F486595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 951 | 411 | 779 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0005553|Ga0495605_0005553_6438_7301 |
| Length | 287 |
| Sequence | MYQVDRFRSRRQRLQVITLAKKGSSMPTLALPDGDLHYQLDGPLDAPVLLLSNSLGTNLAMWDGQIPVFAEHFRVLRYDTRGHGRSLVSDGPYSIEQHARDVLALMDALKIPRANFCGLSMGGLIGQWLMINAAQRLDRVVLCNTAAKIASPAVWNPRIEMVLREGKEGMLSLREATTSRWFSAQFAATQPAQVARLLDMLANTSPQGYAANCAAVRDADFAAQLGSVQLPVLVVCGNQDPVTTESDGELLKQAIAGAQRMTLSAAHLSNVEASEAFSAQVSAFLRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 5 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 6 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 9 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 10 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 11 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 12 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 13 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 14 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 15 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 16 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 17 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 18 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 19 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 20 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 21 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 22 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 23 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 24 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 25 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 26 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 27 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 28 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 29 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 30 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 31 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 32 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 33 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 34 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 35 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 36 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 37 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 38 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 39 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 40 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 41 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 42 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 43 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 44 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 45 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 46 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 47 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 48 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 49 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 50 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 51 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 52 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 53 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 54 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 55 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 56 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 57 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 58 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 59 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 60 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 61 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 62 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 63 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 64 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 65 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 66 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 67 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 68 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 69 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 70 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 71 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 72 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 73 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 74 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 75 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 76 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 77 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 78 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 79 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 80 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 81 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 82 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 83 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 84 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 85 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 86 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 87 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 88 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 89 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 90 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 91 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 92 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 93 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 94 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 95 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 96 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 97 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 98 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 99 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 100 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 101 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 102 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 103 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 104 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 105 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 106 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 107 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 108 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 109 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 110 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 111 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 112 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 113 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 114 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 115 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 116 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 117 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 118 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 119 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 120 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 121 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 122 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 123 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 124 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 125 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 126 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 127 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 128 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 129 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 130 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 131 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 132 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 133 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 134 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 135 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 136 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 137 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 138 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 139 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 140 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 141 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 142 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 143 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 144 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 145 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 146 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 147 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 148 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 149 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 150 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 151 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 152 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 153 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 154 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 155 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 156 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 157 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 158 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 159 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 160 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 161 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 162 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 164 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 165 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 166 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 167 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 168 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 169 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 174 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 175 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 178 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 179 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 180 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 181 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 182 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 183 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 193 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 201 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 202 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 203 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 204 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 239 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 240 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 251 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 252 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 253 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 257 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 258 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 259 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 260 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 261 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 262 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 263 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 264 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 265 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 266 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 267 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 268 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 269 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 270 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 271 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 272 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 273 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 276 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 277 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 389 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 395 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 396 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 397 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 398 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 399 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 400 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 401 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 402 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 403 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 404 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 405 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 406 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 407 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 408 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 409 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 410 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 411 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.91 |
| Metatranscriptomes | 0 |
| Isolates | 18.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 4 |
| Nodule | 1.58 |
| Rhizoplane | 7.57 |
| Rhizosphere | 74.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_26459 | 2124908027 | Bacteria | 1663 |
| 2 | SwRhRL2b_contig_2696906 | 2162886007 | Bacteria | 1618 |
| 3 | JGI25163J39215_1000348 | 3300002771 | Bacteria | 15338 |
| 4 | JGI25164J39214_1000492 | 3300002772 | Bacteria | 19394 |
| 5 | JGI25165J46597_1000934 | 3300003214 | Bacteria | 20070 |
| 6 | rootL2_10085104 | 3300003322 | Bacteria | 3432 |
| 7 | Ga0055526_1010871 | 3300003771 | Bacteria | 4180 |
| 8 | Ga0055536_1000043 | 3300003781 | Bacteria | 124663 |
| 9 | Ga0055536_1001093 | 3300003781 | Bacteria | 17061 |
| 10 | Ga0055530_10000031 | 3300003791 | Bacteria | 122117 |
| 11 | Ga0055530_10000527 | 3300003791 | Bacteria | 33197 |
| 12 | Ga0055540_1000161 | 3300003792 | Bacteria | 66740 |
| 13 | Ga0055540_1000230 | 3300003792 | Bacteria | 51911 |
| 14 | Ga0055540_1001131 | 3300003792 | Bacteria | 16636 |
| 15 | Ga0055531_10001267 | 3300003794 | Bacteria | 19127 |
| 16 | Ga0065714_10003926 | 3300005288 | Bacteria | 8412 |
| 17 | Ga0065714_10007790 | 3300005288 | Bacteria | 2759 |
| 18 | Ga0065714_10026140 | 3300005288 | Bacteria | 1528 |
| 19 | Ga0065714_10065072 | 3300005288 | Bacteria | 13234 |
| 20 | Ga0065714_10069444 | 3300005288 | Bacteria | 4226 |
| 21 | Ga0065714_10070935 | 3300005288 | Bacteria | 3725 |
| 22 | Ga0065714_10073836 | 3300005288 | Bacteria | 3124 |
| 23 | Ga0065704_10001387 | 3300005289 | Bacteria | 12943 |
| 24 | Ga0065704_10095259 | 3300005289 | Bacteria | 2497 |
| 25 | Ga0065704_10142008 | 3300005289 | Bacteria | 1508 |
| 26 | Ga0070683_100000933 | 3300005329 | Bacteria | 21733 |
| 27 | Ga0070670_100001105 | 3300005331 | Bacteria | 21435 |
| 28 | Ga0070670_100009361 | 3300005331 | Bacteria | 8361 |
| 29 | Ga0070661_100000238 | 3300005344 | Bacteria | 45456 |
| 30 | Ga0070669_100000150 | 3300005353 | Bacteria | 62681 |
| 31 | Ga0070709_10005206 | 3300005434 | Bacteria | 7035 |
| 32 | Ga0068853_100005654 | 3300005539 | Bacteria | 9830 |
| 33 | Ga0070665_100251663 | 3300005548 | Bacteria | 1767 |
| 34 | Ga0070664_100000233 | 3300005564 | Bacteria | 39884 |
| 35 | Ga0068854_100008578 | 3300005578 | Bacteria | 6578 |
| 36 | Ga0068851_10000019 | 3300005834 | Bacteria | 135877 |
| 37 | Ga0075364_10294879 | 3300006051 | Bacteria | 1104 |
| 38 | Ga0075432_10006266 | 3300006058 | Bacteria | 4043 |
| 39 | Ga0075436_100076706 | 3300006914 | Bacteria | 2315 |
| 40 | Ga0079104_1028293 | 3300006946 | Bacteria | 1425 |
| 41 | Ga0105251_10000021 | 3300009011 | Bacteria | 137955 |
| 42 | Ga0105251_10000477 | 3300009011 | Bacteria | 37930 |
| 43 | Ga0105251_10003438 | 3300009011 | Bacteria | 11486 |
| 44 | Ga0105251_10003475 | 3300009011 | Bacteria | 11417 |
| 45 | Ga0105251_10009892 | 3300009011 | Bacteria | 5583 |
| 46 | Ga0105251_10017479 | 3300009011 | Bacteria | 3842 |
| 47 | Ga0105244_10004276 | 3300009036 | Bacteria | 9893 |
| 48 | Ga0105244_10004598 | 3300009036 | Bacteria | 9449 |
| 49 | Ga0105244_10010896 | 3300009036 | Bacteria | 5483 |
| 50 | Ga0105244_10021200 | 3300009036 | Bacteria | 3598 |
| 51 | Ga0105244_10026476 | 3300009036 | Bacteria | 3138 |
| 52 | Ga0105244_10041414 | 3300009036 | Bacteria | 2387 |
| 53 | Ga0105244_10072395 | 3300009036 | Bacteria | 1717 |
| 54 | Ga0105244_10093887 | 3300009036 | Bacteria | 1474 |
| 55 | Ga0105250_10000072 | 3300009092 | Bacteria | 94689 |
| 56 | Ga0105250_10000118 | 3300009092 | Bacteria | 71419 |
| 57 | Ga0105250_10002765 | 3300009092 | Bacteria | 8620 |
| 58 | Ga0105250_10003322 | 3300009092 | Bacteria | 7656 |
| 59 | Ga0105250_10065396 | 3300009092 | Bacteria | 1466 |
| 60 | Ga0105247_10051921 | 3300009101 | Bacteria | 2526 |
| 61 | Ga0105243_10001564 | 3300009148 | Bacteria | 20004 |
| 62 | Ga0105243_10239895 | 3300009148 | Bacteria | 1612 |
| 63 | Ga0105242_10000719 | 3300009176 | Bacteria | 25890 |
| 64 | Ga0105248_10438648 | 3300009177 | Bacteria | 1471 |
| 65 | Ga0105237_10005805 | 3300009545 | Bacteria | 13845 |
| 66 | Ga0105246_10001731 | 3300011119 | Bacteria | 13039 |
| 67 | Ga0105246_10002504 | 3300011119 | Bacteria | 11115 |
| 68 | Ga0105246_10027971 | 3300011119 | Bacteria | 3701 |
| 69 | Ga0157345_1000135 | 3300012498 | Bacteria | 13608 |
| 70 | Ga0157373_10001969 | 3300013100 | Bacteria | 15573 |
| 71 | Ga0157373_10007934 | 3300013100 | Bacteria | 7896 |
| 72 | Ga0157373_10008873 | 3300013100 | Bacteria | 7443 |
| 73 | Ga0157373_10031446 | 3300013100 | Bacteria | 3821 |
| 74 | Ga0157373_10031805 | 3300013100 | Bacteria | 3799 |
| 75 | Ga0157373_10070927 | 3300013100 | Bacteria | 2462 |
| 76 | Ga0157373_10178320 | 3300013100 | Bacteria | 1496 |
| 77 | Ga0157373_10312720 | 3300013100 | Bacteria | 1116 |
| 78 | Ga0157371_10000281 | 3300013102 | Bacteria | 68624 |
| 79 | Ga0157371_10019377 | 3300013102 | Bacteria | 5020 |
| 80 | Ga0157371_10501813 | 3300013102 | Bacteria | 896 |
| 81 | Ga0157370_10036138 | 3300013104 | Bacteria | 4796 |
| 82 | Ga0157370_10137734 | 3300013104 | Bacteria | 2274 |
| 83 | Ga0157369_10003643 | 3300013105 | Bacteria | 18275 |
| 84 | Ga0157369_10010141 | 3300013105 | Bacteria | 10753 |
| 85 | Ga0157369_10043869 | 3300013105 | Bacteria | 4871 |
| 86 | Ga0163162_10000835 | 3300013306 | Bacteria | 28677 |
| 87 | Ga0163162_10476875 | 3300013306 | Bacteria | 1379 |
| 88 | Ga0157372_10004247 | 3300013307 | Bacteria | 15318 |
| 89 | Ga0157375_10005491 | 3300013308 | Bacteria | 11026 |
| 90 | Ga0157375_10039221 | 3300013308 | Bacteria | 4557 |
| 91 | Ga0157375_10337200 | 3300013308 | Bacteria | 1673 |
| 92 | Ga0182008_10007260 | 3300014497 | Bacteria | 6125 |
| 93 | Ga0182008_10013392 | 3300014497 | Bacteria | 4313 |
| 94 | Ga0182006_1000736 | 3300015261 | Bacteria | 22519 |
| 95 | Ga0182006_1000816 | 3300015261 | Bacteria | 20884 |
| 96 | Ga0182006_1008689 | 3300015261 | Bacteria | 4598 |
| 97 | Ga0182006_1026599 | 3300015261 | Bacteria | 2367 |
| 98 | Ga0182007_10000110 | 3300015262 | Bacteria | 56498 |
| 99 | Ga0182007_10003838 | 3300015262 | Bacteria | 6987 |
| 100 | Ga0182005_1000627 | 3300015265 | Bacteria | 16999 |
| 101 | Ga0182005_1005224 | 3300015265 | Bacteria | 4077 |
| 102 | Ga0182005_1009143 | 3300015265 | Bacteria | 2895 |
| 103 | Ga0182005_1028956 | 3300015265 | Bacteria | 1510 |
| 104 | Ga0163161_10002537 | 3300017792 | Bacteria | 13028 |
| 105 | Ga0163161_10037516 | 3300017792 | Bacteria | 3474 |
| 106 | Ga0163161_10052017 | 3300017792 | Bacteria | 2969 |
| 107 | Ga0163161_10064796 | 3300017792 | Bacteria | 2666 |
| 108 | Ga0163161_10113280 | 3300017792 | Bacteria | 2030 |
| 109 | Ga0163161_10138446 | 3300017792 | Bacteria | 1842 |
| 110 | Ga0163161_10422888 | 3300017792 | Bacteria | 1072 |
| 111 | Ga0209760_100047 | 3300025207 | Bacteria | 107520 |
| 112 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 113 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 114 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 115 | Ga0209675_1002348 | 3300025291 | Bacteria | 9768 |
| 116 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 117 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 118 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 119 | Ga0209676_1002060 | 3300025292 | Bacteria | 15666 |
| 120 | Ga0209676_1011697 | 3300025292 | Bacteria | 3513 |
| 121 | Ga0209564_1001361 | 3300025295 | Bacteria | 25686 |
| 122 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 123 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 124 | Ga0209050_1000187 | 3300025298 | Bacteria | 139437 |
| 125 | Ga0209050_1001134 | 3300025298 | Bacteria | 32080 |
| 126 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 127 | Ga0209051_1000094 | 3300025303 | Bacteria | 168538 |
| 128 | Ga0209051_1000131 | 3300025303 | Bacteria | 139437 |
| 129 | Ga0209051_1007856 | 3300025303 | Bacteria | 5755 |
| 130 | Ga0209257_1000173 | 3300025304 | Bacteria | 166678 |
| 131 | Ga0207656_10000026 | 3300025321 | Bacteria | 86789 |
| 132 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 133 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 134 | Ga0207696_1000111 | 3300025711 | Bacteria | 155243 |
| 135 | Ga0207696_1018769 | 3300025711 | Bacteria | 2265 |
| 136 | Ga0207655_1000063 | 3300025728 | Bacteria | 257028 |
| 137 | Ga0207655_1000435 | 3300025728 | Bacteria | 55875 |
| 138 | Ga0207655_1000893 | 3300025728 | Bacteria | 31371 |
| 139 | Ga0207655_1002166 | 3300025728 | Bacteria | 16365 |
| 140 | Ga0207655_1002478 | 3300025728 | Bacteria | 14954 |
| 141 | Ga0207655_1002832 | 3300025728 | Bacteria | 13434 |
| 142 | Ga0207655_1006801 | 3300025728 | Bacteria | 7516 |
| 143 | Ga0207655_1007688 | 3300025728 | Bacteria | 6956 |
| 144 | Ga0207655_1014097 | 3300025728 | Bacteria | 4540 |
| 145 | Ga0207655_1025566 | 3300025728 | Bacteria | 2862 |
| 146 | Ga0207655_1074812 | 3300025728 | Bacteria | 1245 |
| 147 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 148 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 149 | Ga0207713_1000104 | 3300025735 | Bacteria | 138310 |
| 150 | Ga0207713_1000564 | 3300025735 | Bacteria | 36882 |
| 151 | Ga0207713_1001593 | 3300025735 | Bacteria | 17743 |
| 152 | Ga0207713_1002004 | 3300025735 | Bacteria | 15301 |
| 153 | Ga0207713_1002990 | 3300025735 | Bacteria | 11815 |
| 154 | Ga0207713_1003370 | 3300025735 | Bacteria | 10952 |
| 155 | Ga0207713_1005039 | 3300025735 | Bacteria | 8397 |
| 156 | Ga0207713_1018153 | 3300025735 | Bacteria | 3491 |
| 157 | Ga0207713_1065880 | 3300025735 | Bacteria | 1358 |
| 158 | Ga0207710_10141532 | 3300025900 | Bacteria | 1161 |
| 159 | Ga0207699_10028489 | 3300025906 | Bacteria | 3105 |
| 160 | Ga0207671_10000436 | 3300025914 | Bacteria | 57399 |
| 161 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 162 | Ga0207681_10000816 | 3300025923 | Bacteria | 20490 |
| 163 | Ga0207650_10000559 | 3300025925 | Bacteria | 30251 |
| 164 | Ga0207650_10000688 | 3300025925 | Bacteria | 26557 |
| 165 | Ga0207706_10005582 | 3300025933 | Bacteria | 11722 |
| 166 | Ga0207686_10005841 | 3300025934 | Bacteria | 6603 |
| 167 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 168 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 169 | Ga0207639_10002172 | 3300026041 | Bacteria | 13210 |
| 170 | Ga0209281_1004003 | 3300027111 | Bacteria | 4567 |
| 171 | Ga0209281_1014772 | 3300027111 | Bacteria | 1645 |
| 172 | Ga0209281_1014996 | 3300027111 | Bacteria | 1626 |
| 173 | Ga0209981_1004989 | 3300027378 | Bacteria | 1755 |
| 174 | Ga0209996_1001558 | 3300027395 | Bacteria | 2792 |
| 175 | Ga0209968_1006918 | 3300027526 | Bacteria | 1712 |
| 176 | Ga0209983_1001292 | 3300027665 | Bacteria | 5572 |
| 177 | Ga0209974_10028508 | 3300027876 | Bacteria | 1849 |
| 178 | Ga0207428_10038182 | 3300027907 | Bacteria | 3905 |
| 179 | Ga0207428_10097691 | 3300027907 | Bacteria | 2273 |
| 180 | Ga0268266_10011117 | 3300028379 | Bacteria | 7837 |
| 181 | Ga0307511_10181496 | 3300030521 | Bacteria | 1133 |
| 182 | Ga0316178_1175126 | 3300030735 | Bacteria | 6677 |
| 183 | Ga0265340_10100814 | 3300031247 | Bacteria | 1342 |
| 184 | Ga0307509_10045079 | 3300031507 | Bacteria | 4760 |
| 185 | Ga0307408_100009275 | 3300031548 | Bacteria | 6487 |
| 186 | Ga0307408_100047218 | 3300031548 | Bacteria | 3083 |
| 187 | Ga0307408_100331416 | 3300031548 | Bacteria | 1285 |
| 188 | Ga0307405_10000858 | 3300031731 | Bacteria | 11988 |
| 189 | Ga0307405_10034002 | 3300031731 | Bacteria | 3029 |
| 190 | Ga0307405_10042297 | 3300031731 | Bacteria | 2772 |
| 191 | Ga0307405_10062191 | 3300031731 | Bacteria | 2363 |
| 192 | Ga0307406_10605063 | 3300031901 | Bacteria | 904 |
| 193 | Ga0307412_10013149 | 3300031911 | Bacteria | 4844 |
| 194 | Ga0307412_10021104 | 3300031911 | Bacteria | 3974 |
| 195 | Ga0307412_10039547 | 3300031911 | Bacteria | 3045 |
| 196 | Ga0307412_10043688 | 3300031911 | Bacteria | 2919 |
| 197 | Ga0307412_10044907 | 3300031911 | Bacteria | 2885 |
| 198 | Ga0307412_10055324 | 3300031911 | Bacteria | 2638 |
| 199 | Ga0307412_10103333 | 3300031911 | Bacteria | 2019 |
| 200 | Ga0307412_10248558 | 3300031911 | Bacteria | 1380 |
| 201 | Ga0307416_100040799 | 3300032002 | Bacteria | 3610 |
| 202 | Ga0307416_100312825 | 3300032002 | Bacteria | 1568 |
| 203 | Ga0307416_100375485 | 3300032002 | Bacteria | 1449 |
| 204 | Ga0307414_10059779 | 3300032004 | Bacteria | 2693 |
| 205 | Ga0307411_10015552 | 3300032005 | Bacteria | 4278 |
| 206 | Ga0307411_10619895 | 3300032005 | Bacteria | 932 |
| 207 | Ga0307510_10017421 | 3300033180 | Bacteria | 8472 |
| 208 | Ga0307510_10107259 | 3300033180 | Bacteria | 2553 |
| 209 | Ga0237819_02852 | 3300038705 | Bacteria | 3285 |
| 210 | Ga0439438_000786 | 3300041405 | Bacteria | 14109 |
| 211 | Ga0439438_002348 | 3300041405 | Bacteria | 8069 |
| 212 | Ga0439438_003155 | 3300041405 | Bacteria | 6762 |
| 213 | Ga0439438_005775 | 3300041405 | Bacteria | 4492 |
| 214 | Ga0439438_007754 | 3300041405 | Bacteria | 3632 |
| 215 | Ga0439438_008580 | 3300041405 | Bacteria | 3375 |
| 216 | Ga0439447_000985 | 3300041407 | Bacteria | 10388 |
| 217 | Ga0439447_001411 | 3300041407 | Bacteria | 8804 |
| 218 | Ga0439447_006363 | 3300041407 | Bacteria | 3842 |
| 219 | Ga0439447_017819 | 3300041407 | Bacteria | 1928 |
| 220 | Ga0439447_046546 | 3300041407 | Bacteria | 1043 |
| 221 | Ga0439466_0001571 | 3300041411 | Bacteria | 8922 |
| 222 | Ga0439466_0001845 | 3300041411 | Bacteria | 8316 |
| 223 | Ga0439466_0001878 | 3300041411 | Bacteria | 8225 |
| 224 | Ga0439466_0008863 | 3300041411 | Bacteria | 3784 |
| 225 | Ga0439466_0027775 | 3300041411 | Bacteria | 1957 |
| 226 | Ga0439466_0028654 | 3300041411 | Bacteria | 1920 |
| 227 | Ga0439466_0040503 | 3300041411 | Bacteria | 1557 |
| 228 | Ga0439465_0007331 | 3300041413 | Bacteria | 3502 |
| 229 | Ga0439431_0010252 | 3300041997 | Bacteria | 2124 |
| 230 | Ga0439445_0044923 | 3300042004 | Bacteria | 1181 |
| 231 | Ga0439432_000245 | 3300042006 | Bacteria | 19526 |
| 232 | Ga0439432_007140 | 3300042006 | Bacteria | 3969 |
| 233 | Ga0439432_058764 | 3300042006 | Bacteria | 1188 |
| 234 | Ga0439432_063597 | 3300042006 | Bacteria | 1133 |
| 235 | Ga0439432_082494 | 3300042006 | Bacteria | 973 |
| 236 | Ga0439451_001190 | 3300042009 | Bacteria | 5124 |
| 237 | Ga0439451_003397 | 3300042009 | Bacteria | 3224 |
| 238 | Ga0439451_010346 | 3300042009 | Bacteria | 1881 |
| 239 | Ga0439451_022469 | 3300042009 | Bacteria | 1271 |
| 240 | Ga0439452_001036 | 3300042010 | Bacteria | 12293 |
| 241 | Ga0439452_002729 | 3300042010 | Bacteria | 6395 |
| 242 | Ga0439452_004324 | 3300042010 | Bacteria | 4792 |
| 243 | Ga0439452_011394 | 3300042010 | Bacteria | 2556 |
| 244 | Ga0439452_020900 | 3300042010 | Bacteria | 1711 |
| 245 | Ga0439452_030104 | 3300042010 | Bacteria | 1341 |
| 246 | Ga0439456_001777 | 3300042013 | Bacteria | 4361 |
| 247 | Ga0439456_019846 | 3300042013 | Bacteria | 1415 |
| 248 | Ga0439456_031682 | 3300042013 | Bacteria | 1133 |
| 249 | Ga0439463_035129 | 3300042016 | Bacteria | 1268 |
| 250 | Ga0450911_001409 | 3300042115 | Bacteria | 5552 |
| 251 | Ga0450911_001580 | 3300042115 | Bacteria | 5148 |
| 252 | Ga0450919_002784 | 3300042121 | Bacteria | 2249 |
| 253 | Ga0450898_019753 | 3300042134 | Bacteria | 1176 |
| 254 | Ga0450900_006911 | 3300042136 | Bacteria | 1385 |
| 255 | Ga0450902_001140 | 3300042137 | Bacteria | 3547 |
| 256 | Ga0450903_003033 | 3300042138 | Bacteria | 2930 |
| 257 | Ga0450903_005287 | 3300042138 | Bacteria | 2165 |
| 258 | Ga0450904_002190 | 3300042139 | Bacteria | 2391 |
| 259 | Ga0450906_004159 | 3300042145 | Bacteria | 3056 |
| 260 | Ga0450906_012772 | 3300042145 | Bacteria | 1554 |
| 261 | Ga0450907_000173 | 3300042146 | Bacteria | 23629 |
| 262 | Ga0450907_004128 | 3300042146 | Bacteria | 2515 |
| 263 | Ga0450907_013304 | 3300042146 | Bacteria | 1370 |
| 264 | Ga0450910_006877 | 3300042147 | Bacteria | 1576 |
| 265 | Ga0450908_013324 | 3300042184 | Bacteria | 1483 |
| 266 | Ga0450909_004414 | 3300042185 | Bacteria | 2006 |
| 267 | Ga0439434_0001671 | 3300042435 | Bacteria | 6428 |
| 268 | Ga0439460_0032672 | 3300042461 | Bacteria | 1491 |
| 269 | Ga0439440_0001312 | 3300042993 | Bacteria | 4519 |
| 270 | Ga0439440_0010474 | 3300042993 | Bacteria | 1939 |
| 271 | Ga0495617_001213 | 3300046452 | Bacteria | 11620 |
| 272 | Ga0495617_007892 | 3300046452 | Bacteria | 3682 |
| 273 | Ga0495617_017307 | 3300046452 | Bacteria | 2434 |
| 274 | Ga0495617_020800 | 3300046452 | Bacteria | 2217 |
| 275 | Ga0495617_021109 | 3300046452 | Bacteria | 2201 |
| 276 | Ga0495617_035676 | 3300046452 | Bacteria | 1669 |
| 277 | Ga0495617_056969 | 3300046452 | Bacteria | 1295 |
| 278 | Ga0495627_000010 | 3300046453 | Bacteria | 381168 |
| 279 | Ga0495627_001278 | 3300046453 | Bacteria | 15487 |
| 280 | Ga0495627_002406 | 3300046453 | Bacteria | 9068 |
| 281 | Ga0495627_005495 | 3300046453 | Bacteria | 5099 |
| 282 | Ga0495603_0005877 | 3300046455 | Bacteria | 7333 |
| 283 | Ga0495603_0013688 | 3300046455 | Bacteria | 4908 |
| 284 | Ga0495590_0001626 | 3300046457 | Bacteria | 9594 |
| 285 | Ga0495590_0004603 | 3300046457 | Bacteria | 5542 |
| 286 | Ga0495590_0006841 | 3300046457 | Bacteria | 4431 |
| 287 | Ga0495590_0021548 | 3300046457 | Bacteria | 2284 |
| 288 | Ga0495591_000002 | 3300046458 | Bacteria | 455013 |
| 289 | Ga0495591_000452 | 3300046458 | Bacteria | 33368 |
| 290 | Ga0495591_001442 | 3300046458 | Bacteria | 14774 |
| 291 | Ga0495591_001556 | 3300046458 | Bacteria | 14002 |
| 292 | Ga0495591_002486 | 3300046458 | Bacteria | 10221 |
| 293 | Ga0495591_002525 | 3300046458 | Bacteria | 10110 |
| 294 | Ga0495591_003543 | 3300046458 | Bacteria | 7996 |
| 295 | Ga0495591_004698 | 3300046458 | Bacteria | 6557 |
| 296 | Ga0495591_007226 | 3300046458 | Bacteria | 4752 |
| 297 | Ga0495591_007825 | 3300046458 | Bacteria | 4468 |
| 298 | Ga0495591_008402 | 3300046458 | Bacteria | 4232 |
| 299 | Ga0495591_013459 | 3300046458 | Bacteria | 2991 |
| 300 | Ga0495591_029909 | 3300046458 | Bacteria | 1649 |
| 301 | Ga0495638_0005689 | 3300046460 | Bacteria | 9183 |
| 302 | Ga0495638_0006808 | 3300046460 | Bacteria | 8254 |
| 303 | Ga0495638_0007812 | 3300046460 | Bacteria | 7637 |
| 304 | Ga0495638_0032131 | 3300046460 | Bacteria | 3367 |
| 305 | Ga0495638_0046056 | 3300046460 | Bacteria | 2741 |
| 306 | Ga0495653_0015282 | 3300046463 | Bacteria | 6256 |
| 307 | Ga0495650_0003766 | 3300046471 | Bacteria | 10820 |
| 308 | Ga0495650_0004073 | 3300046471 | Bacteria | 10221 |
| 309 | Ga0495650_0005829 | 3300046471 | Bacteria | 7848 |
| 310 | Ga0495650_0019471 | 3300046471 | Bacteria | 3338 |
| 311 | Ga0495650_0026336 | 3300046471 | Bacteria | 2707 |
| 312 | Ga0495650_0028975 | 3300046471 | Bacteria | 2530 |
| 313 | Ga0495650_0032847 | 3300046471 | Bacteria | 2316 |
| 314 | Ga0495650_0049992 | 3300046471 | Bacteria | 1731 |
| 315 | Ga0495650_0056126 | 3300046471 | Bacteria | 1599 |
| 316 | Ga0495582_0016390 | 3300046473 | Bacteria | 4060 |
| 317 | Ga0495605_0005553 | 3300046474 | Bacteria | 7335 |
| 318 | Ga0495605_0008470 | 3300046474 | Bacteria | 5814 |
| 319 | Ga0495605_0010655 | 3300046474 | Bacteria | 5138 |
| 320 | Ga0495605_0022243 | 3300046474 | Bacteria | 3350 |
| 321 | Ga0495605_0037769 | 3300046474 | Bacteria | 2427 |
| 322 | Ga0495605_0104320 | 3300046474 | Bacteria | 1299 |
| 323 | Ga0495605_0130337 | 3300046474 | Bacteria | 1134 |
| 324 | Ga0495639_0000994 | 3300046475 | Bacteria | 12799 |
| 325 | Ga0495584_0001291 | 3300046491 | Bacteria | 15247 |
| 326 | Ga0495584_0002832 | 3300046491 | Bacteria | 9681 |
| 327 | Ga0495584_0009191 | 3300046491 | Bacteria | 5096 |
| 328 | Ga0495584_0010632 | 3300046491 | Bacteria | 4726 |
| 329 | Ga0495584_0017755 | 3300046491 | Bacteria | 3619 |
| 330 | Ga0495584_0022206 | 3300046491 | Bacteria | 3221 |
| 331 | Ga0495584_0067622 | 3300046491 | Bacteria | 1795 |
| 332 | Ga0495585_0007924 | 3300046492 | Bacteria | 6458 |
| 333 | Ga0495585_0011257 | 3300046492 | Bacteria | 5299 |
| 334 | Ga0495585_0017386 | 3300046492 | Bacteria | 4154 |
| 335 | Ga0495585_0019132 | 3300046492 | Bacteria | 3952 |
| 336 | Ga0495585_0076259 | 3300046492 | Bacteria | 1821 |
| 337 | Ga0495594_0006698 | 3300046499 | Bacteria | 5925 |
| 338 | Ga0495594_0058585 | 3300046499 | Bacteria | 2129 |
| 339 | Ga0495594_0123797 | 3300046499 | Bacteria | 1462 |
| 340 | Ga0495596_0001019 | 3300046500 | Bacteria | 16647 |
| 341 | Ga0495607_0000025 | 3300046501 | Bacteria | 159379 |
| 342 | Ga0495607_0000723 | 3300046501 | Bacteria | 31710 |
| 343 | Ga0495607_0003843 | 3300046501 | Bacteria | 11330 |
| 344 | Ga0495607_0005334 | 3300046501 | Bacteria | 9236 |
| 345 | Ga0495607_0009730 | 3300046501 | Bacteria | 6489 |
| 346 | Ga0495607_0016411 | 3300046501 | Bacteria | 4778 |
| 347 | Ga0495607_0024112 | 3300046501 | Bacteria | 3797 |
| 348 | Ga0495607_0039658 | 3300046501 | Bacteria | 2811 |
| 349 | Ga0495607_0063469 | 3300046501 | Bacteria | 2089 |
| 350 | Ga0495607_0069373 | 3300046501 | Bacteria | 1973 |
| 351 | Ga0495607_0070726 | 3300046501 | Bacteria | 1948 |
| 352 | Ga0495607_0074243 | 3300046501 | Bacteria | 1888 |
| 353 | Ga0495583_0001907 | 3300046506 | Bacteria | 19301 |
| 354 | Ga0495583_0008510 | 3300046506 | Bacteria | 6260 |
| 355 | Ga0495583_0008516 | 3300046506 | Bacteria | 6258 |
| 356 | Ga0495583_0018824 | 3300046506 | Bacteria | 3623 |
| 357 | Ga0495583_0029479 | 3300046506 | Bacteria | 2684 |
| 358 | Ga0495583_0035446 | 3300046506 | Bacteria | 2381 |
| 359 | Ga0495583_0098419 | 3300046506 | Bacteria | 1250 |
| 360 | Ga0495606_0000055 | 3300046507 | Bacteria | 199348 |
| 361 | Ga0495606_0001543 | 3300046507 | Bacteria | 30359 |
| 362 | Ga0495606_0011362 | 3300046507 | Bacteria | 7270 |
| 363 | Ga0495606_0011908 | 3300046507 | Bacteria | 7035 |
| 364 | Ga0495606_0016397 | 3300046507 | Bacteria | 5650 |
| 365 | Ga0495606_0016942 | 3300046507 | Bacteria | 5530 |
| 366 | Ga0495606_0020935 | 3300046507 | Bacteria | 4802 |
| 367 | Ga0495606_0031545 | 3300046507 | Bacteria | 3682 |
| 368 | Ga0495606_0035464 | 3300046507 | Bacteria | 3408 |
| 369 | Ga0495606_0058330 | 3300046507 | Bacteria | 2481 |
| 370 | Ga0495606_0101267 | 3300046507 | Bacteria | 1753 |
| 371 | Ga0495606_0227933 | 3300046507 | Bacteria | 1046 |
| 372 | Ga0495610_0004508 | 3300046512 | Bacteria | 10261 |
| 373 | Ga0495610_0008798 | 3300046512 | Bacteria | 6475 |
| 374 | Ga0495610_0010140 | 3300046512 | Bacteria | 5880 |
| 375 | Ga0495610_0016078 | 3300046512 | Bacteria | 4325 |
| 376 | Ga0495610_0023992 | 3300046512 | Bacteria | 3300 |
| 377 | Ga0495610_0049979 | 3300046512 | Bacteria | 2043 |
| 378 | Ga0495610_0095346 | 3300046512 | Bacteria | 1341 |
| 379 | Ga0495616_0003008 | 3300046513 | Bacteria | 10938 |
| 380 | Ga0495616_0006069 | 3300046513 | Bacteria | 7361 |
| 381 | Ga0495616_0007496 | 3300046513 | Bacteria | 6533 |
| 382 | Ga0495616_0009252 | 3300046513 | Bacteria | 5776 |
| 383 | Ga0495616_0009306 | 3300046513 | Bacteria | 5756 |
| 384 | Ga0495616_0012317 | 3300046513 | Bacteria | 4857 |
| 385 | Ga0495616_0025253 | 3300046513 | Bacteria | 3176 |
| 386 | Ga0495616_0029012 | 3300046513 | Bacteria | 2924 |
| 387 | Ga0495620_0001753 | 3300046515 | Bacteria | 12769 |
| 388 | Ga0495620_0002591 | 3300046515 | Bacteria | 10455 |
| 389 | Ga0495620_0007857 | 3300046515 | Bacteria | 5755 |
| 390 | Ga0495620_0008194 | 3300046515 | Bacteria | 5619 |
| 391 | Ga0495620_0008988 | 3300046515 | Bacteria | 5336 |
| 392 | Ga0495620_0014699 | 3300046515 | Bacteria | 3970 |
| 393 | Ga0495620_0021640 | 3300046515 | Bacteria | 3119 |
| 394 | Ga0495620_0022198 | 3300046515 | Bacteria | 3064 |
| 395 | Ga0495620_0031288 | 3300046515 | Bacteria | 2440 |
| 396 | Ga0495620_0034269 | 3300046515 | Bacteria | 2296 |
| 397 | Ga0495630_0032621 | 3300046517 | Bacteria | 3882 |
| 398 | Ga0495630_0075306 | 3300046517 | Bacteria | 2543 |
| 399 | Ga0495631_0003291 | 3300046518 | Bacteria | 8883 |
| 400 | Ga0495631_0019988 | 3300046518 | Bacteria | 3133 |
| 401 | Ga0495631_0023185 | 3300046518 | Bacteria | 2879 |
| 402 | Ga0495631_0090514 | 3300046518 | Bacteria | 1317 |
| 403 | Ga0495632_0003292 | 3300046519 | Bacteria | 11535 |
| 404 | Ga0495632_0005336 | 3300046519 | Bacteria | 8522 |
| 405 | Ga0495632_0009359 | 3300046519 | Bacteria | 5914 |
| 406 | Ga0495632_0010459 | 3300046519 | Bacteria | 5494 |
| 407 | Ga0495632_0013714 | 3300046519 | Bacteria | 4612 |
| 408 | Ga0495632_0017467 | 3300046519 | Bacteria | 3957 |
| 409 | Ga0495632_0027429 | 3300046519 | Bacteria | 2983 |
| 410 | Ga0495637_0000414 | 3300046520 | Bacteria | 31478 |
| 411 | Ga0495637_0002290 | 3300046520 | Bacteria | 10607 |
| 412 | Ga0495637_0002474 | 3300046520 | Bacteria | 10205 |
| 413 | Ga0495637_0005314 | 3300046520 | Bacteria | 6585 |
| 414 | Ga0495637_0014643 | 3300046520 | Bacteria | 3695 |
| 415 | Ga0495637_0021535 | 3300046520 | Bacteria | 2954 |
| 416 | Ga0495637_0093929 | 3300046520 | Bacteria | 1179 |
| 417 | Ga0495643_0006744 | 3300046522 | Bacteria | 7511 |
| 418 | Ga0495643_0010283 | 3300046522 | Bacteria | 5762 |
| 419 | Ga0495643_0013850 | 3300046522 | Bacteria | 4811 |
| 420 | Ga0495643_0017952 | 3300046522 | Bacteria | 4123 |
| 421 | Ga0495643_0021971 | 3300046522 | Bacteria | 3648 |
| 422 | Ga0495643_0027922 | 3300046522 | Bacteria | 3167 |
| 423 | Ga0495643_0150046 | 3300046522 | Bacteria | 1155 |
| 424 | Ga0495643_0186716 | 3300046522 | Bacteria | 1003 |
| 425 | Ga0495644_0001339 | 3300046523 | Bacteria | 10077 |
| 426 | Ga0495644_0002235 | 3300046523 | Bacteria | 7743 |
| 427 | Ga0495644_0003754 | 3300046523 | Bacteria | 5977 |
| 428 | Ga0495644_0011222 | 3300046523 | Bacteria | 3452 |
| 429 | Ga0495648_0001887 | 3300046524 | Bacteria | 20035 |
| 430 | Ga0495648_0006635 | 3300046524 | Bacteria | 9379 |
| 431 | Ga0495648_0007214 | 3300046524 | Bacteria | 8929 |
| 432 | Ga0495648_0013042 | 3300046524 | Bacteria | 6166 |
| 433 | Ga0495648_0016559 | 3300046524 | Bacteria | 5309 |
| 434 | Ga0495648_0024568 | 3300046524 | Bacteria | 4100 |
| 435 | Ga0495648_0032234 | 3300046524 | Bacteria | 3441 |
| 436 | Ga0495648_0036612 | 3300046524 | Bacteria | 3162 |
| 437 | Ga0495648_0048425 | 3300046524 | Bacteria | 2616 |
| 438 | Ga0495648_0092173 | 3300046524 | Bacteria | 1692 |
| 439 | Ga0495648_0121460 | 3300046524 | Bacteria | 1403 |
| 440 | Ga0495666_0010775 | 3300046526 | Bacteria | 4560 |
| 441 | Ga0495666_0024064 | 3300046526 | Bacteria | 3011 |
| 442 | Ga0495666_0050239 | 3300046526 | Bacteria | 2005 |
| 443 | Ga0495642_0000619 | 3300046528 | Bacteria | 17900 |
| 444 | Ga0495642_0018089 | 3300046528 | Bacteria | 2756 |
| 445 | Ga0495654_0000673 | 3300046530 | Bacteria | 26934 |
| 446 | Ga0495654_0001952 | 3300046530 | Bacteria | 13616 |
| 447 | Ga0495654_0023755 | 3300046530 | Bacteria | 3172 |
| 448 | Ga0495654_0027139 | 3300046530 | Bacteria | 2938 |
| 449 | Ga0495654_0027278 | 3300046530 | Bacteria | 2929 |
| 450 | Ga0495654_0037975 | 3300046530 | Bacteria | 2410 |
| 451 | Ga0495654_0093213 | 3300046530 | Bacteria | 1395 |
| 452 | Ga0495654_0097301 | 3300046530 | Bacteria | 1359 |
| 453 | Ga0495654_0098547 | 3300046530 | Bacteria | 1348 |
| 454 | Ga0495654_0128589 | 3300046530 | Bacteria | 1139 |
| 455 | Ga0495654_0179222 | 3300046530 | Bacteria | 918 |
| 456 | Ga0495586_0101788 | 3300046535 | Bacteria | 1594 |
| 457 | Ga0495587_0024092 | 3300046536 | Bacteria | 3734 |
| 458 | Ga0495587_0092887 | 3300046536 | Bacteria | 1742 |
| 459 | Ga0495609_0000066 | 3300046538 | Bacteria | 131202 |
| 460 | Ga0495609_0004568 | 3300046538 | Bacteria | 7524 |
| 461 | Ga0495609_0005438 | 3300046538 | Bacteria | 6691 |
| 462 | Ga0495609_0006429 | 3300046538 | Bacteria | 5995 |
| 463 | Ga0495609_0009498 | 3300046538 | Bacteria | 4705 |
| 464 | Ga0495609_0018559 | 3300046538 | Bacteria | 3222 |
| 465 | Ga0495609_0024012 | 3300046538 | Bacteria | 2798 |
| 466 | Ga0495597_0000011 | 3300046542 | Bacteria | 221377 |
| 467 | Ga0495597_0006542 | 3300046542 | Bacteria | 6015 |
| 468 | Ga0495597_0008888 | 3300046542 | Bacteria | 5008 |
| 469 | Ga0495597_0017098 | 3300046542 | Bacteria | 3417 |
| 470 | Ga0495597_0018718 | 3300046542 | Bacteria | 3247 |
| 471 | Ga0495597_0020226 | 3300046542 | Bacteria | 3102 |
| 472 | Ga0495597_0021958 | 3300046542 | Bacteria | 2963 |
| 473 | Ga0495597_0063893 | 3300046542 | Bacteria | 1599 |
| 474 | Ga0495597_0083324 | 3300046542 | Bacteria | 1365 |
| 475 | Ga0495622_0002561 | 3300046557 | Bacteria | 8783 |
| 476 | Ga0495622_0003892 | 3300046557 | Bacteria | 6974 |
| 477 | Ga0495622_0008562 | 3300046557 | Bacteria | 4741 |
| 478 | Ga0495622_0028987 | 3300046557 | Bacteria | 2586 |
| 479 | Ga0495622_0052332 | 3300046557 | Bacteria | 1894 |
| 480 | Ga0495622_0053763 | 3300046557 | Bacteria | 1868 |
| 481 | Ga0495633_0010318 | 3300046558 | Bacteria | 5107 |
| 482 | Ga0495668_0002481 | 3300046616 | Bacteria | 15151 |
| 483 | Ga0495668_0008255 | 3300046616 | Bacteria | 6526 |
| 484 | Ga0495668_0016122 | 3300046616 | Bacteria | 4347 |
| 485 | Ga0495668_0185858 | 3300046616 | Bacteria | 1138 |
| 486 | Ga0495634_0020607 | 3300046642 | Bacteria | 4673 |
| 487 | Ga0495611_0000416 | 3300046648 | Bacteria | 26473 |
| 488 | Ga0495611_0002365 | 3300046648 | Bacteria | 8687 |
| 489 | Ga0495611_0003356 | 3300046648 | Bacteria | 7067 |
| 490 | Ga0495625_0000055 | 3300046660 | Bacteria | 186381 |
| 491 | Ga0495625_0020483 | 3300046660 | Bacteria | 5104 |
| 492 | Ga0495625_0022411 | 3300046660 | Bacteria | 4843 |
| 493 | Ga0495625_0048103 | 3300046660 | Bacteria | 3072 |
| 494 | Ga0495625_0084289 | 3300046660 | Bacteria | 2207 |
| 495 | Ga0495635_0006025 | 3300046663 | Bacteria | 8455 |
| 496 | Ga0495635_0018177 | 3300046663 | Bacteria | 4907 |
| 497 | Ga0495659_0001059 | 3300046664 | Bacteria | 9611 |
| 498 | Ga0495661_0000105 | 3300046665 | Bacteria | 101167 |
| 499 | Ga0495661_0000139 | 3300046665 | Bacteria | 85160 |
| 500 | Ga0495661_0002061 | 3300046665 | Bacteria | 15772 |
| 501 | Ga0495661_0004967 | 3300046665 | Bacteria | 9503 |
| 502 | Ga0495661_0025126 | 3300046665 | Bacteria | 3851 |
| 503 | Ga0495661_0033064 | 3300046665 | Bacteria | 3264 |
| 504 | Ga0495661_0034528 | 3300046665 | Bacteria | 3182 |
| 505 | Ga0495661_0071314 | 3300046665 | Bacteria | 2030 |
| 506 | Ga0495588_0020609 | 3300046674 | Bacteria | 3243 |
| 507 | Ga0495588_0137198 | 3300046674 | Bacteria | 1291 |
| 508 | Ga0495623_0016125 | 3300046679 | Bacteria | 4827 |
| 509 | Ga0495623_0018191 | 3300046679 | Bacteria | 4538 |
| 510 | Ga0495646_0024731 | 3300046680 | Bacteria | 3781 |
| 511 | Ga0495646_0025218 | 3300046680 | Bacteria | 3741 |
| 512 | Ga0495646_0028629 | 3300046680 | Bacteria | 3486 |
| 513 | Ga0495646_0098588 | 3300046680 | Bacteria | 1678 |
| 514 | Ga0495669_0001111 | 3300046684 | Bacteria | 11152 |
| 515 | Ga0495613_0049064 | 3300046689 | Bacteria | 3116 |
| 516 | Ga0495613_0061840 | 3300046689 | Bacteria | 2741 |
| 517 | Ga0495613_0114868 | 3300046689 | Bacteria | 1937 |
| 518 | Ga0495624_0007174 | 3300046690 | Bacteria | 7843 |
| 519 | Ga0495670_0004140 | 3300046691 | Bacteria | 7110 |
| 520 | Ga0495670_0006986 | 3300046691 | Bacteria | 5563 |
| 521 | Ga0495670_0042577 | 3300046691 | Bacteria | 2265 |
| 522 | Ga0495670_0122357 | 3300046691 | Bacteria | 1352 |
| 523 | Ga0495670_0136191 | 3300046691 | Bacteria | 1282 |
| 524 | Ga0495670_0209178 | 3300046691 | Bacteria | 1034 |
| 525 | Ga0495671_0000516 | 3300046692 | Bacteria | 29556 |
| 526 | Ga0495671_0001535 | 3300046692 | Bacteria | 15386 |
| 527 | Ga0495671_0007630 | 3300046692 | Bacteria | 6145 |
| 528 | Ga0495671_0019851 | 3300046692 | Bacteria | 3547 |
| 529 | Ga0495671_0022087 | 3300046692 | Bacteria | 3336 |
| 530 | Ga0495671_0033881 | 3300046692 | Bacteria | 2599 |
| 531 | Ga0495671_0039276 | 3300046692 | Bacteria | 2390 |
| 532 | Ga0495671_0041552 | 3300046692 | Bacteria | 2314 |
| 533 | Ga0495671_0103258 | 3300046692 | Bacteria | 1392 |
| 534 | Ga0495649_0002480 | 3300046694 | Bacteria | 12953 |
| 535 | Ga0495649_0006308 | 3300046694 | Bacteria | 7379 |
| 536 | Ga0495649_0007497 | 3300046694 | Bacteria | 6640 |
| 537 | Ga0495649_0013971 | 3300046694 | Bacteria | 4618 |
| 538 | Ga0495649_0026961 | 3300046694 | Bacteria | 3190 |
| 539 | Ga0495649_0037742 | 3300046694 | Bacteria | 2651 |
| 540 | Ga0495649_0052219 | 3300046694 | Bacteria | 2215 |
| 541 | Ga0495649_0055807 | 3300046694 | Bacteria | 2133 |
| 542 | Ga0495589_0000411 | 3300046794 | Bacteria | 32203 |
| 543 | Ga0495589_0001524 | 3300046794 | Bacteria | 13328 |
| 544 | Ga0495589_0004506 | 3300046794 | Bacteria | 7400 |
| 545 | Ga0495589_0007367 | 3300046794 | Bacteria | 5760 |
| 546 | Ga0495589_0026347 | 3300046794 | Bacteria | 2946 |
| 547 | Ga0495589_0028987 | 3300046794 | Bacteria | 2791 |
| 548 | Ga0495600_0016472 | 3300046809 | Bacteria | 4691 |
| 549 | Ga0495660_0000142 | 3300046810 | Bacteria | 77290 |
| 550 | Ga0495660_0001119 | 3300046810 | Bacteria | 19156 |
| 551 | Ga0495660_0007548 | 3300046810 | Bacteria | 6383 |
| 552 | Ga0495660_0008985 | 3300046810 | Bacteria | 5837 |
| 553 | Ga0495660_0012251 | 3300046810 | Bacteria | 4974 |
| 554 | Ga0495660_0012502 | 3300046810 | Bacteria | 4928 |
| 555 | Ga0495660_0012787 | 3300046810 | Bacteria | 4869 |
| 556 | Ga0495660_0015928 | 3300046810 | Bacteria | 4338 |
| 557 | Ga0495660_0022738 | 3300046810 | Bacteria | 3578 |
| 558 | Ga0495660_0030871 | 3300046810 | Bacteria | 3016 |
| 559 | Ga0495660_0054092 | 3300046810 | Bacteria | 2176 |
| 560 | Ga0495660_0073726 | 3300046810 | Bacteria | 1804 |
| 561 | Ga0495660_0085657 | 3300046810 | Bacteria | 1646 |
| 562 | Ga0495660_0093750 | 3300046810 | Bacteria | 1556 |
| 563 | Ga0495660_0136063 | 3300046810 | Bacteria | 1227 |
| 564 | Ga0495660_0170688 | 3300046810 | Bacteria | 1059 |
| 565 | Ga0495604_0028278 | 3300047317 | Bacteria | 4459 |
| 566 | Ga0495604_0054701 | 3300047317 | Bacteria | 3079 |
| 567 | Ga0495604_0331762 | 3300047317 | Bacteria | 1014 |
| 568 | Ga0495636_0012249 | 3300047318 | Bacteria | 3395 |
| 569 | Ga0495674_0027626 | 3300047319 | Bacteria | 5183 |
| 570 | Ga0495672_0003642 | 3300047320 | Bacteria | 13052 |
| 571 | Ga0495672_0004056 | 3300047320 | Bacteria | 12227 |
| 572 | Ga0495672_0007887 | 3300047320 | Bacteria | 7943 |
| 573 | Ga0495672_0015575 | 3300047320 | Bacteria | 5157 |
| 574 | Ga0495672_0022571 | 3300047320 | Bacteria | 4088 |
| 575 | Ga0495672_0029531 | 3300047320 | Bacteria | 3452 |
| 576 | Ga0495672_0036108 | 3300047320 | Bacteria | 3037 |
| 577 | Ga0495672_0039705 | 3300047320 | Bacteria | 2860 |
| 578 | Ga0495672_0059273 | 3300047320 | Bacteria | 2215 |
| 579 | Ga0495672_0110292 | 3300047320 | Bacteria | 1478 |
| 580 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 581 | Ga0495676_0019443 | 3300047321 | Bacteria | 5973 |
| 582 | Ga0495676_0079116 | 3300047321 | Bacteria | 2500 |
| 583 | Ga0495680_0009030 | 3300047322 | Bacteria | 9005 |
| 584 | Ga0495680_0052857 | 3300047322 | Bacteria | 3164 |
| 585 | Ga0495680_0072207 | 3300047322 | Bacteria | 2625 |
| 586 | Ga0495683_0005515 | 3300047323 | Bacteria | 7015 |
| 587 | Ga0495683_0016832 | 3300047323 | Bacteria | 3794 |
| 588 | Ga0495683_0019268 | 3300047323 | Bacteria | 3522 |
| 589 | Ga0495683_0022825 | 3300047323 | Bacteria | 3217 |
| 590 | Ga0495683_0039481 | 3300047323 | Bacteria | 2385 |
| 591 | Ga0495683_0193713 | 3300047323 | Bacteria | 920 |
| 592 | Ga0495687_004474 | 3300047443 | Bacteria | 9414 |
| 593 | Ga0495687_025436 | 3300047443 | Bacteria | 2798 |
| 594 | Ga0495675_0303601 | 3300047444 | Bacteria | 947 |
| 595 | Ga0495677_0003504 | 3300047445 | Bacteria | 6089 |
| 596 | Ga0495679_000129 | 3300047446 | Bacteria | 67544 |
| 597 | Ga0495679_004672 | 3300047446 | Bacteria | 6240 |
| 598 | Ga0495679_007869 | 3300047446 | Bacteria | 4391 |
| 599 | Ga0495679_007997 | 3300047446 | Bacteria | 4347 |
| 600 | Ga0495679_009193 | 3300047446 | Bacteria | 3972 |
| 601 | Ga0495679_009679 | 3300047446 | Bacteria | 3839 |
| 602 | Ga0495679_016820 | 3300047446 | Bacteria | 2635 |
| 603 | Ga0495679_016840 | 3300047446 | Bacteria | 2633 |
| 604 | Ga0495679_030636 | 3300047446 | Bacteria | 1743 |
| 605 | Ga0495679_069681 | 3300047446 | Bacteria | 1015 |
| 606 | Ga0495673_0000510 | 3300047469 | Bacteria | 41036 |
| 607 | Ga0495673_0000641 | 3300047469 | Bacteria | 34387 |
| 608 | Ga0495673_0001049 | 3300047469 | Bacteria | 24312 |
| 609 | Ga0495673_0003806 | 3300047469 | Bacteria | 9745 |
| 610 | Ga0495673_0004768 | 3300047469 | Bacteria | 8399 |
| 611 | Ga0495673_0006091 | 3300047469 | Bacteria | 7162 |
| 612 | Ga0495673_0008502 | 3300047469 | Bacteria | 5767 |
| 613 | Ga0495673_0009496 | 3300047469 | Bacteria | 5383 |
| 614 | Ga0495673_0010918 | 3300047469 | Bacteria | 4914 |
| 615 | Ga0495673_0013311 | 3300047469 | Bacteria | 4325 |
| 616 | Ga0495673_0013457 | 3300047469 | Bacteria | 4292 |
| 617 | Ga0495673_0014564 | 3300047469 | Bacteria | 4085 |
| 618 | Ga0495673_0014875 | 3300047469 | Bacteria | 4030 |
| 619 | Ga0495673_0022411 | 3300047469 | Bacteria | 3096 |
| 620 | Ga0495673_0025384 | 3300047469 | Bacteria | 2846 |
| 621 | Ga0495673_0026170 | 3300047469 | Bacteria | 2792 |
| 622 | Ga0495673_0029441 | 3300047469 | Bacteria | 2591 |
| 623 | Ga0495673_0036349 | 3300047469 | Bacteria | 2260 |
| 624 | Ga0495673_0039748 | 3300047469 | Bacteria | 2132 |
| 625 | Ga0495673_0041298 | 3300047469 | Bacteria | 2077 |
| 626 | Ga0495681_0001437 | 3300047470 | Bacteria | 17881 |
| 627 | Ga0495681_0004955 | 3300047470 | Bacteria | 8985 |
| 628 | Ga0495681_0005721 | 3300047470 | Bacteria | 8274 |
| 629 | Ga0495681_0007131 | 3300047470 | Bacteria | 7202 |
| 630 | Ga0495681_0007318 | 3300047470 | Bacteria | 7072 |
| 631 | Ga0495681_0015381 | 3300047470 | Bacteria | 4331 |
| 632 | Ga0495681_0018869 | 3300047470 | Bacteria | 3785 |
| 633 | Ga0495681_0038148 | 3300047470 | Bacteria | 2358 |
| 634 | Ga0495681_0105343 | 3300047470 | Bacteria | 1227 |
| 635 | Ga0495681_0155149 | 3300047470 | Bacteria | 957 |
| 636 | Ga0495684_0010506 | 3300047471 | Bacteria | 7159 |
| 637 | Ga0495684_0022241 | 3300047471 | Bacteria | 4882 |
| 638 | Ga0495686_0015573 | 3300047472 | Bacteria | 5186 |
| 639 | Ga0495686_0017332 | 3300047472 | Bacteria | 4856 |
| 640 | Ga0495686_0021878 | 3300047472 | Bacteria | 4237 |
| 641 | Ga0495686_0031136 | 3300047472 | Bacteria | 3461 |
| 642 | Ga0495686_0040447 | 3300047472 | Bacteria | 2973 |
| 643 | Ga0495686_0179017 | 3300047472 | Bacteria | 1229 |
| 644 | Ga0495686_0229606 | 3300047472 | Bacteria | 1051 |
| 645 | Ga0495593_0011041 | 3300047673 | Bacteria | 5199 |
| 646 | Ga0495602_0015548 | 3300048088 | Bacteria | 7673 |
| 647 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 648 | Ga0495626_0001149 | 3300048091 | Bacteria | 22106 |
| 649 | Ga0495626_0001346 | 3300048091 | Bacteria | 19873 |
| 650 | Ga0495626_0002001 | 3300048091 | Bacteria | 15031 |
| 651 | Ga0495626_0003528 | 3300048091 | Bacteria | 10014 |
| 652 | Ga0495626_0007781 | 3300048091 | Bacteria | 5938 |
| 653 | Ga0495626_0010537 | 3300048091 | Bacteria | 4923 |
| 654 | Ga0495626_0011028 | 3300048091 | Bacteria | 4794 |
| 655 | Ga0495626_0022037 | 3300048091 | Bacteria | 3151 |
| 656 | Ga0495626_0048137 | 3300048091 | Bacteria | 1979 |
| 657 | Ga0495626_0133578 | 3300048091 | Bacteria | 1057 |
| 658 | Ga0496100_0032875 | 3300048903 | Bacteria | 3240 |
| 659 | Ga0496101_0012768 | 3300048904 | Bacteria | 5617 |
| 660 | Ga0496102_0004463 | 3300048905 | Bacteria | 11805 |
| 661 | Ga0496102_0275671 | 3300048905 | Bacteria | 1585 |
| 662 | Ga0496102_0622638 | 3300048905 | Bacteria | 1002 |
| 663 | Ga0496103_0013756 | 3300048906 | Bacteria | 4803 |
| 664 | Ga0496103_0140729 | 3300048906 | Bacteria | 1543 |
| 665 | Ga0496104_0034402 | 3300048907 | Bacteria | 4725 |
| 666 | Ga0496105_0092973 | 3300048908 | Bacteria | 2490 |
| 667 | Ga0496110_0322043 | 3300048913 | Bacteria | 1408 |
| 668 | Ga0496111_0327545 | 3300048914 | Bacteria | 1134 |
| 669 | Ga0496112_0257867 | 3300048915 | Bacteria | 1693 |
| 670 | Ga0496116_0006411 | 3300048919 | Bacteria | 10676 |
| 671 | Ga0496116_0014738 | 3300048919 | Bacteria | 6226 |
| 672 | Ga0496116_0022706 | 3300048919 | Bacteria | 4694 |
| 673 | Ga0496116_0032094 | 3300048919 | Bacteria | 3748 |
| 674 | Ga0496116_0046236 | 3300048919 | Bacteria | 2939 |
| 675 | Ga0496116_0088988 | 3300048919 | Bacteria | 1885 |
| 676 | Ga0496117_0002789 | 3300048920 | Bacteria | 21338 |
| 677 | Ga0496117_0008857 | 3300048920 | Bacteria | 9496 |
| 678 | Ga0496117_0011214 | 3300048920 | Bacteria | 8046 |
| 679 | Ga0496117_0017405 | 3300048920 | Bacteria | 6000 |
| 680 | Ga0496117_0025548 | 3300048920 | Bacteria | 4641 |
| 681 | Ga0496117_0028665 | 3300048920 | Bacteria | 4308 |
| 682 | Ga0496118_0016084 | 3300048921 | Bacteria | 6883 |
| 683 | Ga0496118_0018336 | 3300048921 | Bacteria | 6319 |
| 684 | Ga0496118_0025463 | 3300048921 | Bacteria | 5072 |
| 685 | Ga0496118_0029625 | 3300048921 | Bacteria | 4586 |
| 686 | Ga0496118_0051207 | 3300048921 | Bacteria | 3160 |
| 687 | Ga0496118_0123217 | 3300048921 | Bacteria | 1684 |
| 688 | Ga0496118_0170014 | 3300048921 | Bacteria | 1333 |
| 689 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 690 | Ga0496119_0000570 | 3300048922 | Bacteria | 49795 |
| 691 | Ga0496119_0030527 | 3300048922 | Bacteria | 3631 |
| 692 | Ga0496119_0046829 | 3300048922 | Bacteria | 2695 |
| 693 | Ga0496120_0000306 | 3300048923 | Bacteria | 81699 |
| 694 | Ga0496120_0008512 | 3300048923 | Bacteria | 7437 |
| 695 | Ga0496120_0020768 | 3300048923 | Bacteria | 4164 |
| 696 | Ga0496120_0031599 | 3300048923 | Bacteria | 3203 |
| 697 | Ga0496120_0033638 | 3300048923 | Bacteria | 3078 |
| 698 | Ga0496121_0005089 | 3300048924 | Bacteria | 17144 |
| 699 | Ga0496121_0008265 | 3300048924 | Bacteria | 12317 |
| 700 | Ga0496121_0018914 | 3300048924 | Bacteria | 6913 |
| 701 | Ga0496121_0023351 | 3300048924 | Bacteria | 5959 |
| 702 | Ga0496121_0048821 | 3300048924 | Bacteria | 3596 |
| 703 | Ga0496121_0071713 | 3300048924 | Bacteria | 2784 |
| 704 | Ga0496121_0501650 | 3300048924 | Bacteria | 770 |
| 705 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 706 | Ga0496122_0037968 | 3300048925 | Bacteria | 3867 |
| 707 | Ga0496122_0043373 | 3300048925 | Bacteria | 3525 |
| 708 | Ga0496122_0057593 | 3300048925 | Bacteria | 2884 |
| 709 | Ga0496122_0063686 | 3300048925 | Bacteria | 2688 |
| 710 | Ga0496122_0092629 | 3300048925 | Bacteria | 2053 |
| 711 | Ga0496122_0102264 | 3300048925 | Bacteria | 1911 |
| 712 | Ga0496122_0201513 | 3300048925 | Bacteria | 1163 |
| 713 | Ga0496123_0000173 | 3300048926 | Bacteria | 130586 |
| 714 | Ga0496123_0009566 | 3300048926 | Bacteria | 8711 |
| 715 | Ga0496123_0044650 | 3300048926 | Bacteria | 3028 |
| 716 | Ga0496123_0074315 | 3300048926 | Bacteria | 2104 |
| 717 | Ga0496123_0097294 | 3300048926 | Bacteria | 1725 |
| 718 | Ga0496123_0192918 | 3300048926 | Bacteria | 1052 |
| 719 | Ga0496124_0007784 | 3300048927 | Bacteria | 11315 |
| 720 | Ga0496124_0007979 | 3300048927 | Bacteria | 11142 |
| 721 | Ga0496124_0008166 | 3300048927 | Bacteria | 10983 |
| 722 | Ga0496124_0010290 | 3300048927 | Bacteria | 9492 |
| 723 | Ga0496124_0013760 | 3300048927 | Bacteria | 7874 |
| 724 | Ga0496124_0048184 | 3300048927 | Bacteria | 3643 |
| 725 | Ga0496124_0081591 | 3300048927 | Bacteria | 2657 |
| 726 | Ga0496124_0136492 | 3300048927 | Bacteria | 1941 |
| 727 | Ga0496124_0160948 | 3300048927 | Bacteria | 1749 |
| 728 | Ga0496124_0260254 | 3300048927 | Bacteria | 1277 |
| 729 | Ga0496125_0001578 | 3300048928 | Bacteria | 32443 |
| 730 | Ga0496125_0008486 | 3300048928 | Bacteria | 10751 |
| 731 | Ga0496125_0031155 | 3300048928 | Bacteria | 4757 |
| 732 | Ga0496125_0035635 | 3300048928 | Bacteria | 4359 |
| 733 | Ga0496125_0037745 | 3300048928 | Bacteria | 4196 |
| 734 | Ga0496125_0046617 | 3300048928 | Bacteria | 3635 |
| 735 | Ga0496125_0109197 | 3300048928 | Bacteria | 2009 |
| 736 | Ga0496125_0206908 | 3300048928 | Bacteria | 1278 |
| 737 | Ga0496126_0004789 | 3300048929 | Bacteria | 15903 |
| 738 | Ga0496126_0011313 | 3300048929 | Bacteria | 9256 |
| 739 | Ga0496126_0044097 | 3300048929 | Bacteria | 4110 |
| 740 | Ga0496126_0087985 | 3300048929 | Bacteria | 2737 |
| 741 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 742 | Ga0495678_002391 | 3300049459 | Bacteria | 12835 |
| 743 | Ga0495678_016115 | 3300049459 | Bacteria | 3426 |
| 744 | Ga0495678_018587 | 3300049459 | Bacteria | 3120 |
| 745 | Ga0495678_019146 | 3300049459 | Bacteria | 3061 |
| 746 | Ga0495678_038471 | 3300049459 | Bacteria | 1935 |
| 747 | Ga0495678_054293 | 3300049459 | Bacteria | 1534 |
| 748 | Ga0495678_091212 | 3300049459 | Bacteria | 1073 |
| 749 | Ga0495682_0002255 | 3300049460 | Bacteria | 9263 |
| 750 | Ga0495682_0007653 | 3300049460 | Bacteria | 4287 |
| 751 | Ga0495682_0011864 | 3300049460 | Bacteria | 3349 |
| 752 | Ga0495682_0053676 | 3300049460 | Bacteria | 1463 |
| 753 | Ga0495682_0080369 | 3300049460 | Bacteria | 1172 |
| 754 | Ga0495682_0130893 | 3300049460 | Bacteria | 897 |
| 755 | Ga0501036_0572564 | 3300049572 | Bacteria | 938 |
| 756 | Ga0501037_0118024 | 3300049573 | Bacteria | 1909 |
| 757 | Ga0501038_0050334 | 3300049574 | Bacteria | 3600 |
| 758 | Ga0501040_0075444 | 3300049576 | Unclassified | 2330 |
| 759 | Ga0501042_0027560 | 3300049578 | Bacteria | 3996 |
| 760 | Ga0501042_0131366 | 3300049578 | Unclassified | 1805 |
| 761 | Ga0501048_0042347 | 3300049582 | Bacteria | 3260 |
| 762 | Ga0501071_0114807 | 3300049587 | Bacteria | 1992 |
| 763 | Ga0501072_0164664 | 3300049588 | Bacteria | 1769 |
| 764 | Ga0501075_0010719 | 3300049591 | Bacteria | 6453 |
| 765 | Ga0501076_0086422 | 3300049592 | Unclassified | 2521 |
| 766 | Ga0501076_0294829 | 3300049592 | Unclassified | 1329 |
| 767 | Ga0501079_0032358 | 3300049741 | Bacteria | 4020 |
| 768 | Ga0501080_0149400 | 3300049742 | Bacteria | 2160 |
| 769 | Ga0501081_0573881 | 3300049743 | Unclassified | 843 |
| 770 | Ga0501241_002124 | 3300049758 | Bacteria | 3878 |
| 771 | Ga0500643_002976 | 3300053087 | Bacteria | 8393 |
| 772 | Ga0500650_0086734 | 3300053098 | Bacteria | 1465 |
| 773 | Ga0500572_004600 | 3300053111 | Bacteria | 3129 |
| 774 | Ga0500573_0002559 | 3300053140 | Bacteria | 9137 |
| 775 | Ga0500634_0002065 | 3300053161 | Bacteria | 8271 |
| 776 | Ga0501084_0072561 | 3300054114 | Unclassified | 2883 |
| 777 | Ga0501082_0406445 | 3300060353 | Bacteria | 1188 |
| 778 | Ga0501082_0461427 | 3300060353 | Unclassified | 1110 |
| 779 | Ga0530510_0050452 | 3300061734 | Unclassified | 3006 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0042347 | Ga0501048_0042347_75_755 | 225 |
| 2 | 3300060353 | Ga0501082_0461427 | Ga0501082_0461427_45_725 | 225 |
| 3 | 3300047469 | Ga0495673_0041298 | Ga0495673_0041298_1351_2055 | 234 |
| 4 | 3300048924 | Ga0496121_0501650 | Ga0496121_0501650_13_732 | 239 |
| 5 | 3300049743 | Ga0501081_0573881 | Ga0501081_0573881_100_825 | 240 |
| 6 | 3300048903 | Ga0496100_0032875 | Ga0496100_0032875_1038_1817 | 244 |
| 7 | 3300048904 | Ga0496101_0012768 | Ga0496101_0012768_3433_4212 | 244 |
| 8 | iso_pu_bacteria | 2554235234 | 2555257608 | 246 |
| 9 | iso_pu_bacteria | 2599185169 | 2599409582 | 246 |
| 10 | iso_pu_bacteria | 2600255254 | 2601521924 | 246 |
| 11 | iso_pu_bacteria | 2600255255 | 2601526949 | 246 |
| 12 | iso_pu_bacteria | 2600255280 | 2601613779 | 246 |
| 13 | iso_pu_bacteria | 2600255281 | 2601618502 | 246 |
| 14 | iso_pu_bacteria | 2600255287 | 2601642870 | 246 |
| 15 | iso_pu_bacteria | 2600255288 | 2601647741 | 246 |
| 16 | iso_pu_bacteria | 2600255289 | 2601651927 | 246 |
| 17 | iso_pu_bacteria | 2600255290 | 2601657254 | 246 |
| 18 | iso_pu_bacteria | 2600255291 | 2601662691 | 246 |
| 19 | iso_pu_bacteria | 2600255298 | 2601695648 | 246 |
| 20 | iso_pu_bacteria | 2600255299 | 2601700324 | 246 |
| 21 | iso_pu_bacteria | 2600255300 | 2601705051 | 246 |
| 22 | iso_pu_bacteria | 2600255301 | 2601710080 | 246 |
| 23 | iso_pu_bacteria | 2600255302 | 2601715092 | 246 |
| 24 | iso_pu_bacteria | 2600255303 | 2601720675 | 246 |
| 25 | iso_pu_bacteria | 2600255304 | 2601725498 | 246 |
| 26 | iso_pu_bacteria | 2600255305 | 2601730040 | 246 |
| 27 | iso_pu_bacteria | 2600255306 | 2601735057 | 246 |
| 28 | iso_pu_bacteria | 2600255307 | 2601739742 | 246 |
| 29 | iso_pu_bacteria | 2600255309 | 2601750231 | 246 |
| 30 | iso_pu_bacteria | 2600255392 | 2602017484 | 246 |
| 31 | iso_pu_bacteria | 2602042052 | 2603660065 | 246 |
| 32 | iso_pu_bacteria | 2602042053 | 2603665341 | 246 |
| 33 | iso_pu_bacteria | 2602042103 | 2603837424 | 246 |
| 34 | iso_pu_bacteria | 2602042104 | 2603842500 | 246 |
| 35 | iso_pu_bacteria | 2602042105 | 2603847573 | 246 |
| 36 | iso_pu_bacteria | 2602042106 | 2603852644 | 246 |
| 37 | iso_pu_bacteria | 2602042109 | 2603866623 | 246 |
| 38 | iso_pu_bacteria | 2602042110 | 2603870697 | 246 |
| 39 | iso_pu_bacteria | 2602042111 | 2603875632 | 246 |
| 40 | iso_pu_bacteria | 2603880178 | 2606047888 | 246 |
| 41 | iso_pu_bacteria | 2603880184 | 2606069772 | 246 |
| 42 | iso_pu_bacteria | 2603880202 | 2606145607 | 246 |
| 43 | iso_pu_bacteria | 2603880211 | 2606175290 | 246 |
| 44 | iso_pu_bacteria | 2636415599 | 2637225502 | 246 |
| 45 | iso_pu_bacteria | 2675903046 | 2676406730 | 246 |
| 46 | iso_pu_bacteria | 2775507074 | 2777022858 | 246 |
| 47 | iso_pu_bacteria | 2904513164 | 2904513638 | 246 |
| 48 | iso_pu_bacteria | 2919108558 | 2919108806 | 246 |
| 49 | iso_pu_bacteria | 2969079654 | 2969082498 | 246 |
| 50 | iso_pu_bacteria | 2971820967 | 2971823375 | 246 |
| 51 | iso_pu_bacteria | 2984559226 | 2984559556 | 246 |
| 52 | iso_pu_bacteria | 2984595703 | 2984597642 | 246 |
| 53 | iso_pu_bacteria | 8057304971 | 8057309341 | 246 |
| 54 | iso_pu_bacteria | 2939607340 | 2939609135 | 248 |
| 55 | iso_pu_bacteria | 8055087960 | 8055090523 | 248 |
| 56 | iso_pu_bacteria | 8055092621 | 8055096811 | 248 |
| 57 | iso_pu_bacteria | 8055097453 | 8055098680 | 248 |
| 58 | 3300005289 | Ga0065704_10095259 | Ga0065704_100952593 | 250 |
| 59 | 3300009011 | Ga0105251_10000021 | Ga0105251_100000214 | 250 |
| 60 | 3300009011 | Ga0105251_10000477 | Ga0105251_100004777 | 250 |
| 61 | 3300009036 | Ga0105244_10072395 | Ga0105244_100723952 | 250 |
| 62 | 3300009092 | Ga0105250_10000072 | Ga0105250_1000007253 | 250 |
| 63 | 3300025711 | Ga0207696_1000005 | Ga0207696_1000005526 | 250 |
| 64 | 3300025728 | Ga0207655_1000063 | Ga0207655_100006355 | 250 |
| 65 | 3300025728 | Ga0207655_1025566 | Ga0207655_10255662 | 250 |
| 66 | 3300025735 | Ga0207713_1000002 | Ga0207713_1000002768 | 250 |
| 67 | 3300025735 | Ga0207713_1000003 | Ga0207713_1000003216 | 250 |
| 68 | 3300027111 | Ga0209281_1004003 | Ga0209281_10040032 | 250 |
| 69 | 3300046458 | Ga0495591_002486 | Ga0495591_002486_2093_2845 | 250 |
| 70 | 3300046460 | Ga0495638_0005689 | Ga0495638_0005689_803_1555 | 250 |
| 71 | 3300046471 | Ga0495650_0004073 | Ga0495650_0004073_2972_3739 | 250 |
| 72 | 3300046515 | Ga0495620_0034269 | Ga0495620_0034269_1282_2034 | 250 |
| 73 | 3300046694 | Ga0495649_0007497 | Ga0495649_0007497_1806_2558 | 250 |
| 74 | 3300046694 | Ga0495649_0037742 | Ga0495649_0037742_47_799 | 250 |
| 75 | 3300047446 | Ga0495679_007869 | Ga0495679_007869_1003_1755 | 250 |
| 76 | 3300047446 | Ga0495679_069681 | Ga0495679_069681_135_887 | 250 |
| 77 | 3300048907 | Ga0496104_0034402 | Ga0496104_0034402_650_1417 | 250 |
| 78 | 3300048908 | Ga0496105_0092973 | Ga0496105_0092973_388_1155 | 250 |
| 79 | 3300048920 | Ga0496117_0008857 | Ga0496117_0008857_2755_3522 | 250 |
| 80 | 3300048921 | Ga0496118_0016084 | Ga0496118_0016084_208_975 | 250 |
| 81 | 3300048922 | Ga0496119_0000570 | Ga0496119_0000570_38745_39512 | 250 |
| 82 | 3300048923 | Ga0496120_0008512 | Ga0496120_0008512_344_1111 | 250 |
| 83 | 3300048925 | Ga0496122_0102264 | Ga0496122_0102264_326_1093 | 250 |
| 84 | 3300048926 | Ga0496123_0192918 | Ga0496123_0192918_272_1039 | 250 |
| 85 | 3300048927 | Ga0496124_0010290 | Ga0496124_0010290_3340_4113 | 250 |
| 86 | 3300048927 | Ga0496124_0048184 | Ga0496124_0048184_1295_2062 | 250 |
| 87 | 3300048928 | Ga0496125_0046617 | Ga0496125_0046617_2148_2915 | 250 |
| 88 | 3300048929 | Ga0496126_0044097 | Ga0496126_0044097_2483_3250 | 250 |
| 89 | 3300041405 | Ga0439438_000786 | Ga0439438_000786_1973_2740 | 252 |
| 90 | 3300003322 | rootL2_10085104 | rootL2_100851042 | 253 |
| 91 | iso_pu_bacteria | 2643221638 | 2644213542 | 255 |
| 92 | iso_pu_bacteria | 2524023250 | 2524613639 | 256 |
| 93 | 3300046453 | Ga0495627_000010 | Ga0495627_000010_252434_253207 | 257 |
| 94 | 3300053140 | Ga0500573_0002559 | Ga0500573_0002559_7158_7931 | 257 |
| 95 | 3300013100 | Ga0157373_10312720 | Ga0157373_103127201 | 258 |
| 96 | 3300053087 | Ga0500643_002976 | Ga0500643_002976_2844_3623 | 258 |
| 97 | iso_pu_bacteria | 2511231023 | 2511368196 | 258 |
| 98 | iso_pu_bacteria | 2511231031 | 2511414973 | 258 |
| 99 | iso_pu_bacteria | 2599185307 | 2599973206 | 258 |
| 100 | iso_pu_bacteria | 2600255283 | 2601625800 | 258 |
| 101 | iso_pu_bacteria | 2718217725 | 2718632994 | 258 |
| 102 | iso_pu_bacteria | 2738543025 | 2739313069 | 258 |
| 103 | iso_pu_bacteria | 2808606379 | 2808942732 | 258 |
| 104 | iso_pu_bacteria | 2919155634 | 2919157028 | 258 |
| 105 | iso_pu_bacteria | 2919501602 | 2919506349 | 258 |
| 106 | iso_pu_bacteria | 2926063275 | 2926067419 | 258 |
| 107 | iso_pu_bacteria | 3007614139 | 3007614924 | 258 |
| 108 | iso_pu_bacteria | 640427133 | 640487214 | 258 |
| 109 | iso_pu_bacteria | 651053060 | 651175091 | 258 |
| 110 | 3300027876 | Ga0209974_10028508 | Ga0209974_100285083 | 259 |
| 111 | 3300049573 | Ga0501037_0118024 | Ga0501037_0118024_239_1021 | 259 |
| 112 | iso_pu_bacteria | 2511231010 | 2511291803 | 259 |
| 113 | iso_pu_bacteria | 2511231011 | 2511294913 | 259 |
| 114 | iso_pu_bacteria | 2511231012 | 2511302974 | 259 |
| 115 | iso_pu_bacteria | 2511231017 | 2511330554 | 259 |
| 116 | iso_pu_bacteria | 2511231156 | 2511823334 | 259 |
| 117 | iso_pu_bacteria | 2512047018 | 2512326399 | 259 |
| 118 | iso_pu_bacteria | 2582580891 | 2583790717 | 259 |
| 119 | iso_pu_bacteria | 2599185167 | 2599396774 | 259 |
| 120 | iso_pu_bacteria | 2599185179 | 2599448752 | 259 |
| 121 | iso_pu_bacteria | 2599185190 | 2599511489 | 259 |
| 122 | iso_pu_bacteria | 2599185191 | 2599517571 | 259 |
| 123 | iso_pu_bacteria | 2599185257 | 2599805129 | 259 |
| 124 | iso_pu_bacteria | 2599185288 | 2599879939 | 259 |
| 125 | iso_pu_bacteria | 2599185290 | 2599890863 | 259 |
| 126 | iso_pu_bacteria | 2599185302 | 2599946134 | 259 |
| 127 | iso_pu_bacteria | 2599185303 | 2599948446 | 259 |
| 128 | iso_pu_bacteria | 2599185304 | 2599957273 | 259 |
| 129 | iso_pu_bacteria | 2599185306 | 2599965536 | 259 |
| 130 | iso_pu_bacteria | 2599185308 | 2599980073 | 259 |
| 131 | iso_pu_bacteria | 2599185309 | 2599986180 | 259 |
| 132 | iso_pu_bacteria | 2599185310 | 2599991947 | 259 |
| 133 | iso_pu_bacteria | 2599185312 | 2600003024 | 259 |
| 134 | iso_pu_bacteria | 2599185314 | 2600013985 | 259 |
| 135 | iso_pu_bacteria | 2599185320 | 2600050476 | 259 |
| 136 | iso_pu_bacteria | 2600254931 | 2600363839 | 259 |
| 137 | iso_pu_bacteria | 2600255318 | 2601799819 | 259 |
| 138 | iso_pu_bacteria | 2603880185 | 2606074382 | 259 |
| 139 | iso_pu_bacteria | 2603880199 | 2606127245 | 259 |
| 140 | iso_pu_bacteria | 2619619299 | 2621301239 | 259 |
| 141 | iso_pu_bacteria | 2623620443 | 2624479105 | 259 |
| 142 | iso_pu_bacteria | 2643221650 | 2644283489 | 259 |
| 143 | iso_pu_bacteria | 2671180172 | 2671768137 | 259 |
| 144 | iso_pu_bacteria | 2675903515 | 2678261883 | 259 |
| 145 | iso_pu_bacteria | 2713897149 | 2715758826 | 259 |
| 146 | iso_pu_bacteria | 2738541265 | 2738673992 | 259 |
| 147 | iso_pu_bacteria | 2738541282 | 2738752385 | 259 |
| 148 | iso_pu_bacteria | 2738541294 | 2738809405 | 259 |
| 149 | iso_pu_bacteria | 2738541303 | 2738861426 | 259 |
| 150 | iso_pu_bacteria | 2738541309 | 2738896765 | 259 |
| 151 | iso_pu_bacteria | 2740892503 | 2743735933 | 259 |
| 152 | iso_pu_bacteria | 2744054620 | 2745008232 | 259 |
| 153 | iso_pu_bacteria | 2773857670 | 2774121484 | 259 |
| 154 | iso_pu_bacteria | 2784132063 | 2784260177 | 259 |
| 155 | iso_pu_bacteria | 2784132072 | 2784315628 | 259 |
| 156 | iso_pu_bacteria | 2791355520 | 2794594698 | 259 |
| 157 | iso_pu_bacteria | 2808606361 | 2808856746 | 259 |
| 158 | iso_pu_bacteria | 2808606373 | 2808907739 | 259 |
| 159 | iso_pu_bacteria | 2808606376 | 2808926927 | 259 |
| 160 | iso_pu_bacteria | 2808606377 | 2808929359 | 259 |
| 161 | iso_pu_bacteria | 2808606378 | 2808936805 | 259 |
| 162 | iso_pu_bacteria | 2808606380 | 2808945968 | 259 |
| 163 | iso_pu_bacteria | 2808606381 | 2808951533 | 259 |
| 164 | iso_pu_bacteria | 2808606382 | 2808960878 | 259 |
| 165 | iso_pu_bacteria | 2808606383 | 2808965133 | 259 |
| 166 | iso_pu_bacteria | 2808606389 | 2809000025 | 259 |
| 167 | iso_pu_bacteria | 2816332298 | 2817489399 | 259 |
| 168 | iso_pu_bacteria | 2818991456 | 2819654667 | 259 |
| 169 | iso_pu_bacteria | 2825651385 | 2825653392 | 259 |
| 170 | iso_pu_bacteria | 2834028612 | 2834029311 | 259 |
| 171 | iso_pu_bacteria | 2842832357 | 2842833066 | 259 |
| 172 | iso_pu_bacteria | 2842854478 | 2842856952 | 259 |
| 173 | iso_pu_bacteria | 2860339153 | 2860340387 | 259 |
| 174 | iso_pu_bacteria | 2860867994 | 2860869355 | 259 |
| 175 | iso_pu_bacteria | 2878029506 | 2878031063 | 259 |
| 176 | iso_pu_bacteria | 2880230671 | 2880231977 | 259 |
| 177 | iso_pu_bacteria | 2913036834 | 2913038229 | 259 |
| 178 | iso_pu_bacteria | 2919063839 | 2919064422 | 259 |
| 179 | iso_pu_bacteria | 2919385768 | 2919386103 | 259 |
| 180 | iso_pu_bacteria | 2919456309 | 2919458045 | 259 |
| 181 | iso_pu_bacteria | 2923153595 | 2923154943 | 259 |
| 182 | iso_pu_bacteria | 2929144301 | 2929145676 | 259 |
| 183 | iso_pu_bacteria | 2931369376 | 2931370992 | 259 |
| 184 | iso_pu_bacteria | 2931390751 | 2931392330 | 259 |
| 185 | iso_pu_bacteria | 2931396565 | 2931399708 | 259 |
| 186 | iso_pu_bacteria | 2945961074 | 2945961582 | 259 |
| 187 | iso_pu_bacteria | 2946006987 | 2946011513 | 259 |
| 188 | iso_pu_bacteria | 2946027586 | 2946029549 | 259 |
| 189 | iso_pu_bacteria | 2969304461 | 2969305888 | 259 |
| 190 | iso_pu_bacteria | 2974289157 | 2974292497 | 259 |
| 191 | iso_pu_bacteria | 2984286254 | 2984291088 | 259 |
| 192 | iso_pu_bacteria | 2988728565 | 2988733218 | 259 |
| 193 | iso_pu_bacteria | 2998139840 | 2998141310 | 259 |
| 194 | iso_pu_bacteria | 3007395558 | 3007400461 | 259 |
| 195 | iso_pu_bacteria | 3007619802 | 3007622039 | 259 |
| 196 | iso_pu_bacteria | 3007718800 | 3007722961 | 259 |
| 197 | iso_pu_bacteria | 3007855910 | 3007855921 | 259 |
| 198 | iso_pu_bacteria | 3007861166 | 3007863454 | 259 |
| 199 | iso_pu_bacteria | 8015687852 | 8015689175 | 259 |
| 200 | iso_pu_bacteria | 8029995093 | 8029999436 | 259 |
| 201 | iso_pu_bacteria | 8054285046 | 8054288823 | 259 |
| 202 | iso_pu_bacteria | 8054503363 | 8054504893 | 259 |
| 203 | iso_pu_bacteria | 8055817908 | 8055819353 | 259 |
| 204 | iso_pu_bacteria | 8056131705 | 8056133260 | 259 |
| 205 | iso_pu_bacteria | 8056143049 | 8056147603 | 259 |
| 206 | iso_pu_bacteria | 8056166840 | 8056169746 | 259 |
| 207 | iso_pu_bacteria | 8056569372 | 8056569973 | 259 |
| 208 | 3300003771 | Ga0055526_1010871 | Ga0055526_10108714 | 260 |
| 209 | 3300005329 | Ga0070683_100000933 | Ga0070683_10000093311 | 260 |
| 210 | 3300005434 | Ga0070709_10005206 | Ga0070709_1000520611 | 260 |
| 211 | 3300009101 | Ga0105247_10051921 | Ga0105247_100519212 | 260 |
| 212 | 3300025295 | Ga0209564_1001361 | Ga0209564_100136113 | 260 |
| 213 | 3300025900 | Ga0207710_10141532 | Ga0207710_101415322 | 260 |
| 214 | 3300025906 | Ga0207699_10028489 | Ga0207699_100284893 | 260 |
| 215 | 3300049572 | Ga0501036_0572564 | Ga0501036_0572564_10_819 | 260 |
| 216 | 3300049574 | Ga0501038_0050334 | Ga0501038_0050334_35_820 | 260 |
| 217 | 3300049576 | Ga0501040_0075444 | Ga0501040_0075444_560_1369 | 260 |
| 218 | 3300049578 | Ga0501042_0027560 | Ga0501042_0027560_299_1108 | 260 |
| 219 | 3300049578 | Ga0501042_0131366 | Ga0501042_0131366_12_797 | 260 |
| 220 | 3300049587 | Ga0501071_0114807 | Ga0501071_0114807_1073_1858 | 260 |
| 221 | 3300049588 | Ga0501072_0164664 | Ga0501072_0164664_454_1239 | 260 |
| 222 | 3300049591 | Ga0501075_0010719 | Ga0501075_0010719_2938_3747 | 260 |
| 223 | 3300049592 | Ga0501076_0086422 | Ga0501076_0086422_671_1480 | 260 |
| 224 | 3300049592 | Ga0501076_0294829 | Ga0501076_0294829_389_1174 | 260 |
| 225 | 3300049741 | Ga0501079_0032358 | Ga0501079_0032358_688_1497 | 260 |
| 226 | 3300049742 | Ga0501080_0149400 | Ga0501080_0149400_1337_2146 | 260 |
| 227 | 3300054114 | Ga0501084_0072561 | Ga0501084_0072561_1388_2197 | 260 |
| 228 | 3300060353 | Ga0501082_0406445 | Ga0501082_0406445_253_1062 | 260 |
| 229 | 3300061734 | Ga0530510_0050452 | Ga0530510_0050452_1244_2053 | 260 |
| 230 | 3300046458 | Ga0495591_000452 | Ga0495591_000452_28228_29013 | 261 |
| 231 | 3300046507 | Ga0495606_0001543 | Ga0495606_0001543_837_1622 | 261 |
| 232 | 3300046616 | Ga0495668_0008255 | Ga0495668_0008255_524_1309 | 261 |
| 233 | 3300047469 | Ga0495673_0008502 | Ga0495673_0008502_4660_5445 | 261 |
| 234 | 3300048905 | Ga0496102_0622638 | Ga0496102_0622638_32_817 | 261 |
| 235 | 3300048913 | Ga0496110_0322043 | Ga0496110_0322043_132_917 | 261 |
| 236 | 3300048927 | Ga0496124_0136492 | Ga0496124_0136492_661_1446 | 261 |
| 237 | 3300005289 | Ga0065704_10142008 | Ga0065704_101420082 | 262 |
| 238 | 3300009036 | Ga0105244_10041414 | Ga0105244_100414142 | 262 |
| 239 | 3300009036 | Ga0105244_10093887 | Ga0105244_100938872 | 262 |
| 240 | 3300012498 | Ga0157345_1000135 | Ga0157345_10001357 | 262 |
| 241 | 3300013307 | Ga0157372_10004247 | Ga0157372_100042472 | 262 |
| 242 | 3300017792 | Ga0163161_10002537 | Ga0163161_100025375 | 262 |
| 243 | 3300025728 | Ga0207655_1074812 | Ga0207655_10748122 | 262 |
| 244 | 3300025735 | Ga0207713_1000104 | Ga0207713_100010479 | 262 |
| 245 | 3300027378 | Ga0209981_1004989 | Ga0209981_10049892 | 262 |
| 246 | 3300027395 | Ga0209996_1001558 | Ga0209996_10015582 | 262 |
| 247 | 3300027526 | Ga0209968_1006918 | Ga0209968_10069182 | 262 |
| 248 | 3300027665 | Ga0209983_1001292 | Ga0209983_10012927 | 262 |
| 249 | 3300031911 | Ga0307412_10021104 | Ga0307412_100211043 | 262 |
| 250 | 3300033180 | Ga0307510_10107259 | Ga0307510_101072592 | 262 |
| 251 | 3300041411 | Ga0439466_0008863 | Ga0439466_0008863_1220_2008 | 262 |
| 252 | 3300046452 | Ga0495617_007892 | Ga0495617_007892_1479_2267 | 262 |
| 253 | 3300046453 | Ga0495627_005495 | Ga0495627_005495_2492_3280 | 262 |
| 254 | 3300046458 | Ga0495591_000002 | Ga0495591_000002_168832_169620 | 262 |
| 255 | 3300046458 | Ga0495591_001442 | Ga0495591_001442_3355_4143 | 262 |
| 256 | 3300046458 | Ga0495591_002525 | Ga0495591_002525_6139_6927 | 262 |
| 257 | 3300046458 | Ga0495591_004698 | Ga0495591_004698_125_913 | 262 |
| 258 | 3300046458 | Ga0495591_007825 | Ga0495591_007825_125_913 | 262 |
| 259 | 3300046458 | Ga0495591_008402 | Ga0495591_008402_1913_2701 | 262 |
| 260 | 3300046458 | Ga0495591_013459 | Ga0495591_013459_521_1333 | 262 |
| 261 | 3300046460 | Ga0495638_0007812 | Ga0495638_0007812_4997_5785 | 262 |
| 262 | 3300046460 | Ga0495638_0032131 | Ga0495638_0032131_2271_3059 | 262 |
| 263 | 3300046463 | Ga0495653_0015282 | Ga0495653_0015282_284_1072 | 262 |
| 264 | 3300046471 | Ga0495650_0019471 | Ga0495650_0019471_686_1474 | 262 |
| 265 | 3300046471 | Ga0495650_0032847 | Ga0495650_0032847_127_915 | 262 |
| 266 | 3300046471 | Ga0495650_0049992 | Ga0495650_0049992_931_1719 | 262 |
| 267 | 3300046471 | Ga0495650_0056126 | Ga0495650_0056126_194_982 | 262 |
| 268 | 3300046474 | Ga0495605_0005553 | Ga0495605_0005553_6438_7301 | 262 |
| 269 | 3300046474 | Ga0495605_0010655 | Ga0495605_0010655_2497_3285 | 262 |
| 270 | 3300046474 | Ga0495605_0022243 | Ga0495605_0022243_1905_2732 | 262 |
| 271 | 3300046491 | Ga0495584_0017755 | Ga0495584_0017755_1365_2153 | 262 |
| 272 | 3300046491 | Ga0495584_0022206 | Ga0495584_0022206_1889_2677 | 262 |
| 273 | 3300046491 | Ga0495584_0067622 | Ga0495584_0067622_84_872 | 262 |
| 274 | 3300046492 | Ga0495585_0007924 | Ga0495585_0007924_3557_4345 | 262 |
| 275 | 3300046492 | Ga0495585_0076259 | Ga0495585_0076259_881_1669 | 262 |
| 276 | 3300046501 | Ga0495607_0000025 | Ga0495607_0000025_139687_140475 | 262 |
| 277 | 3300046501 | Ga0495607_0000723 | Ga0495607_0000723_5085_5873 | 262 |
| 278 | 3300046501 | Ga0495607_0009730 | Ga0495607_0009730_2192_2980 | 262 |
| 279 | 3300046501 | Ga0495607_0063469 | Ga0495607_0063469_414_1202 | 262 |
| 280 | 3300046506 | Ga0495583_0001907 | Ga0495583_0001907_12251_13078 | 262 |
| 281 | 3300046506 | Ga0495583_0008510 | Ga0495583_0008510_389_1177 | 262 |
| 282 | 3300046506 | Ga0495583_0029479 | Ga0495583_0029479_84_872 | 262 |
| 283 | 3300046507 | Ga0495606_0000055 | Ga0495606_0000055_117709_118536 | 262 |
| 284 | 3300046507 | Ga0495606_0016397 | Ga0495606_0016397_2335_3123 | 262 |
| 285 | 3300046507 | Ga0495606_0020935 | Ga0495606_0020935_1816_2604 | 262 |
| 286 | 3300046507 | Ga0495606_0031545 | Ga0495606_0031545_1145_1933 | 262 |
| 287 | 3300046507 | Ga0495606_0101267 | Ga0495606_0101267_59_847 | 262 |
| 288 | 3300046507 | Ga0495606_0227933 | Ga0495606_0227933_134_922 | 262 |
| 289 | 3300046512 | Ga0495610_0008798 | Ga0495610_0008798_2890_3678 | 262 |
| 290 | 3300046512 | Ga0495610_0010140 | Ga0495610_0010140_3511_4299 | 262 |
| 291 | 3300046512 | Ga0495610_0016078 | Ga0495610_0016078_967_1794 | 262 |
| 292 | 3300046512 | Ga0495610_0049979 | Ga0495610_0049979_1081_1869 | 262 |
| 293 | 3300046513 | Ga0495616_0009252 | Ga0495616_0009252_3800_4588 | 262 |
| 294 | 3300046513 | Ga0495616_0012317 | Ga0495616_0012317_1840_2628 | 262 |
| 295 | 3300046513 | Ga0495616_0025253 | Ga0495616_0025253_2033_2860 | 262 |
| 296 | 3300046515 | Ga0495620_0001753 | Ga0495620_0001753_4079_4867 | 262 |
| 297 | 3300046515 | Ga0495620_0002591 | Ga0495620_0002591_3475_4263 | 262 |
| 298 | 3300046515 | Ga0495620_0007857 | Ga0495620_0007857_4460_5248 | 262 |
| 299 | 3300046515 | Ga0495620_0008194 | Ga0495620_0008194_3258_4046 | 262 |
| 300 | 3300046515 | Ga0495620_0022198 | Ga0495620_0022198_1315_2103 | 262 |
| 301 | 3300046515 | Ga0495620_0031288 | Ga0495620_0031288_241_1029 | 262 |
| 302 | 3300046518 | Ga0495631_0003291 | Ga0495631_0003291_5898_6686 | 262 |
| 303 | 3300046518 | Ga0495631_0023185 | Ga0495631_0023185_185_1012 | 262 |
| 304 | 3300046518 | Ga0495631_0090514 | Ga0495631_0090514_32_820 | 262 |
| 305 | 3300046519 | Ga0495632_0013714 | Ga0495632_0013714_2782_3570 | 262 |
| 306 | 3300046520 | Ga0495637_0000414 | Ga0495637_0000414_26406_27194 | 262 |
| 307 | 3300046520 | Ga0495637_0002290 | Ga0495637_0002290_3643_4431 | 262 |
| 308 | 3300046520 | Ga0495637_0014643 | Ga0495637_0014643_1500_2288 | 262 |
| 309 | 3300046522 | Ga0495643_0006744 | Ga0495643_0006744_6304_7092 | 262 |
| 310 | 3300046522 | Ga0495643_0186716 | Ga0495643_0186716_28_816 | 262 |
| 311 | 3300046523 | Ga0495644_0001339 | Ga0495644_0001339_3976_4803 | 262 |
| 312 | 3300046523 | Ga0495644_0011222 | Ga0495644_0011222_1374_2162 | 262 |
| 313 | 3300046524 | Ga0495648_0006635 | Ga0495648_0006635_4480_5268 | 262 |
| 314 | 3300046524 | Ga0495648_0007214 | Ga0495648_0007214_5838_6626 | 262 |
| 315 | 3300046524 | Ga0495648_0013042 | Ga0495648_0013042_3505_4293 | 262 |
| 316 | 3300046524 | Ga0495648_0016559 | Ga0495648_0016559_2314_3102 | 262 |
| 317 | 3300046524 | Ga0495648_0024568 | Ga0495648_0024568_1550_2338 | 262 |
| 318 | 3300046530 | Ga0495654_0000673 | Ga0495654_0000673_20086_20913 | 262 |
| 319 | 3300046530 | Ga0495654_0027278 | Ga0495654_0027278_2089_2877 | 262 |
| 320 | 3300046530 | Ga0495654_0037975 | Ga0495654_0037975_53_841 | 262 |
| 321 | 3300046530 | Ga0495654_0128589 | Ga0495654_0128589_292_1080 | 262 |
| 322 | 3300046538 | Ga0495609_0000066 | Ga0495609_0000066_100028_100855 | 262 |
| 323 | 3300046538 | Ga0495609_0018559 | Ga0495609_0018559_2016_2804 | 262 |
| 324 | 3300046542 | Ga0495597_0000011 | Ga0495597_0000011_201414_202202 | 262 |
| 325 | 3300046542 | Ga0495597_0008888 | Ga0495597_0008888_1878_2666 | 262 |
| 326 | 3300046557 | Ga0495622_0002561 | Ga0495622_0002561_5385_6173 | 262 |
| 327 | 3300046557 | Ga0495622_0008562 | Ga0495622_0008562_658_1485 | 262 |
| 328 | 3300046616 | Ga0495668_0185858 | Ga0495668_0185858_64_852 | 262 |
| 329 | 3300046648 | Ga0495611_0000416 | Ga0495611_0000416_9868_10656 | 262 |
| 330 | 3300046648 | Ga0495611_0002365 | Ga0495611_0002365_3709_4497 | 262 |
| 331 | 3300046648 | Ga0495611_0003356 | Ga0495611_0003356_4718_5506 | 262 |
| 332 | 3300046660 | Ga0495625_0000055 | Ga0495625_0000055_102390_103178 | 262 |
| 333 | 3300046660 | Ga0495625_0020483 | Ga0495625_0020483_1720_2508 | 262 |
| 334 | 3300046665 | Ga0495661_0000105 | Ga0495661_0000105_143_970 | 262 |
| 335 | 3300046665 | Ga0495661_0000139 | Ga0495661_0000139_86_874 | 262 |
| 336 | 3300046665 | Ga0495661_0025126 | Ga0495661_0025126_1094_1882 | 262 |
| 337 | 3300046665 | Ga0495661_0034528 | Ga0495661_0034528_2233_3021 | 262 |
| 338 | 3300046680 | Ga0495646_0098588 | Ga0495646_0098588_607_1395 | 262 |
| 339 | 3300046689 | Ga0495613_0061840 | Ga0495613_0061840_1886_2674 | 262 |
| 340 | 3300046690 | Ga0495624_0007174 | Ga0495624_0007174_5138_5926 | 262 |
| 341 | 3300046692 | Ga0495671_0000516 | Ga0495671_0000516_28683_29471 | 262 |
| 342 | 3300046692 | Ga0495671_0022087 | Ga0495671_0022087_309_1097 | 262 |
| 343 | 3300046692 | Ga0495671_0033881 | Ga0495671_0033881_806_1594 | 262 |
| 344 | 3300046692 | Ga0495671_0039276 | Ga0495671_0039276_60_848 | 262 |
| 345 | 3300046694 | Ga0495649_0013971 | Ga0495649_0013971_1848_2636 | 262 |
| 346 | 3300046694 | Ga0495649_0052219 | Ga0495649_0052219_1229_2017 | 262 |
| 347 | 3300046794 | Ga0495589_0000411 | Ga0495589_0000411_18242_19030 | 262 |
| 348 | 3300046809 | Ga0495600_0016472 | Ga0495600_0016472_1852_2640 | 262 |
| 349 | 3300046810 | Ga0495660_0000142 | Ga0495660_0000142_24108_24971 | 262 |
| 350 | 3300046810 | Ga0495660_0001119 | Ga0495660_0001119_10071_10859 | 262 |
| 351 | 3300046810 | Ga0495660_0007548 | Ga0495660_0007548_3685_4473 | 262 |
| 352 | 3300046810 | Ga0495660_0054092 | Ga0495660_0054092_230_1018 | 262 |
| 353 | 3300046810 | Ga0495660_0073726 | Ga0495660_0073726_931_1719 | 262 |
| 354 | 3300046810 | Ga0495660_0093750 | Ga0495660_0093750_168_956 | 262 |
| 355 | 3300046810 | Ga0495660_0170688 | Ga0495660_0170688_186_1013 | 262 |
| 356 | 3300047317 | Ga0495604_0331762 | Ga0495604_0331762_199_987 | 262 |
| 357 | 3300047320 | Ga0495672_0007887 | Ga0495672_0007887_5227_6015 | 262 |
| 358 | 3300047320 | Ga0495672_0029531 | Ga0495672_0029531_145_933 | 262 |
| 359 | 3300047320 | Ga0495672_0036108 | Ga0495672_0036108_53_841 | 262 |
| 360 | 3300047320 | Ga0495672_0059273 | Ga0495672_0059273_1280_2068 | 262 |
| 361 | 3300047320 | Ga0495672_0110292 | Ga0495672_0110292_298_1086 | 262 |
| 362 | 3300047321 | Ga0495676_0000013 | Ga0495676_0000013_103259_104086 | 262 |
| 363 | 3300047321 | Ga0495676_0079116 | Ga0495676_0079116_107_895 | 262 |
| 364 | 3300047322 | Ga0495680_0052857 | Ga0495680_0052857_735_1523 | 262 |
| 365 | 3300047323 | Ga0495683_0005515 | Ga0495683_0005515_2975_3802 | 262 |
| 366 | 3300047323 | Ga0495683_0019268 | Ga0495683_0019268_2474_3262 | 262 |
| 367 | 3300047446 | Ga0495679_000129 | Ga0495679_000129_24495_25322 | 262 |
| 368 | 3300047446 | Ga0495679_004672 | Ga0495679_004672_3542_4330 | 262 |
| 369 | 3300047446 | Ga0495679_009193 | Ga0495679_009193_1566_2354 | 262 |
| 370 | 3300047469 | Ga0495673_0000510 | Ga0495673_0000510_15322_16110 | 262 |
| 371 | 3300047469 | Ga0495673_0000641 | Ga0495673_0000641_11289_12077 | 262 |
| 372 | 3300047469 | Ga0495673_0001049 | Ga0495673_0001049_20562_21368 | 262 |
| 373 | 3300047469 | Ga0495673_0009496 | Ga0495673_0009496_3583_4371 | 262 |
| 374 | 3300047469 | Ga0495673_0013311 | Ga0495673_0013311_2794_3582 | 262 |
| 375 | 3300047469 | Ga0495673_0013457 | Ga0495673_0013457_37_825 | 262 |
| 376 | 3300047469 | Ga0495673_0014564 | Ga0495673_0014564_1880_2668 | 262 |
| 377 | 3300047469 | Ga0495673_0014875 | Ga0495673_0014875_3209_3997 | 262 |
| 378 | 3300047469 | Ga0495673_0039748 | Ga0495673_0039748_1171_1959 | 262 |
| 379 | 3300047470 | Ga0495681_0005721 | Ga0495681_0005721_4168_4956 | 262 |
| 380 | 3300047470 | Ga0495681_0015381 | Ga0495681_0015381_415_1203 | 262 |
| 381 | 3300047471 | Ga0495684_0022241 | Ga0495684_0022241_3690_4478 | 262 |
| 382 | 3300047472 | Ga0495686_0017332 | Ga0495686_0017332_2119_2907 | 262 |
| 383 | 3300047472 | Ga0495686_0021878 | Ga0495686_0021878_2013_2801 | 262 |
| 384 | 3300047472 | Ga0495686_0031136 | Ga0495686_0031136_2433_3221 | 262 |
| 385 | 3300047472 | Ga0495686_0040447 | Ga0495686_0040447_2048_2836 | 262 |
| 386 | 3300048088 | Ga0495602_0015548 | Ga0495602_0015548_5092_5880 | 262 |
| 387 | 3300048091 | Ga0495626_0000056 | Ga0495626_0000056_40993_41820 | 262 |
| 388 | 3300048091 | Ga0495626_0010537 | Ga0495626_0010537_2016_2804 | 262 |
| 389 | 3300048905 | Ga0496102_0275671 | Ga0496102_0275671_154_942 | 262 |
| 390 | 3300048906 | Ga0496103_0140729 | Ga0496103_0140729_265_1053 | 262 |
| 391 | 3300048914 | Ga0496111_0327545 | Ga0496111_0327545_212_1000 | 262 |
| 392 | 3300048919 | Ga0496116_0088988 | Ga0496116_0088988_801_1589 | 262 |
| 393 | 3300048921 | Ga0496118_0170014 | Ga0496118_0170014_454_1242 | 262 |
| 394 | 3300048922 | Ga0496119_0000011 | Ga0496119_0000011_42352_43140 | 262 |
| 395 | 3300048923 | Ga0496120_0000306 | Ga0496120_0000306_21122_21910 | 262 |
| 396 | 3300048924 | Ga0496121_0005089 | Ga0496121_0005089_9664_10452 | 262 |
| 397 | 3300048924 | Ga0496121_0008265 | Ga0496121_0008265_5235_6023 | 262 |
| 398 | 3300048925 | Ga0496122_0000122 | Ga0496122_0000122_99713_100501 | 262 |
| 399 | 3300048925 | Ga0496122_0092629 | Ga0496122_0092629_71_859 | 262 |
| 400 | 3300048926 | Ga0496123_0000173 | Ga0496123_0000173_71194_71982 | 262 |
| 401 | 3300048926 | Ga0496123_0074315 | Ga0496123_0074315_1192_1980 | 262 |
| 402 | 3300048927 | Ga0496124_0007784 | Ga0496124_0007784_906_1694 | 262 |
| 403 | 3300049459 | Ga0495678_000031 | Ga0495678_000031_162704_163492 | 262 |
| 404 | 3300049459 | Ga0495678_016115 | Ga0495678_016115_1332_2120 | 262 |
| 405 | 3300049459 | Ga0495678_018587 | Ga0495678_018587_2251_3039 | 262 |
| 406 | 3300049459 | Ga0495678_019146 | Ga0495678_019146_1257_2045 | 262 |
| 407 | 3300049459 | Ga0495678_038471 | Ga0495678_038471_315_1103 | 262 |
| 408 | 3300049460 | Ga0495682_0002255 | Ga0495682_0002255_288_1076 | 262 |
| 409 | 3300049460 | Ga0495682_0007653 | Ga0495682_0007653_1299_2087 | 262 |
| 410 | 3300053098 | Ga0500650_0086734 | Ga0500650_0086734_132_950 | 262 |
| 411 | 3300053111 | Ga0500572_004600 | Ga0500572_004600_1862_2650 | 262 |
| 412 | 2162886007 | SwRhRL2b_contig_2696906 | SwRhRL2b_0502.00007160 | 263 |
| 413 | 3300002771 | JGI25163J39215_1000348 | JGI25163J39215_10003488 | 263 |
| 414 | 3300002772 | JGI25164J39214_1000492 | JGI25164J39214_10004928 | 263 |
| 415 | 3300003214 | JGI25165J46597_1000934 | JGI25165J46597_10009349 | 263 |
| 416 | 3300003781 | Ga0055536_1000043 | Ga0055536_1000043108 | 263 |
| 417 | 3300003781 | Ga0055536_1001093 | Ga0055536_10010935 | 263 |
| 418 | 3300003791 | Ga0055530_10000031 | Ga0055530_1000003113 | 263 |
| 419 | 3300003791 | Ga0055530_10000527 | Ga0055530_1000052724 | 263 |
| 420 | 3300003792 | Ga0055540_1000161 | Ga0055540_100016155 | 263 |
| 421 | 3300003792 | Ga0055540_1000230 | Ga0055540_100023018 | 263 |
| 422 | 3300003792 | Ga0055540_1001131 | Ga0055540_100113118 | 263 |
| 423 | 3300003794 | Ga0055531_10001267 | Ga0055531_100012676 | 263 |
| 424 | 3300005288 | Ga0065714_10065072 | Ga0065714_100650726 | 263 |
| 425 | 3300005288 | Ga0065714_10069444 | Ga0065714_100694442 | 263 |
| 426 | 3300005288 | Ga0065714_10070935 | Ga0065714_100709352 | 263 |
| 427 | 3300005288 | Ga0065714_10073836 | Ga0065714_100738363 | 263 |
| 428 | 3300005289 | Ga0065704_10001387 | Ga0065704_1000138713 | 263 |
| 429 | 3300005331 | Ga0070670_100001105 | Ga0070670_1000011058 | 263 |
| 430 | 3300005331 | Ga0070670_100009361 | Ga0070670_1000093619 | 263 |
| 431 | 3300005344 | Ga0070661_100000238 | Ga0070661_10000023813 | 263 |
| 432 | 3300005353 | Ga0070669_100000150 | Ga0070669_10000015039 | 263 |
| 433 | 3300005539 | Ga0068853_100005654 | Ga0068853_1000056547 | 263 |
| 434 | 3300005548 | Ga0070665_100251663 | Ga0070665_1002516632 | 263 |
| 435 | 3300005564 | Ga0070664_100000233 | Ga0070664_10000023328 | 263 |
| 436 | 3300005578 | Ga0068854_100008578 | Ga0068854_1000085786 | 263 |
| 437 | 3300005834 | Ga0068851_10000019 | Ga0068851_10000019115 | 263 |
| 438 | 3300006051 | Ga0075364_10294879 | Ga0075364_102948791 | 263 |
| 439 | 3300006946 | Ga0079104_1028293 | Ga0079104_10282932 | 263 |
| 440 | 3300009011 | Ga0105251_10003438 | Ga0105251_100034387 | 263 |
| 441 | 3300009011 | Ga0105251_10003475 | Ga0105251_100034751 | 263 |
| 442 | 3300009011 | Ga0105251_10009892 | Ga0105251_100098922 | 263 |
| 443 | 3300009011 | Ga0105251_10017479 | Ga0105251_100174794 | 263 |
| 444 | 3300009036 | Ga0105244_10004276 | Ga0105244_100042763 | 263 |
| 445 | 3300009036 | Ga0105244_10004598 | Ga0105244_100045987 | 263 |
| 446 | 3300009036 | Ga0105244_10010896 | Ga0105244_100108966 | 263 |
| 447 | 3300009036 | Ga0105244_10026476 | Ga0105244_100264764 | 263 |
| 448 | 3300009092 | Ga0105250_10000118 | Ga0105250_1000011820 | 263 |
| 449 | 3300009092 | Ga0105250_10002765 | Ga0105250_100027653 | 263 |
| 450 | 3300009092 | Ga0105250_10003322 | Ga0105250_100033224 | 263 |
| 451 | 3300009092 | Ga0105250_10065396 | Ga0105250_100653962 | 263 |
| 452 | 3300009148 | Ga0105243_10001564 | Ga0105243_1000156420 | 263 |
| 453 | 3300009176 | Ga0105242_10000719 | Ga0105242_100007199 | 263 |
| 454 | 3300009177 | Ga0105248_10438648 | Ga0105248_104386482 | 263 |
| 455 | 3300009545 | Ga0105237_10005805 | Ga0105237_100058054 | 263 |
| 456 | 3300011119 | Ga0105246_10001731 | Ga0105246_100017311 | 263 |
| 457 | 3300011119 | Ga0105246_10002504 | Ga0105246_100025048 | 263 |
| 458 | 3300011119 | Ga0105246_10027971 | Ga0105246_100279713 | 263 |
| 459 | 3300013100 | Ga0157373_10001969 | Ga0157373_1000196912 | 263 |
| 460 | 3300013100 | Ga0157373_10007934 | Ga0157373_100079348 | 263 |
| 461 | 3300013100 | Ga0157373_10008873 | Ga0157373_100088734 | 263 |
| 462 | 3300013100 | Ga0157373_10031446 | Ga0157373_100314462 | 263 |
| 463 | 3300013100 | Ga0157373_10031805 | Ga0157373_100318053 | 263 |
| 464 | 3300013100 | Ga0157373_10070927 | Ga0157373_100709272 | 263 |
| 465 | 3300013100 | Ga0157373_10178320 | Ga0157373_101783202 | 263 |
| 466 | 3300013102 | Ga0157371_10000281 | Ga0157371_1000028112 | 263 |
| 467 | 3300013102 | Ga0157371_10019377 | Ga0157371_100193773 | 263 |
| 468 | 3300013104 | Ga0157370_10036138 | Ga0157370_100361384 | 263 |
| 469 | 3300013104 | Ga0157370_10137734 | Ga0157370_101377343 | 263 |
| 470 | 3300013105 | Ga0157369_10003643 | Ga0157369_1000364312 | 263 |
| 471 | 3300013105 | Ga0157369_10010141 | Ga0157369_100101415 | 263 |
| 472 | 3300013105 | Ga0157369_10043869 | Ga0157369_100438692 | 263 |
| 473 | 3300013306 | Ga0163162_10000835 | Ga0163162_1000083515 | 263 |
| 474 | 3300013306 | Ga0163162_10476875 | Ga0163162_104768752 | 263 |
| 475 | 3300013308 | Ga0157375_10005491 | Ga0157375_100054918 | 263 |
| 476 | 3300013308 | Ga0157375_10039221 | Ga0157375_100392214 | 263 |
| 477 | 3300013308 | Ga0157375_10337200 | Ga0157375_103372001 | 263 |
| 478 | 3300014497 | Ga0182008_10007260 | Ga0182008_100072606 | 263 |
| 479 | 3300014497 | Ga0182008_10013392 | Ga0182008_100133922 | 263 |
| 480 | 3300015261 | Ga0182006_1000816 | Ga0182006_10008169 | 263 |
| 481 | 3300015261 | Ga0182006_1008689 | Ga0182006_10086894 | 263 |
| 482 | 3300015262 | Ga0182007_10003838 | Ga0182007_100038385 | 263 |
| 483 | 3300015265 | Ga0182005_1005224 | Ga0182005_10052245 | 263 |
| 484 | 3300015265 | Ga0182005_1009143 | Ga0182005_10091432 | 263 |
| 485 | 3300015265 | Ga0182005_1028956 | Ga0182005_10289562 | 263 |
| 486 | 3300017792 | Ga0163161_10037516 | Ga0163161_100375162 | 263 |
| 487 | 3300017792 | Ga0163161_10052017 | Ga0163161_100520172 | 263 |
| 488 | 3300017792 | Ga0163161_10064796 | Ga0163161_100647963 | 263 |
| 489 | 3300017792 | Ga0163161_10113280 | Ga0163161_101132802 | 263 |
| 490 | 3300017792 | Ga0163161_10138446 | Ga0163161_101384462 | 263 |
| 491 | 3300017792 | Ga0163161_10422888 | Ga0163161_104228882 | 263 |
| 492 | 3300025207 | Ga0209760_100047 | Ga0209760_10004714 | 263 |
| 493 | 3300025231 | Ga0207427_100029 | Ga0207427_100029194 | 263 |
| 494 | 3300025233 | Ga0209437_100009 | Ga0209437_100009449 | 263 |
| 495 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032449 | 263 |
| 496 | 3300025291 | Ga0209675_1002348 | Ga0209675_10023488 | 263 |
| 497 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016227 | 263 |
| 498 | 3300025292 | Ga0209676_1000033 | Ga0209676_100003369 | 263 |
| 499 | 3300025292 | Ga0209676_1000080 | Ga0209676_1000080153 | 263 |
| 500 | 3300025292 | Ga0209676_1002060 | Ga0209676_100206010 | 263 |
| 501 | 3300025292 | Ga0209676_1011697 | Ga0209676_10116973 | 263 |
| 502 | 3300025298 | Ga0209050_1000036 | Ga0209050_1000036331 | 263 |
| 503 | 3300025298 | Ga0209050_1000117 | Ga0209050_1000117107 | 263 |
| 504 | 3300025298 | Ga0209050_1000187 | Ga0209050_1000187133 | 263 |
| 505 | 3300025298 | Ga0209050_1001134 | Ga0209050_100113423 | 263 |
| 506 | 3300025303 | Ga0209051_1000077 | Ga0209051_1000077107 | 263 |
| 507 | 3300025303 | Ga0209051_1000094 | Ga0209051_1000094118 | 263 |
| 508 | 3300025303 | Ga0209051_1000131 | Ga0209051_1000131133 | 263 |
| 509 | 3300025303 | Ga0209051_1007856 | Ga0209051_10078563 | 263 |
| 510 | 3300025304 | Ga0209257_1000173 | Ga0209257_100017372 | 263 |
| 511 | 3300025321 | Ga0207656_10000026 | Ga0207656_1000002644 | 263 |
| 512 | 3300025711 | Ga0207696_1000083 | Ga0207696_100008373 | 263 |
| 513 | 3300025711 | Ga0207696_1000111 | Ga0207696_100011169 | 263 |
| 514 | 3300025711 | Ga0207696_1018769 | Ga0207696_10187693 | 263 |
| 515 | 3300025728 | Ga0207655_1000435 | Ga0207655_100043534 | 263 |
| 516 | 3300025728 | Ga0207655_1002166 | Ga0207655_100216611 | 263 |
| 517 | 3300025728 | Ga0207655_1002478 | Ga0207655_100247810 | 263 |
| 518 | 3300025728 | Ga0207655_1002832 | Ga0207655_10028327 | 263 |
| 519 | 3300025728 | Ga0207655_1006801 | Ga0207655_10068017 | 263 |
| 520 | 3300025728 | Ga0207655_1014097 | Ga0207655_10140973 | 263 |
| 521 | 3300025735 | Ga0207713_1000564 | Ga0207713_100056414 | 263 |
| 522 | 3300025735 | Ga0207713_1001593 | Ga0207713_100159310 | 263 |
| 523 | 3300025735 | Ga0207713_1002004 | Ga0207713_100200417 | 263 |
| 524 | 3300025735 | Ga0207713_1002990 | Ga0207713_10029908 | 263 |
| 525 | 3300025735 | Ga0207713_1003370 | Ga0207713_10033705 | 263 |
| 526 | 3300025735 | Ga0207713_1005039 | Ga0207713_10050395 | 263 |
| 527 | 3300025735 | Ga0207713_1018153 | Ga0207713_10181533 | 263 |
| 528 | 3300025735 | Ga0207713_1065880 | Ga0207713_10658802 | 263 |
| 529 | 3300025914 | Ga0207671_10000436 | Ga0207671_1000043623 | 263 |
| 530 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002290 | 263 |
| 531 | 3300025923 | Ga0207681_10000816 | Ga0207681_100008168 | 263 |
| 532 | 3300025925 | Ga0207650_10000559 | Ga0207650_1000055919 | 263 |
| 533 | 3300025925 | Ga0207650_10000688 | Ga0207650_1000068819 | 263 |
| 534 | 3300025933 | Ga0207706_10005582 | Ga0207706_100055823 | 263 |
| 535 | 3300025934 | Ga0207686_10005841 | Ga0207686_100058411 | 263 |
| 536 | 3300025935 | Ga0207709_10000036 | Ga0207709_1000003681 | 263 |
| 537 | 3300025945 | Ga0207679_10000006 | Ga0207679_10000006201 | 263 |
| 538 | 3300026041 | Ga0207639_10002172 | Ga0207639_100021725 | 263 |
| 539 | 3300027111 | Ga0209281_1014772 | Ga0209281_10147722 | 263 |
| 540 | 3300027111 | Ga0209281_1014996 | Ga0209281_10149962 | 263 |
| 541 | 3300028379 | Ga0268266_10011117 | Ga0268266_100111173 | 263 |
| 542 | 3300030521 | Ga0307511_10181496 | Ga0307511_101814962 | 263 |
| 543 | 3300030735 | Ga0316178_1175126 | Ga0316178_11751262 | 263 |
| 544 | 3300031247 | Ga0265340_10100814 | Ga0265340_101008142 | 263 |
| 545 | 3300031507 | Ga0307509_10045079 | Ga0307509_100450793 | 263 |
| 546 | 3300031548 | Ga0307408_100009275 | Ga0307408_1000092753 | 263 |
| 547 | 3300031548 | Ga0307408_100047218 | Ga0307408_1000472183 | 263 |
| 548 | 3300031548 | Ga0307408_100331416 | Ga0307408_1003314162 | 263 |
| 549 | 3300031731 | Ga0307405_10000858 | Ga0307405_100008588 | 263 |
| 550 | 3300031731 | Ga0307405_10042297 | Ga0307405_100422972 | 263 |
| 551 | 3300031731 | Ga0307405_10062191 | Ga0307405_100621912 | 263 |
| 552 | 3300031901 | Ga0307406_10605063 | Ga0307406_106050631 | 263 |
| 553 | 3300031911 | Ga0307412_10013149 | Ga0307412_100131494 | 263 |
| 554 | 3300031911 | Ga0307412_10039547 | Ga0307412_100395472 | 263 |
| 555 | 3300031911 | Ga0307412_10043688 | Ga0307412_100436882 | 263 |
| 556 | 3300031911 | Ga0307412_10044907 | Ga0307412_100449073 | 263 |
| 557 | 3300031911 | Ga0307412_10055324 | Ga0307412_100553242 | 263 |
| 558 | 3300031911 | Ga0307412_10103333 | Ga0307412_101033332 | 263 |
| 559 | 3300031911 | Ga0307412_10248558 | Ga0307412_102485582 | 263 |
| 560 | 3300032002 | Ga0307416_100040799 | Ga0307416_1000407992 | 263 |
| 561 | 3300032002 | Ga0307416_100312825 | Ga0307416_1003128252 | 263 |
| 562 | 3300032002 | Ga0307416_100375485 | Ga0307416_1003754852 | 263 |
| 563 | 3300032004 | Ga0307414_10059779 | Ga0307414_100597792 | 263 |
| 564 | 3300032005 | Ga0307411_10015552 | Ga0307411_100155523 | 263 |
| 565 | 3300032005 | Ga0307411_10619895 | Ga0307411_106198952 | 263 |
| 566 | 3300033180 | Ga0307510_10017421 | Ga0307510_100174213 | 263 |
| 567 | 3300038705 | Ga0237819_02852 | Ga0237819_02852_1950_2741 | 263 |
| 568 | 3300041405 | Ga0439438_002348 | Ga0439438_002348_995_1786 | 263 |
| 569 | 3300041405 | Ga0439438_005775 | Ga0439438_005775_3555_4346 | 263 |
| 570 | 3300041405 | Ga0439438_007754 | Ga0439438_007754_765_1565 | 263 |
| 571 | 3300041407 | Ga0439447_000985 | Ga0439447_000985_5341_6132 | 263 |
| 572 | 3300041407 | Ga0439447_001411 | Ga0439447_001411_6069_6875 | 263 |
| 573 | 3300041407 | Ga0439447_017819 | Ga0439447_017819_531_1331 | 263 |
| 574 | 3300041407 | Ga0439447_046546 | Ga0439447_046546_181_972 | 263 |
| 575 | 3300041411 | Ga0439466_0001571 | Ga0439466_0001571_5527_6318 | 263 |
| 576 | 3300041411 | Ga0439466_0001845 | Ga0439466_0001845_1301_2101 | 263 |
| 577 | 3300041411 | Ga0439466_0001878 | Ga0439466_0001878_5924_6715 | 263 |
| 578 | 3300041411 | Ga0439466_0028654 | Ga0439466_0028654_82_888 | 263 |
| 579 | 3300041411 | Ga0439466_0040503 | Ga0439466_0040503_184_975 | 263 |
| 580 | 3300041413 | Ga0439465_0007331 | Ga0439465_0007331_1876_2667 | 263 |
| 581 | 3300041997 | Ga0439431_0010252 | Ga0439431_0010252_590_1390 | 263 |
| 582 | 3300042004 | Ga0439445_0044923 | Ga0439445_0044923_23_814 | 263 |
| 583 | 3300042006 | Ga0439432_000245 | Ga0439432_000245_8175_8966 | 263 |
| 584 | 3300042006 | Ga0439432_007140 | Ga0439432_007140_1063_1863 | 263 |
| 585 | 3300042006 | Ga0439432_058764 | Ga0439432_058764_147_938 | 263 |
| 586 | 3300042006 | Ga0439432_063597 | Ga0439432_063597_69_875 | 263 |
| 587 | 3300042006 | Ga0439432_082494 | Ga0439432_082494_58_849 | 263 |
| 588 | 3300042009 | Ga0439451_001190 | Ga0439451_001190_3274_4080 | 263 |
| 589 | 3300042009 | Ga0439451_003397 | Ga0439451_003397_2287_3078 | 263 |
| 590 | 3300042009 | Ga0439451_010346 | Ga0439451_010346_303_1103 | 263 |
| 591 | 3300042010 | Ga0439452_001036 | Ga0439452_001036_10974_11765 | 263 |
| 592 | 3300042010 | Ga0439452_002729 | Ga0439452_002729_3726_4517 | 263 |
| 593 | 3300042010 | Ga0439452_004324 | Ga0439452_004324_279_1076 | 263 |
| 594 | 3300042010 | Ga0439452_030104 | Ga0439452_030104_467_1273 | 263 |
| 595 | 3300042013 | Ga0439456_001777 | Ga0439456_001777_3469_4260 | 263 |
| 596 | 3300042013 | Ga0439456_019846 | Ga0439456_019846_221_1021 | 263 |
| 597 | 3300042013 | Ga0439456_031682 | Ga0439456_031682_259_1050 | 263 |
| 598 | 3300042115 | Ga0450911_001409 | Ga0450911_001409_993_1784 | 263 |
| 599 | 3300042115 | Ga0450911_001580 | Ga0450911_001580_1851_2642 | 263 |
| 600 | 3300042121 | Ga0450919_002784 | Ga0450919_002784_216_1007 | 263 |
| 601 | 3300042134 | Ga0450898_019753 | Ga0450898_019753_176_967 | 263 |
| 602 | 3300042136 | Ga0450900_006911 | Ga0450900_006911_454_1245 | 263 |
| 603 | 3300042137 | Ga0450902_001140 | Ga0450902_001140_2147_2938 | 263 |
| 604 | 3300042138 | Ga0450903_003033 | Ga0450903_003033_657_1448 | 263 |
| 605 | 3300042138 | Ga0450903_005287 | Ga0450903_005287_1108_1914 | 263 |
| 606 | 3300042145 | Ga0450906_004159 | Ga0450906_004159_213_1004 | 263 |
| 607 | 3300042145 | Ga0450906_012772 | Ga0450906_012772_662_1468 | 263 |
| 608 | 3300042146 | Ga0450907_004128 | Ga0450907_004128_289_1095 | 263 |
| 609 | 3300042147 | Ga0450910_006877 | Ga0450910_006877_646_1452 | 263 |
| 610 | 3300042184 | Ga0450908_013324 | Ga0450908_013324_262_1068 | 263 |
| 611 | 3300042185 | Ga0450909_004414 | Ga0450909_004414_628_1434 | 263 |
| 612 | 3300042993 | Ga0439440_0010474 | Ga0439440_0010474_100_906 | 263 |
| 613 | 3300046452 | Ga0495617_020800 | Ga0495617_020800_1329_2120 | 263 |
| 614 | 3300046452 | Ga0495617_021109 | Ga0495617_021109_1158_1949 | 263 |
| 615 | 3300046452 | Ga0495617_035676 | Ga0495617_035676_804_1595 | 263 |
| 616 | 3300046453 | Ga0495627_001278 | Ga0495627_001278_10708_11499 | 263 |
| 617 | 3300046453 | Ga0495627_002406 | Ga0495627_002406_4047_4838 | 263 |
| 618 | 3300046455 | Ga0495603_0013688 | Ga0495603_0013688_2010_2801 | 263 |
| 619 | 3300046457 | Ga0495590_0004603 | Ga0495590_0004603_3706_4497 | 263 |
| 620 | 3300046457 | Ga0495590_0006841 | Ga0495590_0006841_1776_2567 | 263 |
| 621 | 3300046457 | Ga0495590_0021548 | Ga0495590_0021548_1450_2241 | 263 |
| 622 | 3300046458 | Ga0495591_001556 | Ga0495591_001556_3752_4543 | 263 |
| 623 | 3300046458 | Ga0495591_003543 | Ga0495591_003543_3362_4153 | 263 |
| 624 | 3300046458 | Ga0495591_029909 | Ga0495591_029909_563_1354 | 263 |
| 625 | 3300046460 | Ga0495638_0006808 | Ga0495638_0006808_5621_6412 | 263 |
| 626 | 3300046471 | Ga0495650_0003766 | Ga0495650_0003766_980_1771 | 263 |
| 627 | 3300046471 | Ga0495650_0005829 | Ga0495650_0005829_5623_6414 | 263 |
| 628 | 3300046473 | Ga0495582_0016390 | Ga0495582_0016390_440_1231 | 263 |
| 629 | 3300046474 | Ga0495605_0008470 | Ga0495605_0008470_3505_4296 | 263 |
| 630 | 3300046474 | Ga0495605_0104320 | Ga0495605_0104320_191_982 | 263 |
| 631 | 3300046474 | Ga0495605_0130337 | Ga0495605_0130337_112_903 | 263 |
| 632 | 3300046491 | Ga0495584_0002832 | Ga0495584_0002832_6922_7713 | 263 |
| 633 | 3300046491 | Ga0495584_0009191 | Ga0495584_0009191_1289_2080 | 263 |
| 634 | 3300046491 | Ga0495584_0010632 | Ga0495584_0010632_1908_2699 | 263 |
| 635 | 3300046492 | Ga0495585_0017386 | Ga0495585_0017386_1431_2222 | 263 |
| 636 | 3300046492 | Ga0495585_0019132 | Ga0495585_0019132_1796_2587 | 263 |
| 637 | 3300046499 | Ga0495594_0006698 | Ga0495594_0006698_3328_4119 | 263 |
| 638 | 3300046499 | Ga0495594_0123797 | Ga0495594_0123797_659_1450 | 263 |
| 639 | 3300046500 | Ga0495596_0001019 | Ga0495596_0001019_6399_7190 | 263 |
| 640 | 3300046501 | Ga0495607_0005334 | Ga0495607_0005334_4116_4907 | 263 |
| 641 | 3300046501 | Ga0495607_0016411 | Ga0495607_0016411_3866_4657 | 263 |
| 642 | 3300046501 | Ga0495607_0024112 | Ga0495607_0024112_1544_2335 | 263 |
| 643 | 3300046501 | Ga0495607_0070726 | Ga0495607_0070726_803_1594 | 263 |
| 644 | 3300046501 | Ga0495607_0074243 | Ga0495607_0074243_99_890 | 263 |
| 645 | 3300046506 | Ga0495583_0008516 | Ga0495583_0008516_4755_5546 | 263 |
| 646 | 3300046506 | Ga0495583_0018824 | Ga0495583_0018824_1037_1828 | 263 |
| 647 | 3300046506 | Ga0495583_0098419 | Ga0495583_0098419_376_1167 | 263 |
| 648 | 3300046507 | Ga0495606_0011362 | Ga0495606_0011362_3570_4361 | 263 |
| 649 | 3300046507 | Ga0495606_0011908 | Ga0495606_0011908_299_1090 | 263 |
| 650 | 3300046507 | Ga0495606_0035464 | Ga0495606_0035464_1997_2788 | 263 |
| 651 | 3300046507 | Ga0495606_0058330 | Ga0495606_0058330_950_1741 | 263 |
| 652 | 3300046512 | Ga0495610_0004508 | Ga0495610_0004508_9387_10178 | 263 |
| 653 | 3300046512 | Ga0495610_0023992 | Ga0495610_0023992_178_969 | 263 |
| 654 | 3300046513 | Ga0495616_0006069 | Ga0495616_0006069_5035_5826 | 263 |
| 655 | 3300046513 | Ga0495616_0007496 | Ga0495616_0007496_4101_4892 | 263 |
| 656 | 3300046513 | Ga0495616_0009306 | Ga0495616_0009306_3123_3914 | 263 |
| 657 | 3300046513 | Ga0495616_0029012 | Ga0495616_0029012_2052_2843 | 263 |
| 658 | 3300046515 | Ga0495620_0014699 | Ga0495620_0014699_1928_2719 | 263 |
| 659 | 3300046515 | Ga0495620_0021640 | Ga0495620_0021640_304_1095 | 263 |
| 660 | 3300046517 | Ga0495630_0032621 | Ga0495630_0032621_2860_3651 | 263 |
| 661 | 3300046517 | Ga0495630_0075306 | Ga0495630_0075306_98_889 | 263 |
| 662 | 3300046518 | Ga0495631_0019988 | Ga0495631_0019988_413_1204 | 263 |
| 663 | 3300046519 | Ga0495632_0003292 | Ga0495632_0003292_1951_2742 | 263 |
| 664 | 3300046519 | Ga0495632_0005336 | Ga0495632_0005336_1854_2645 | 263 |
| 665 | 3300046519 | Ga0495632_0010459 | Ga0495632_0010459_2776_3567 | 263 |
| 666 | 3300046519 | Ga0495632_0017467 | Ga0495632_0017467_1923_2714 | 263 |
| 667 | 3300046520 | Ga0495637_0002474 | Ga0495637_0002474_3018_3809 | 263 |
| 668 | 3300046520 | Ga0495637_0005314 | Ga0495637_0005314_4663_5454 | 263 |
| 669 | 3300046522 | Ga0495643_0010283 | Ga0495643_0010283_3859_4650 | 263 |
| 670 | 3300046522 | Ga0495643_0013850 | Ga0495643_0013850_1917_2708 | 263 |
| 671 | 3300046522 | Ga0495643_0017952 | Ga0495643_0017952_1508_2299 | 263 |
| 672 | 3300046522 | Ga0495643_0021971 | Ga0495643_0021971_2217_3008 | 263 |
| 673 | 3300046522 | Ga0495643_0150046 | Ga0495643_0150046_308_1099 | 263 |
| 674 | 3300046523 | Ga0495644_0003754 | Ga0495644_0003754_3352_4143 | 263 |
| 675 | 3300046524 | Ga0495648_0001887 | Ga0495648_0001887_9661_10452 | 263 |
| 676 | 3300046524 | Ga0495648_0032234 | Ga0495648_0032234_1742_2533 | 263 |
| 677 | 3300046524 | Ga0495648_0092173 | Ga0495648_0092173_741_1532 | 263 |
| 678 | 3300046526 | Ga0495666_0010775 | Ga0495666_0010775_2056_2847 | 263 |
| 679 | 3300046526 | Ga0495666_0024064 | Ga0495666_0024064_133_924 | 263 |
| 680 | 3300046526 | Ga0495666_0050239 | Ga0495666_0050239_627_1418 | 263 |
| 681 | 3300046528 | Ga0495642_0000619 | Ga0495642_0000619_5953_6744 | 263 |
| 682 | 3300046528 | Ga0495642_0018089 | Ga0495642_0018089_294_1085 | 263 |
| 683 | 3300046530 | Ga0495654_0001952 | Ga0495654_0001952_6738_7529 | 263 |
| 684 | 3300046530 | Ga0495654_0023755 | Ga0495654_0023755_2093_2884 | 263 |
| 685 | 3300046530 | Ga0495654_0097301 | Ga0495654_0097301_132_923 | 263 |
| 686 | 3300046530 | Ga0495654_0098547 | Ga0495654_0098547_156_947 | 263 |
| 687 | 3300046535 | Ga0495586_0101788 | Ga0495586_0101788_656_1447 | 263 |
| 688 | 3300046536 | Ga0495587_0024092 | Ga0495587_0024092_1888_2679 | 263 |
| 689 | 3300046536 | Ga0495587_0092887 | Ga0495587_0092887_445_1236 | 263 |
| 690 | 3300046538 | Ga0495609_0004568 | Ga0495609_0004568_2381_3172 | 263 |
| 691 | 3300046538 | Ga0495609_0005438 | Ga0495609_0005438_2260_3051 | 263 |
| 692 | 3300046538 | Ga0495609_0006429 | Ga0495609_0006429_856_1647 | 263 |
| 693 | 3300046538 | Ga0495609_0009498 | Ga0495609_0009498_650_1441 | 263 |
| 694 | 3300046542 | Ga0495597_0006542 | Ga0495597_0006542_541_1332 | 263 |
| 695 | 3300046542 | Ga0495597_0020226 | Ga0495597_0020226_289_1080 | 263 |
| 696 | 3300046542 | Ga0495597_0063893 | Ga0495597_0063893_643_1434 | 263 |
| 697 | 3300046557 | Ga0495622_0028987 | Ga0495622_0028987_462_1253 | 263 |
| 698 | 3300046557 | Ga0495622_0053763 | Ga0495622_0053763_1001_1792 | 263 |
| 699 | 3300046558 | Ga0495633_0010318 | Ga0495633_0010318_1872_2663 | 263 |
| 700 | 3300046616 | Ga0495668_0002481 | Ga0495668_0002481_9454_10245 | 263 |
| 701 | 3300046616 | Ga0495668_0016122 | Ga0495668_0016122_3498_4289 | 263 |
| 702 | 3300046642 | Ga0495634_0020607 | Ga0495634_0020607_1854_2645 | 263 |
| 703 | 3300046660 | Ga0495625_0022411 | Ga0495625_0022411_2568_3359 | 263 |
| 704 | 3300046663 | Ga0495635_0006025 | Ga0495635_0006025_1704_2495 | 263 |
| 705 | 3300046663 | Ga0495635_0018177 | Ga0495635_0018177_1071_1862 | 263 |
| 706 | 3300046665 | Ga0495661_0002061 | Ga0495661_0002061_4268_5059 | 263 |
| 707 | 3300046665 | Ga0495661_0004967 | Ga0495661_0004967_4734_5525 | 263 |
| 708 | 3300046665 | Ga0495661_0033064 | Ga0495661_0033064_1048_1839 | 263 |
| 709 | 3300046674 | Ga0495588_0020609 | Ga0495588_0020609_1228_2019 | 263 |
| 710 | 3300046679 | Ga0495623_0016125 | Ga0495623_0016125_3655_4446 | 263 |
| 711 | 3300046679 | Ga0495623_0018191 | Ga0495623_0018191_1260_2051 | 263 |
| 712 | 3300046680 | Ga0495646_0024731 | Ga0495646_0024731_173_964 | 263 |
| 713 | 3300046680 | Ga0495646_0025218 | Ga0495646_0025218_1746_2537 | 263 |
| 714 | 3300046680 | Ga0495646_0028629 | Ga0495646_0028629_1205_1996 | 263 |
| 715 | 3300046684 | Ga0495669_0001111 | Ga0495669_0001111_1475_2266 | 263 |
| 716 | 3300046689 | Ga0495613_0049064 | Ga0495613_0049064_487_1278 | 263 |
| 717 | 3300046689 | Ga0495613_0114868 | Ga0495613_0114868_334_1125 | 263 |
| 718 | 3300046691 | Ga0495670_0004140 | Ga0495670_0004140_2175_2966 | 263 |
| 719 | 3300046691 | Ga0495670_0136191 | Ga0495670_0136191_408_1199 | 263 |
| 720 | 3300046692 | Ga0495671_0019851 | Ga0495671_0019851_2095_2886 | 263 |
| 721 | 3300046692 | Ga0495671_0041552 | Ga0495671_0041552_1113_1904 | 263 |
| 722 | 3300046694 | Ga0495649_0002480 | Ga0495649_0002480_10233_11024 | 263 |
| 723 | 3300046694 | Ga0495649_0006308 | Ga0495649_0006308_915_1706 | 263 |
| 724 | 3300046694 | Ga0495649_0026961 | Ga0495649_0026961_470_1261 | 263 |
| 725 | 3300046694 | Ga0495649_0055807 | Ga0495649_0055807_230_1021 | 263 |
| 726 | 3300046794 | Ga0495589_0001524 | Ga0495589_0001524_3290_4081 | 263 |
| 727 | 3300046794 | Ga0495589_0004506 | Ga0495589_0004506_6515_7306 | 263 |
| 728 | 3300046794 | Ga0495589_0007367 | Ga0495589_0007367_3497_4288 | 263 |
| 729 | 3300046794 | Ga0495589_0026347 | Ga0495589_0026347_2022_2813 | 263 |
| 730 | 3300046794 | Ga0495589_0028987 | Ga0495589_0028987_1804_2595 | 263 |
| 731 | 3300046810 | Ga0495660_0008985 | Ga0495660_0008985_3374_4165 | 263 |
| 732 | 3300046810 | Ga0495660_0012251 | Ga0495660_0012251_2319_3110 | 263 |
| 733 | 3300046810 | Ga0495660_0012502 | Ga0495660_0012502_2014_2805 | 263 |
| 734 | 3300046810 | Ga0495660_0012787 | Ga0495660_0012787_3458_4249 | 263 |
| 735 | 3300046810 | Ga0495660_0022738 | Ga0495660_0022738_1396_2187 | 263 |
| 736 | 3300046810 | Ga0495660_0030871 | Ga0495660_0030871_741_1532 | 263 |
| 737 | 3300047317 | Ga0495604_0028278 | Ga0495604_0028278_1763_2554 | 263 |
| 738 | 3300047317 | Ga0495604_0054701 | Ga0495604_0054701_479_1270 | 263 |
| 739 | 3300047319 | Ga0495674_0027626 | Ga0495674_0027626_1313_2104 | 263 |
| 740 | 3300047320 | Ga0495672_0022571 | Ga0495672_0022571_1268_2059 | 263 |
| 741 | 3300047321 | Ga0495676_0019443 | Ga0495676_0019443_3500_4291 | 263 |
| 742 | 3300047322 | Ga0495680_0009030 | Ga0495680_0009030_8143_8934 | 263 |
| 743 | 3300047322 | Ga0495680_0072207 | Ga0495680_0072207_98_889 | 263 |
| 744 | 3300047323 | Ga0495683_0016832 | Ga0495683_0016832_1566_2357 | 263 |
| 745 | 3300047323 | Ga0495683_0193713 | Ga0495683_0193713_35_826 | 263 |
| 746 | 3300047443 | Ga0495687_004474 | Ga0495687_004474_6838_7629 | 263 |
| 747 | 3300047444 | Ga0495675_0303601 | Ga0495675_0303601_59_850 | 263 |
| 748 | 3300047445 | Ga0495677_0003504 | Ga0495677_0003504_4742_5533 | 263 |
| 749 | 3300047446 | Ga0495679_007997 | Ga0495679_007997_132_923 | 263 |
| 750 | 3300047446 | Ga0495679_009679 | Ga0495679_009679_1546_2337 | 263 |
| 751 | 3300047446 | Ga0495679_016820 | Ga0495679_016820_506_1297 | 263 |
| 752 | 3300047446 | Ga0495679_016840 | Ga0495679_016840_187_978 | 263 |
| 753 | 3300047446 | Ga0495679_030636 | Ga0495679_030636_160_951 | 263 |
| 754 | 3300047469 | Ga0495673_0004768 | Ga0495673_0004768_1860_2651 | 263 |
| 755 | 3300047469 | Ga0495673_0006091 | Ga0495673_0006091_869_1660 | 263 |
| 756 | 3300047469 | Ga0495673_0010918 | Ga0495673_0010918_1926_2717 | 263 |
| 757 | 3300047469 | Ga0495673_0026170 | Ga0495673_0026170_519_1310 | 263 |
| 758 | 3300047469 | Ga0495673_0029441 | Ga0495673_0029441_1244_2035 | 263 |
| 759 | 3300047469 | Ga0495673_0036349 | Ga0495673_0036349_1410_2201 | 263 |
| 760 | 3300047470 | Ga0495681_0004955 | Ga0495681_0004955_3916_4707 | 263 |
| 761 | 3300047470 | Ga0495681_0007131 | Ga0495681_0007131_3402_4193 | 263 |
| 762 | 3300047470 | Ga0495681_0018869 | Ga0495681_0018869_412_1203 | 263 |
| 763 | 3300047470 | Ga0495681_0038148 | Ga0495681_0038148_1505_2296 | 263 |
| 764 | 3300047470 | Ga0495681_0105343 | Ga0495681_0105343_292_1083 | 263 |
| 765 | 3300047470 | Ga0495681_0155149 | Ga0495681_0155149_56_847 | 263 |
| 766 | 3300047471 | Ga0495684_0010506 | Ga0495684_0010506_1695_2486 | 263 |
| 767 | 3300047472 | Ga0495686_0015573 | Ga0495686_0015573_3155_3946 | 263 |
| 768 | 3300047472 | Ga0495686_0229606 | Ga0495686_0229606_171_962 | 263 |
| 769 | 3300047673 | Ga0495593_0011041 | Ga0495593_0011041_1717_2508 | 263 |
| 770 | 3300048091 | Ga0495626_0002001 | Ga0495626_0002001_2629_3420 | 263 |
| 771 | 3300048091 | Ga0495626_0003528 | Ga0495626_0003528_6399_7190 | 263 |
| 772 | 3300048091 | Ga0495626_0007781 | Ga0495626_0007781_2991_3782 | 263 |
| 773 | 3300048091 | Ga0495626_0011028 | Ga0495626_0011028_2138_2929 | 263 |
| 774 | 3300048091 | Ga0495626_0022037 | Ga0495626_0022037_1875_2666 | 263 |
| 775 | 3300048091 | Ga0495626_0048137 | Ga0495626_0048137_1005_1796 | 263 |
| 776 | 3300048091 | Ga0495626_0133578 | Ga0495626_0133578_95_886 | 263 |
| 777 | 3300048905 | Ga0496102_0004463 | Ga0496102_0004463_8998_9789 | 263 |
| 778 | 3300048906 | Ga0496103_0013756 | Ga0496103_0013756_3735_4526 | 263 |
| 779 | 3300048915 | Ga0496112_0257867 | Ga0496112_0257867_322_1122 | 263 |
| 780 | 3300048919 | Ga0496116_0006411 | Ga0496116_0006411_3737_4528 | 263 |
| 781 | 3300048919 | Ga0496116_0014738 | Ga0496116_0014738_4084_4875 | 263 |
| 782 | 3300048919 | Ga0496116_0022706 | Ga0496116_0022706_581_1372 | 263 |
| 783 | 3300048919 | Ga0496116_0046236 | Ga0496116_0046236_27_818 | 263 |
| 784 | 3300048920 | Ga0496117_0002789 | Ga0496117_0002789_16863_17654 | 263 |
| 785 | 3300048920 | Ga0496117_0011214 | Ga0496117_0011214_1891_2682 | 263 |
| 786 | 3300048920 | Ga0496117_0017405 | Ga0496117_0017405_3549_4340 | 263 |
| 787 | 3300048920 | Ga0496117_0025548 | Ga0496117_0025548_2224_3015 | 263 |
| 788 | 3300048920 | Ga0496117_0028665 | Ga0496117_0028665_41_850 | 263 |
| 789 | 3300048921 | Ga0496118_0018336 | Ga0496118_0018336_1810_2601 | 263 |
| 790 | 3300048921 | Ga0496118_0025463 | Ga0496118_0025463_425_1234 | 263 |
| 791 | 3300048921 | Ga0496118_0029625 | Ga0496118_0029625_1676_2467 | 263 |
| 792 | 3300048921 | Ga0496118_0051207 | Ga0496118_0051207_1356_2147 | 263 |
| 793 | 3300048921 | Ga0496118_0123217 | Ga0496118_0123217_520_1311 | 263 |
| 794 | 3300048922 | Ga0496119_0030527 | Ga0496119_0030527_2785_3594 | 263 |
| 795 | 3300048922 | Ga0496119_0046829 | Ga0496119_0046829_82_873 | 263 |
| 796 | 3300048923 | Ga0496120_0020768 | Ga0496120_0020768_86_895 | 263 |
| 797 | 3300048923 | Ga0496120_0031599 | Ga0496120_0031599_2082_2873 | 263 |
| 798 | 3300048923 | Ga0496120_0033638 | Ga0496120_0033638_1842_2633 | 263 |
| 799 | 3300048924 | Ga0496121_0018914 | Ga0496121_0018914_1324_2115 | 263 |
| 800 | 3300048924 | Ga0496121_0023351 | Ga0496121_0023351_1367_2158 | 263 |
| 801 | 3300048924 | Ga0496121_0048821 | Ga0496121_0048821_2362_3153 | 263 |
| 802 | 3300048925 | Ga0496122_0037968 | Ga0496122_0037968_1189_1980 | 263 |
| 803 | 3300048925 | Ga0496122_0043373 | Ga0496122_0043373_245_1036 | 263 |
| 804 | 3300048925 | Ga0496122_0057593 | Ga0496122_0057593_1735_2526 | 263 |
| 805 | 3300048925 | Ga0496122_0201513 | Ga0496122_0201513_267_1058 | 263 |
| 806 | 3300048926 | Ga0496123_0009566 | Ga0496123_0009566_3040_3831 | 263 |
| 807 | 3300048926 | Ga0496123_0044650 | Ga0496123_0044650_550_1341 | 263 |
| 808 | 3300048926 | Ga0496123_0097294 | Ga0496123_0097294_909_1700 | 263 |
| 809 | 3300048927 | Ga0496124_0007979 | Ga0496124_0007979_9303_10094 | 263 |
| 810 | 3300048927 | Ga0496124_0008166 | Ga0496124_0008166_3543_4334 | 263 |
| 811 | 3300048927 | Ga0496124_0013760 | Ga0496124_0013760_2734_3525 | 263 |
| 812 | 3300048927 | Ga0496124_0081591 | Ga0496124_0081591_515_1306 | 263 |
| 813 | 3300048927 | Ga0496124_0160948 | Ga0496124_0160948_676_1467 | 263 |
| 814 | 3300048927 | Ga0496124_0260254 | Ga0496124_0260254_181_972 | 263 |
| 815 | 3300048928 | Ga0496125_0001578 | Ga0496125_0001578_27972_28763 | 263 |
| 816 | 3300048928 | Ga0496125_0008486 | Ga0496125_0008486_5009_5800 | 263 |
| 817 | 3300048928 | Ga0496125_0035635 | Ga0496125_0035635_3446_4255 | 263 |
| 818 | 3300048928 | Ga0496125_0037745 | Ga0496125_0037745_1775_2566 | 263 |
| 819 | 3300048928 | Ga0496125_0109197 | Ga0496125_0109197_93_884 | 263 |
| 820 | 3300048928 | Ga0496125_0206908 | Ga0496125_0206908_187_978 | 263 |
| 821 | 3300048929 | Ga0496126_0004789 | Ga0496126_0004789_4536_5327 | 263 |
| 822 | 3300048929 | Ga0496126_0011313 | Ga0496126_0011313_1845_2636 | 263 |
| 823 | 3300048929 | Ga0496126_0087985 | Ga0496126_0087985_1852_2643 | 263 |
| 824 | 3300049459 | Ga0495678_002391 | Ga0495678_002391_10129_10920 | 263 |
| 825 | 3300049459 | Ga0495678_054293 | Ga0495678_054293_319_1110 | 263 |
| 826 | 3300049459 | Ga0495678_091212 | Ga0495678_091212_153_944 | 263 |
| 827 | 3300049460 | Ga0495682_0011864 | Ga0495682_0011864_809_1600 | 263 |
| 828 | 3300049460 | Ga0495682_0053676 | Ga0495682_0053676_250_1041 | 263 |
| 829 | 3300049460 | Ga0495682_0080369 | Ga0495682_0080369_270_1061 | 263 |
| 830 | 3300049758 | Ga0501241_002124 | Ga0501241_002124_1294_2085 | 263 |
| 831 | 3300053161 | Ga0500634_0002065 | Ga0500634_0002065_3416_4207 | 263 |
| 832 | iso_pu_bacteria | 2511231004 | 2511256705 | 264 |
| 833 | iso_pu_bacteria | 2511231016 | 2511324099 | 264 |
| 834 | iso_pu_bacteria | 2511231019 | 2511344049 | 264 |
| 835 | iso_pu_bacteria | 2511231022 | 2511365006 | 264 |
| 836 | iso_pu_bacteria | 2623620446 | 2624493899 | 264 |
| 837 | iso_pu_bacteria | 2643221633 | 2644184879 | 264 |
| 838 | iso_pu_bacteria | 2808606445 | 2809216070 | 264 |
| 839 | iso_pu_bacteria | 2919697872 | 2919700183 | 264 |
| 840 | iso_pu_bacteria | 3007511990 | 3007512682 | 264 |
| 841 | iso_pu_bacteria | 8019775933 | 8019776850 | 264 |
| 842 | iso_pu_bacteria | 8056155041 | 8056159465 | 264 |
| 843 | 3300041405 | Ga0439438_003155 | Ga0439438_003155_268_1077 | 266 |
| 844 | 3300041405 | Ga0439438_008580 | Ga0439438_008580_2455_3264 | 266 |
| 845 | 3300042010 | Ga0439452_011394 | Ga0439452_011394_117_926 | 266 |
| 846 | 2124908027 | MRS2a_Contig_26459 | MRS2a_00344980 | 268 |
| 847 | 3300005288 | Ga0065714_10003926 | Ga0065714_100039265 | 268 |
| 848 | 3300005288 | Ga0065714_10007790 | Ga0065714_100077903 | 268 |
| 849 | 3300005288 | Ga0065714_10026140 | Ga0065714_100261402 | 268 |
| 850 | 3300006058 | Ga0075432_10006266 | Ga0075432_100062663 | 268 |
| 851 | 3300006914 | Ga0075436_100076706 | Ga0075436_1000767062 | 268 |
| 852 | 3300009036 | Ga0105244_10021200 | Ga0105244_100212003 | 268 |
| 853 | 3300009148 | Ga0105243_10239895 | Ga0105243_102398952 | 268 |
| 854 | 3300013102 | Ga0157371_10501813 | Ga0157371_105018131 | 268 |
| 855 | 3300015261 | Ga0182006_1000736 | Ga0182006_10007369 | 268 |
| 856 | 3300015261 | Ga0182006_1026599 | Ga0182006_10265992 | 268 |
| 857 | 3300015262 | Ga0182007_10000110 | Ga0182007_100001107 | 268 |
| 858 | 3300015265 | Ga0182005_1000627 | Ga0182005_10006279 | 268 |
| 859 | 3300025728 | Ga0207655_1000893 | Ga0207655_100089324 | 268 |
| 860 | 3300025728 | Ga0207655_1007688 | Ga0207655_10076882 | 268 |
| 861 | 3300027907 | Ga0207428_10038182 | Ga0207428_100381823 | 268 |
| 862 | 3300027907 | Ga0207428_10097691 | Ga0207428_100976911 | 268 |
| 863 | 3300031731 | Ga0307405_10034002 | Ga0307405_100340021 | 268 |
| 864 | 3300041407 | Ga0439447_006363 | Ga0439447_006363_2095_2901 | 268 |
| 865 | 3300041411 | Ga0439466_0027775 | Ga0439466_0027775_816_1622 | 268 |
| 866 | 3300042009 | Ga0439451_022469 | Ga0439451_022469_387_1193 | 268 |
| 867 | 3300042010 | Ga0439452_020900 | Ga0439452_020900_609_1415 | 268 |
| 868 | 3300042016 | Ga0439463_035129 | Ga0439463_035129_284_1105 | 268 |
| 869 | 3300042139 | Ga0450904_002190 | Ga0450904_002190_1027_1833 | 268 |
| 870 | 3300042146 | Ga0450907_000173 | Ga0450907_000173_13860_14666 | 268 |
| 871 | 3300042146 | Ga0450907_013304 | Ga0450907_013304_173_994 | 268 |
| 872 | 3300042435 | Ga0439434_0001671 | Ga0439434_0001671_1902_2708 | 268 |
| 873 | 3300042461 | Ga0439460_0032672 | Ga0439460_0032672_79_900 | 268 |
| 874 | 3300042993 | Ga0439440_0001312 | Ga0439440_0001312_1990_2796 | 268 |
| 875 | 3300046452 | Ga0495617_001213 | Ga0495617_001213_1959_2765 | 268 |
| 876 | 3300046452 | Ga0495617_017307 | Ga0495617_017307_185_991 | 268 |
| 877 | 3300046452 | Ga0495617_056969 | Ga0495617_056969_472_1278 | 268 |
| 878 | 3300046455 | Ga0495603_0005877 | Ga0495603_0005877_1334_2140 | 268 |
| 879 | 3300046457 | Ga0495590_0001626 | Ga0495590_0001626_1974_2780 | 268 |
| 880 | 3300046458 | Ga0495591_007226 | Ga0495591_007226_1855_2661 | 268 |
| 881 | 3300046460 | Ga0495638_0046056 | Ga0495638_0046056_248_1054 | 268 |
| 882 | 3300046471 | Ga0495650_0026336 | Ga0495650_0026336_94_900 | 268 |
| 883 | 3300046471 | Ga0495650_0028975 | Ga0495650_0028975_416_1222 | 268 |
| 884 | 3300046474 | Ga0495605_0037769 | Ga0495605_0037769_207_1013 | 268 |
| 885 | 3300046475 | Ga0495639_0000994 | Ga0495639_0000994_10132_10938 | 268 |
| 886 | 3300046491 | Ga0495584_0001291 | Ga0495584_0001291_3842_4648 | 268 |
| 887 | 3300046492 | Ga0495585_0011257 | Ga0495585_0011257_3019_3825 | 268 |
| 888 | 3300046499 | Ga0495594_0058585 | Ga0495594_0058585_1289_2095 | 268 |
| 889 | 3300046501 | Ga0495607_0003843 | Ga0495607_0003843_332_1138 | 268 |
| 890 | 3300046501 | Ga0495607_0039658 | Ga0495607_0039658_191_997 | 268 |
| 891 | 3300046501 | Ga0495607_0069373 | Ga0495607_0069373_884_1690 | 268 |
| 892 | 3300046506 | Ga0495583_0035446 | Ga0495583_0035446_1158_1964 | 268 |
| 893 | 3300046507 | Ga0495606_0016942 | Ga0495606_0016942_3180_3986 | 268 |
| 894 | 3300046512 | Ga0495610_0095346 | Ga0495610_0095346_22_828 | 268 |
| 895 | 3300046513 | Ga0495616_0003008 | Ga0495616_0003008_9261_10067 | 268 |
| 896 | 3300046515 | Ga0495620_0008988 | Ga0495620_0008988_2453_3259 | 268 |
| 897 | 3300046519 | Ga0495632_0009359 | Ga0495632_0009359_1495_2301 | 268 |
| 898 | 3300046519 | Ga0495632_0027429 | Ga0495632_0027429_310_1131 | 268 |
| 899 | 3300046520 | Ga0495637_0021535 | Ga0495637_0021535_217_1023 | 268 |
| 900 | 3300046520 | Ga0495637_0093929 | Ga0495637_0093929_191_997 | 268 |
| 901 | 3300046522 | Ga0495643_0027922 | Ga0495643_0027922_524_1330 | 268 |
| 902 | 3300046523 | Ga0495644_0002235 | Ga0495644_0002235_4345_5151 | 268 |
| 903 | 3300046524 | Ga0495648_0036612 | Ga0495648_0036612_1264_2070 | 268 |
| 904 | 3300046524 | Ga0495648_0048425 | Ga0495648_0048425_96_902 | 268 |
| 905 | 3300046524 | Ga0495648_0121460 | Ga0495648_0121460_466_1272 | 268 |
| 906 | 3300046530 | Ga0495654_0027139 | Ga0495654_0027139_1593_2399 | 268 |
| 907 | 3300046530 | Ga0495654_0093213 | Ga0495654_0093213_163_969 | 268 |
| 908 | 3300046530 | Ga0495654_0179222 | Ga0495654_0179222_77_883 | 268 |
| 909 | 3300046538 | Ga0495609_0024012 | Ga0495609_0024012_1343_2149 | 268 |
| 910 | 3300046542 | Ga0495597_0017098 | Ga0495597_0017098_2123_2929 | 268 |
| 911 | 3300046542 | Ga0495597_0018718 | Ga0495597_0018718_1297_2103 | 268 |
| 912 | 3300046542 | Ga0495597_0021958 | Ga0495597_0021958_238_1059 | 268 |
| 913 | 3300046542 | Ga0495597_0083324 | Ga0495597_0083324_144_950 | 268 |
| 914 | 3300046557 | Ga0495622_0003892 | Ga0495622_0003892_50_856 | 268 |
| 915 | 3300046557 | Ga0495622_0052332 | Ga0495622_0052332_244_1050 | 268 |
| 916 | 3300046660 | Ga0495625_0048103 | Ga0495625_0048103_647_1453 | 268 |
| 917 | 3300046660 | Ga0495625_0084289 | Ga0495625_0084289_1377_2183 | 268 |
| 918 | 3300046664 | Ga0495659_0001059 | Ga0495659_0001059_6972_7778 | 268 |
| 919 | 3300046665 | Ga0495661_0071314 | Ga0495661_0071314_751_1557 | 268 |
| 920 | 3300046674 | Ga0495588_0137198 | Ga0495588_0137198_380_1186 | 268 |
| 921 | 3300046691 | Ga0495670_0006986 | Ga0495670_0006986_2174_2980 | 268 |
| 922 | 3300046691 | Ga0495670_0042577 | Ga0495670_0042577_1296_2102 | 268 |
| 923 | 3300046691 | Ga0495670_0122357 | Ga0495670_0122357_241_1062 | 268 |
| 924 | 3300046691 | Ga0495670_0209178 | Ga0495670_0209178_133_939 | 268 |
| 925 | 3300046692 | Ga0495671_0001535 | Ga0495671_0001535_12679_13485 | 268 |
| 926 | 3300046692 | Ga0495671_0007630 | Ga0495671_0007630_93_899 | 268 |
| 927 | 3300046692 | Ga0495671_0103258 | Ga0495671_0103258_494_1300 | 268 |
| 928 | 3300046810 | Ga0495660_0015928 | Ga0495660_0015928_3044_3850 | 268 |
| 929 | 3300046810 | Ga0495660_0085657 | Ga0495660_0085657_212_1018 | 268 |
| 930 | 3300046810 | Ga0495660_0136063 | Ga0495660_0136063_112_918 | 268 |
| 931 | 3300047318 | Ga0495636_0012249 | Ga0495636_0012249_1948_2754 | 268 |
| 932 | 3300047320 | Ga0495672_0003642 | Ga0495672_0003642_1670_2476 | 268 |
| 933 | 3300047320 | Ga0495672_0004056 | Ga0495672_0004056_818_1624 | 268 |
| 934 | 3300047320 | Ga0495672_0015575 | Ga0495672_0015575_1741_2547 | 268 |
| 935 | 3300047320 | Ga0495672_0039705 | Ga0495672_0039705_1981_2787 | 268 |
| 936 | 3300047323 | Ga0495683_0022825 | Ga0495683_0022825_239_1045 | 268 |
| 937 | 3300047323 | Ga0495683_0039481 | Ga0495683_0039481_467_1273 | 268 |
| 938 | 3300047443 | Ga0495687_025436 | Ga0495687_025436_1879_2685 | 268 |
| 939 | 3300047469 | Ga0495673_0003806 | Ga0495673_0003806_1953_2759 | 268 |
| 940 | 3300047469 | Ga0495673_0022411 | Ga0495673_0022411_980_1786 | 268 |
| 941 | 3300047469 | Ga0495673_0025384 | Ga0495673_0025384_1483_2289 | 268 |
| 942 | 3300047470 | Ga0495681_0001437 | Ga0495681_0001437_11827_12633 | 268 |
| 943 | 3300047470 | Ga0495681_0007318 | Ga0495681_0007318_3544_4350 | 268 |
| 944 | 3300047472 | Ga0495686_0179017 | Ga0495686_0179017_160_981 | 268 |
| 945 | 3300048091 | Ga0495626_0001149 | Ga0495626_0001149_11129_11935 | 268 |
| 946 | 3300048091 | Ga0495626_0001346 | Ga0495626_0001346_12613_13419 | 268 |
| 947 | 3300048919 | Ga0496116_0032094 | Ga0496116_0032094_1946_2752 | 268 |
| 948 | 3300048924 | Ga0496121_0071713 | Ga0496121_0071713_1403_2209 | 268 |
| 949 | 3300048925 | Ga0496122_0063686 | Ga0496122_0063686_1843_2649 | 268 |
| 950 | 3300048928 | Ga0496125_0031155 | Ga0496125_0031155_2043_2849 | 268 |
| 951 | 3300049460 | Ga0495682_0130893 | Ga0495682_0130893_27_833 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.978 | 2 | 266 |
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.9706 | 2 | 266 |
| 3om8-assembly1.cif.gz_B | the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 | 0.9653 | 2 | 268 |
| 3om8-assembly1.cif.gz_B | the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 | 0.9439 | 2 | 268 |
| 4uhd-assembly1.cif.gz_A | structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) | 0.9217 | 9 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9704 | 2 | 266 | 3.40.50.1820 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9675 | 2 | 268 | 3.40.50.1820 |
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9629 | 2 | 266 | 3.40.50.1820 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9457 | 2 | 268 | 3.40.50.1820 |
| 4uhfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9214 | 9 | 266 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0T6VL91-F1-model_v4 | deleted | 0.9962 | 1 | 266 |
|
| AF-A0A2Z4GHL9-F1-model_v4 | 3-oxoadipate enol-lactonase | 0.9845 | 11 | 268 |
GO:0016020
GO:0042952 GO:0047570 |
| AF-A0A2N5C326-F1-model_v4 | AraC family transcriptional regulator | 0.9817 | 3 | 267 |
GO:0042952
GO:0047570 GO:0051920 |
| AF-A0A0T6VL91-F1-model_v4 | deleted | 0.9812 | 1 | 266 |
|
| AF-A0A2V2BBY9-F1-model_v4 | 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) | 0.981 | 11 | 265 |
GO:0042952
GO:0047570 GO:0047575 GO:0051920 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar