3300013100 Ga0157373_10312720 Ga0157373_103127201 258
96 3300053087 Ga0500643_002976 Ga0500643_002976_2844_3623 258
97 iso_pu_bacteria 2511231023 2511368196 258
98 iso_pu_bacteria 2511231031 2511414973 258
99 iso_pu_bacteria 2599185307 2599973206 258
100 iso_pu_bacteria 2600255283 2601625800 258
101 iso_pu_bacteria 2718217725 2718632994 258
102 iso_pu_bacteria 2738543025 2739313069 258
103 iso_pu_bacteria 2808606379 2808942732 258
104 iso_pu_bacteria 2919155634 2919157028 258
105 iso_pu_bacteria 2919501602 2919506349 258
106 iso_pu_bacteria 2926063275 2926067419 258
107 iso_pu_bacteria 3007614139 3007614924 258
108 iso_pu_bacteria 640427133 640487214 258
109 iso_pu_bacteria 651053060 651175091 258
110 3300027876 Ga0209974_10028508 Ga0209974_100285083 259
111 3300049573 Ga0501037_0118024 Ga0501037_0118024_239_1021 259
112 iso_pu_bacteria 2511231010 2511291803 259
113 iso_pu_bacteria 2511231011 2511294913 259
114 iso_pu_bacteria 2511231012 2511302974 259
115 iso_pu_bacteria 2511231017 2511330554 259
116 iso_pu_bacteria 2511231156 2511823334 259
117 iso_pu_bacteria 2512047018 2512326399 259
118 iso_pu_bacteria 2582580891 2583790717 259
119 iso_pu_bacteria 2599185167 2599396774 259
120 iso_pu_bacteria 2599185179 2599448752 259
121 iso_pu_bacteria 2599185190 2599511489 259
122 iso_pu_bacteria 2599185191 2599517571 259
123 iso_pu_bacteria 2599185257 2599805129 259
124 iso_pu_bacteria 2599185288 2599879939 259
125 iso_pu_bacteria 2599185290 2599890863 259
126 iso_pu_bacteria 2599185302 2599946134 259
127 iso_pu_bacteria 2599185303 2599948446 259
128 iso_pu_bacteria 2599185304 2599957273 259
129 iso_pu_bacteria 2599185306 2599965536 259
130 iso_pu_bacteria 2599185308 2599980073 259
131 iso_pu_bacteria 2599185309 2599986180 259
132 iso_pu_bacteria 2599185310 2599991947 259
133 iso_pu_bacteria 2599185312 2600003024 259
134 iso_pu_bacteria 2599185314 2600013985 259
135 iso_pu_bacteria 2599185320 2600050476 259
136 iso_pu_bacteria 2600254931 2600363839 259
137 iso_pu_bacteria 2600255318 2601799819 259
138 iso_pu_bacteria 2603880185 2606074382 259
139 iso_pu_bacteria 2603880199 2606127245 259
140 iso_pu_bacteria 2619619299 2621301239 259
141 iso_pu_bacteria 2623620443 2624479105 259
142 iso_pu_bacteria 2643221650 2644283489 259
143 iso_pu_bacteria 2671180172 2671768137 259
144 iso_pu_bacteria 2675903515 2678261883 259
145 iso_pu_bacteria 2713897149 2715758826 259
146 iso_pu_bacteria 2738541265 2738673992 259
147 iso_pu_bacteria 2738541282 2738752385 259
148 iso_pu_bacteria 2738541294 2738809405 259
149 iso_pu_bacteria 2738541303 2738861426 259
150 iso_pu_bacteria 2738541309 2738896765 259
151 iso_pu_bacteria 2740892503 2743735933 259
152 iso_pu_bacteria 2744054620 2745008232 259
153 iso_pu_bacteria 2773857670 2774121484 259
154 iso_pu_bacteria 2784132063 2784260177 259
155 iso_pu_bacteria 2784132072 2784315628 259
156 iso_pu_bacteria 2791355520 2794594698 259
157 iso_pu_bacteria 2808606361 2808856746 259
158 iso_pu_bacteria 2808606373 2808907739 259
159 iso_pu_bacteria 2808606376 2808926927 259
160 iso_pu_bacteria 2808606377 2808929359 259
161 iso_pu_bacteria 2808606378 2808936805 259
162 iso_pu_bacteria 2808606380 2808945968 259
163 iso_pu_bacteria 2808606381 2808951533 259
164 iso_pu_bacteria 2808606382 2808960878 259
165 iso_pu_bacteria 2808606383 2808965133 259
166 iso_pu_bacteria 2808606389 2809000025 259
167 iso_pu_bacteria 2816332298 2817489399 259
168 iso_pu_bacteria 2818991456 2819654667 259
169 iso_pu_bacteria 2825651385 2825653392 259
170 iso_pu_bacteria 2834028612 2834029311 259
171 iso_pu_bacteria 2842832357 2842833066 259
172 iso_pu_bacteria 2842854478 2842856952 259
173 iso_pu_bacteria 2860339153 2860340387 259
174 iso_pu_bacteria 2860867994 2860869355 259
175 iso_pu_bacteria 2878029506 2878031063 259
176 iso_pu_bacteria 2880230671 2880231977 259
177 iso_pu_bacteria 2913036834 2913038229 259
178 iso_pu_bacteria 2919063839 2919064422 259
179 iso_pu_bacteria 2919385768 2919386103 259
180 iso_pu_bacteria 2919456309 2919458045 259
181 iso_pu_bacteria 2923153595 2923154943 259
182 iso_pu_bacteria 2929144301 2929145676 259
183 iso_pu_bacteria 2931369376 2931370992 259
184 iso_pu_bacteria 2931390751 2931392330 259
185 iso_pu_bacteria 2931396565 2931399708 259
186 iso_pu_bacteria 2945961074 2945961582 259
187 iso_pu_bacteria 2946006987 2946011513 259
188 iso_pu_bacteria 2946027586 2946029549 259
189 iso_pu_bacteria 2969304461 2969305888 259
190 iso_pu_bacteria 2974289157 2974292497 259
191 iso_pu_bacteria 2984286254 2984291088 259
192 iso_pu_bacteria 2988728565 2988733218 259
193 iso_pu_bacteria 2998139840 2998141310 259
194 iso_pu_bacteria 3007395558 3007400461 259
195 iso_pu_bacteria 3007619802 3007622039 259
196 iso_pu_bacteria 3007718800 3007722961 259
197 iso_pu_bacteria 3007855910 3007855921 259
198 iso_pu_bacteria 3007861166 3007863454 259
199 iso_pu_bacteria 8015687852 8015689175 259
200 iso_pu_bacteria 8029995093 8029999436 259
201 iso_pu_bacteria 8054285046 8054288823 259
202 iso_pu_bacteria 8054503363 8054504893 259
203 iso_pu_bacteria 8055817908 8055819353 259
204 iso_pu_bacteria 8056131705 8056133260 259
205 iso_pu_bacteria 8056143049 8056147603 259
206 iso_pu_bacteria 8056166840 8056169746 259
207 iso_pu_bacteria 8056569372 8056569973 259
208 3300003771 Ga0055526_1010871 Ga0055526_10108714 260
209 3300005329 Ga0070683_100000933 Ga0070683_10000093311 260
210 3300005434 Ga0070709_10005206 Ga0070709_1000520611 260
211 3300009101 Ga0105247_10051921 Ga0105247_100519212 260
212 3300025295 Ga0209564_1001361 Ga0209564_100136113 260
213 3300025900 Ga0207710_10141532 Ga0207710_101415322 260
214 3300025906 Ga0207699_10028489 Ga0207699_100284893 260
215 3300049572 Ga0501036_0572564 Ga0501036_0572564_10_819 260
216 3300049574 Ga0501038_0050334 Ga0501038_0050334_35_820 260
217 3300049576 Ga0501040_0075444 Ga0501040_0075444_560_1369 260
218 3300049578 Ga0501042_0027560 Ga0501042_0027560_299_1108 260
219 3300049578 Ga0501042_0131366 Ga0501042_0131366_12_797 260
220 3300049587 Ga0501071_0114807 Ga0501071_0114807_1073_1858 260
221 3300049588 Ga0501072_0164664 Ga0501072_0164664_454_1239 260
222 3300049591 Ga0501075_0010719 Ga0501075_0010719_2938_3747 260
223 3300049592 Ga0501076_0086422 Ga0501076_0086422_671_1480 260
224 3300049592 Ga0501076_0294829 Ga0501076_0294829_389_1174 260
225 3300049741 Ga0501079_0032358 Ga0501079_0032358_688_1497 260
226 3300049742 Ga0501080_0149400 Ga0501080_0149400_1337_2146 260
227 3300054114 Ga0501084_0072561 Ga0501084_0072561_1388_2197 260
228 3300060353 Ga0501082_0406445 Ga0501082_0406445_253_1062 260
229 3300061734 Ga0530510_0050452 Ga0530510_0050452_1244_2053 260
230 3300046458 Ga0495591_000452 Ga0495591_000452_28228_29013 261
231 3300046507 Ga0495606_0001543 Ga0495606_0001543_837_1622 261
232 3300046616 Ga0495668_0008255 Ga0495668_0008255_524_1309 261
233 3300047469 Ga0495673_0008502 Ga0495673_0008502_4660_5445 261
234 3300048905 Ga0496102_0622638 Ga0496102_0622638_32_817 261
235 3300048913 Ga0496110_0322043 Ga0496110_0322043_132_917 261
236 3300048927 Ga0496124_0136492 Ga0496124_0136492_661_1446 261
237 3300005289 Ga0065704_10142008 Ga0065704_101420082 262
238 3300009036 Ga0105244_10041414 Ga0105244_100414142 262
239 3300009036 Ga0105244_10093887 Ga0105244_100938872 262
240 3300012498 Ga0157345_1000135 Ga0157345_10001357 262
241 3300013307 Ga0157372_10004247 Ga0157372_100042472 262
242 3300017792 Ga0163161_10002537 Ga0163161_100025375 262
243 3300025728 Ga0207655_1074812 Ga0207655_10748122 262
244 3300025735 Ga0207713_1000104 Ga0207713_100010479 262
245 3300027378 Ga0209981_1004989 Ga0209981_10049892 262
246 3300027395 Ga0209996_1001558 Ga0209996_10015582 262
247 3300027526 Ga0209968_1006918 Ga0209968_10069182 262
248 3300027665 Ga0209983_1001292 Ga0209983_10012927 262
249 3300031911 Ga0307412_10021104 Ga0307412_100211043 262
250 3300033180 Ga0307510_10107259 Ga0307510_101072592 262
251 3300041411 Ga0439466_0008863 Ga0439466_0008863_1220_2008 262
252 3300046452 Ga0495617_007892 Ga0495617_007892_1479_2267 262
253 3300046453 Ga0495627_005495 Ga0495627_005495_2492_3280 262
254 3300046458 Ga0495591_000002 Ga0495591_000002_168832_169620 262
255 3300046458 Ga0495591_001442 Ga0495591_001442_3355_4143 262
256 3300046458 Ga0495591_002525 Ga0495591_002525_6139_6927 262
257 3300046458 Ga0495591_004698 Ga0495591_004698_125_913 262
258 3300046458 Ga0495591_007825 Ga0495591_007825_125_913 262
259 3300046458 Ga0495591_008402 Ga0495591_008402_1913_2701 262
260 3300046458 Ga0495591_013459 Ga0495591_013459_521_1333 262
261 3300046460 Ga0495638_0007812 Ga0495638_0007812_4997_5785 262
262 3300046460 Ga0495638_0032131 Ga0495638_0032131_2271_3059 262
263 3300046463 Ga0495653_0015282 Ga0495653_0015282_284_1072 262
264 3300046471 Ga0495650_0019471 Ga0495650_0019471_686_1474 262
265 3300046471 Ga0495650_0032847 Ga0495650_0032847_127_915 262
266 3300046471 Ga0495650_0049992 Ga0495650_0049992_931_1719 262
267 3300046471 Ga0495650_0056126 Ga0495650_0056126_194_982 262
268 3300046474 Ga0495605_0005553 Ga0495605_0005553_6438_7301 262
269 3300046474 Ga0495605_0010655 Ga0495605_0010655_2497_3285 262
270 3300046474 Ga0495605_0022243 Ga0495605_0022243_1905_2732 262
271 3300046491 Ga0495584_0017755 Ga0495584_0017755_1365_2153 262
272 3300046491 Ga0495584_0022206 Ga0495584_0022206_1889_2677 262
273 3300046491 Ga0495584_0067622 Ga0495584_0067622_84_872 262
274 3300046492 Ga0495585_0007924 Ga0495585_0007924_3557_4345 262
275 3300046492 Ga0495585_0076259 Ga0495585_0076259_881_1669 262
276 3300046501 Ga0495607_0000025 Ga0495607_0000025_139687_140475 262
277 3300046501 Ga0495607_0000723 Ga0495607_0000723_5085_5873 262
278 3300046501 Ga0495607_0009730 Ga0495607_0009730_2192_2980 262
279 3300046501 Ga0495607_0063469 Ga0495607_0063469_414_1202 262
280 3300046506 Ga0495583_0001907 Ga0495583_0001907_12251_13078 262
281 3300046506 Ga0495583_0008510 Ga0495583_0008510_389_1177 262
282 3300046506 Ga0495583_0029479 Ga0495583_0029479_84_872 262
283 3300046507 Ga0495606_0000055 Ga0495606_0000055_117709_118536 262
284 3300046507 Ga0495606_0016397 Ga0495606_0016397_2335_3123 262
285 3300046507 Ga0495606_0020935 Ga0495606_0020935_1816_2604 262
286 3300046507 Ga0495606_0031545 Ga0495606_0031545_1145_1933 262
287 3300046507 Ga0495606_0101267 Ga0495606_0101267_59_847 262
288 3300046507 Ga0495606_0227933 Ga0495606_0227933_134_922 262
289 3300046512 Ga0495610_0008798 Ga0495610_0008798_2890_3678 262
290 3300046512 Ga0495610_0010140 Ga0495610_0010140_3511_4299 262
291 3300046512 Ga0495610_0016078 Ga0495610_0016078_967_1794 262
292 3300046512 Ga0495610_0049979 Ga0495610_0049979_1081_1869 262
293 3300046513 Ga0495616_0009252 Ga0495616_0009252_3800_4588 262
294 3300046513 Ga0495616_0012317 Ga0495616_0012317_1840_2628 262
295 3300046513 Ga0495616_0025253 Ga0495616_0025253_2033_2860 262
296 3300046515 Ga0495620_0001753 Ga0495620_0001753_4079_4867 262
297 3300046515 Ga0495620_0002591 Ga0495620_0002591_3475_4263 262
298 3300046515 Ga0495620_0007857 Ga0495620_0007857_4460_5248 262
299 3300046515 Ga0495620_0008194 Ga0495620_0008194_3258_4046 262
300 3300046515 Ga0495620_0022198 Ga0495620_0022198_1315_2103 262
301 3300046515 Ga0495620_0031288 Ga0495620_0031288_241_1029 262
302 3300046518 Ga0495631_0003291 Ga0495631_0003291_5898_6686 262
303 3300046518 Ga0495631_0023185 Ga0495631_0023185_185_1012 262
304 3300046518 Ga0495631_0090514 Ga0495631_0090514_32_820 262
305 3300046519 Ga0495632_0013714 Ga0495632_0013714_2782_3570 262
306 3300046520 Ga0495637_0000414 Ga0495637_0000414_26406_27194 262
307 3300046520 Ga0495637_0002290 Ga0495637_0002290_3643_4431 262
308 3300046520 Ga0495637_0014643 Ga0495637_0014643_1500_2288 262
309 3300046522 Ga0495643_0006744 Ga0495643_0006744_6304_7092 262
310 3300046522 Ga0495643_0186716 Ga0495643_0186716_28_816 262
311 3300046523 Ga0495644_0001339 Ga0495644_0001339_3976_4803 262
312 3300046523 Ga0495644_0011222 Ga0495644_0011222_1374_2162 262
313 3300046524 Ga0495648_0006635 Ga0495648_0006635_4480_5268 262
314 3300046524 Ga0495648_0007214 Ga0495648_0007214_5838_6626 262
315 3300046524 Ga0495648_0013042 Ga0495648_0013042_3505_4293 262
316 3300046524 Ga0495648_0016559 Ga0495648_0016559_2314_3102 262
317 3300046524 Ga0495648_0024568 Ga0495648_0024568_1550_2338 262
318 3300046530 Ga0495654_0000673 Ga0495654_0000673_20086_20913 262
319 3300046530 Ga0495654_0027278 Ga0495654_0027278_2089_2877 262
320 3300046530 Ga0495654_0037975 Ga0495654_0037975_53_841 262
321 3300046530 Ga0495654_0128589 Ga0495654_0128589_292_1080 262
322 3300046538 Ga0495609_0000066 Ga0495609_0000066_100028_100855 262
323 3300046538 Ga0495609_0018559 Ga0495609_0018559_2016_2804 262
324 3300046542 Ga0495597_0000011 Ga0495597_0000011_201414_202202 262
325 3300046542 Ga0495597_0008888 Ga0495597_0008888_1878_2666 262
326 3300046557 Ga0495622_0002561 Ga0495622_0002561_5385_6173 262
327 3300046557 Ga0495622_0008562 Ga0495622_0008562_658_1485 262
328 3300046616 Ga0495668_0185858 Ga0495668_0185858_64_852 262
329 3300046648 Ga0495611_0000416 Ga0495611_0000416_9868_10656 262
330 3300046648 Ga0495611_0002365 Ga0495611_0002365_3709_4497 262
331 3300046648 Ga0495611_0003356 Ga0495611_0003356_4718_5506 262
332 3300046660 Ga0495625_0000055 Ga0495625_0000055_102390_103178 262
333 3300046660 Ga0495625_0020483 Ga0495625_0020483_1720_2508 262
334 3300046665 Ga0495661_0000105 Ga0495661_0000105_143_970 262
335 3300046665 Ga0495661_0000139 Ga0495661_0000139_86_874 262
336 3300046665 Ga0495661_0025126 Ga0495661_0025126_1094_1882 262
337 3300046665 Ga0495661_0034528 Ga0495661_0034528_2233_3021 262
338 3300046680 Ga0495646_0098588 Ga0495646_0098588_607_1395 262
339 3300046689 Ga0495613_0061840 Ga0495613_0061840_1886_2674 262
340 3300046690 Ga0495624_0007174 Ga0495624_0007174_5138_5926 262
341 3300046692 Ga0495671_0000516 Ga0495671_0000516_28683_29471 262
342 3300046692 Ga0495671_0022087 Ga0495671_0022087_309_1097 262
343 3300046692 Ga0495671_0033881 Ga0495671_0033881_806_1594 262
344 3300046692 Ga0495671_0039276 Ga0495671_0039276_60_848 262
345 3300046694 Ga0495649_0013971 Ga0495649_0013971_1848_2636 262
346 3300046694 Ga0495649_0052219 Ga0495649_0052219_1229_2017 262
347 3300046794 Ga0495589_0000411 Ga0495589_0000411_18242_19030 262
348 3300046809 Ga0495600_0016472 Ga0495600_0016472_1852_2640 262
349 3300046810 Ga0495660_0000142 Ga0495660_0000142_24108_24971 262
350 3300046810 Ga0495660_0001119 Ga0495660_0001119_10071_10859 262
351 3300046810 Ga0495660_0007548 Ga0495660_0007548_3685_4473 262
352 3300046810 Ga0495660_0054092 Ga0495660_0054092_230_1018 262
353 3300046810 Ga0495660_0073726 Ga0495660_0073726_931_1719 262
354 3300046810 Ga0495660_0093750 Ga0495660_0093750_168_956 262
355 3300046810 Ga0495660_0170688 Ga0495660_0170688_186_1013 262
356 3300047317 Ga0495604_0331762 Ga0495604_0331762_199_987 262
357 3300047320 Ga0495672_0007887 Ga0495672_0007887_5227_6015 262
358 3300047320 Ga0495672_0029531 Ga0495672_0029531_145_933 262
359 3300047320 Ga0495672_0036108 Ga0495672_0036108_53_841 262
360 3300047320 Ga0495672_0059273 Ga0495672_0059273_1280_2068 262
361 3300047320 Ga0495672_0110292 Ga0495672_0110292_298_1086 262
362 3300047321 Ga0495676_0000013 Ga0495676_0000013_103259_104086 262
363 3300047321 Ga0495676_0079116 Ga0495676_0079116_107_895 262
364 3300047322 Ga0495680_0052857 Ga0495680_0052857_735_1523 262
365 3300047323 Ga0495683_0005515 Ga0495683_0005515_2975_3802 262
366 3300047323 Ga0495683_0019268 Ga0495683_0019268_2474_3262 262
367 3300047446 Ga0495679_000129 Ga0495679_000129_24495_25322 262
368 3300047446 Ga0495679_004672 Ga0495679_004672_3542_4330 262
369 3300047446 Ga0495679_009193 Ga0495679_009193_1566_2354 262
370 3300047469 Ga0495673_0000510 Ga0495673_0000510_15322_16110 262
371 3300047469 Ga0495673_0000641 Ga0495673_0000641_11289_12077 262
372 3300047469 Ga0495673_0001049 Ga0495673_0001049_20562_21368 262
373 3300047469 Ga0495673_0009496 Ga0495673_0009496_3583_4371 262
374 3300047469 Ga0495673_0013311 Ga0495673_0013311_2794_3582 262
375 3300047469 Ga0495673_0013457 Ga0495673_0013457_37_825 262
376 3300047469 Ga0495673_0014564 Ga0495673_0014564_1880_2668 262
377 3300047469 Ga0495673_0014875 Ga0495673_0014875_3209_3997 262
378 3300047469 Ga0495673_0039748 Ga0495673_0039748_1171_1959 262
379 3300047470 Ga0495681_0005721 Ga0495681_0005721_4168_4956 262
380 3300047470 Ga0495681_0015381 Ga0495681_0015381_415_1203 262
381 3300047471 Ga0495684_0022241 Ga0495684_0022241_3690_4478 262
382 3300047472 Ga0495686_0017332 Ga0495686_0017332_2119_2907 262
383 3300047472 Ga0495686_0021878 Ga0495686_0021878_2013_2801 262
384 3300047472 Ga0495686_0031136 Ga0495686_0031136_2433_3221 262
385 3300047472 Ga0495686_0040447 Ga0495686_0040447_2048_2836 262
386 3300048088 Ga0495602_0015548 Ga0495602_0015548_5092_5880 262
387 3300048091 Ga0495626_0000056 Ga0495626_0000056_40993_41820 262
388 3300048091 Ga0495626_0010537 Ga0495626_0010537_2016_2804 262
389 3300048905 Ga0496102_0275671 Ga0496102_0275671_154_942 262
390 3300048906 Ga0496103_0140729 Ga0496103_0140729_265_1053 262
391 3300048914 Ga0496111_0327545 Ga0496111_0327545_212_1000 262
392 3300048919 Ga0496116_0088988 Ga0496116_0088988_801_1589 262
393 3300048921 Ga0496118_0170014 Ga0496118_0170014_454_1242 262
394 3300048922 Ga0496119_0000011 Ga0496119_0000011_42352_43140 262
395 3300048923 Ga0496120_0000306 Ga0496120_0000306_21122_21910 262
396 3300048924 Ga0496121_0005089 Ga0496121_0005089_9664_10452 262
397 3300048924 Ga0496121_0008265 Ga0496121_0008265_5235_6023 262
398 3300048925 Ga0496122_0000122 Ga0496122_0000122_99713_100501 262
399 3300048925 Ga0496122_0092629 Ga0496122_0092629_71_859 262
400 3300048926 Ga0496123_0000173 Ga0496123_0000173_71194_71982 262
401 3300048926 Ga0496123_0074315 Ga0496123_0074315_1192_1980 262
402 3300048927 Ga0496124_0007784 Ga0496124_0007784_906_1694 262
403 3300049459 Ga0495678_000031 Ga0495678_000031_162704_163492 262
404 3300049459 Ga0495678_016115 Ga0495678_016115_1332_2120 262
405 3300049459 Ga0495678_018587 Ga0495678_018587_2251_3039 262
406 3300049459 Ga0495678_019146 Ga0495678_019146_1257_2045 262
407 3300049459 Ga0495678_038471 Ga0495678_038471_315_1103 262
408 3300049460 Ga0495682_0002255 Ga0495682_0002255_288_1076 262
409 3300049460 Ga0495682_0007653 Ga0495682_0007653_1299_2087 262
410 3300053098 Ga0500650_0086734 Ga0500650_0086734_132_950 262
411 3300053111 Ga0500572_004600 Ga0500572_004600_1862_2650 262
412 2162886007 SwRhRL2b_contig_2696906 SwRhRL2b_0502.00007160 263
413 3300002771 JGI25163J39215_1000348 JGI25163J39215_10003488 263
414 3300002772 JGI25164J39214_1000492 JGI25164J39214_10004928 263
415 3300003214 JGI25165J46597_1000934 JGI25165J46597_10009349 263
416 3300003781 Ga0055536_1000043 Ga0055536_1000043108 263
417 3300003781 Ga0055536_1001093 Ga0055536_10010935 263
418 3300003791 Ga0055530_10000031 Ga0055530_1000003113 263
419 3300003791 Ga0055530_10000527 Ga0055530_1000052724 263
420 3300003792 Ga0055540_1000161 Ga0055540_100016155 263
421 3300003792 Ga0055540_1000230 Ga0055540_100023018 263
422 3300003792 Ga0055540_1001131 Ga0055540_100113118 263
423 3300003794 Ga0055531_10001267 Ga0055531_100012676 263
424 3300005288 Ga0065714_10065072 Ga0065714_100650726 263
425 3300005288 Ga0065714_10069444 Ga0065714_100694442 263
426 3300005288 Ga0065714_10070935 Ga0065714_100709352 263
427 3300005288 Ga0065714_10073836 Ga0065714_100738363 263
428 3300005289 Ga0065704_10001387 Ga0065704_1000138713 263
429 3300005331 Ga0070670_100001105 Ga0070670_1000011058 263
430 3300005331 Ga0070670_100009361 Ga0070670_1000093619 263
431 3300005344 Ga0070661_100000238 Ga0070661_10000023813 263
432 3300005353 Ga0070669_100000150 Ga0070669_10000015039 263
433 3300005539 Ga0068853_100005654 Ga0068853_1000056547 263
434 3300005548 Ga0070665_100251663 Ga0070665_1002516632 263
435 3300005564 Ga0070664_100000233 Ga0070664_10000023328 263
436 3300005578 Ga0068854_100008578 Ga0068854_1000085786 263
437 3300005834 Ga0068851_10000019 Ga0068851_10000019115 263
438 3300006051 Ga0075364_10294879 Ga0075364_102948791 263
439 3300006946 Ga0079104_1028293 Ga0079104_10282932 263
440 3300009011 Ga0105251_10003438 Ga0105251_100034387 263
441 3300009011 Ga0105251_10003475 Ga0105251_100034751 263
442 3300009011 Ga0105251_10009892 Ga0105251_100098922 263
443 3300009011 Ga0105251_10017479 Ga0105251_100174794 263
444 3300009036 Ga0105244_10004276 Ga0105244_100042763 263
445 3300009036 Ga0105244_10004598 Ga0105244_100045987 263
446 3300009036 Ga0105244_10010896 Ga0105244_100108966 263
447 3300009036 Ga0105244_10026476 Ga0105244_100264764 263
448 3300009092 Ga0105250_10000118 Ga0105250_1000011820 263
449 3300009092 Ga0105250_10002765 Ga0105250_100027653 263
450 3300009092 Ga0105250_10003322 Ga0105250_100033224 263
451 3300009092 Ga0105250_10065396 Ga0105250_100653962 263
452 3300009148 Ga0105243_10001564 Ga0105243_1000156420 263
453 3300009176 Ga0105242_10000719 Ga0105242_100007199 263
454 3300009177 Ga0105248_10438648 Ga0105248_104386482 263
455 3300009545 Ga0105237_10005805 Ga0105237_100058054 263
456 3300011119 Ga0105246_10001731 Ga0105246_100017311 263
457 3300011119 Ga0105246_10002504 Ga0105246_100025048 263
458 3300011119 Ga0105246_10027971 Ga0105246_100279713 263
459 3300013100 Ga0157373_10001969 Ga0157373_1000196912 263
460 3300013100 Ga0157373_10007934 Ga0157373_100079348 263
461 3300013100 Ga0157373_10008873 Ga0157373_100088734 263
462 3300013100 Ga0157373_10031446 Ga0157373_100314462 263
463 3300013100 Ga0157373_10031805 Ga0157373_100318053 263
464 3300013100 Ga0157373_10070927 Ga0157373_100709272 263
465 3300013100 Ga0157373_10178320 Ga0157373_101783202 263
466 3300013102 Ga0157371_10000281 Ga0157371_1000028112 263
467 3300013102 Ga0157371_10019377 Ga0157371_100193773 263
468 3300013104 Ga0157370_10036138 Ga0157370_100361384 263
469 3300013104 Ga0157370_10137734 Ga0157370_101377343 263
470 3300013105 Ga0157369_10003643 Ga0157369_1000364312 263
471 3300013105 Ga0157369_10010141 Ga0157369_100101415 263
472 3300013105 Ga0157369_10043869 Ga0157369_100438692 263
473 3300013306 Ga0163162_10000835 Ga0163162_1000083515 263
474 3300013306 Ga0163162_10476875 Ga0163162_104768752 263
475 3300013308 Ga0157375_10005491 Ga0157375_100054918 263
476 3300013308 Ga0157375_10039221 Ga0157375_100392214 263
477 3300013308 Ga0157375_10337200 Ga0157375_103372001 263
478 3300014497 Ga0182008_10007260 Ga0182008_100072606 263
479 3300014497 Ga0182008_10013392 Ga0182008_100133922 263
480 3300015261 Ga0182006_1000816 Ga0182006_10008169 263
481 3300015261 Ga0182006_1008689 Ga0182006_10086894 263
482 3300015262 Ga0182007_10003838 Ga0182007_100038385 263
483 3300015265 Ga0182005_1005224 Ga0182005_10052245 263
484 3300015265 Ga0182005_1009143 Ga0182005_10091432 263
485 3300015265 Ga0182005_1028956 Ga0182005_10289562 263
486 3300017792 Ga0163161_10037516 Ga0163161_100375162 263
487 3300017792 Ga0163161_10052017 Ga0163161_100520172 263
488 3300017792 Ga0163161_10064796 Ga0163161_100647963 263
489 3300017792 Ga0163161_10113280 Ga0163161_101132802 263
490 3300017792 Ga0163161_10138446 Ga0163161_101384462 263
491 3300017792 Ga0163161_10422888 Ga0163161_104228882 263
492 3300025207 Ga0209760_100047 Ga0209760_10004714 263
493 3300025231 Ga0207427_100029 Ga0207427_100029194 263
494 3300025233 Ga0209437_100009 Ga0209437_100009449 263
495 3300025261 Ga0209233_1000032 Ga0209233_1000032449 263
496 3300025291 Ga0209675_1002348 Ga0209675_10023488 263
497 3300025292 Ga0209676_1000016 Ga0209676_1000016227 263
498 3300025292 Ga0209676_1000033 Ga0209676_100003369 263
499 3300025292 Ga0209676_1000080 Ga0209676_1000080153 263
500 3300025292 Ga0209676_1002060 Ga0209676_100206010 263
501 3300025292 Ga0209676_1011697 Ga0209676_10116973 263
502 3300025298 Ga0209050_1000036 Ga0209050_1000036331 263
503 3300025298 Ga0209050_1000117 Ga0209050_1000117107 263
504 3300025298 Ga0209050_1000187 Ga0209050_1000187133 263
505 3300025298 Ga0209050_1001134 Ga0209050_100113423 263
506 3300025303 Ga0209051_1000077 Ga0209051_1000077107 263
507 3300025303 Ga0209051_1000094 Ga0209051_1000094118 263
508 3300025303 Ga0209051_1000131 Ga0209051_1000131133 263
509 3300025303 Ga0209051_1007856 Ga0209051_10078563 263
510 3300025304 Ga0209257_1000173 Ga0209257_100017372 263
511 3300025321 Ga0207656_10000026 Ga0207656_1000002644 263
512 3300025711 Ga0207696_1000083 Ga0207696_100008373 263
513 3300025711 Ga0207696_1000111 Ga0207696_100011169 263
514 3300025711 Ga0207696_1018769 Ga0207696_10187693 263
515 3300025728 Ga0207655_1000435 Ga0207655_100043534 263
516 3300025728 Ga0207655_1002166 Ga0207655_100216611 263
517 3300025728 Ga0207655_1002478 Ga0207655_100247810 263
518 3300025728 Ga0207655_1002832 Ga0207655_10028327 263
519 3300025728 Ga0207655_1006801 Ga0207655_10068017 263
520 3300025728 Ga0207655_1014097 Ga0207655_10140973 263
521 3300025735 Ga0207713_1000564 Ga0207713_100056414 263
522 3300025735 Ga0207713_1001593 Ga0207713_100159310 263
523 3300025735 Ga0207713_1002004 Ga0207713_100200417 263
524 3300025735 Ga0207713_1002990 Ga0207713_10029908 263
525 3300025735 Ga0207713_1003370 Ga0207713_10033705 263
526 3300025735 Ga0207713_1005039 Ga0207713_10050395 263
527 3300025735 Ga0207713_1018153 Ga0207713_10181533 263
528 3300025735 Ga0207713_1065880 Ga0207713_10658802 263
529 3300025914 Ga0207671_10000436 Ga0207671_1000043623 263
530 3300025920 Ga0207649_10000002 Ga0207649_10000002290 263
531 3300025923 Ga0207681_10000816 Ga0207681_100008168 263
532 3300025925 Ga0207650_10000559 Ga0207650_1000055919 263
533 3300025925 Ga0207650_10000688 Ga0207650_1000068819 263
534 3300025933 Ga0207706_10005582 Ga0207706_100055823 263
535 3300025934 Ga0207686_10005841 Ga0207686_100058411 263
536 3300025935 Ga0207709_10000036 Ga0207709_1000003681 263
537 3300025945 Ga0207679_10000006 Ga0207679_10000006201 263
538 3300026041 Ga0207639_10002172 Ga0207639_100021725 263
539 3300027111 Ga0209281_1014772 Ga0209281_10147722 263
540 3300027111 Ga0209281_1014996 Ga0209281_10149962 263
541 3300028379 Ga0268266_10011117 Ga0268266_100111173 263
542 3300030521 Ga0307511_10181496 Ga0307511_101814962 263
543 3300030735 Ga0316178_1175126 Ga0316178_11751262 263
544 3300031247 Ga0265340_10100814 Ga0265340_101008142 263
545 3300031507 Ga0307509_10045079 Ga0307509_100450793 263
546 3300031548 Ga0307408_100009275 Ga0307408_1000092753 263
547 3300031548 Ga0307408_100047218 Ga0307408_1000472183 263
548 3300031548 Ga0307408_100331416 Ga0307408_1003314162 263
549 3300031731 Ga0307405_10000858 Ga0307405_100008588 263
550 3300031731 Ga0307405_10042297 Ga0307405_100422972 263
551 3300031731 Ga0307405_10062191 Ga0307405_100621912 263
552 3300031901 Ga0307406_10605063 Ga0307406_106050631 263
553 3300031911 Ga0307412_10013149 Ga0307412_100131494 263
554 3300031911 Ga0307412_10039547 Ga0307412_100395472 263
555 3300031911 Ga0307412_10043688 Ga0307412_100436882 263
556 3300031911 Ga0307412_10044907 Ga0307412_100449073 263
557 3300031911 Ga0307412_10055324 Ga0307412_100553242 263
558 3300031911 Ga0307412_10103333 Ga0307412_101033332 263
559 3300031911 Ga0307412_10248558 Ga0307412_102485582 263
560 3300032002 Ga0307416_100040799 Ga0307416_1000407992 263
561 3300032002 Ga0307416_100312825 Ga0307416_1003128252 263
562 3300032002 Ga0307416_100375485 Ga0307416_1003754852 263
563 3300032004 Ga0307414_10059779 Ga0307414_100597792 263
564 3300032005 Ga0307411_10015552 Ga0307411_100155523 263
565 3300032005 Ga0307411_10619895 Ga0307411_106198952 263
566 3300033180 Ga0307510_10017421 Ga0307510_100174213 263
567 3300038705 Ga0237819_02852 Ga0237819_02852_1950_2741 263
568 3300041405 Ga0439438_002348 Ga0439438_002348_995_1786 263
569 3300041405 Ga0439438_005775 Ga0439438_005775_3555_4346 263
570 3300041405 Ga0439438_007754 Ga0439438_007754_765_1565 263
571 3300041407 Ga0439447_000985 Ga0439447_000985_5341_6132 263
572 3300041407 Ga0439447_001411 Ga0439447_001411_6069_6875 263
573 3300041407 Ga0439447_017819 Ga0439447_017819_531_1331 263
574 3300041407 Ga0439447_046546 Ga0439447_046546_181_972 263
575 3300041411 Ga0439466_0001571 Ga0439466_0001571_5527_6318 263
576 3300041411 Ga0439466_0001845 Ga0439466_0001845_1301_2101 263
577 3300041411 Ga0439466_0001878 Ga0439466_0001878_5924_6715 263
578 3300041411 Ga0439466_0028654 Ga0439466_0028654_82_888 263
579 3300041411 Ga0439466_0040503 Ga0439466_0040503_184_975 263
580 3300041413 Ga0439465_0007331 Ga0439465_0007331_1876_2667 263
581 3300041997 Ga0439431_0010252 Ga0439431_0010252_590_1390 263
582 3300042004 Ga0439445_0044923 Ga0439445_0044923_23_814 263
583 3300042006 Ga0439432_000245 Ga0439432_000245_8175_8966 263
584 3300042006 Ga0439432_007140 Ga0439432_007140_1063_1863 263
585 3300042006 Ga0439432_058764 Ga0439432_058764_147_938 263
586 3300042006 Ga0439432_063597 Ga0439432_063597_69_875 263
587 3300042006 Ga0439432_082494 Ga0439432_082494_58_849 263
588 3300042009 Ga0439451_001190 Ga0439451_001190_3274_4080 263
589 3300042009 Ga0439451_003397 Ga0439451_003397_2287_3078 263
590 3300042009 Ga0439451_010346 Ga0439451_010346_303_1103 263
591 3300042010 Ga0439452_001036 Ga0439452_001036_10974_11765 263
592 3300042010 Ga0439452_002729 Ga0439452_002729_3726_4517 263
593 3300042010 Ga0439452_004324 Ga0439452_004324_279_1076 263
594 3300042010 Ga0439452_030104 Ga0439452_030104_467_1273 263
595 3300042013 Ga0439456_001777 Ga0439456_001777_3469_4260 263
596 3300042013 Ga0439456_019846 Ga0439456_019846_221_1021 263
597 3300042013 Ga0439456_031682 Ga0439456_031682_259_1050 263
598 3300042115 Ga0450911_001409 Ga0450911_001409_993_1784 263
599 3300042115 Ga0450911_001580 Ga0450911_001580_1851_2642 263
600 3300042121 Ga0450919_002784 Ga0450919_002784_216_1007 263
601 3300042134 Ga0450898_019753 Ga0450898_019753_176_967 263
602 3300042136 Ga0450900_006911 Ga0450900_006911_454_1245 263
603 3300042137 Ga0450902_001140 Ga0450902_001140_2147_2938 263
604 3300042138 Ga0450903_003033 Ga0450903_003033_657_1448 263
605 3300042138 Ga0450903_005287 Ga0450903_005287_1108_1914 263
606 3300042145 Ga0450906_004159 Ga0450906_004159_213_1004 263
607 3300042145 Ga0450906_012772 Ga0450906_012772_662_1468 263
608 3300042146 Ga0450907_004128 Ga0450907_004128_289_1095 263
609 3300042147 Ga0450910_006877 Ga0450910_006877_646_1452 263
610 3300042184 Ga0450908_013324 Ga0450908_013324_262_1068 263
611 3300042185 Ga0450909_004414 Ga0450909_004414_628_1434 263
612 3300042993 Ga0439440_0010474 Ga0439440_0010474_100_906 263
613 3300046452 Ga0495617_020800 Ga0495617_020800_1329_2120 263
614 3300046452 Ga0495617_021109 Ga0495617_021109_1158_1949 263
615 3300046452 Ga0495617_035676 Ga0495617_035676_804_1595 263
616 3300046453 Ga0495627_001278 Ga0495627_001278_10708_11499 263
617 3300046453 Ga0495627_002406 Ga0495627_002406_4047_4838 263
618 3300046455 Ga0495603_0013688 Ga0495603_0013688_2010_2801 263
619 3300046457 Ga0495590_0004603 Ga0495590_0004603_3706_4497 263
620 3300046457 Ga0495590_0006841 Ga0495590_0006841_1776_2567 263
621 3300046457 Ga0495590_0021548 Ga0495590_0021548_1450_2241 263
622 3300046458 Ga0495591_001556 Ga0495591_001556_3752_4543 263
623 3300046458 Ga0495591_003543 Ga0495591_003543_3362_4153 263
624 3300046458 Ga0495591_029909 Ga0495591_029909_563_1354 263
625 3300046460 Ga0495638_0006808 Ga0495638_0006808_5621_6412 263
626 3300046471 Ga0495650_0003766 Ga0495650_0003766_980_1771 263
627 3300046471 Ga0495650_0005829 Ga0495650_0005829_5623_6414 263
628 3300046473 Ga0495582_0016390 Ga0495582_0016390_440_1231 263
629 3300046474 Ga0495605_0008470 Ga0495605_0008470_3505_4296 263
630 3300046474 Ga0495605_0104320 Ga0495605_0104320_191_982 263
631 3300046474 Ga0495605_0130337 Ga0495605_0130337_112_903 263
632 3300046491 Ga0495584_0002832 Ga0495584_0002832_6922_7713 263
633 3300046491 Ga0495584_0009191 Ga0495584_0009191_1289_2080 263
634 3300046491 Ga0495584_0010632 Ga0495584_0010632_1908_2699 263
635 3300046492 Ga0495585_0017386 Ga0495585_0017386_1431_2222 263
636 3300046492 Ga0495585_0019132 Ga0495585_0019132_1796_2587 263
637 3300046499 Ga0495594_0006698 Ga0495594_0006698_3328_4119 263
638 3300046499 Ga0495594_0123797 Ga0495594_0123797_659_1450 263
639 3300046500 Ga0495596_0001019 Ga0495596_0001019_6399_7190 263
640 3300046501 Ga0495607_0005334 Ga0495607_0005334_4116_4907 263
641 3300046501 Ga0495607_0016411 Ga0495607_0016411_3866_4657 263
642 3300046501 Ga0495607_0024112 Ga0495607_0024112_1544_2335 263
643 3300046501 Ga0495607_0070726 Ga0495607_0070726_803_1594 263
644 3300046501 Ga0495607_0074243 Ga0495607_0074243_99_890 263
645 3300046506 Ga0495583_0008516 Ga0495583_0008516_4755_5546 263
646 3300046506 Ga0495583_0018824 Ga0495583_0018824_1037_1828 263
647 3300046506 Ga0495583_0098419 Ga0495583_0098419_376_1167 263
648 3300046507 Ga0495606_0011362 Ga0495606_0011362_3570_4361 263
649 3300046507 Ga0495606_0011908 Ga0495606_0011908_299_1090 263
650 3300046507 Ga0495606_0035464 Ga0495606_0035464_1997_2788 263
651 3300046507 Ga0495606_0058330 Ga0495606_0058330_950_1741 263
652 3300046512 Ga0495610_0004508 Ga0495610_0004508_9387_10178 263
653 3300046512 Ga0495610_0023992 Ga0495610_0023992_178_969 263
654 3300046513 Ga0495616_0006069 Ga0495616_0006069_5035_5826 263
655 3300046513 Ga0495616_0007496 Ga0495616_0007496_4101_4892 263
656 3300046513 Ga0495616_0009306 Ga0495616_0009306_3123_3914 263
657 3300046513 Ga0495616_0029012 Ga0495616_0029012_2052_2843 263
658 3300046515 Ga0495620_0014699 Ga0495620_0014699_1928_2719 263
659 3300046515 Ga0495620_0021640 Ga0495620_0021640_304_1095 263
660 3300046517 Ga0495630_0032621 Ga0495630_0032621_2860_3651 263
661 3300046517 Ga0495630_0075306 Ga0495630_0075306_98_889 263
662 3300046518 Ga0495631_0019988 Ga0495631_0019988_413_1204 263
663 3300046519 Ga0495632_0003292 Ga0495632_0003292_1951_2742 263
664 3300046519 Ga0495632_0005336 Ga0495632_0005336_1854_2645 263
665 3300046519 Ga0495632_0010459 Ga0495632_0010459_2776_3567 263
666 3300046519 Ga0495632_0017467 Ga0495632_0017467_1923_2714 263
667 3300046520 Ga0495637_0002474 Ga0495637_0002474_3018_3809 263
668 3300046520 Ga0495637_0005314 Ga0495637_0005314_4663_5454 263
669 3300046522 Ga0495643_0010283 Ga0495643_0010283_3859_4650 263
670 3300046522 Ga0495643_0013850 Ga0495643_0013850_1917_2708 263
671 3300046522 Ga0495643_0017952 Ga0495643_0017952_1508_2299 263
672 3300046522 Ga0495643_0021971 Ga0495643_0021971_2217_3008 263
673 3300046522 Ga0495643_0150046 Ga0495643_0150046_308_1099 263
674 3300046523 Ga0495644_0003754 Ga0495644_0003754_3352_4143 263
675 3300046524 Ga0495648_0001887 Ga0495648_0001887_9661_10452 263
676 3300046524 Ga0495648_0032234 Ga0495648_0032234_1742_2533 263
677 3300046524 Ga0495648_0092173 Ga0495648_0092173_741_1532 263
678 3300046526 Ga0495666_0010775 Ga0495666_0010775_2056_2847 263
679 3300046526 Ga0495666_0024064 Ga0495666_0024064_133_924 263
680 3300046526 Ga0495666_0050239 Ga0495666_0050239_627_1418 263
681 3300046528 Ga0495642_0000619 Ga0495642_0000619_5953_6744 263
682 3300046528 Ga0495642_0018089 Ga0495642_0018089_294_1085 263
683 3300046530 Ga0495654_0001952 Ga0495654_0001952_6738_7529 263
684 3300046530 Ga0495654_0023755 Ga0495654_0023755_2093_2884 263
685 3300046530 Ga0495654_0097301 Ga0495654_0097301_132_923 263
686 3300046530 Ga0495654_0098547 Ga0495654_0098547_156_947 263
687 3300046535 Ga0495586_0101788 Ga0495586_0101788_656_1447 263
688 3300046536 Ga0495587_0024092 Ga0495587_0024092_1888_2679 263
689 3300046536 Ga0495587_0092887 Ga0495587_0092887_445_1236 263
690 3300046538 Ga0495609_0004568 Ga0495609_0004568_2381_3172 263
691 3300046538 Ga0495609_0005438 Ga0495609_0005438_2260_3051 263
692 3300046538 Ga0495609_0006429 Ga0495609_0006429_856_1647 263
693 3300046538 Ga0495609_0009498 Ga0495609_0009498_650_1441 263
694 3300046542 Ga0495597_0006542 Ga0495597_0006542_541_1332 263
695 3300046542 Ga0495597_0020226 Ga0495597_0020226_289_1080 263
696 3300046542 Ga0495597_0063893 Ga0495597_0063893_643_1434 263
697 3300046557 Ga0495622_0028987 Ga0495622_0028987_462_1253 263
698 3300046557 Ga0495622_0053763 Ga0495622_0053763_1001_1792 263
699 3300046558 Ga0495633_0010318 Ga0495633_0010318_1872_2663 263
700 3300046616 Ga0495668_0002481 Ga0495668_0002481_9454_10245 263
701 3300046616 Ga0495668_0016122 Ga0495668_0016122_3498_4289 263
702 3300046642 Ga0495634_0020607 Ga0495634_0020607_1854_2645 263
703 3300046660 Ga0495625_0022411 Ga0495625_0022411_2568_3359 263
704 3300046663 Ga0495635_0006025 Ga0495635_0006025_1704_2495 263
705 3300046663 Ga0495635_0018177 Ga0495635_0018177_1071_1862 263
706 3300046665 Ga0495661_0002061 Ga0495661_0002061_4268_5059 263
707 3300046665 Ga0495661_0004967 Ga0495661_0004967_4734_5525 263
708 3300046665 Ga0495661_0033064 Ga0495661_0033064_1048_1839 263
709 3300046674 Ga0495588_0020609 Ga0495588_0020609_1228_2019 263
710 3300046679 Ga0495623_0016125 Ga0495623_0016125_3655_4446 263
711 3300046679 Ga0495623_0018191 Ga0495623_0018191_1260_2051 263
712 3300046680 Ga0495646_0024731 Ga0495646_0024731_173_964 263
713 3300046680 Ga0495646_0025218 Ga0495646_0025218_1746_2537 263
714 3300046680 Ga0495646_0028629 Ga0495646_0028629_1205_1996 263
715 3300046684 Ga0495669_0001111 Ga0495669_0001111_1475_2266 263
716 3300046689 Ga0495613_0049064 Ga0495613_0049064_487_1278 263
717 3300046689 Ga0495613_0114868 Ga0495613_0114868_334_1125 263
718 3300046691 Ga0495670_0004140 Ga0495670_0004140_2175_2966 263
719 3300046691 Ga0495670_0136191 Ga0495670_0136191_408_1199 263
720 3300046692 Ga0495671_0019851 Ga0495671_0019851_2095_2886 263
721 3300046692 Ga0495671_0041552 Ga0495671_0041552_1113_1904 263
722 3300046694 Ga0495649_0002480 Ga0495649_0002480_10233_11024 263
723 3300046694 Ga0495649_0006308 Ga0495649_0006308_915_1706 263
724 3300046694 Ga0495649_0026961 Ga0495649_0026961_470_1261 263
725 3300046694 Ga0495649_0055807 Ga0495649_0055807_230_1021 263
726 3300046794 Ga0495589_0001524 Ga0495589_0001524_3290_4081 263
727 3300046794 Ga0495589_0004506 Ga0495589_0004506_6515_7306 263
728 3300046794 Ga0495589_0007367 Ga0495589_0007367_3497_4288 263
729 3300046794 Ga0495589_0026347 Ga0495589_0026347_2022_2813 263
730 3300046794 Ga0495589_0028987 Ga0495589_0028987_1804_2595 263
731 3300046810 Ga0495660_0008985 Ga0495660_0008985_3374_4165 263
732 3300046810 Ga0495660_0012251 Ga0495660_0012251_2319_3110 263
733 3300046810 Ga0495660_0012502 Ga0495660_0012502_2014_2805 263
734 3300046810 Ga0495660_0012787 Ga0495660_0012787_3458_4249 263
735 3300046810 Ga0495660_0022738 Ga0495660_0022738_1396_2187 263
736 3300046810 Ga0495660_0030871 Ga0495660_0030871_741_1532 263
737 3300047317 Ga0495604_0028278 Ga0495604_0028278_1763_2554 263
738 3300047317 Ga0495604_0054701 Ga0495604_0054701_479_1270 263
739 3300047319 Ga0495674_0027626 Ga0495674_0027626_1313_2104 263
740 3300047320 Ga0495672_0022571 Ga0495672_0022571_1268_2059 263
741 3300047321 Ga0495676_0019443 Ga0495676_0019443_3500_4291 263
742 3300047322 Ga0495680_0009030 Ga0495680_0009030_8143_8934 263
743 3300047322 Ga0495680_0072207 Ga0495680_0072207_98_889 263
744 3300047323 Ga0495683_0016832 Ga0495683_0016832_1566_2357 263
745 3300047323 Ga0495683_0193713 Ga0495683_0193713_35_826 263
746 3300047443 Ga0495687_004474 Ga0495687_004474_6838_7629 263
747 3300047444 Ga0495675_0303601 Ga0495675_0303601_59_850 263
748 3300047445 Ga0495677_0003504 Ga0495677_0003504_4742_5533 263
749 3300047446 Ga0495679_007997 Ga0495679_007997_132_923 263
750 3300047446 Ga0495679_009679 Ga0495679_009679_1546_2337 263
751 3300047446 Ga0495679_016820 Ga0495679_016820_506_1297 263
752 3300047446 Ga0495679_016840 Ga0495679_016840_187_978 263
753 3300047446 Ga0495679_030636 Ga0495679_030636_160_951 263
754 3300047469 Ga0495673_0004768 Ga0495673_0004768_1860_2651 263
755 3300047469 Ga0495673_0006091 Ga0495673_0006091_869_1660 263
756 3300047469 Ga0495673_0010918 Ga0495673_0010918_1926_2717 263
757 3300047469 Ga0495673_0026170 Ga0495673_0026170_519_1310 263
758 3300047469 Ga0495673_0029441 Ga0495673_0029441_1244_2035 263
759 3300047469 Ga0495673_0036349 Ga0495673_0036349_1410_2201 263
760 3300047470 Ga0495681_0004955 Ga0495681_0004955_3916_4707 263
761 3300047470 Ga0495681_0007131 Ga0495681_0007131_3402_4193 263
762 3300047470 Ga0495681_0018869 Ga0495681_0018869_412_1203 263
763 3300047470 Ga0495681_0038148 Ga0495681_0038148_1505_2296 263
764 3300047470 Ga0495681_0105343 Ga0495681_0105343_292_1083 263
765 3300047470 Ga0495681_0155149 Ga0495681_0155149_56_847 263
766 3300047471 Ga0495684_0010506 Ga0495684_0010506_1695_2486 263
767 3300047472 Ga0495686_0015573 Ga0495686_0015573_3155_3946 263
768 3300047472 Ga0495686_0229606 Ga0495686_0229606_171_962 263
769 3300047673 Ga0495593_0011041 Ga0495593_0011041_1717_2508 263
770 3300048091 Ga0495626_0002001 Ga0495626_0002001_2629_3420 263
771 3300048091 Ga0495626_0003528 Ga0495626_0003528_6399_7190 263
772 3300048091 Ga0495626_0007781 Ga0495626_0007781_2991_3782 263
773 3300048091 Ga0495626_0011028 Ga0495626_0011028_2138_2929 263
774 3300048091 Ga0495626_0022037 Ga0495626_0022037_1875_2666 263
775 3300048091 Ga0495626_0048137 Ga0495626_0048137_1005_1796 263
776 3300048091 Ga0495626_0133578 Ga0495626_0133578_95_886 263
777 3300048905 Ga0496102_0004463 Ga0496102_0004463_8998_9789 263
778 3300048906 Ga0496103_0013756 Ga0496103_0013756_3735_4526 263
779 3300048915 Ga0496112_0257867 Ga0496112_0257867_322_1122 263
780 3300048919 Ga0496116_0006411 Ga0496116_0006411_3737_4528 263
781 3300048919 Ga0496116_0014738 Ga0496116_0014738_4084_4875 263
782 3300048919 Ga0496116_0022706 Ga0496116_0022706_581_1372 263
783 3300048919 Ga0496116_0046236 Ga0496116_0046236_27_818 263
784 3300048920 Ga0496117_0002789 Ga0496117_0002789_16863_17654 263
785 3300048920 Ga0496117_0011214 Ga0496117_0011214_1891_2682 263
786 3300048920 Ga0496117_0017405 Ga0496117_0017405_3549_4340 263
787 3300048920 Ga0496117_0025548 Ga0496117_0025548_2224_3015 263
788 3300048920 Ga0496117_0028665 Ga0496117_0028665_41_850 263
789 3300048921 Ga0496118_0018336 Ga0496118_0018336_1810_2601 263
790 3300048921 Ga0496118_0025463 Ga0496118_0025463_425_1234 263
791 3300048921 Ga0496118_0029625 Ga0496118_0029625_1676_2467 263
792 3300048921 Ga0496118_0051207 Ga0496118_0051207_1356_2147 263
793 3300048921 Ga0496118_0123217 Ga0496118_0123217_520_1311 263
794 3300048922 Ga0496119_0030527 Ga0496119_0030527_2785_3594 263
795 3300048922 Ga0496119_0046829 Ga0496119_0046829_82_873 263
796 3300048923 Ga0496120_0020768 Ga0496120_0020768_86_895 263
797 3300048923 Ga0496120_0031599 Ga0496120_0031599_2082_2873 263
798 3300048923 Ga0496120_0033638 Ga0496120_0033638_1842_2633 263
799 3300048924 Ga0496121_0018914 Ga0496121_0018914_1324_2115 263
800 3300048924 Ga0496121_0023351 Ga0496121_0023351_1367_2158 263
801 3300048924 Ga0496121_0048821 Ga0496121_0048821_2362_3153 263
802 3300048925 Ga0496122_0037968 Ga0496122_0037968_1189_1980 263
803 3300048925 Ga0496122_0043373 Ga0496122_0043373_245_1036 263
804 3300048925 Ga0496122_0057593 Ga0496122_0057593_1735_2526 263
805 3300048925 Ga0496122_0201513 Ga0496122_0201513_267_1058 263
806 3300048926 Ga0496123_0009566 Ga0496123_0009566_3040_3831 263
807 3300048926 Ga0496123_0044650 Ga0496123_0044650_550_1341 263
808 3300048926 Ga0496123_0097294 Ga0496123_0097294_909_1700 263
809 3300048927 Ga0496124_0007979 Ga0496124_0007979_9303_10094 263
810 3300048927 Ga0496124_0008166 Ga0496124_0008166_3543_4334 263
811 3300048927 Ga0496124_0013760 Ga0496124_0013760_2734_3525 263
812 3300048927 Ga0496124_0081591 Ga0496124_0081591_515_1306 263
813 3300048927 Ga0496124_0160948 Ga0496124_0160948_676_1467 263
814 3300048927 Ga0496124_0260254 Ga0496124_0260254_181_972 263
815 3300048928 Ga0496125_0001578 Ga0496125_0001578_27972_28763 263
816 3300048928 Ga0496125_0008486 Ga0496125_0008486_5009_5800 263
817 3300048928 Ga0496125_0035635 Ga0496125_0035635_3446_4255 263
818 3300048928 Ga0496125_0037745 Ga0496125_0037745_1775_2566 263
819 3300048928 Ga0496125_0109197 Ga0496125_0109197_93_884 263
820 3300048928 Ga0496125_0206908 Ga0496125_0206908_187_978 263
821 3300048929 Ga0496126_0004789 Ga0496126_0004789_4536_5327 263
822 3300048929 Ga0496126_0011313 Ga0496126_0011313_1845_2636 263
823 3300048929 Ga0496126_0087985 Ga0496126_0087985_1852_2643 263
824 3300049459 Ga0495678_002391 Ga0495678_002391_10129_10920 263
825 3300049459 Ga0495678_054293 Ga0495678_054293_319_1110 263
826 3300049459 Ga0495678_091212 Ga0495678_091212_153_944 263
827 3300049460 Ga0495682_0011864 Ga0495682_0011864_809_1600 263
828 3300049460 Ga0495682_0053676 Ga0495682_0053676_250_1041 263
829 3300049460 Ga0495682_0080369 Ga0495682_0080369_270_1061 263
830 3300049758 Ga0501241_002124 Ga0501241_002124_1294_2085 263
831 3300053161 Ga0500634_0002065 Ga0500634_0002065_3416_4207 263
832 iso_pu_bacteria 2511231004 2511256705 264
833 iso_pu_bacteria 2511231016 2511324099 264
834 iso_pu_bacteria 2511231019 2511344049 264
835 iso_pu_bacteria 2511231022 2511365006 264
836 iso_pu_bacteria 2623620446 2624493899 264
837 iso_pu_bacteria 2643221633 2644184879 264
838 iso_pu_bacteria 2808606445 2809216070 264
839 iso_pu_bacteria 2919697872 2919700183 264
840 iso_pu_bacteria 3007511990 3007512682 264
841 iso_pu_bacteria 8019775933 8019776850 264
842 iso_pu_bacteria 8056155041 8056159465 264
843 3300041405 Ga0439438_003155 Ga0439438_003155_268_1077 266
844 3300041405 Ga0439438_008580 Ga0439438_008580_2455_3264 266
845 3300042010 Ga0439452_011394 Ga0439452_011394_117_926 266
846 2124908027 MRS2a_Contig_26459 MRS2a_00344980 268
847 3300005288 Ga0065714_10003926 Ga0065714_100039265 268
848 3300005288 Ga0065714_10007790 Ga0065714_100077903 268
849 3300005288 Ga0065714_10026140 Ga0065714_100261402 268
850 3300006058 Ga0075432_10006266 Ga0075432_100062663 268
851 3300006914 Ga0075436_100076706 Ga0075436_1000767062 268
852 3300009036 Ga0105244_10021200 Ga0105244_100212003 268
853 3300009148 Ga0105243_10239895 Ga0105243_102398952 268
854 3300013102 Ga0157371_10501813 Ga0157371_105018131 268
855 3300015261 Ga0182006_1000736 Ga0182006_10007369 268
856 3300015261 Ga0182006_1026599 Ga0182006_10265992 268
857 3300015262 Ga0182007_10000110 Ga0182007_100001107 268
858 3300015265 Ga0182005_1000627 Ga0182005_10006279 268
859 3300025728 Ga0207655_1000893 Ga0207655_100089324 268
860 3300025728 Ga0207655_1007688 Ga0207655_10076882 268
861 3300027907 Ga0207428_10038182 Ga0207428_100381823 268
862 3300027907 Ga0207428_10097691 Ga0207428_100976911 268
863 3300031731 Ga0307405_10034002 Ga0307405_100340021 268
864 3300041407 Ga0439447_006363 Ga0439447_006363_2095_2901 268
865 3300041411 Ga0439466_0027775 Ga0439466_0027775_816_1622 268
866 3300042009 Ga0439451_022469 Ga0439451_022469_387_1193 268
867 3300042010 Ga0439452_020900 Ga0439452_020900_609_1415 268
868 3300042016 Ga0439463_035129 Ga0439463_035129_284_1105 268
869 3300042139 Ga0450904_002190 Ga0450904_002190_1027_1833 268
870 3300042146 Ga0450907_000173 Ga0450907_000173_13860_14666 268
871 3300042146 Ga0450907_013304 Ga0450907_013304_173_994 268
872 3300042435 Ga0439434_0001671 Ga0439434_0001671_1902_2708 268
873 3300042461 Ga0439460_0032672 Ga0439460_0032672_79_900 268
874 3300042993 Ga0439440_0001312 Ga0439440_0001312_1990_2796 268
875 3300046452 Ga0495617_001213 Ga0495617_001213_1959_2765 268
876 3300046452 Ga0495617_017307 Ga0495617_017307_185_991 268
877 3300046452 Ga0495617_056969 Ga0495617_056969_472_1278 268
878 3300046455 Ga0495603_0005877 Ga0495603_0005877_1334_2140 268
879 3300046457 Ga0495590_0001626 Ga0495590_0001626_1974_2780 268
880 3300046458 Ga0495591_007226 Ga0495591_007226_1855_2661 268
881 3300046460 Ga0495638_0046056 Ga0495638_0046056_248_1054 268
882 3300046471 Ga0495650_0026336 Ga0495650_0026336_94_900 268
883 3300046471 Ga0495650_0028975 Ga0495650_0028975_416_1222 268
884 3300046474 Ga0495605_0037769 Ga0495605_0037769_207_1013 268
885 3300046475 Ga0495639_0000994 Ga0495639_0000994_10132_10938 268
886 3300046491 Ga0495584_0001291 Ga0495584_0001291_3842_4648 268
887 3300046492 Ga0495585_0011257 Ga0495585_0011257_3019_3825 268
888 3300046499 Ga0495594_0058585 Ga0495594_0058585_1289_2095 268
889 3300046501 Ga0495607_0003843 Ga0495607_0003843_332_1138 268
890 3300046501 Ga0495607_0039658 Ga0495607_0039658_191_997 268
891 3300046501 Ga0495607_0069373 Ga0495607_0069373_884_1690 268
892 3300046506 Ga0495583_0035446 Ga0495583_0035446_1158_1964 268
893 3300046507 Ga0495606_0016942 Ga0495606_0016942_3180_3986 268
894 3300046512 Ga0495610_0095346 Ga0495610_0095346_22_828 268
895 3300046513 Ga0495616_0003008 Ga0495616_0003008_9261_10067 268
896 3300046515 Ga0495620_0008988 Ga0495620_0008988_2453_3259 268
897 3300046519 Ga0495632_0009359 Ga0495632_0009359_1495_2301 268
898 3300046519 Ga0495632_0027429 Ga0495632_0027429_310_1131 268
899 3300046520 Ga0495637_0021535 Ga0495637_0021535_217_1023 268
900 3300046520 Ga0495637_0093929 Ga0495637_0093929_191_997 268
901 3300046522 Ga0495643_0027922 Ga0495643_0027922_524_1330 268
902 3300046523 Ga0495644_0002235 Ga0495644_0002235_4345_5151 268
903 3300046524 Ga0495648_0036612 Ga0495648_0036612_1264_2070 268
904 3300046524 Ga0495648_0048425 Ga0495648_0048425_96_902 268
905 3300046524 Ga0495648_0121460 Ga0495648_0121460_466_1272 268
906 3300046530 Ga0495654_0027139 Ga0495654_0027139_1593_2399 268
907 3300046530 Ga0495654_0093213 Ga0495654_0093213_163_969 268
908 3300046530 Ga0495654_0179222 Ga0495654_0179222_77_883 268
909 3300046538 Ga0495609_0024012 Ga0495609_0024012_1343_2149 268
910 3300046542 Ga0495597_0017098 Ga0495597_0017098_2123_2929 268
911 3300046542 Ga0495597_0018718 Ga0495597_0018718_1297_2103 268
912 3300046542 Ga0495597_0021958 Ga0495597_0021958_238_1059 268
913 3300046542 Ga0495597_0083324 Ga0495597_0083324_144_950 268
914 3300046557 Ga0495622_0003892 Ga0495622_0003892_50_856 268
915 3300046557 Ga0495622_0052332 Ga0495622_0052332_244_1050 268
916 3300046660 Ga0495625_0048103 Ga0495625_0048103_647_1453 268
917 3300046660 Ga0495625_0084289 Ga0495625_0084289_1377_2183 268
918 3300046664 Ga0495659_0001059 Ga0495659_0001059_6972_7778 268
919 3300046665 Ga0495661_0071314 Ga0495661_0071314_751_1557 268
920 3300046674 Ga0495588_0137198 Ga0495588_0137198_380_1186 268
921 3300046691 Ga0495670_0006986 Ga0495670_0006986_2174_2980 268
922 3300046691 Ga0495670_0042577 Ga0495670_0042577_1296_2102 268
923 3300046691 Ga0495670_0122357 Ga0495670_0122357_241_1062 268
924 3300046691 Ga0495670_0209178 Ga0495670_0209178_133_939 268
925 3300046692 Ga0495671_0001535 Ga0495671_0001535_12679_13485 268
926 3300046692 Ga0495671_0007630 Ga0495671_0007630_93_899 268
927 3300046692 Ga0495671_0103258 Ga0495671_0103258_494_1300 268
928 3300046810 Ga0495660_0015928 Ga0495660_0015928_3044_3850 268
929 3300046810 Ga0495660_0085657 Ga0495660_0085657_212_1018 268
930 3300046810 Ga0495660_0136063 Ga0495660_0136063_112_918 268
931 3300047318 Ga0495636_0012249 Ga0495636_0012249_1948_2754 268
932 3300047320 Ga0495672_0003642 Ga0495672_0003642_1670_2476 268
933 3300047320 Ga0495672_0004056 Ga0495672_0004056_818_1624 268
934 3300047320 Ga0495672_0015575 Ga0495672_0015575_1741_2547 268
935 3300047320 Ga0495672_0039705 Ga0495672_0039705_1981_2787 268
936 3300047323 Ga0495683_0022825 Ga0495683_0022825_239_1045 268
937 3300047323 Ga0495683_0039481 Ga0495683_0039481_467_1273 268
938 3300047443 Ga0495687_025436 Ga0495687_025436_1879_2685 268
939 3300047469 Ga0495673_0003806 Ga0495673_0003806_1953_2759 268
940 3300047469 Ga0495673_0022411 Ga0495673_0022411_980_1786 268
941 3300047469 Ga0495673_0025384 Ga0495673_0025384_1483_2289 268
942 3300047470 Ga0495681_0001437 Ga0495681_0001437_11827_12633 268
943 3300047470 Ga0495681_0007318 Ga0495681_0007318_3544_4350 268
944 3300047472 Ga0495686_0179017 Ga0495686_0179017_160_981 268
945 3300048091 Ga0495626_0001149 Ga0495626_0001149_11129_11935 268
946 3300048091 Ga0495626_0001346 Ga0495626_0001346_12613_13419 268
947 3300048919 Ga0496116_0032094 Ga0496116_0032094_1946_2752 268
948 3300048924 Ga0496121_0071713 Ga0496121_0071713_1403_2209 268
949 3300048925 Ga0496122_0063686 Ga0496122_0063686_1843_2649 268
950 3300048928 Ga0496125_0031155 Ga0496125_0031155_2043_2849 268
951 3300049460 Ga0495682_0130893 Ga0495682_0130893_27_833 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

47

274

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

267

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

49

280

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.978 2 266
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9706 2 266
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9653 2 268
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9439 2 268
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9217 9 266
ID Description Score Start End Superfamily
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9704 2 266 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9675 2 268 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9629 2 266 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9457 2 268 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9214 9 266 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0T6VL91-F1-model_v4 deleted 0.9962 1 266
AF-A0A2Z4GHL9-F1-model_v4 3-oxoadipate enol-lactonase 0.9845 11 268 GO:0016020
GO:0042952
GO:0047570
AF-A0A2N5C326-F1-model_v4 AraC family transcriptional regulator 0.9817 3 267 GO:0042952
GO:0047570
GO:0051920
AF-A0A0T6VL91-F1-model_v4 deleted 0.9812 1 266
AF-A0A2V2BBY9-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.981 11 265 GO:0042952
GO:0047570
GO:0047575
GO:0051920

Feature Viewer

pLDDT pTM Quality
96.1 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map