F486544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 950 | 392 | 1900 | 411 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100011909|Ga0068869_1000119094 |
| Length | 448 |
| Sequence | MRPLAAAIKIRLRECALYIAHSRIILDHTARELRSSTQRTSVPSAHPAPCEGVSTVTRPRLPTKITVWNGWTDVQAENFTRLLDQYNKEHPDVQVTQLVTPSDQVLQKVLTAVRGNSAPDVAYMFGSWSPNIAEIPQVVNMAEYVKQPDWKWDDFYPGERAAATVGDKVVGVPALVDNLAIVYNKTLFEQAGLTPPTSAAAKLTDPAKGQYGWSIPADGSEDTVWHYLPMLWEAGGDLLTPDNQHAAFNSEAGVKALTTLQQMAVTDKSLYVDTTNQEYSKLFTAGKIGMLVTGPWDLGTFSDVDYGVQIMPTYTGSAGGHQTISGPDNWVVFDNGAQRKQAAIDFVKWLTAAPQVKSTSLTTADLPTRISVGDDSAFVAELNEKQPGSEVFVHNLANAQKARPTVSQYPKISEALGQAIVSVLLGKAQPADALNTAAQTTDAALAEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 242 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 245 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 380 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 382 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 383 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 386 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 387 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 388 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 389 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 390 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 391 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 392 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0.63 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.05 |
| Nodule | 0 |
| Rhizoplane | 8.32 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100011909 | 3300005334 | Bacteria | 5722 |
| 2 | JGI24752J21851_1002611 | 3300001976 | Bacteria | 2399 |
| 3 | JGI24746J21847_1000089 | 3300001977 | Bacteria | 10008 |
| 4 | JGI24743J22301_10000709 | 3300001991 | Bacteria | 4122 |
| 5 | JGI24033J26618_1000486 | 3300002155 | Bacteria | 3902 |
| 6 | JGI24751J29686_10000684 | 3300002459 | Bacteria | 8434 |
| 7 | JGI24751J29686_10009198 | 3300002459 | Bacteria | 2029 |
| 8 | JGI24751J29686_10016832 | 3300002459 | Bacteria | 1509 |
| 9 | JGI25404J52841_10001437 | 3300003659 | Bacteria | 4191 |
| 10 | Ga0055540_1001155 | 3300003792 | Bacteria | 16426 |
| 11 | Ga0055540_1002276 | 3300003792 | Bacteria | 10354 |
| 12 | Ga0058861_11975033 | 3300004800 | Bacteria | 1991 |
| 13 | Ga0058862_10034740 | 3300004803 | Bacteria | 1396 |
| 14 | Ga0070658_10093466 | 3300005327 | Bacteria | 2481 |
| 15 | Ga0070683_100199128 | 3300005329 | Bacteria | 1902 |
| 16 | Ga0070670_100088619 | 3300005331 | Bacteria | 2660 |
| 17 | Ga0068869_100068037 | 3300005334 | Bacteria | 2629 |
| 18 | Ga0070680_100072410 | 3300005336 | Bacteria | 2832 |
| 19 | Ga0070682_100022719 | 3300005337 | Bacteria | 3718 |
| 20 | Ga0070682_100049408 | 3300005337 | Bacteria | 2622 |
| 21 | Ga0068868_100000529 | 3300005338 | Bacteria | 25593 |
| 22 | Ga0068868_100014372 | 3300005338 | Bacteria | 5834 |
| 23 | Ga0070660_100188515 | 3300005339 | Bacteria | 1670 |
| 24 | Ga0070660_100222383 | 3300005339 | Bacteria | 1535 |
| 25 | Ga0070691_10011823 | 3300005341 | Bacteria | 3994 |
| 26 | Ga0070661_100005479 | 3300005344 | Bacteria | 8752 |
| 27 | Ga0070661_100009141 | 3300005344 | Bacteria | 6848 |
| 28 | Ga0070668_100005441 | 3300005347 | Bacteria | 9451 |
| 29 | Ga0070668_100055714 | 3300005347 | Bacteria | 3052 |
| 30 | Ga0070675_100063813 | 3300005354 | Bacteria | 3045 |
| 31 | Ga0070675_100313505 | 3300005354 | Bacteria | 1384 |
| 32 | Ga0070671_100010460 | 3300005355 | Bacteria | 7442 |
| 33 | Ga0070671_100013019 | 3300005355 | Bacteria | 6704 |
| 34 | Ga0070671_100047247 | 3300005355 | Bacteria | 3580 |
| 35 | Ga0070674_100002482 | 3300005356 | Bacteria | 10217 |
| 36 | Ga0070674_100003430 | 3300005356 | Bacteria | 8897 |
| 37 | Ga0070674_100021807 | 3300005356 | Bacteria | 4121 |
| 38 | Ga0070673_100010279 | 3300005364 | Bacteria | 6329 |
| 39 | Ga0070688_100005859 | 3300005365 | Bacteria | 6503 |
| 40 | Ga0070667_100002267 | 3300005367 | Bacteria | 16931 |
| 41 | Ga0070667_100105326 | 3300005367 | Bacteria | 2441 |
| 42 | Ga0070667_100212282 | 3300005367 | Bacteria | 1721 |
| 43 | Ga0070703_10000001 | 3300005406 | Bacteria | 202194 |
| 44 | Ga0070703_10010304 | 3300005406 | Bacteria | 2634 |
| 45 | Ga0070709_10000243 | 3300005434 | Bacteria | 35120 |
| 46 | Ga0070709_10000794 | 3300005434 | Bacteria | 17668 |
| 47 | Ga0070709_10012534 | 3300005434 | Bacteria | 4746 |
| 48 | Ga0070709_10022973 | 3300005434 | Bacteria | 3656 |
| 49 | Ga0070709_10079546 | 3300005434 | Bacteria | 2135 |
| 50 | Ga0070709_10173787 | 3300005434 | Bacteria | 1507 |
| 51 | Ga0070714_100000640 | 3300005435 | Bacteria | 24879 |
| 52 | Ga0070714_100004478 | 3300005435 | Bacteria | 10525 |
| 53 | Ga0070714_100040816 | 3300005435 | Bacteria | 3912 |
| 54 | Ga0070714_100042573 | 3300005435 | Bacteria | 3837 |
| 55 | Ga0070714_100060030 | 3300005435 | Bacteria | 3263 |
| 56 | Ga0070714_100180351 | 3300005435 | Bacteria | 1921 |
| 57 | Ga0070714_100180693 | 3300005435 | Bacteria | 1919 |
| 58 | Ga0070713_100000428 | 3300005436 | Bacteria | 26844 |
| 59 | Ga0070713_100004385 | 3300005436 | Bacteria | 9479 |
| 60 | Ga0070713_100021199 | 3300005436 | Bacteria | 4993 |
| 61 | Ga0070713_100023985 | 3300005436 | Bacteria | 4744 |
| 62 | Ga0070713_100025930 | 3300005436 | Bacteria | 4593 |
| 63 | Ga0070713_100113829 | 3300005436 | Bacteria | 2362 |
| 64 | Ga0070710_10000101 | 3300005437 | Bacteria | 39498 |
| 65 | Ga0070710_10000900 | 3300005437 | Bacteria | 14236 |
| 66 | Ga0070710_10001923 | 3300005437 | Bacteria | 9836 |
| 67 | Ga0070710_10003412 | 3300005437 | Bacteria | 7527 |
| 68 | Ga0070710_10073616 | 3300005437 | Bacteria | 1976 |
| 69 | Ga0070701_10003486 | 3300005438 | Bacteria | 6233 |
| 70 | Ga0070701_10023934 | 3300005438 | Bacteria | 2948 |
| 71 | Ga0070711_100000437 | 3300005439 | Bacteria | 21680 |
| 72 | Ga0070711_100001095 | 3300005439 | Bacteria | 14465 |
| 73 | Ga0070711_100001607 | 3300005439 | Bacteria | 12467 |
| 74 | Ga0070711_100004296 | 3300005439 | Bacteria | 8388 |
| 75 | Ga0070711_100004473 | 3300005439 | Bacteria | 8258 |
| 76 | Ga0070711_100105261 | 3300005439 | Bacteria | 2060 |
| 77 | Ga0070711_100147979 | 3300005439 | Bacteria | 1768 |
| 78 | Ga0070705_100018343 | 3300005440 | Bacteria | 3667 |
| 79 | Ga0070705_100027798 | 3300005440 | Bacteria | 3091 |
| 80 | Ga0070705_100038364 | 3300005440 | Bacteria | 2710 |
| 81 | Ga0070700_100008542 | 3300005441 | Bacteria | 5575 |
| 82 | Ga0070700_100009104 | 3300005441 | Bacteria | 5441 |
| 83 | Ga0070700_100018846 | 3300005441 | Bacteria | 3974 |
| 84 | Ga0070700_100049200 | 3300005441 | Bacteria | 2616 |
| 85 | Ga0070694_100015852 | 3300005444 | Bacteria | 4741 |
| 86 | Ga0070694_100033732 | 3300005444 | Bacteria | 3371 |
| 87 | Ga0070694_100041620 | 3300005444 | Bacteria | 3066 |
| 88 | Ga0070708_100001067 | 3300005445 | Bacteria | 20944 |
| 89 | Ga0070708_100287649 | 3300005445 | Bacteria | 1547 |
| 90 | Ga0070663_100004269 | 3300005455 | Bacteria | 8363 |
| 91 | Ga0070663_100018208 | 3300005455 | Bacteria | 4599 |
| 92 | Ga0070663_100140945 | 3300005455 | Bacteria | 1841 |
| 93 | Ga0070678_100009361 | 3300005456 | Bacteria | 5929 |
| 94 | Ga0070678_100067738 | 3300005456 | Bacteria | 2658 |
| 95 | Ga0070662_100009027 | 3300005457 | Bacteria | 6502 |
| 96 | Ga0070662_100017040 | 3300005457 | Bacteria | 4889 |
| 97 | Ga0070662_100044175 | 3300005457 | Bacteria | 3190 |
| 98 | Ga0070681_10126386 | 3300005458 | Bacteria | 2489 |
| 99 | Ga0068867_100001323 | 3300005459 | Bacteria | 17157 |
| 100 | Ga0068867_100002000 | 3300005459 | Bacteria | 14225 |
| 101 | Ga0068867_100149122 | 3300005459 | Bacteria | 1835 |
| 102 | Ga0070685_10050343 | 3300005466 | Bacteria | 2406 |
| 103 | Ga0070706_100003990 | 3300005467 | Bacteria | 14367 |
| 104 | Ga0070706_100010233 | 3300005467 | Bacteria | 8717 |
| 105 | Ga0070706_100030567 | 3300005467 | Bacteria | 4964 |
| 106 | Ga0070706_100298265 | 3300005467 | Bacteria | 1504 |
| 107 | Ga0070707_100000041 | 3300005468 | Bacteria | 111077 |
| 108 | Ga0070707_100008503 | 3300005468 | Bacteria | 9535 |
| 109 | Ga0070707_100011276 | 3300005468 | Bacteria | 8333 |
| 110 | Ga0070707_100031450 | 3300005468 | Bacteria | 5056 |
| 111 | Ga0070707_100140216 | 3300005468 | Bacteria | 2353 |
| 112 | Ga0070698_100000082 | 3300005471 | Bacteria | 73573 |
| 113 | Ga0070698_100030094 | 3300005471 | Bacteria | 5633 |
| 114 | Ga0070698_100051050 | 3300005471 | Bacteria | 4214 |
| 115 | Ga0070698_100075801 | 3300005471 | Bacteria | 3367 |
| 116 | Ga0070698_100173688 | 3300005471 | Bacteria | 2095 |
| 117 | Ga0070684_100003351 | 3300005535 | Bacteria | 12004 |
| 118 | Ga0070684_100031025 | 3300005535 | Bacteria | 4547 |
| 119 | Ga0070684_100082513 | 3300005535 | Bacteria | 2846 |
| 120 | Ga0070697_100036724 | 3300005536 | Bacteria | 3958 |
| 121 | Ga0070697_100049392 | 3300005536 | Bacteria | 3415 |
| 122 | Ga0068853_100008397 | 3300005539 | Bacteria | 8294 |
| 123 | Ga0068853_100016775 | 3300005539 | Bacteria | 6034 |
| 124 | Ga0068853_100049796 | 3300005539 | Bacteria | 3601 |
| 125 | Ga0068853_100069006 | 3300005539 | Bacteria | 3074 |
| 126 | Ga0070672_100162157 | 3300005543 | Bacteria | 1856 |
| 127 | Ga0070695_100010024 | 3300005545 | Bacteria | 5651 |
| 128 | Ga0070695_100139249 | 3300005545 | Bacteria | 1681 |
| 129 | Ga0070695_100182054 | 3300005545 | Bacteria | 1490 |
| 130 | Ga0070696_100003305 | 3300005546 | Bacteria | 10765 |
| 131 | Ga0070696_100005272 | 3300005546 | Bacteria | 8629 |
| 132 | Ga0070696_100058492 | 3300005546 | Bacteria | 2692 |
| 133 | Ga0070696_100063569 | 3300005546 | Bacteria | 2585 |
| 134 | Ga0070693_100001858 | 3300005547 | Bacteria | 9651 |
| 135 | Ga0070665_100001745 | 3300005548 | Bacteria | 24881 |
| 136 | Ga0070665_100009958 | 3300005548 | Bacteria | 9614 |
| 137 | Ga0070665_100022355 | 3300005548 | Bacteria | 6364 |
| 138 | Ga0070665_100045725 | 3300005548 | Bacteria | 4396 |
| 139 | Ga0070665_100096225 | 3300005548 | Bacteria | 2966 |
| 140 | Ga0070704_100000706 | 3300005549 | Bacteria | 16275 |
| 141 | Ga0070704_100004595 | 3300005549 | Bacteria | 7982 |
| 142 | Ga0070704_100007803 | 3300005549 | Bacteria | 6381 |
| 143 | Ga0068855_100055086 | 3300005563 | Bacteria | 4672 |
| 144 | Ga0068855_100076751 | 3300005563 | Bacteria | 3876 |
| 145 | Ga0070664_100002582 | 3300005564 | Bacteria | 14605 |
| 146 | Ga0068857_100017591 | 3300005577 | Bacteria | 6267 |
| 147 | Ga0068854_100005243 | 3300005578 | Bacteria | 8178 |
| 148 | Ga0070702_100001404 | 3300005615 | Bacteria | 9838 |
| 149 | Ga0070702_100017389 | 3300005615 | Bacteria | 3708 |
| 150 | Ga0070702_100148897 | 3300005615 | Unclassified | 1500 |
| 151 | Ga0068852_100156097 | 3300005616 | Bacteria | 2126 |
| 152 | Ga0068859_100003134 | 3300005617 | Bacteria | 16809 |
| 153 | Ga0068864_100020685 | 3300005618 | Bacteria | 5506 |
| 154 | Ga0068864_100098059 | 3300005618 | Bacteria | 2595 |
| 155 | Ga0068864_100114068 | 3300005618 | Bacteria | 2409 |
| 156 | Ga0068866_10000376 | 3300005718 | Bacteria | 21007 |
| 157 | Ga0068866_10013060 | 3300005718 | Bacteria | 3633 |
| 158 | Ga0068866_10057117 | 3300005718 | Bacteria | 2010 |
| 159 | Ga0068861_100025534 | 3300005719 | Bacteria | 4286 |
| 160 | Ga0068861_100030613 | 3300005719 | Bacteria | 3946 |
| 161 | Ga0068861_100052331 | 3300005719 | Bacteria | 3103 |
| 162 | Ga0068870_10029598 | 3300005840 | Bacteria | 2760 |
| 163 | Ga0068863_100001514 | 3300005841 | Bacteria | 22958 |
| 164 | Ga0068863_100006801 | 3300005841 | Bacteria | 11207 |
| 165 | Ga0068858_100002465 | 3300005842 | Bacteria | 18668 |
| 166 | Ga0068858_100071177 | 3300005842 | Bacteria | 3225 |
| 167 | Ga0068858_100080445 | 3300005842 | Bacteria | 3028 |
| 168 | Ga0068858_100113426 | 3300005842 | Bacteria | 2531 |
| 169 | Ga0068860_100025928 | 3300005843 | Bacteria | 5656 |
| 170 | Ga0068860_100115207 | 3300005843 | Bacteria | 2570 |
| 171 | Ga0068860_100249342 | 3300005843 | Bacteria | 1728 |
| 172 | Ga0068862_100043121 | 3300005844 | Bacteria | 3845 |
| 173 | Ga0081455_10001614 | 3300005937 | Bacteria | 27559 |
| 174 | Ga0081455_10003773 | 3300005937 | Bacteria | 17295 |
| 175 | Ga0081455_10043919 | 3300005937 | Bacteria | 3905 |
| 176 | Ga0081455_10071142 | 3300005937 | Bacteria | 2885 |
| 177 | Ga0081538_10000404 | 3300005981 | Bacteria | 48911 |
| 178 | Ga0081540_1000505 | 3300005983 | Bacteria | 38435 |
| 179 | Ga0081539_10021040 | 3300005985 | Bacteria | 4377 |
| 180 | Ga0070717_10000956 | 3300006028 | Bacteria | 19241 |
| 181 | Ga0070717_10007851 | 3300006028 | Bacteria | 7943 |
| 182 | Ga0070717_10034864 | 3300006028 | Bacteria | 4070 |
| 183 | Ga0070717_10047787 | 3300006028 | Bacteria | 3508 |
| 184 | Ga0070717_10064802 | 3300006028 | Bacteria | 3036 |
| 185 | Ga0075365_10015384 | 3300006038 | Bacteria | 4627 |
| 186 | Ga0075365_10090040 | 3300006038 | Bacteria | 2089 |
| 187 | Ga0075365_10140439 | 3300006038 | Bacteria | 1677 |
| 188 | Ga0075363_100000787 | 3300006048 | Bacteria | 10932 |
| 189 | Ga0075363_100060987 | 3300006048 | Bacteria | 2031 |
| 190 | Ga0075363_100077904 | 3300006048 | Bacteria | 1809 |
| 191 | Ga0075363_100087743 | 3300006048 | Bacteria | 1709 |
| 192 | Ga0075363_100115160 | 3300006048 | Bacteria | 1497 |
| 193 | Ga0075364_10000184 | 3300006051 | Bacteria | 28604 |
| 194 | Ga0075364_10006965 | 3300006051 | Bacteria | 6679 |
| 195 | Ga0075364_10076198 | 3300006051 | Bacteria | 2213 |
| 196 | Ga0075432_10000387 | 3300006058 | Bacteria | 12750 |
| 197 | Ga0075432_10004840 | 3300006058 | Bacteria | 4582 |
| 198 | Ga0070715_10004042 | 3300006163 | Bacteria | 4759 |
| 199 | Ga0070715_10013894 | 3300006163 | Bacteria | 2968 |
| 200 | Ga0070715_10023722 | 3300006163 | Bacteria | 2407 |
| 201 | Ga0070716_100000560 | 3300006173 | Bacteria | 15555 |
| 202 | Ga0070716_100002661 | 3300006173 | Bacteria | 8264 |
| 203 | Ga0070716_100004017 | 3300006173 | Bacteria | 6984 |
| 204 | Ga0070716_100005420 | 3300006173 | Bacteria | 6179 |
| 205 | Ga0070716_100006565 | 3300006173 | Bacteria | 5687 |
| 206 | Ga0070712_100001062 | 3300006175 | Bacteria | 16596 |
| 207 | Ga0070712_100002191 | 3300006175 | Bacteria | 12010 |
| 208 | Ga0070712_100012459 | 3300006175 | Bacteria | 5406 |
| 209 | Ga0070712_100017727 | 3300006175 | Bacteria | 4612 |
| 210 | Ga0070712_100102759 | 3300006175 | Bacteria | 2117 |
| 211 | Ga0070712_100126999 | 3300006175 | Bacteria | 1928 |
| 212 | Ga0075367_10001919 | 3300006178 | Bacteria | 9229 |
| 213 | Ga0075367_10088124 | 3300006178 | Bacteria | 1886 |
| 214 | Ga0075369_10001370 | 3300006186 | Bacteria | 8293 |
| 215 | Ga0075369_10037641 | 3300006186 | Bacteria | 2061 |
| 216 | Ga0097621_100015140 | 3300006237 | Bacteria | 5795 |
| 217 | Ga0097621_100073596 | 3300006237 | Bacteria | 2828 |
| 218 | Ga0075370_10008783 | 3300006353 | Bacteria | 5215 |
| 219 | Ga0075370_10033932 | 3300006353 | Bacteria | 2860 |
| 220 | Ga0075370_10044383 | 3300006353 | Bacteria | 2513 |
| 221 | Ga0068871_100018339 | 3300006358 | Bacteria | 5316 |
| 222 | Ga0068871_100189674 | 3300006358 | Bacteria | 1770 |
| 223 | Ga0075428_100065799 | 3300006844 | Bacteria | 3969 |
| 224 | Ga0075428_100089059 | 3300006844 | Bacteria | 3366 |
| 225 | Ga0075430_100051156 | 3300006846 | Bacteria | 3482 |
| 226 | Ga0075431_100036726 | 3300006847 | Bacteria | 5046 |
| 227 | Ga0075433_10005527 | 3300006852 | Bacteria | 9923 |
| 228 | Ga0075433_10012875 | 3300006852 | Bacteria | 6777 |
| 229 | Ga0075433_10163690 | 3300006852 | Bacteria | 1980 |
| 230 | Ga0075434_100003943 | 3300006871 | Bacteria | 13290 |
| 231 | Ga0075434_100005157 | 3300006871 | Bacteria | 11860 |
| 232 | Ga0075434_100008894 | 3300006871 | Bacteria | 9348 |
| 233 | Ga0075434_100014932 | 3300006871 | Bacteria | 7431 |
| 234 | Ga0068865_100000828 | 3300006881 | Bacteria | 17443 |
| 235 | Ga0068865_100022777 | 3300006881 | Bacteria | 4092 |
| 236 | Ga0068865_100028975 | 3300006881 | Bacteria | 3669 |
| 237 | Ga0068865_100029811 | 3300006881 | Bacteria | 3624 |
| 238 | Ga0097620_100003133 | 3300006931 | Bacteria | 16809 |
| 239 | Ga0075435_100007491 | 3300007076 | Bacteria | 7786 |
| 240 | Ga0075435_100107436 | 3300007076 | Bacteria | 2318 |
| 241 | Ga0105251_10017533 | 3300009011 | Bacteria | 3834 |
| 242 | Ga0111539_10184592 | 3300009094 | Bacteria | 2436 |
| 243 | Ga0105245_10003220 | 3300009098 | Bacteria | 14625 |
| 244 | Ga0105245_10018583 | 3300009098 | Bacteria | 6080 |
| 245 | Ga0105245_10107688 | 3300009098 | Bacteria | 2588 |
| 246 | Ga0105245_10116217 | 3300009098 | Bacteria | 2494 |
| 247 | Ga0105245_10133233 | 3300009098 | Bacteria | 2333 |
| 248 | Ga0105245_10162114 | 3300009098 | Bacteria | 2123 |
| 249 | Ga0105245_10171307 | 3300009098 | Bacteria | 2067 |
| 250 | Ga0105247_10000334 | 3300009101 | Bacteria | 41242 |
| 251 | Ga0105247_10029448 | 3300009101 | Bacteria | 3327 |
| 252 | Ga0105247_10069989 | 3300009101 | Bacteria | 2191 |
| 253 | Ga0114129_10004398 | 3300009147 | Bacteria | 19873 |
| 254 | Ga0114129_10018631 | 3300009147 | Bacteria | 9882 |
| 255 | Ga0114129_10019233 | 3300009147 | Bacteria | 9728 |
| 256 | Ga0114129_10026156 | 3300009147 | Bacteria | 8264 |
| 257 | Ga0114129_10039891 | 3300009147 | Bacteria | 6623 |
| 258 | Ga0114129_10223859 | 3300009147 | Bacteria | 2537 |
| 259 | Ga0105243_10005418 | 3300009148 | Bacteria | 9960 |
| 260 | Ga0105243_10006751 | 3300009148 | Bacteria | 8853 |
| 261 | Ga0105243_10007191 | 3300009148 | Bacteria | 8556 |
| 262 | Ga0105243_10116559 | 3300009148 | Bacteria | 2244 |
| 263 | Ga0105241_10019951 | 3300009174 | Bacteria | 4948 |
| 264 | Ga0105242_10000620 | 3300009176 | Bacteria | 27832 |
| 265 | Ga0105242_10002226 | 3300009176 | Bacteria | 15303 |
| 266 | Ga0105242_10002528 | 3300009176 | Bacteria | 14350 |
| 267 | Ga0105242_10042211 | 3300009176 | Bacteria | 3682 |
| 268 | Ga0105242_10052953 | 3300009176 | Bacteria | 3313 |
| 269 | Ga0105248_10004419 | 3300009177 | Bacteria | 15561 |
| 270 | Ga0105248_10025304 | 3300009177 | Bacteria | 6599 |
| 271 | Ga0105248_10044839 | 3300009177 | Bacteria | 4960 |
| 272 | Ga0105237_10000178 | 3300009545 | Bacteria | 89960 |
| 273 | Ga0105237_10002564 | 3300009545 | Bacteria | 22427 |
| 274 | Ga0105237_10034235 | 3300009545 | Bacteria | 5144 |
| 275 | Ga0105237_10051382 | 3300009545 | Bacteria | 4140 |
| 276 | Ga0105238_10093468 | 3300009551 | Bacteria | 2995 |
| 277 | Ga0105238_10195444 | 3300009551 | Bacteria | 1999 |
| 278 | Ga0105249_10000767 | 3300009553 | Bacteria | 28791 |
| 279 | Ga0105249_10012184 | 3300009553 | Bacteria | 7573 |
| 280 | Ga0105249_10053836 | 3300009553 | Bacteria | 3678 |
| 281 | Ga0105249_10108817 | 3300009553 | Bacteria | 2617 |
| 282 | Ga0105249_10172159 | 3300009553 | Bacteria | 2101 |
| 283 | Ga0105239_10002879 | 3300010375 | Bacteria | 21522 |
| 284 | Ga0105239_10007516 | 3300010375 | Bacteria | 12498 |
| 285 | Ga0105239_10030663 | 3300010375 | Bacteria | 5914 |
| 286 | Ga0105239_10059987 | 3300010375 | Bacteria | 4174 |
| 287 | Ga0105239_10228472 | 3300010375 | Bacteria | 2088 |
| 288 | Ga0105239_10269472 | 3300010375 | Archaea | 1915 |
| 289 | Ga0105246_10066414 | 3300011119 | Bacteria | 2525 |
| 290 | Ga0105246_10140320 | 3300011119 | Bacteria | 1816 |
| 291 | Ga0157373_10015473 | 3300013100 | Bacteria | 5577 |
| 292 | Ga0157371_10099871 | 3300013102 | Bacteria | 2058 |
| 293 | Ga0157370_10030713 | 3300013104 | Bacteria | 5263 |
| 294 | Ga0157369_10003613 | 3300013105 | Bacteria | 18373 |
| 295 | Ga0157374_10035561 | 3300013296 | Bacteria | 4558 |
| 296 | Ga0157374_10067899 | 3300013296 | Bacteria | 3353 |
| 297 | Ga0157374_10232882 | 3300013296 | Bacteria | 1810 |
| 298 | Ga0157378_10001690 | 3300013297 | Bacteria | 19860 |
| 299 | Ga0157378_10018845 | 3300013297 | Bacteria | 6066 |
| 300 | Ga0157378_10019027 | 3300013297 | Bacteria | 6035 |
| 301 | Ga0157378_10089398 | 3300013297 | Bacteria | 2797 |
| 302 | Ga0163162_10026392 | 3300013306 | Bacteria | 5740 |
| 303 | Ga0163162_10027146 | 3300013306 | Bacteria | 5661 |
| 304 | Ga0163162_10174064 | 3300013306 | Bacteria | 2277 |
| 305 | Ga0163162_10205789 | 3300013306 | Bacteria | 2097 |
| 306 | Ga0157372_10171892 | 3300013307 | Bacteria | 2507 |
| 307 | Ga0157372_10341252 | 3300013307 | Bacteria | 1745 |
| 308 | Ga0157375_10003452 | 3300013308 | Bacteria | 13692 |
| 309 | Ga0157375_10042351 | 3300013308 | Bacteria | 4407 |
| 310 | Ga0157375_10122797 | 3300013308 | Bacteria | 2709 |
| 311 | Ga0163163_10002897 | 3300014325 | Bacteria | 14510 |
| 312 | Ga0163163_10008170 | 3300014325 | Bacteria | 9282 |
| 313 | Ga0163163_10021984 | 3300014325 | Bacteria | 6030 |
| 314 | Ga0163163_10032021 | 3300014325 | Bacteria | 5078 |
| 315 | Ga0163163_10067769 | 3300014325 | Bacteria | 3549 |
| 316 | Ga0163163_10385973 | 3300014325 | Bacteria | 1458 |
| 317 | Ga0157380_10003813 | 3300014326 | Bacteria | 10374 |
| 318 | Ga0157377_10007912 | 3300014745 | Bacteria | 5159 |
| 319 | Ga0157377_10122128 | 3300014745 | Bacteria | 1580 |
| 320 | Ga0157377_10146693 | 3300014745 | Bacteria | 1455 |
| 321 | Ga0157379_10004932 | 3300014968 | Bacteria | 11450 |
| 322 | Ga0157379_10069475 | 3300014968 | Bacteria | 3150 |
| 323 | Ga0157376_10022035 | 3300014969 | Bacteria | 4957 |
| 324 | Ga0157376_10023837 | 3300014969 | Bacteria | 4798 |
| 325 | Ga0157376_10083979 | 3300014969 | Bacteria | 2741 |
| 326 | Ga0163161_10061975 | 3300017792 | Bacteria | 2724 |
| 327 | Ga0163161_10171762 | 3300017792 | Bacteria | 1658 |
| 328 | Ga0206352_10246956 | 3300020078 | Bacteria | 1383 |
| 329 | Ga0206353_11818343 | 3300020082 | Bacteria | 4369 |
| 330 | Ga0213875_10000570 | 3300021388 | Bacteria | 30105 |
| 331 | Ga0213875_10000604 | 3300021388 | Bacteria | 29093 |
| 332 | Ga0224712_10040519 | 3300022467 | Bacteria | 1753 |
| 333 | Ga0224712_10065178 | 3300022467 | Bacteria | 1463 |
| 334 | Ga0209051_1000528 | 3300025303 | Bacteria | 47444 |
| 335 | Ga0209051_1001208 | 3300025303 | Bacteria | 23322 |
| 336 | Ga0209051_1006114 | 3300025303 | Bacteria | 6849 |
| 337 | Ga0209051_1008439 | 3300025303 | Bacteria | 5451 |
| 338 | Ga0209051_1028496 | 3300025303 | Bacteria | 2205 |
| 339 | Ga0207656_10030145 | 3300025321 | Bacteria | 2239 |
| 340 | Ga0207653_10000004 | 3300025885 | Bacteria | 263142 |
| 341 | Ga0207653_10002058 | 3300025885 | Bacteria | 6408 |
| 342 | Ga0207692_10001870 | 3300025898 | Bacteria | 7987 |
| 343 | Ga0207642_10002962 | 3300025899 | Bacteria | 5313 |
| 344 | Ga0207642_10012124 | 3300025899 | Bacteria | 3101 |
| 345 | Ga0207642_10030974 | 3300025899 | Bacteria | 2236 |
| 346 | Ga0207710_10001088 | 3300025900 | Bacteria | 13985 |
| 347 | Ga0207710_10081651 | 3300025900 | Bacteria | 1501 |
| 348 | Ga0207688_10000352 | 3300025901 | Bacteria | 21384 |
| 349 | Ga0207688_10001514 | 3300025901 | Bacteria | 12214 |
| 350 | Ga0207688_10014587 | 3300025901 | Bacteria | 4269 |
| 351 | Ga0207647_10063954 | 3300025904 | Bacteria | 2237 |
| 352 | Ga0207647_10079885 | 3300025904 | Bacteria | 1962 |
| 353 | Ga0207685_10001280 | 3300025905 | Bacteria | 5144 |
| 354 | Ga0207685_10003910 | 3300025905 | Bacteria | 3698 |
| 355 | Ga0207699_10000156 | 3300025906 | Bacteria | 42514 |
| 356 | Ga0207699_10002495 | 3300025906 | Bacteria | 8691 |
| 357 | Ga0207699_10028701 | 3300025906 | Bacteria | 3095 |
| 358 | Ga0207643_10000055 | 3300025908 | Bacteria | 73929 |
| 359 | Ga0207643_10002720 | 3300025908 | Bacteria | 9565 |
| 360 | Ga0207684_10000339 | 3300025910 | Bacteria | 65102 |
| 361 | Ga0207684_10000911 | 3300025910 | Bacteria | 33666 |
| 362 | Ga0207684_10057831 | 3300025910 | Bacteria | 3290 |
| 363 | Ga0207654_10092056 | 3300025911 | Bacteria | 1851 |
| 364 | Ga0207671_10008270 | 3300025914 | Bacteria | 8850 |
| 365 | Ga0207671_10011790 | 3300025914 | Bacteria | 7076 |
| 366 | Ga0207693_10000199 | 3300025915 | Bacteria | 54571 |
| 367 | Ga0207693_10001171 | 3300025915 | Bacteria | 23404 |
| 368 | Ga0207693_10001690 | 3300025915 | Bacteria | 19437 |
| 369 | Ga0207693_10002490 | 3300025915 | Bacteria | 16019 |
| 370 | Ga0207693_10005402 | 3300025915 | Bacteria | 10677 |
| 371 | Ga0207693_10045359 | 3300025915 | Bacteria | 3454 |
| 372 | Ga0207693_10061181 | 3300025915 | Bacteria | 2949 |
| 373 | Ga0207693_10089600 | 3300025915 | Bacteria | 2411 |
| 374 | Ga0207693_10093630 | 3300025915 | Bacteria | 2355 |
| 375 | Ga0207663_10001603 | 3300025916 | Bacteria | 10631 |
| 376 | Ga0207663_10005265 | 3300025916 | Bacteria | 6513 |
| 377 | Ga0207663_10006245 | 3300025916 | Bacteria | 6079 |
| 378 | Ga0207663_10014279 | 3300025916 | Bacteria | 4343 |
| 379 | Ga0207663_10017362 | 3300025916 | Bacteria | 4008 |
| 380 | Ga0207663_10021617 | 3300025916 | Bacteria | 3665 |
| 381 | Ga0207662_10004973 | 3300025918 | Bacteria | 7033 |
| 382 | Ga0207657_10030438 | 3300025919 | Bacteria | 4899 |
| 383 | Ga0207657_10072009 | 3300025919 | Bacteria | 2925 |
| 384 | Ga0207649_10020440 | 3300025920 | Bacteria | 3798 |
| 385 | Ga0207649_10082505 | 3300025920 | Bacteria | 2084 |
| 386 | Ga0207646_10000061 | 3300025922 | Bacteria | 151425 |
| 387 | Ga0207646_10005885 | 3300025922 | Bacteria | 12805 |
| 388 | Ga0207646_10007478 | 3300025922 | Bacteria | 11089 |
| 389 | Ga0207646_10009346 | 3300025922 | Bacteria | 9691 |
| 390 | Ga0207646_10042854 | 3300025922 | Bacteria | 4066 |
| 391 | Ga0207650_10001024 | 3300025925 | Bacteria | 20982 |
| 392 | Ga0207650_10020009 | 3300025925 | Bacteria | 4713 |
| 393 | Ga0207659_10138959 | 3300025926 | Bacteria | 1884 |
| 394 | Ga0207687_10001147 | 3300025927 | Bacteria | 18035 |
| 395 | Ga0207687_10029528 | 3300025927 | Bacteria | 3689 |
| 396 | Ga0207687_10165851 | 3300025927 | Bacteria | 1699 |
| 397 | Ga0207700_10000063 | 3300025928 | Bacteria | 65696 |
| 398 | Ga0207700_10016567 | 3300025928 | Bacteria | 4900 |
| 399 | Ga0207700_10026919 | 3300025928 | Bacteria | 4018 |
| 400 | Ga0207700_10029262 | 3300025928 | Bacteria | 3884 |
| 401 | Ga0207700_10029504 | 3300025928 | Bacteria | 3871 |
| 402 | Ga0207700_10055669 | 3300025928 | Bacteria | 2974 |
| 403 | Ga0207700_10109651 | 3300025928 | Bacteria | 2219 |
| 404 | Ga0207664_10000196 | 3300025929 | Bacteria | 45388 |
| 405 | Ga0207664_10001029 | 3300025929 | Bacteria | 18674 |
| 406 | Ga0207664_10002329 | 3300025929 | Bacteria | 12548 |
| 407 | Ga0207664_10021830 | 3300025929 | Bacteria | 4770 |
| 408 | Ga0207664_10024393 | 3300025929 | Bacteria | 4544 |
| 409 | Ga0207664_10032064 | 3300025929 | Bacteria | 4025 |
| 410 | Ga0207664_10044307 | 3300025929 | Bacteria | 3483 |
| 411 | Ga0207664_10047539 | 3300025929 | Bacteria | 3371 |
| 412 | Ga0207664_10056440 | 3300025929 | Bacteria | 3119 |
| 413 | Ga0207664_10243144 | 3300025929 | Bacteria | 1568 |
| 414 | Ga0207664_10272932 | 3300025929 | Bacteria | 1482 |
| 415 | Ga0207664_10331043 | 3300025929 | Bacteria | 1345 |
| 416 | Ga0207644_10005208 | 3300025931 | Bacteria | 8493 |
| 417 | Ga0207644_10031027 | 3300025931 | Bacteria | 3721 |
| 418 | Ga0207644_10103641 | 3300025931 | Bacteria | 2141 |
| 419 | Ga0207690_10028152 | 3300025932 | Bacteria | 3559 |
| 420 | Ga0207690_10054150 | 3300025932 | Bacteria | 2696 |
| 421 | Ga0207706_10001128 | 3300025933 | Bacteria | 27189 |
| 422 | Ga0207706_10009818 | 3300025933 | Bacteria | 8781 |
| 423 | Ga0207706_10019781 | 3300025933 | Bacteria | 6054 |
| 424 | Ga0207706_10022575 | 3300025933 | Bacteria | 5647 |
| 425 | Ga0207686_10002468 | 3300025934 | Bacteria | 10044 |
| 426 | Ga0207686_10005839 | 3300025934 | Bacteria | 6603 |
| 427 | Ga0207686_10006248 | 3300025934 | Bacteria | 6406 |
| 428 | Ga0207686_10037607 | 3300025934 | Bacteria | 2922 |
| 429 | Ga0207709_10007186 | 3300025935 | Bacteria | 6215 |
| 430 | Ga0207709_10017218 | 3300025935 | Bacteria | 4030 |
| 431 | Ga0207709_10023700 | 3300025935 | Bacteria | 3496 |
| 432 | Ga0207709_10034736 | 3300025935 | Bacteria | 2975 |
| 433 | Ga0207709_10196818 | 3300025935 | Unclassified | 1436 |
| 434 | Ga0207670_10127309 | 3300025936 | Bacteria | 1860 |
| 435 | Ga0207669_10032348 | 3300025937 | Bacteria | 2936 |
| 436 | Ga0207669_10057020 | 3300025937 | Bacteria | 2376 |
| 437 | Ga0207669_10058311 | 3300025937 | Bacteria | 2355 |
| 438 | Ga0207704_10000377 | 3300025938 | Bacteria | 20506 |
| 439 | Ga0207704_10012981 | 3300025938 | Bacteria | 4153 |
| 440 | Ga0207704_10044070 | 3300025938 | Bacteria | 2640 |
| 441 | Ga0207704_10132560 | 3300025938 | Bacteria | 1729 |
| 442 | Ga0207665_10000226 | 3300025939 | Bacteria | 38498 |
| 443 | Ga0207665_10001670 | 3300025939 | Bacteria | 14929 |
| 444 | Ga0207665_10005772 | 3300025939 | Bacteria | 8231 |
| 445 | Ga0207665_10013801 | 3300025939 | Bacteria | 5314 |
| 446 | Ga0207665_10056850 | 3300025939 | Bacteria | 2642 |
| 447 | Ga0207665_10058954 | 3300025939 | Bacteria | 2597 |
| 448 | Ga0207665_10059404 | 3300025939 | Bacteria | 2588 |
| 449 | Ga0207665_10067547 | 3300025939 | Bacteria | 2435 |
| 450 | Ga0207665_10073331 | 3300025939 | Bacteria | 2341 |
| 451 | Ga0207691_10033981 | 3300025940 | Bacteria | 4746 |
| 452 | Ga0207691_10040532 | 3300025940 | Bacteria | 4302 |
| 453 | Ga0207711_10108185 | 3300025941 | Bacteria | 2469 |
| 454 | Ga0207711_10165028 | 3300025941 | Bacteria | 2007 |
| 455 | Ga0207689_10002296 | 3300025942 | Bacteria | 17905 |
| 456 | Ga0207689_10009916 | 3300025942 | Bacteria | 8213 |
| 457 | Ga0207689_10025969 | 3300025942 | Bacteria | 4905 |
| 458 | Ga0207661_10082020 | 3300025944 | Bacteria | 2665 |
| 459 | Ga0207661_10097199 | 3300025944 | Bacteria | 2465 |
| 460 | Ga0207661_10104229 | 3300025944 | Bacteria | 2388 |
| 461 | Ga0207679_10002946 | 3300025945 | Bacteria | 10545 |
| 462 | Ga0207679_10169321 | 3300025945 | Bacteria | 1797 |
| 463 | Ga0207667_10107381 | 3300025949 | Bacteria | 2880 |
| 464 | Ga0207651_10050424 | 3300025960 | Bacteria | 2826 |
| 465 | Ga0207712_10006309 | 3300025961 | Bacteria | 7477 |
| 466 | Ga0207712_10043419 | 3300025961 | Bacteria | 3101 |
| 467 | Ga0207668_10056080 | 3300025972 | Bacteria | 2742 |
| 468 | Ga0207640_10003409 | 3300025981 | Bacteria | 8561 |
| 469 | Ga0207658_10012179 | 3300025986 | Bacteria | 5867 |
| 470 | Ga0207677_10011441 | 3300026023 | Bacteria | 5061 |
| 471 | Ga0207703_10014135 | 3300026035 | Bacteria | 6223 |
| 472 | Ga0207703_10018284 | 3300026035 | Bacteria | 5473 |
| 473 | Ga0207703_10053855 | 3300026035 | Bacteria | 3271 |
| 474 | Ga0207678_10001390 | 3300026067 | Bacteria | 22261 |
| 475 | Ga0207678_10016407 | 3300026067 | Bacteria | 6503 |
| 476 | Ga0207678_10032965 | 3300026067 | Bacteria | 4513 |
| 477 | Ga0207678_10045686 | 3300026067 | Bacteria | 3787 |
| 478 | Ga0207708_10003968 | 3300026075 | Bacteria | 10890 |
| 479 | Ga0207708_10005234 | 3300026075 | Bacteria | 9557 |
| 480 | Ga0207708_10005684 | 3300026075 | Bacteria | 9215 |
| 481 | Ga0207708_10006707 | 3300026075 | Bacteria | 8516 |
| 482 | Ga0207702_10138335 | 3300026078 | Bacteria | 2200 |
| 483 | Ga0207641_10003507 | 3300026088 | Bacteria | 13886 |
| 484 | Ga0207641_10071720 | 3300026088 | Bacteria | 2980 |
| 485 | Ga0207648_10001355 | 3300026089 | Bacteria | 27091 |
| 486 | Ga0207648_10004217 | 3300026089 | Bacteria | 14857 |
| 487 | Ga0207648_10026700 | 3300026089 | Bacteria | 5129 |
| 488 | Ga0207648_10103641 | 3300026089 | Bacteria | 2495 |
| 489 | Ga0207676_10001452 | 3300026095 | Bacteria | 17629 |
| 490 | Ga0207676_10016180 | 3300026095 | Bacteria | 5399 |
| 491 | Ga0207676_10022955 | 3300026095 | Bacteria | 4594 |
| 492 | Ga0207674_10000186 | 3300026116 | Bacteria | 75904 |
| 493 | Ga0207674_10010966 | 3300026116 | Bacteria | 10198 |
| 494 | Ga0207674_10150848 | 3300026116 | Bacteria | 2282 |
| 495 | Ga0207675_100013054 | 3300026118 | Bacteria | 7753 |
| 496 | Ga0207675_100015022 | 3300026118 | Bacteria | 7224 |
| 497 | Ga0207675_100017867 | 3300026118 | Bacteria | 6615 |
| 498 | Ga0207675_100040429 | 3300026118 | Bacteria | 4355 |
| 499 | Ga0207675_100078529 | 3300026118 | Bacteria | 3092 |
| 500 | Ga0207675_100163300 | 3300026118 | Bacteria | 2126 |
| 501 | Ga0207683_10000201 | 3300026121 | Bacteria | 51559 |
| 502 | Ga0207683_10008060 | 3300026121 | Bacteria | 9009 |
| 503 | Ga0207683_10027425 | 3300026121 | Bacteria | 4922 |
| 504 | Ga0207698_10205597 | 3300026142 | Bacteria | 1767 |
| 505 | Ga0207428_10001001 | 3300027907 | Bacteria | 31346 |
| 506 | Ga0207428_10011760 | 3300027907 | Bacteria | 7719 |
| 507 | Ga0268266_10007843 | 3300028379 | Bacteria | 9563 |
| 508 | Ga0268266_10065058 | 3300028379 | Bacteria | 3152 |
| 509 | Ga0268266_10188837 | 3300028379 | Bacteria | 1880 |
| 510 | Ga0268266_10205726 | 3300028379 | Bacteria | 1803 |
| 511 | Ga0268266_10246931 | 3300028379 | Bacteria | 1649 |
| 512 | Ga0268265_10121015 | 3300028380 | Bacteria | 2156 |
| 513 | Ga0268264_10114403 | 3300028381 | Bacteria | 2368 |
| 514 | Ga0265337_1000027 | 3300028556 | Bacteria | 68392 |
| 515 | Ga0265326_10001234 | 3300028558 | Bacteria | 9119 |
| 516 | Ga0265319_1001055 | 3300028563 | Bacteria | 17217 |
| 517 | Ga0265334_10000773 | 3300028573 | Bacteria | 16014 |
| 518 | Ga0265322_10001284 | 3300028654 | Bacteria | 8433 |
| 519 | Ga0265336_10002288 | 3300028666 | Bacteria | 8003 |
| 520 | Ga0265338_10000227 | 3300028800 | Bacteria | 104795 |
| 521 | Ga0265338_10001512 | 3300028800 | Bacteria | 37550 |
| 522 | Ga0265338_10007886 | 3300028800 | Bacteria | 13062 |
| 523 | Ga0265338_10011419 | 3300028800 | Bacteria | 10257 |
| 524 | Ga0265324_10004386 | 3300029957 | Bacteria | 6400 |
| 525 | Ga0265332_10001185 | 3300031238 | Bacteria | 15099 |
| 526 | Ga0265325_10005218 | 3300031241 | Bacteria | 8066 |
| 527 | Ga0265339_10021776 | 3300031249 | Bacteria | 3723 |
| 528 | Ga0265327_10008031 | 3300031251 | Bacteria | 7964 |
| 529 | Ga0265316_10007705 | 3300031344 | Bacteria | 10091 |
| 530 | Ga0307408_100231039 | 3300031548 | Bacteria | 1515 |
| 531 | Ga0265313_10010516 | 3300031595 | Bacteria | 5839 |
| 532 | Ga0265314_10010105 | 3300031711 | Bacteria | 7910 |
| 533 | Ga0307405_10018316 | 3300031731 | Bacteria | 3860 |
| 534 | Ga0307406_10058952 | 3300031901 | Bacteria | 2469 |
| 535 | Ga0307409_100226090 | 3300031995 | Bacteria | 1693 |
| 536 | Ga0307416_100017768 | 3300032002 | Bacteria | 4988 |
| 537 | Ga0307415_100027908 | 3300032126 | Bacteria | 3583 |
| 538 | Ga0373926_0001462 | 3300035083 | Bacteria | 7192 |
| 539 | Ga0373926_0021075 | 3300035083 | Bacteria | 2254 |
| 540 | Ga0373926_0032850 | 3300035083 | Bacteria | 1832 |
| 541 | Ga0373934_0015454 | 3300035086 | Bacteria | 2895 |
| 542 | Ga0373940_0001161 | 3300035088 | Bacteria | 4616 |
| 543 | Ga0373944_0000926 | 3300035089 | Bacteria | 7259 |
| 544 | Ga0373923_0009489 | 3300035111 | Bacteria | 3512 |
| 545 | Ga0373923_0010272 | 3300035111 | Bacteria | 3401 |
| 546 | Ga0373923_0020707 | 3300035111 | Bacteria | 2558 |
| 547 | Ga0373936_0000519 | 3300035113 | Bacteria | 13160 |
| 548 | Ga0373936_0004471 | 3300035113 | Bacteria | 5286 |
| 549 | Ga0373936_0006048 | 3300035113 | Bacteria | 4562 |
| 550 | Ga0373936_0008708 | 3300035113 | Bacteria | 3820 |
| 551 | Ga0373936_0014364 | 3300035113 | Bacteria | 3025 |
| 552 | Ga0373939_0005927 | 3300035114 | Bacteria | 2926 |
| 553 | Ga0373941_0005711 | 3300035115 | Bacteria | 2950 |
| 554 | Ga0373945_0001751 | 3300035116 | Bacteria | 6703 |
| 555 | Ga0373945_0014754 | 3300035116 | Bacteria | 2622 |
| 556 | Ga0373953_0003298 | 3300035117 | Bacteria | 5010 |
| 557 | Ga0373954_0014349 | 3300035118 | Bacteria | 3533 |
| 558 | Ga0373954_0035904 | 3300035118 | Bacteria | 2299 |
| 559 | Ga0373956_0025651 | 3300035119 | Bacteria | 2549 |
| 560 | Ga0373957_0015658 | 3300035120 | Bacteria | 2613 |
| 561 | Ga0373957_0051606 | 3300035120 | Bacteria | 1573 |
| 562 | Ga0373943_0000223 | 3300035170 | Bacteria | 23116 |
| 563 | Ga0373946_0000756 | 3300035171 | Bacteria | 10990 |
| 564 | Ga0373946_0000798 | 3300035171 | Bacteria | 10747 |
| 565 | Ga0373955_0021637 | 3300035172 | Bacteria | 3250 |
| 566 | Ga0373955_0101848 | 3300035172 | Bacteria | 1650 |
| 567 | Ga0373962_0007345 | 3300035242 | Bacteria | 2697 |
| 568 | Ga0373924_0008387 | 3300035410 | Bacteria | 3752 |
| 569 | Ga0373924_0012085 | 3300035410 | Bacteria | 3220 |
| 570 | Ga0373924_0051869 | 3300035410 | Bacteria | 1702 |
| 571 | Ga0373931_0013389 | 3300035691 | Bacteria | 3994 |
| 572 | Ga0373931_0022723 | 3300035691 | Bacteria | 3159 |
| 573 | Ga0373935_0004598 | 3300035692 | Bacteria | 8110 |
| 574 | Ga0373935_0010760 | 3300035692 | Bacteria | 5494 |
| 575 | Ga0373935_0042798 | 3300035692 | Bacteria | 2848 |
| 576 | Ga0373927_0003276 | 3300035695 | Bacteria | 11646 |
| 577 | Ga0373927_0051849 | 3300035695 | Bacteria | 2653 |
| 578 | Ga0373947_0000014 | 3300035725 | Bacteria | 135749 |
| 579 | Ga0373937_0065515 | 3300036401 | Bacteria | 3344 |
| 580 | Ga0373925_0000421 | 3300037068 | Bacteria | 43136 |
| 581 | Ga0373925_0009690 | 3300037068 | Bacteria | 7009 |
| 582 | Ga0373925_0010661 | 3300037068 | Bacteria | 6665 |
| 583 | Ga0373925_0012062 | 3300037068 | Bacteria | 6257 |
| 584 | Ga0373925_0045115 | 3300037068 | Bacteria | 3274 |
| 585 | Ga0373925_0081599 | 3300037068 | Bacteria | 2459 |
| 586 | Ga0395899_0005983 | 3300037312 | Bacteria | 9447 |
| 587 | Ga0395899_0140674 | 3300037312 | Unclassified | 1717 |
| 588 | Ga0395900_0033278 | 3300037418 | Bacteria | 5306 |
| 589 | Ga0395900_0125814 | 3300037418 | Bacteria | 2629 |
| 590 | Ga0395898_0003800 | 3300037466 | Bacteria | 16715 |
| 591 | Ga0395898_0019897 | 3300037466 | Bacteria | 6826 |
| 592 | Ga0395898_0019979 | 3300037466 | Bacteria | 6812 |
| 593 | Ga0395905_0008955 | 3300037471 | Bacteria | 9823 |
| 594 | Ga0395905_0047873 | 3300037471 | Bacteria | 4006 |
| 595 | Ga0436364_0485851 | 3300037853 | Bacteria | 2704 |
| 596 | Ga0436364_0824111 | 3300037853 | Bacteria | 10643 |
| 597 | Ga0436364_0841117 | 3300037853 | Bacteria | 5270 |
| 598 | Ga0436364_1107254 | 3300037853 | Bacteria | 1626 |
| 599 | Ga0436364_1421530 | 3300037853 | Bacteria | 3172 |
| 600 | Ga0436364_1435297 | 3300037853 | Bacteria | 74939 |
| 601 | Ga0436364_1450559 | 3300037853 | Bacteria | 2346 |
| 602 | Ga0436364_1520571 | 3300037853 | Bacteria | 46168 |
| 603 | Ga0395901_0032219 | 3300038443 | Bacteria | 5408 |
| 604 | Ga0439461_0000217 | 3300041410 | Bacteria | 8182 |
| 605 | Ga0439466_0021262 | 3300041411 | Bacteria | 2303 |
| 606 | Ga0439465_0000349 | 3300041413 | Bacteria | 13257 |
| 607 | Ga0439431_0000859 | 3300041997 | Bacteria | 6579 |
| 608 | Ga0439440_0014134 | 3300042993 | Bacteria | 1720 |
| 609 | Ga0466969_0078576 | 3300044656 | Bacteria | 1578 |
| 610 | Ga0466972_0012299 | 3300044658 | Bacteria | 4302 |
| 611 | Ga0466965_0002177 | 3300044683 | Bacteria | 8246 |
| 612 | Ga0466965_0022873 | 3300044683 | Bacteria | 3015 |
| 613 | Ga0466966_0009549 | 3300044684 | Bacteria | 6420 |
| 614 | Ga0466961_0002650 | 3300044693 | Bacteria | 11103 |
| 615 | Ga0466963_0005765 | 3300044694 | Bacteria | 7282 |
| 616 | Ga0466963_0040770 | 3300044694 | Bacteria | 3044 |
| 617 | Ga0466964_0005286 | 3300044706 | Bacteria | 4789 |
| 618 | Ga0466964_0017103 | 3300044706 | Bacteria | 2774 |
| 619 | Ga0466968_0001088 | 3300044735 | Bacteria | 9619 |
| 620 | Ga0466970_0016640 | 3300044765 | Bacteria | 3794 |
| 621 | Ga0466957_0008856 | 3300044842 | Bacteria | 5731 |
| 622 | Ga0466957_0043503 | 3300044842 | Bacteria | 2720 |
| 623 | Ga0466960_0079258 | 3300044901 | Bacteria | 1651 |
| 624 | Ga0466959_0001490 | 3300045049 | Bacteria | 14375 |
| 625 | Ga0466959_0027893 | 3300045049 | Bacteria | 4188 |
| 626 | Ga0466959_0075817 | 3300045049 | Bacteria | 2429 |
| 627 | Ga0466958_0063732 | 3300045836 | Bacteria | 2248 |
| 628 | Ga0466967_0010721 | 3300045976 | Bacteria | 6891 |
| 629 | Ga0466967_0012654 | 3300045976 | Bacteria | 6471 |
| 630 | Ga0466967_0036069 | 3300045976 | Bacteria | 4218 |
| 631 | Ga0466967_0056273 | 3300045976 | Bacteria | 3467 |
| 632 | Ga0466967_0056739 | 3300045976 | Bacteria | 3455 |
| 633 | Ga0466967_0111964 | 3300045976 | Bacteria | 2509 |
| 634 | Ga0466967_0113400 | 3300045976 | Bacteria | 2494 |
| 635 | Ga0466967_0132388 | 3300045976 | Bacteria | 2316 |
| 636 | Ga0466967_0158221 | 3300045976 | Bacteria | 2124 |
| 637 | Ga0495592_0000455 | 3300046454 | Bacteria | 30633 |
| 638 | Ga0495592_0015925 | 3300046454 | Bacteria | 5704 |
| 639 | Ga0495592_0025553 | 3300046454 | Bacteria | 4482 |
| 640 | Ga0495592_0068405 | 3300046454 | Bacteria | 2592 |
| 641 | Ga0495603_0001901 | 3300046455 | Bacteria | 12324 |
| 642 | Ga0495603_0006218 | 3300046455 | Bacteria | 7140 |
| 643 | Ga0495603_0024918 | 3300046455 | Bacteria | 3618 |
| 644 | Ga0495603_0040047 | 3300046455 | Bacteria | 2806 |
| 645 | Ga0495603_0122091 | 3300046455 | Bacteria | 1518 |
| 646 | Ga0495629_0003190 | 3300046459 | Bacteria | 12420 |
| 647 | Ga0495629_0012234 | 3300046459 | Bacteria | 6215 |
| 648 | Ga0495629_0190503 | 3300046459 | Bacteria | 1419 |
| 649 | Ga0495638_0002264 | 3300046460 | Bacteria | 15935 |
| 650 | Ga0495641_0007936 | 3300046461 | Bacteria | 6551 |
| 651 | Ga0495641_0012394 | 3300046461 | Bacteria | 4773 |
| 652 | Ga0495641_0044956 | 3300046461 | Bacteria | 2034 |
| 653 | Ga0495651_0000174 | 3300046462 | Bacteria | 47579 |
| 654 | Ga0495651_0007208 | 3300046462 | Bacteria | 8501 |
| 655 | Ga0495651_0059179 | 3300046462 | Bacteria | 2938 |
| 656 | Ga0495653_0000414 | 3300046463 | Bacteria | 34250 |
| 657 | Ga0495580_0206685 | 3300046472 | Unclassified | 1352 |
| 658 | Ga0495582_0013066 | 3300046473 | Bacteria | 4571 |
| 659 | Ga0495582_0027448 | 3300046473 | Bacteria | 3121 |
| 660 | Ga0495582_0033593 | 3300046473 | Bacteria | 2820 |
| 661 | Ga0495582_0036446 | 3300046473 | Bacteria | 2706 |
| 662 | Ga0495582_0155062 | 3300046473 | Unclassified | 1301 |
| 663 | Ga0495605_0139752 | 3300046474 | Unclassified | 1087 |
| 664 | Ga0495639_0019856 | 3300046475 | Bacteria | 2933 |
| 665 | Ga0495662_0005395 | 3300046476 | Bacteria | 6399 |
| 666 | Ga0495662_0013986 | 3300046476 | Bacteria | 3907 |
| 667 | Ga0495662_0027687 | 3300046476 | Bacteria | 2738 |
| 668 | Ga0495664_0000074 | 3300046477 | Bacteria | 48269 |
| 669 | Ga0495664_0003697 | 3300046477 | Bacteria | 8341 |
| 670 | Ga0495664_0039541 | 3300046477 | Bacteria | 2787 |
| 671 | Ga0495664_0099478 | 3300046477 | Bacteria | 1751 |
| 672 | Ga0495664_0113788 | 3300046477 | Bacteria | 1634 |
| 673 | Ga0495664_0136094 | 3300046477 | Unclassified | 1488 |
| 674 | Ga0495584_0037466 | 3300046491 | Bacteria | 2451 |
| 675 | Ga0495584_0069862 | 3300046491 | Unclassified | 1765 |
| 676 | Ga0495584_0089727 | 3300046491 | Bacteria | 1550 |
| 677 | Ga0495594_0100555 | 3300046499 | Bacteria | 1626 |
| 678 | Ga0495596_0029721 | 3300046500 | Bacteria | 2190 |
| 679 | Ga0495606_0051487 | 3300046507 | Bacteria | 2685 |
| 680 | Ga0495608_0000410 | 3300046511 | Bacteria | 29942 |
| 681 | Ga0495608_0010194 | 3300046511 | Bacteria | 6558 |
| 682 | Ga0495608_0018431 | 3300046511 | Bacteria | 4815 |
| 683 | Ga0495618_0039001 | 3300046514 | Bacteria | 2986 |
| 684 | Ga0495618_0071028 | 3300046514 | Bacteria | 2214 |
| 685 | Ga0495618_0089619 | 3300046514 | Bacteria | 1967 |
| 686 | Ga0495628_0000444 | 3300046516 | Bacteria | 37801 |
| 687 | Ga0495628_0024834 | 3300046516 | Bacteria | 4902 |
| 688 | Ga0495628_0101290 | 3300046516 | Bacteria | 2222 |
| 689 | Ga0495628_0102534 | 3300046516 | Bacteria | 2207 |
| 690 | Ga0495630_0009396 | 3300046517 | Bacteria | 7025 |
| 691 | Ga0495630_0011332 | 3300046517 | Bacteria | 6451 |
| 692 | Ga0495630_0016278 | 3300046517 | Bacteria | 5433 |
| 693 | Ga0495630_0032481 | 3300046517 | Bacteria | 3889 |
| 694 | Ga0495631_0051413 | 3300046518 | Bacteria | 1801 |
| 695 | Ga0495644_0027858 | 3300046523 | Bacteria | 2139 |
| 696 | Ga0495644_0028662 | 3300046523 | Bacteria | 2106 |
| 697 | Ga0495648_0005458 | 3300046524 | Bacteria | 10554 |
| 698 | Ga0495663_0006952 | 3300046525 | Bacteria | 3122 |
| 699 | Ga0495666_0000996 | 3300046526 | Bacteria | 13421 |
| 700 | Ga0495666_0068629 | 3300046526 | Bacteria | 1688 |
| 701 | Ga0495652_0000665 | 3300046529 | Bacteria | 39849 |
| 702 | Ga0495652_0043197 | 3300046529 | Bacteria | 3884 |
| 703 | Ga0495654_0081550 | 3300046530 | Bacteria | 1516 |
| 704 | Ga0495665_0009444 | 3300046531 | Bacteria | 5280 |
| 705 | Ga0495665_0013989 | 3300046531 | Bacteria | 4333 |
| 706 | Ga0495665_0061076 | 3300046531 | Bacteria | 1990 |
| 707 | Ga0495640_0006097 | 3300046533 | Bacteria | 9555 |
| 708 | Ga0495640_0018263 | 3300046533 | Bacteria | 5207 |
| 709 | Ga0495586_0005340 | 3300046535 | Bacteria | 6874 |
| 710 | Ga0495586_0107155 | 3300046535 | Bacteria | 1554 |
| 711 | Ga0495587_0002878 | 3300046536 | Bacteria | 11528 |
| 712 | Ga0495587_0019393 | 3300046536 | Bacteria | 4209 |
| 713 | Ga0495587_0055100 | 3300046536 | Bacteria | 2342 |
| 714 | Ga0495587_0091279 | 3300046536 | Bacteria | 1759 |
| 715 | Ga0495609_0051361 | 3300046538 | Bacteria | 1836 |
| 716 | Ga0495621_0023587 | 3300046539 | Bacteria | 2048 |
| 717 | Ga0495645_0001127 | 3300046543 | Bacteria | 18070 |
| 718 | Ga0495645_0158078 | 3300046543 | Bacteria | 1569 |
| 719 | Ga0495667_0000117 | 3300046559 | Bacteria | 57725 |
| 720 | Ga0495667_0000908 | 3300046559 | Bacteria | 19115 |
| 721 | Ga0495667_0029518 | 3300046559 | Bacteria | 3691 |
| 722 | Ga0495667_0047522 | 3300046559 | Bacteria | 2835 |
| 723 | Ga0495667_0057206 | 3300046559 | Bacteria | 2564 |
| 724 | Ga0495667_0068884 | 3300046559 | Bacteria | 2309 |
| 725 | Ga0495667_0087160 | 3300046559 | Bacteria | 2024 |
| 726 | Ga0495656_0000291 | 3300046615 | Bacteria | 17446 |
| 727 | Ga0495656_0022991 | 3300046615 | Bacteria | 2448 |
| 728 | Ga0495634_0001586 | 3300046642 | Bacteria | 19947 |
| 729 | Ga0495634_0002700 | 3300046642 | Bacteria | 14596 |
| 730 | Ga0495634_0056454 | 3300046642 | Bacteria | 2623 |
| 731 | Ga0495635_0000773 | 3300046663 | Bacteria | 20815 |
| 732 | Ga0495635_0011752 | 3300046663 | Bacteria | 6139 |
| 733 | Ga0495635_0063839 | 3300046663 | Bacteria | 2528 |
| 734 | Ga0495635_0173446 | 3300046663 | Bacteria | 1466 |
| 735 | Ga0495659_0000889 | 3300046664 | Bacteria | 10637 |
| 736 | Ga0495588_0001357 | 3300046674 | Bacteria | 10445 |
| 737 | Ga0495657_0006991 | 3300046675 | Bacteria | 8754 |
| 738 | Ga0495657_0007099 | 3300046675 | Bacteria | 8687 |
| 739 | Ga0495657_0051040 | 3300046675 | Bacteria | 2778 |
| 740 | Ga0495599_0000185 | 3300046678 | Bacteria | 40953 |
| 741 | Ga0495599_0053041 | 3300046678 | Bacteria | 2540 |
| 742 | Ga0495623_0055054 | 3300046679 | Bacteria | 2508 |
| 743 | Ga0495646_0000628 | 3300046680 | Bacteria | 19227 |
| 744 | Ga0495646_0018567 | 3300046680 | Bacteria | 4403 |
| 745 | Ga0495646_0041034 | 3300046680 | Bacteria | 2845 |
| 746 | Ga0495647_0001537 | 3300046681 | Bacteria | 7126 |
| 747 | Ga0495647_0042764 | 3300046681 | Bacteria | 1731 |
| 748 | Ga0495647_0058534 | 3300046681 | Bacteria | 1515 |
| 749 | Ga0495658_0001438 | 3300046683 | Bacteria | 12529 |
| 750 | Ga0495658_0011377 | 3300046683 | Bacteria | 4475 |
| 751 | Ga0495613_0053181 | 3300046689 | Bacteria | 2980 |
| 752 | Ga0495613_0108031 | 3300046689 | Bacteria | 2007 |
| 753 | Ga0495624_0006757 | 3300046690 | Bacteria | 8106 |
| 754 | Ga0495624_0028048 | 3300046690 | Bacteria | 3681 |
| 755 | Ga0495624_0033267 | 3300046690 | Bacteria | 3339 |
| 756 | Ga0495624_0086899 | 3300046690 | Bacteria | 1931 |
| 757 | Ga0495671_0034988 | 3300046692 | Bacteria | 2553 |
| 758 | Ga0495589_0007696 | 3300046794 | Bacteria | 5639 |
| 759 | Ga0495600_0014669 | 3300046809 | Bacteria | 4940 |
| 760 | Ga0495581_0004943 | 3300047315 | Bacteria | 7715 |
| 761 | Ga0495581_0008059 | 3300047315 | Bacteria | 6097 |
| 762 | Ga0495581_0009928 | 3300047315 | Bacteria | 5508 |
| 763 | Ga0495581_0036608 | 3300047315 | Bacteria | 2839 |
| 764 | Ga0495604_0016061 | 3300047317 | Bacteria | 5979 |
| 765 | Ga0495604_0025456 | 3300047317 | Bacteria | 4715 |
| 766 | Ga0495636_0005073 | 3300047318 | Bacteria | 5170 |
| 767 | Ga0495674_0000984 | 3300047319 | Bacteria | 27406 |
| 768 | Ga0495674_0002797 | 3300047319 | Bacteria | 16935 |
| 769 | Ga0495674_0041283 | 3300047319 | Bacteria | 4122 |
| 770 | Ga0495674_0050652 | 3300047319 | Bacteria | 3664 |
| 771 | Ga0495674_0054886 | 3300047319 | Bacteria | 3497 |
| 772 | Ga0495674_0107812 | 3300047319 | Bacteria | 2364 |
| 773 | Ga0495672_0030900 | 3300047320 | Bacteria | 3350 |
| 774 | Ga0495676_0020287 | 3300047321 | Bacteria | 5835 |
| 775 | Ga0495676_0040298 | 3300047321 | Bacteria | 3856 |
| 776 | Ga0495680_0000401 | 3300047322 | Bacteria | 48480 |
| 777 | Ga0495680_0001586 | 3300047322 | Bacteria | 24314 |
| 778 | Ga0495680_0029597 | 3300047322 | Bacteria | 4483 |
| 779 | Ga0495680_0071146 | 3300047322 | Bacteria | 2649 |
| 780 | Ga0495680_0167712 | 3300047322 | Bacteria | 1591 |
| 781 | Ga0495675_0005713 | 3300047444 | Bacteria | 7607 |
| 782 | Ga0495675_0009139 | 3300047444 | Bacteria | 6161 |
| 783 | Ga0495673_0001205 | 3300047469 | Bacteria | 21534 |
| 784 | Ga0495684_0000598 | 3300047471 | Bacteria | 29035 |
| 785 | Ga0495684_0005984 | 3300047471 | Bacteria | 9451 |
| 786 | Ga0495686_0003330 | 3300047472 | Bacteria | 14025 |
| 787 | Ga0495686_0058912 | 3300047472 | Bacteria | 2393 |
| 788 | Ga0495593_0015763 | 3300047673 | Bacteria | 4272 |
| 789 | Ga0495593_0050767 | 3300047673 | Bacteria | 2196 |
| 790 | Ga0495602_0002949 | 3300048088 | Bacteria | 17454 |
| 791 | Ga0495602_0130474 | 3300048088 | Bacteria | 2005 |
| 792 | Ga0495614_0001554 | 3300048089 | Bacteria | 9962 |
| 793 | Ga0496100_0004799 | 3300048903 | Bacteria | 7220 |
| 794 | Ga0496100_0006150 | 3300048903 | Bacteria | 6531 |
| 795 | Ga0496100_0009450 | 3300048903 | Bacteria | 5482 |
| 796 | Ga0496100_0042136 | 3300048903 | Bacteria | 2914 |
| 797 | Ga0496100_0083030 | 3300048903 | Bacteria | 2168 |
| 798 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 799 | Ga0496101_0001613 | 3300048904 | Bacteria | 13562 |
| 800 | Ga0496101_0056770 | 3300048904 | Bacteria | 2830 |
| 801 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 802 | Ga0496102_0000590 | 3300048905 | Bacteria | 38332 |
| 803 | Ga0496102_0001309 | 3300048905 | Bacteria | 22360 |
| 804 | Ga0496102_0010316 | 3300048905 | Bacteria | 8034 |
| 805 | Ga0496102_0029162 | 3300048905 | Bacteria | 4935 |
| 806 | Ga0496102_0073674 | 3300048905 | Bacteria | 3138 |
| 807 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 808 | Ga0496103_0015572 | 3300048906 | Bacteria | 4529 |
| 809 | Ga0496103_0019054 | 3300048906 | Bacteria | 4120 |
| 810 | Ga0496103_0041252 | 3300048906 | Bacteria | 2837 |
| 811 | Ga0496103_0074244 | 3300048906 | Bacteria | 2131 |
| 812 | Ga0496103_0156782 | 3300048906 | Bacteria | 1459 |
| 813 | Ga0496104_0010504 | 3300048907 | Bacteria | 8271 |
| 814 | Ga0496104_0011782 | 3300048907 | Bacteria | 7846 |
| 815 | Ga0496104_0020133 | 3300048907 | Bacteria | 6112 |
| 816 | Ga0496104_0091076 | 3300048907 | Bacteria | 2914 |
| 817 | Ga0496104_0187398 | 3300048907 | Bacteria | 1980 |
| 818 | Ga0496104_0323470 | 3300048907 | Bacteria | 1455 |
| 819 | Ga0496105_0015872 | 3300048908 | Bacteria | 6008 |
| 820 | Ga0496105_0031392 | 3300048908 | Bacteria | 4355 |
| 821 | Ga0496105_0057685 | 3300048908 | Bacteria | 3205 |
| 822 | Ga0496105_0182583 | 3300048908 | Bacteria | 1718 |
| 823 | Ga0496106_0002503 | 3300048909 | Bacteria | 13678 |
| 824 | Ga0496106_0003195 | 3300048909 | Bacteria | 12259 |
| 825 | Ga0496106_0003386 | 3300048909 | Bacteria | 11881 |
| 826 | Ga0496106_0028783 | 3300048909 | Bacteria | 4139 |
| 827 | Ga0496106_0065366 | 3300048909 | Bacteria | 2769 |
| 828 | Ga0496106_0107582 | 3300048909 | Bacteria | 2169 |
| 829 | Ga0496107_0000321 | 3300048910 | Bacteria | 25887 |
| 830 | Ga0496107_0003559 | 3300048910 | Bacteria | 10431 |
| 831 | Ga0496107_0011486 | 3300048910 | Bacteria | 6170 |
| 832 | Ga0496107_0016357 | 3300048910 | Bacteria | 5206 |
| 833 | Ga0496107_0040227 | 3300048910 | Bacteria | 3355 |
| 834 | Ga0496107_0041137 | 3300048910 | Bacteria | 3318 |
| 835 | Ga0496107_0074185 | 3300048910 | Bacteria | 2475 |
| 836 | Ga0496108_0000645 | 3300048911 | Bacteria | 27126 |
| 837 | Ga0496108_0020996 | 3300048911 | Bacteria | 5368 |
| 838 | Ga0496108_0021599 | 3300048911 | Bacteria | 5289 |
| 839 | Ga0496108_0028914 | 3300048911 | Bacteria | 4587 |
| 840 | Ga0496108_0093677 | 3300048911 | Bacteria | 2555 |
| 841 | Ga0496108_0127244 | 3300048911 | Bacteria | 2188 |
| 842 | Ga0496108_0132006 | 3300048911 | Bacteria | 2147 |
| 843 | Ga0496108_0143694 | 3300048911 | Bacteria | 2056 |
| 844 | Ga0496109_0016603 | 3300048912 | Bacteria | 6438 |
| 845 | Ga0496109_0024888 | 3300048912 | Bacteria | 5329 |
| 846 | Ga0496109_0053112 | 3300048912 | Bacteria | 3694 |
| 847 | Ga0496109_0280463 | 3300048912 | Bacteria | 1570 |
| 848 | Ga0496110_0002173 | 3300048913 | Bacteria | 14645 |
| 849 | Ga0496110_0034997 | 3300048913 | Bacteria | 4354 |
| 850 | Ga0496110_0039235 | 3300048913 | Bacteria | 4123 |
| 851 | Ga0496110_0209617 | 3300048913 | Bacteria | 1771 |
| 852 | Ga0496110_0231112 | 3300048913 | Bacteria | 1682 |
| 853 | Ga0496111_0025718 | 3300048914 | Bacteria | 4154 |
| 854 | Ga0496111_0031195 | 3300048914 | Bacteria | 3795 |
| 855 | Ga0496111_0043019 | 3300048914 | Bacteria | 3245 |
| 856 | Ga0496111_0072558 | 3300048914 | Bacteria | 2505 |
| 857 | Ga0496111_0078746 | 3300048914 | Bacteria | 2403 |
| 858 | Ga0496111_0117387 | 3300048914 | Bacteria | 1963 |
| 859 | Ga0496112_0005708 | 3300048915 | Bacteria | 10813 |
| 860 | Ga0496112_0117982 | 3300048915 | Bacteria | 2624 |
| 861 | Ga0496113_0013407 | 3300048916 | Bacteria | 5553 |
| 862 | Ga0496113_0032813 | 3300048916 | Bacteria | 3775 |
| 863 | Ga0496113_0121038 | 3300048916 | Bacteria | 2046 |
| 864 | Ga0496114_0000495 | 3300048917 | Bacteria | 28787 |
| 865 | Ga0496114_0002288 | 3300048917 | Bacteria | 14597 |
| 866 | Ga0496114_0032144 | 3300048917 | Bacteria | 4318 |
| 867 | Ga0496114_0041127 | 3300048917 | Bacteria | 3830 |
| 868 | Ga0496115_0001075 | 3300048918 | Bacteria | 19794 |
| 869 | Ga0496115_0003085 | 3300048918 | Bacteria | 11965 |
| 870 | Ga0496115_0014339 | 3300048918 | Bacteria | 6000 |
| 871 | Ga0496115_0101112 | 3300048918 | Bacteria | 2363 |
| 872 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 873 | Ga0496116_0000166 | 3300048919 | Bacteria | 133474 |
| 874 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 875 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 876 | Ga0496118_0051275 | 3300048921 | Bacteria | 3158 |
| 877 | Ga0496119_0000454 | 3300048922 | Bacteria | 56086 |
| 878 | Ga0496119_0060786 | 3300048922 | Bacteria | 2260 |
| 879 | Ga0496119_0072685 | 3300048922 | Bacteria | 2008 |
| 880 | Ga0496120_0001962 | 3300048923 | Bacteria | 22491 |
| 881 | Ga0496120_0006298 | 3300048923 | Bacteria | 9148 |
| 882 | Ga0496121_0000177 | 3300048924 | Bacteria | 141456 |
| 883 | Ga0496125_0016319 | 3300048928 | Bacteria | 7136 |
| 884 | Ga0496126_0001113 | 3300048929 | Bacteria | 45012 |
| 885 | Ga0501034_0127982 | 3300049571 | Bacteria | 2524 |
| 886 | Ga0501038_0121932 | 3300049574 | Bacteria | 2149 |
| 887 | Ga0501067_0004530 | 3300049583 | Bacteria | 7678 |
| 888 | Ga0501068_0110415 | 3300049584 | Bacteria | 1709 |
| 889 | Ga0501070_0040248 | 3300049586 | Bacteria | 3897 |
| 890 | Ga0501073_0100478 | 3300049589 | Bacteria | 2008 |
| 891 | Ga0501074_0062711 | 3300049590 | Bacteria | 2677 |
| 892 | Ga0501074_0133790 | 3300049590 | Bacteria | 1773 |
| 893 | Ga0501077_0028597 | 3300049593 | Bacteria | 3543 |
| 894 | Ga0501080_0516152 | 3300049742 | Bacteria | 1066 |
| 895 | Ga0501083_0016126 | 3300049744 | Bacteria | 5233 |
| 896 | Ga0501083_0038734 | 3300049744 | Bacteria | 3239 |
| 897 | Ga0501044_0196617 | 3300049823 | Bacteria | 1976 |
| 898 | nmdc:mga03683_3552_c1 | 3300050489 | Bacteria | 5050 |
| 899 | nmdc:mga03n38_17725_c1 | 3300050490 | Bacteria | 2795 |
| 900 | nmdc:mga03n38_7306_c1 | 3300050490 | Bacteria | 3903 |
| 901 | nmdc:mga03n38_9110_c1 | 3300050490 | Bacteria | 3593 |
| 902 | nmdc:mga00v17_1369_c1 | 3300050491 | Bacteria | 12779 |
| 903 | nmdc:mga00v17_17742_c2 | 3300050491 | Bacteria | 3508 |
| 904 | nmdc:mga00v17_5888_c1 | 3300050491 | Bacteria | 6476 |
| 905 | nmdc:mga0yw44_15068_c1 | 3300050492 | Bacteria | 4128 |
| 906 | nmdc:mga0yw44_64861_c1 | 3300050492 | Bacteria | 2249 |
| 907 | nmdc:mga07m45_24287_c1 | 3300050496 | Bacteria | 3319 |
| 908 | nmdc:mga07m45_69649_c1 | 3300050496 | Bacteria | 2000 |
| 909 | nmdc:mga05p37_11253_c1 | 3300050507 | Bacteria | 10641 |
| 910 | nmdc:mga05p37_47560_c1 | 3300050507 | Bacteria | 5275 |
| 911 | nmdc:mga05p37_87829_c1 | 3300050507 | Bacteria | 3833 |
| 912 | nmdc:mga09592_86124_c1 | 3300050508 | Bacteria | 2681 |
| 913 | nmdc:mga08y16_140196_c1 | 3300050511 | Bacteria | 2514 |
| 914 | nmdc:mga0n895_16162_c1 | 3300050512 | Bacteria | 6841 |
| 915 | nmdc:mga0n895_17799_c1 | 3300050512 | Bacteria | 6560 |
| 916 | nmdc:mga0n895_213832_c1 | 3300050512 | Bacteria | 1958 |
| 917 | nmdc:mga0n895_39305_c1 | 3300050512 | Bacteria | 4590 |
| 918 | nmdc:mga0rr50_3260_c1 | 3300050513 | Bacteria | 9300 |
| 919 | nmdc:mga0a205_2637_c1 | 3300050515 | Bacteria | 15841 |
| 920 | nmdc:mga0sz30_3201_c1 | 3300050516 | Bacteria | 5873 |
| 921 | nmdc:mga0sz30_42494_c1 | 3300050516 | Bacteria | 1912 |
| 922 | nmdc:mga0sz30_88335_c1 | 3300050516 | Bacteria | 1347 |
| 923 | Ga0495601_0015602 | 3300053077 | Bacteria | 4592 |
| 924 | Ga0495601_0085524 | 3300053077 | Unclassified | 2026 |
| 925 | Ga0495612_0008199 | 3300053078 | Bacteria | 4245 |
| 926 | Ga0500635_0004952 | 3300053080 | Bacteria | 3464 |
| 927 | Ga0495655_0001501 | 3300053083 | Bacteria | 3589 |
| 928 | Ga0495595_0002988 | 3300053084 | Bacteria | 6681 |
| 929 | Ga0495595_0024353 | 3300053084 | Bacteria | 2674 |
| 930 | Ga0495619_0001449 | 3300053085 | Bacteria | 15619 |
| 931 | Ga0495619_0037454 | 3300053085 | Bacteria | 3161 |
| 932 | Ga0495619_0046837 | 3300053085 | Bacteria | 2845 |
| 933 | Ga0495619_0063206 | 3300053085 | Bacteria | 2466 |
| 934 | Ga0500643_001154 | 3300053087 | Bacteria | 15747 |
| 935 | Ga0500643_001862 | 3300053087 | Bacteria | 11500 |
| 936 | Ga0500643_006474 | 3300053087 | Bacteria | 4886 |
| 937 | Ga0500643_007970 | 3300053087 | Bacteria | 4207 |
| 938 | Ga0500556_0001572 | 3300053104 | Bacteria | 9240 |
| 939 | Ga0500562_005490 | 3300053108 | Bacteria | 3182 |
| 940 | Ga0500652_007547 | 3300053131 | Bacteria | 3567 |
| 941 | Ga0500645_000035 | 3300053730 | Bacteria | 113679 |
| 942 | Ga0501082_0022336 | 3300060353 | Bacteria | 5450 |
| 943 | 2644488274 | 2643221687 | Bacteria | 6500351 |
| 944 | 2738704647 | 2738541274 | Bacteria | 6909446 |
| 945 | 2902795187 | 2902792274 | Bacteria | 7270173 |
| 946 | 2902811298 | 2902810491 | Bacteria | 6794147 |
| 947 | 2902841362 | 2902837492 | Bacteria | 6697721 |
| 948 | 2929216249 | 2929212328 | Bacteria | 7708288 |
| 949 | 2939583058 | 2939582691 | Bacteria | 7088898 |
| 950 | 8055072402 | 8055066027 | Bacteria | 9479577 |
| 951 | Ga0068869_100011909 | |||
| 952 | JGI24752J21851_1002611 | |||
| 953 | JGI24746J21847_1000089 | |||
| 954 | JGI24743J22301_10000709 | |||
| 955 | JGI24033J26618_1000486 | |||
| 956 | JGI24751J29686_10000684 | |||
| 957 | JGI24751J29686_10009198 | |||
| 958 | JGI24751J29686_10016832 | |||
| 959 | JGI25404J52841_10001437 | |||
| 960 | Ga0055540_1001155 | |||
| 961 | Ga0055540_1002276 | |||
| 962 | Ga0058861_11975033 | |||
| 963 | Ga0058862_10034740 | |||
| 964 | Ga0070658_10093466 | |||
| 965 | Ga0070683_100199128 | |||
| 966 | Ga0070670_100088619 | |||
| 967 | Ga0068869_100068037 | |||
| 968 | Ga0070680_100072410 | |||
| 969 | Ga0070682_100022719 | |||
| 970 | Ga0070682_100049408 | |||
| 971 | Ga0068868_100000529 | |||
| 972 | Ga0068868_100014372 | |||
| 973 | Ga0070660_100188515 | |||
| 974 | Ga0070660_100222383 | |||
| 975 | Ga0070691_10011823 | |||
| 976 | Ga0070661_100005479 | |||
| 977 | Ga0070661_100009141 | |||
| 978 | Ga0070668_100005441 | |||
| 979 | Ga0070668_100055714 | |||
| 980 | Ga0070675_100063813 | |||
| 981 | Ga0070675_100313505 | |||
| 982 | Ga0070671_100010460 | |||
| 983 | Ga0070671_100013019 | |||
| 984 | Ga0070671_100047247 | |||
| 985 | Ga0070674_100002482 | |||
| 986 | Ga0070674_100003430 | |||
| 987 | Ga0070674_100021807 | |||
| 988 | Ga0070673_100010279 | |||
| 989 | Ga0070688_100005859 | |||
| 990 | Ga0070667_100002267 | |||
| 991 | Ga0070667_100105326 | |||
| 992 | Ga0070667_100212282 | |||
| 993 | Ga0070703_10000001 | |||
| 994 | Ga0070703_10010304 | |||
| 995 | Ga0070709_10000243 | |||
| 996 | Ga0070709_10000794 | |||
| 997 | Ga0070709_10012534 | |||
| 998 | Ga0070709_10022973 | |||
| 999 | Ga0070709_10079546 | |||
| 1000 | Ga0070709_10173787 | |||
| 1001 | Ga0070714_100000640 | |||
| 1002 | Ga0070714_100004478 | |||
| 1003 | Ga0070714_100040816 | |||
| 1004 | Ga0070714_100042573 | |||
| 1005 | Ga0070714_100060030 | |||
| 1006 | Ga0070714_100180351 | |||
| 1007 | Ga0070714_100180693 | |||
| 1008 | Ga0070713_100000428 | |||
| 1009 | Ga0070713_100004385 | |||
| 1010 | Ga0070713_100021199 | |||
| 1011 | Ga0070713_100023985 | |||
| 1012 | Ga0070713_100025930 | |||
| 1013 | Ga0070713_100113829 | |||
| 1014 | Ga0070710_10000101 | |||
| 1015 | Ga0070710_10000900 | |||
| 1016 | Ga0070710_10001923 | |||
| 1017 | Ga0070710_10003412 | |||
| 1018 | Ga0070710_10073616 | |||
| 1019 | Ga0070701_10003486 | |||
| 1020 | Ga0070701_10023934 | |||
| 1021 | Ga0070711_100000437 | |||
| 1022 | Ga0070711_100001095 | |||
| 1023 | Ga0070711_100001607 | |||
| 1024 | Ga0070711_100004296 | |||
| 1025 | Ga0070711_100004473 | |||
| 1026 | Ga0070711_100105261 | |||
| 1027 | Ga0070711_100147979 | |||
| 1028 | Ga0070705_100018343 | |||
| 1029 | Ga0070705_100027798 | |||
| 1030 | Ga0070705_100038364 | |||
| 1031 | Ga0070700_100008542 | |||
| 1032 | Ga0070700_100009104 | |||
| 1033 | Ga0070700_100018846 | |||
| 1034 | Ga0070700_100049200 | |||
| 1035 | Ga0070694_100015852 | |||
| 1036 | Ga0070694_100033732 | |||
| 1037 | Ga0070694_100041620 | |||
| 1038 | Ga0070708_100001067 | |||
| 1039 | Ga0070708_100287649 | |||
| 1040 | Ga0070663_100004269 | |||
| 1041 | Ga0070663_100018208 | |||
| 1042 | Ga0070663_100140945 | |||
| 1043 | Ga0070678_100009361 | |||
| 1044 | Ga0070678_100067738 | |||
| 1045 | Ga0070662_100009027 | |||
| 1046 | Ga0070662_100017040 | |||
| 1047 | Ga0070662_100044175 | |||
| 1048 | Ga0070681_10126386 | |||
| 1049 | Ga0068867_100001323 | |||
| 1050 | Ga0068867_100002000 | |||
| 1051 | Ga0068867_100149122 | |||
| 1052 | Ga0070685_10050343 | |||
| 1053 | Ga0070706_100003990 | |||
| 1054 | Ga0070706_100010233 | |||
| 1055 | Ga0070706_100030567 | |||
| 1056 | Ga0070706_100298265 | |||
| 1057 | Ga0070707_100000041 | |||
| 1058 | Ga0070707_100008503 | |||
| 1059 | Ga0070707_100011276 | |||
| 1060 | Ga0070707_100031450 | |||
| 1061 | Ga0070707_100140216 | |||
| 1062 | Ga0070698_100000082 | |||
| 1063 | Ga0070698_100030094 | |||
| 1064 | Ga0070698_100051050 | |||
| 1065 | Ga0070698_100075801 | |||
| 1066 | Ga0070698_100173688 | |||
| 1067 | Ga0070684_100003351 | |||
| 1068 | Ga0070684_100031025 | |||
| 1069 | Ga0070684_100082513 | |||
| 1070 | Ga0070697_100036724 | |||
| 1071 | Ga0070697_100049392 | |||
| 1072 | Ga0068853_100008397 | |||
| 1073 | Ga0068853_100016775 | |||
| 1074 | Ga0068853_100049796 | |||
| 1075 | Ga0068853_100069006 | |||
| 1076 | Ga0070672_100162157 | |||
| 1077 | Ga0070695_100010024 | |||
| 1078 | Ga0070695_100139249 | |||
| 1079 | Ga0070695_100182054 | |||
| 1080 | Ga0070696_100003305 | |||
| 1081 | Ga0070696_100005272 | |||
| 1082 | Ga0070696_100058492 | |||
| 1083 | Ga0070696_100063569 | |||
| 1084 | Ga0070693_100001858 | |||
| 1085 | Ga0070665_100001745 | |||
| 1086 | Ga0070665_100009958 | |||
| 1087 | Ga0070665_100022355 | |||
| 1088 | Ga0070665_100045725 | |||
| 1089 | Ga0070665_100096225 | |||
| 1090 | Ga0070704_100000706 | |||
| 1091 | Ga0070704_100004595 | |||
| 1092 | Ga0070704_100007803 | |||
| 1093 | Ga0068855_100055086 | |||
| 1094 | Ga0068855_100076751 | |||
| 1095 | Ga0070664_100002582 | |||
| 1096 | Ga0068857_100017591 | |||
| 1097 | Ga0068854_100005243 | |||
| 1098 | Ga0070702_100001404 | |||
| 1099 | Ga0070702_100017389 | |||
| 1100 | Ga0070702_100148897 | |||
| 1101 | Ga0068852_100156097 | |||
| 1102 | Ga0068859_100003134 | |||
| 1103 | Ga0068864_100020685 | |||
| 1104 | Ga0068864_100098059 | |||
| 1105 | Ga0068864_100114068 | |||
| 1106 | Ga0068866_10000376 | |||
| 1107 | Ga0068866_10013060 | |||
| 1108 | Ga0068866_10057117 | |||
| 1109 | Ga0068861_100025534 | |||
| 1110 | Ga0068861_100030613 | |||
| 1111 | Ga0068861_100052331 | |||
| 1112 | Ga0068870_10029598 | |||
| 1113 | Ga0068863_100001514 | |||
| 1114 | Ga0068863_100006801 | |||
| 1115 | Ga0068858_100002465 | |||
| 1116 | Ga0068858_100071177 | |||
| 1117 | Ga0068858_100080445 | |||
| 1118 | Ga0068858_100113426 | |||
| 1119 | Ga0068860_100025928 | |||
| 1120 | Ga0068860_100115207 | |||
| 1121 | Ga0068860_100249342 | |||
| 1122 | Ga0068862_100043121 | |||
| 1123 | Ga0081455_10001614 | |||
| 1124 | Ga0081455_10003773 | |||
| 1125 | Ga0081455_10043919 | |||
| 1126 | Ga0081455_10071142 | |||
| 1127 | Ga0081538_10000404 | |||
| 1128 | Ga0081540_1000505 | |||
| 1129 | Ga0081539_10021040 | |||
| 1130 | Ga0070717_10000956 | |||
| 1131 | Ga0070717_10007851 | |||
| 1132 | Ga0070717_10034864 | |||
| 1133 | Ga0070717_10047787 | |||
| 1134 | Ga0070717_10064802 | |||
| 1135 | Ga0075365_10015384 | |||
| 1136 | Ga0075365_10090040 | |||
| 1137 | Ga0075365_10140439 | |||
| 1138 | Ga0075363_100000787 | |||
| 1139 | Ga0075363_100060987 | |||
| 1140 | Ga0075363_100077904 | |||
| 1141 | Ga0075363_100087743 | |||
| 1142 | Ga0075363_100115160 | |||
| 1143 | Ga0075364_10000184 | |||
| 1144 | Ga0075364_10006965 | |||
| 1145 | Ga0075364_10076198 | |||
| 1146 | Ga0075432_10000387 | |||
| 1147 | Ga0075432_10004840 | |||
| 1148 | Ga0070715_10004042 | |||
| 1149 | Ga0070715_10013894 | |||
| 1150 | Ga0070715_10023722 | |||
| 1151 | Ga0070716_100000560 | |||
| 1152 | Ga0070716_100002661 | |||
| 1153 | Ga0070716_100004017 | |||
| 1154 | Ga0070716_100005420 | |||
| 1155 | Ga0070716_100006565 | |||
| 1156 | Ga0070712_100001062 | |||
| 1157 | Ga0070712_100002191 | |||
| 1158 | Ga0070712_100012459 | |||
| 1159 | Ga0070712_100017727 | |||
| 1160 | Ga0070712_100102759 | |||
| 1161 | Ga0070712_100126999 | |||
| 1162 | Ga0075367_10001919 | |||
| 1163 | Ga0075367_10088124 | |||
| 1164 | Ga0075369_10001370 | |||
| 1165 | Ga0075369_10037641 | |||
| 1166 | Ga0097621_100015140 | |||
| 1167 | Ga0097621_100073596 | |||
| 1168 | Ga0075370_10008783 | |||
| 1169 | Ga0075370_10033932 | |||
| 1170 | Ga0075370_10044383 | |||
| 1171 | Ga0068871_100018339 | |||
| 1172 | Ga0068871_100189674 | |||
| 1173 | Ga0075428_100065799 | |||
| 1174 | Ga0075428_100089059 | |||
| 1175 | Ga0075430_100051156 | |||
| 1176 | Ga0075431_100036726 | |||
| 1177 | Ga0075433_10005527 | |||
| 1178 | Ga0075433_10012875 | |||
| 1179 | Ga0075433_10163690 | |||
| 1180 | Ga0075434_100003943 | |||
| 1181 | Ga0075434_100005157 | |||
| 1182 | Ga0075434_100008894 | |||
| 1183 | Ga0075434_100014932 | |||
| 1184 | Ga0068865_100000828 | |||
| 1185 | Ga0068865_100022777 | |||
| 1186 | Ga0068865_100028975 | |||
| 1187 | Ga0068865_100029811 | |||
| 1188 | Ga0097620_100003133 | |||
| 1189 | Ga0075435_100007491 | |||
| 1190 | Ga0075435_100107436 | |||
| 1191 | Ga0105251_10017533 | |||
| 1192 | Ga0111539_10184592 | |||
| 1193 | Ga0105245_10003220 | |||
| 1194 | Ga0105245_10018583 | |||
| 1195 | Ga0105245_10107688 | |||
| 1196 | Ga0105245_10116217 | |||
| 1197 | Ga0105245_10133233 | |||
| 1198 | Ga0105245_10162114 | |||
| 1199 | Ga0105245_10171307 | |||
| 1200 | Ga0105247_10000334 | |||
| 1201 | Ga0105247_10029448 | |||
| 1202 | Ga0105247_10069989 | |||
| 1203 | Ga0114129_10004398 | |||
| 1204 | Ga0114129_10018631 | |||
| 1205 | Ga0114129_10019233 | |||
| 1206 | Ga0114129_10026156 | |||
| 1207 | Ga0114129_10039891 | |||
| 1208 | Ga0114129_10223859 | |||
| 1209 | Ga0105243_10005418 | |||
| 1210 | Ga0105243_10006751 | |||
| 1211 | Ga0105243_10007191 | |||
| 1212 | Ga0105243_10116559 | |||
| 1213 | Ga0105241_10019951 | |||
| 1214 | Ga0105242_10000620 | |||
| 1215 | Ga0105242_10002226 | |||
| 1216 | Ga0105242_10002528 | |||
| 1217 | Ga0105242_10042211 | |||
| 1218 | Ga0105242_10052953 | |||
| 1219 | Ga0105248_10004419 | |||
| 1220 | Ga0105248_10025304 | |||
| 1221 | Ga0105248_10044839 | |||
| 1222 | Ga0105237_10000178 | |||
| 1223 | Ga0105237_10002564 | |||
| 1224 | Ga0105237_10034235 | |||
| 1225 | Ga0105237_10051382 | |||
| 1226 | Ga0105238_10093468 | |||
| 1227 | Ga0105238_10195444 | |||
| 1228 | Ga0105249_10000767 | |||
| 1229 | Ga0105249_10012184 | |||
| 1230 | Ga0105249_10053836 | |||
| 1231 | Ga0105249_10108817 | |||
| 1232 | Ga0105249_10172159 | |||
| 1233 | Ga0105239_10002879 | |||
| 1234 | Ga0105239_10007516 | |||
| 1235 | Ga0105239_10030663 | |||
| 1236 | Ga0105239_10059987 | |||
| 1237 | Ga0105239_10228472 | |||
| 1238 | Ga0105239_10269472 | |||
| 1239 | Ga0105246_10066414 | |||
| 1240 | Ga0105246_10140320 | |||
| 1241 | Ga0157373_10015473 | |||
| 1242 | Ga0157371_10099871 | |||
| 1243 | Ga0157370_10030713 | |||
| 1244 | Ga0157369_10003613 | |||
| 1245 | Ga0157374_10035561 | |||
| 1246 | Ga0157374_10067899 | |||
| 1247 | Ga0157374_10232882 | |||
| 1248 | Ga0157378_10001690 | |||
| 1249 | Ga0157378_10018845 | |||
| 1250 | Ga0157378_10019027 | |||
| 1251 | Ga0157378_10089398 | |||
| 1252 | Ga0163162_10026392 | |||
| 1253 | Ga0163162_10027146 | |||
| 1254 | Ga0163162_10174064 | |||
| 1255 | Ga0163162_10205789 | |||
| 1256 | Ga0157372_10171892 | |||
| 1257 | Ga0157372_10341252 | |||
| 1258 | Ga0157375_10003452 | |||
| 1259 | Ga0157375_10042351 | |||
| 1260 | Ga0157375_10122797 | |||
| 1261 | Ga0163163_10002897 | |||
| 1262 | Ga0163163_10008170 | |||
| 1263 | Ga0163163_10021984 | |||
| 1264 | Ga0163163_10032021 | |||
| 1265 | Ga0163163_10067769 | |||
| 1266 | Ga0163163_10385973 | |||
| 1267 | Ga0157380_10003813 | |||
| 1268 | Ga0157377_10007912 | |||
| 1269 | Ga0157377_10122128 | |||
| 1270 | Ga0157377_10146693 | |||
| 1271 | Ga0157379_10004932 | |||
| 1272 | Ga0157379_10069475 | |||
| 1273 | Ga0157376_10022035 | |||
| 1274 | Ga0157376_10023837 | |||
| 1275 | Ga0157376_10083979 | |||
| 1276 | Ga0163161_10061975 | |||
| 1277 | Ga0163161_10171762 | |||
| 1278 | Ga0206352_10246956 | |||
| 1279 | Ga0206353_11818343 | |||
| 1280 | Ga0213875_10000570 | |||
| 1281 | Ga0213875_10000604 | |||
| 1282 | Ga0224712_10040519 | |||
| 1283 | Ga0224712_10065178 | |||
| 1284 | Ga0209051_1000528 | |||
| 1285 | Ga0209051_1001208 | |||
| 1286 | Ga0209051_1006114 | |||
| 1287 | Ga0209051_1008439 | |||
| 1288 | Ga0209051_1028496 | |||
| 1289 | Ga0207656_10030145 | |||
| 1290 | Ga0207653_10000004 | |||
| 1291 | Ga0207653_10002058 | |||
| 1292 | Ga0207692_10001870 | |||
| 1293 | Ga0207642_10002962 | |||
| 1294 | Ga0207642_10012124 | |||
| 1295 | Ga0207642_10030974 | |||
| 1296 | Ga0207710_10001088 | |||
| 1297 | Ga0207710_10081651 | |||
| 1298 | Ga0207688_10000352 | |||
| 1299 | Ga0207688_10001514 | |||
| 1300 | Ga0207688_10014587 | |||
| 1301 | Ga0207647_10063954 | |||
| 1302 | Ga0207647_10079885 | |||
| 1303 | Ga0207685_10001280 | |||
| 1304 | Ga0207685_10003910 | |||
| 1305 | Ga0207699_10000156 | |||
| 1306 | Ga0207699_10002495 | |||
| 1307 | Ga0207699_10028701 | |||
| 1308 | Ga0207643_10000055 | |||
| 1309 | Ga0207643_10002720 | |||
| 1310 | Ga0207684_10000339 | |||
| 1311 | Ga0207684_10000911 | |||
| 1312 | Ga0207684_10057831 | |||
| 1313 | Ga0207654_10092056 | |||
| 1314 | Ga0207671_10008270 | |||
| 1315 | Ga0207671_10011790 | |||
| 1316 | Ga0207693_10000199 | |||
| 1317 | Ga0207693_10001171 | |||
| 1318 | Ga0207693_10001690 | |||
| 1319 | Ga0207693_10002490 | |||
| 1320 | Ga0207693_10005402 | |||
| 1321 | Ga0207693_10045359 | |||
| 1322 | Ga0207693_10061181 | |||
| 1323 | Ga0207693_10089600 | |||
| 1324 | Ga0207693_10093630 | |||
| 1325 | Ga0207663_10001603 | |||
| 1326 | Ga0207663_10005265 | |||
| 1327 | Ga0207663_10006245 | |||
| 1328 | Ga0207663_10014279 | |||
| 1329 | Ga0207663_10017362 | |||
| 1330 | Ga0207663_10021617 | |||
| 1331 | Ga0207662_10004973 | |||
| 1332 | Ga0207657_10030438 | |||
| 1333 | Ga0207657_10072009 | |||
| 1334 | Ga0207649_10020440 | |||
| 1335 | Ga0207649_10082505 | |||
| 1336 | Ga0207646_10000061 | |||
| 1337 | Ga0207646_10005885 | |||
| 1338 | Ga0207646_10007478 | |||
| 1339 | Ga0207646_10009346 | |||
| 1340 | Ga0207646_10042854 | |||
| 1341 | Ga0207650_10001024 | |||
| 1342 | Ga0207650_10020009 | |||
| 1343 | Ga0207659_10138959 | |||
| 1344 | Ga0207687_10001147 | |||
| 1345 | Ga0207687_10029528 | |||
| 1346 | Ga0207687_10165851 | |||
| 1347 | Ga0207700_10000063 | |||
| 1348 | Ga0207700_10016567 | |||
| 1349 | Ga0207700_10026919 | |||
| 1350 | Ga0207700_10029262 | |||
| 1351 | Ga0207700_10029504 | |||
| 1352 | Ga0207700_10055669 | |||
| 1353 | Ga0207700_10109651 | |||
| 1354 | Ga0207664_10000196 | |||
| 1355 | Ga0207664_10001029 | |||
| 1356 | Ga0207664_10002329 | |||
| 1357 | Ga0207664_10021830 | |||
| 1358 | Ga0207664_10024393 | |||
| 1359 | Ga0207664_10032064 | |||
| 1360 | Ga0207664_10044307 | |||
| 1361 | Ga0207664_10047539 | |||
| 1362 | Ga0207664_10056440 | |||
| 1363 | Ga0207664_10243144 | |||
| 1364 | Ga0207664_10272932 | |||
| 1365 | Ga0207664_10331043 | |||
| 1366 | Ga0207644_10005208 | |||
| 1367 | Ga0207644_10031027 | |||
| 1368 | Ga0207644_10103641 | |||
| 1369 | Ga0207690_10028152 | |||
| 1370 | Ga0207690_10054150 | |||
| 1371 | Ga0207706_10001128 | |||
| 1372 | Ga0207706_10009818 | |||
| 1373 | Ga0207706_10019781 | |||
| 1374 | Ga0207706_10022575 | |||
| 1375 | Ga0207686_10002468 | |||
| 1376 | Ga0207686_10005839 | |||
| 1377 | Ga0207686_10006248 | |||
| 1378 | Ga0207686_10037607 | |||
| 1379 | Ga0207709_10007186 | |||
| 1380 | Ga0207709_10017218 | |||
| 1381 | Ga0207709_10023700 | |||
| 1382 | Ga0207709_10034736 | |||
| 1383 | Ga0207709_10196818 | |||
| 1384 | Ga0207670_10127309 | |||
| 1385 | Ga0207669_10032348 | |||
| 1386 | Ga0207669_10057020 | |||
| 1387 | Ga0207669_10058311 | |||
| 1388 | Ga0207704_10000377 | |||
| 1389 | Ga0207704_10012981 | |||
| 1390 | Ga0207704_10044070 | |||
| 1391 | Ga0207704_10132560 | |||
| 1392 | Ga0207665_10000226 | |||
| 1393 | Ga0207665_10001670 | |||
| 1394 | Ga0207665_10005772 | |||
| 1395 | Ga0207665_10013801 | |||
| 1396 | Ga0207665_10056850 | |||
| 1397 | Ga0207665_10058954 | |||
| 1398 | Ga0207665_10059404 | |||
| 1399 | Ga0207665_10067547 | |||
| 1400 | Ga0207665_10073331 | |||
| 1401 | Ga0207691_10033981 | |||
| 1402 | Ga0207691_10040532 | |||
| 1403 | Ga0207711_10108185 | |||
| 1404 | Ga0207711_10165028 | |||
| 1405 | Ga0207689_10002296 | |||
| 1406 | Ga0207689_10009916 | |||
| 1407 | Ga0207689_10025969 | |||
| 1408 | Ga0207661_10082020 | |||
| 1409 | Ga0207661_10097199 | |||
| 1410 | Ga0207661_10104229 | |||
| 1411 | Ga0207679_10002946 | |||
| 1412 | Ga0207679_10169321 | |||
| 1413 | Ga0207667_10107381 | |||
| 1414 | Ga0207651_10050424 | |||
| 1415 | Ga0207712_10006309 | |||
| 1416 | Ga0207712_10043419 | |||
| 1417 | Ga0207668_10056080 | |||
| 1418 | Ga0207640_10003409 | |||
| 1419 | Ga0207658_10012179 | |||
| 1420 | Ga0207677_10011441 | |||
| 1421 | Ga0207703_10014135 | |||
| 1422 | Ga0207703_10018284 | |||
| 1423 | Ga0207703_10053855 | |||
| 1424 | Ga0207678_10001390 | |||
| 1425 | Ga0207678_10016407 | |||
| 1426 | Ga0207678_10032965 | |||
| 1427 | Ga0207678_10045686 | |||
| 1428 | Ga0207708_10003968 | |||
| 1429 | Ga0207708_10005234 | |||
| 1430 | Ga0207708_10005684 | |||
| 1431 | Ga0207708_10006707 | |||
| 1432 | Ga0207702_10138335 | |||
| 1433 | Ga0207641_10003507 | |||
| 1434 | Ga0207641_10071720 | |||
| 1435 | Ga0207648_10001355 | |||
| 1436 | Ga0207648_10004217 | |||
| 1437 | Ga0207648_10026700 | |||
| 1438 | Ga0207648_10103641 | |||
| 1439 | Ga0207676_10001452 | |||
| 1440 | Ga0207676_10016180 | |||
| 1441 | Ga0207676_10022955 | |||
| 1442 | Ga0207674_10000186 | |||
| 1443 | Ga0207674_10010966 | |||
| 1444 | Ga0207674_10150848 | |||
| 1445 | Ga0207675_100013054 | |||
| 1446 | Ga0207675_100015022 | |||
| 1447 | Ga0207675_100017867 | |||
| 1448 | Ga0207675_100040429 | |||
| 1449 | Ga0207675_100078529 | |||
| 1450 | Ga0207675_100163300 | |||
| 1451 | Ga0207683_10000201 | |||
| 1452 | Ga0207683_10008060 | |||
| 1453 | Ga0207683_10027425 | |||
| 1454 | Ga0207698_10205597 | |||
| 1455 | Ga0207428_10001001 | |||
| 1456 | Ga0207428_10011760 | |||
| 1457 | Ga0268266_10007843 | |||
| 1458 | Ga0268266_10065058 | |||
| 1459 | Ga0268266_10188837 | |||
| 1460 | Ga0268266_10205726 | |||
| 1461 | Ga0268266_10246931 | |||
| 1462 | Ga0268265_10121015 | |||
| 1463 | Ga0268264_10114403 | |||
| 1464 | Ga0265337_1000027 | |||
| 1465 | Ga0265326_10001234 | |||
| 1466 | Ga0265319_1001055 | |||
| 1467 | Ga0265334_10000773 | |||
| 1468 | Ga0265322_10001284 | |||
| 1469 | Ga0265336_10002288 | |||
| 1470 | Ga0265338_10000227 | |||
| 1471 | Ga0265338_10001512 | |||
| 1472 | Ga0265338_10007886 | |||
| 1473 | Ga0265338_10011419 | |||
| 1474 | Ga0265324_10004386 | |||
| 1475 | Ga0265332_10001185 | |||
| 1476 | Ga0265325_10005218 | |||
| 1477 | Ga0265339_10021776 | |||
| 1478 | Ga0265327_10008031 | |||
| 1479 | Ga0265316_10007705 | |||
| 1480 | Ga0307408_100231039 | |||
| 1481 | Ga0265313_10010516 | |||
| 1482 | Ga0265314_10010105 | |||
| 1483 | Ga0307405_10018316 | |||
| 1484 | Ga0307406_10058952 | |||
| 1485 | Ga0307409_100226090 | |||
| 1486 | Ga0307416_100017768 | |||
| 1487 | Ga0307415_100027908 | |||
| 1488 | Ga0373926_0001462 | |||
| 1489 | Ga0373926_0021075 | |||
| 1490 | Ga0373926_0032850 | |||
| 1491 | Ga0373934_0015454 | |||
| 1492 | Ga0373940_0001161 | |||
| 1493 | Ga0373944_0000926 | |||
| 1494 | Ga0373923_0009489 | |||
| 1495 | Ga0373923_0010272 | |||
| 1496 | Ga0373923_0020707 | |||
| 1497 | Ga0373936_0000519 | |||
| 1498 | Ga0373936_0004471 | |||
| 1499 | Ga0373936_0006048 | |||
| 1500 | Ga0373936_0008708 | |||
| 1501 | Ga0373936_0014364 | |||
| 1502 | Ga0373939_0005927 | |||
| 1503 | Ga0373941_0005711 | |||
| 1504 | Ga0373945_0001751 | |||
| 1505 | Ga0373945_0014754 | |||
| 1506 | Ga0373953_0003298 | |||
| 1507 | Ga0373954_0014349 | |||
| 1508 | Ga0373954_0035904 | |||
| 1509 | Ga0373956_0025651 | |||
| 1510 | Ga0373957_0015658 | |||
| 1511 | Ga0373957_0051606 | |||
| 1512 | Ga0373943_0000223 | |||
| 1513 | Ga0373946_0000756 | |||
| 1514 | Ga0373946_0000798 | |||
| 1515 | Ga0373955_0021637 | |||
| 1516 | Ga0373955_0101848 | |||
| 1517 | Ga0373962_0007345 | |||
| 1518 | Ga0373924_0008387 | |||
| 1519 | Ga0373924_0012085 | |||
| 1520 | Ga0373924_0051869 | |||
| 1521 | Ga0373931_0013389 | |||
| 1522 | Ga0373931_0022723 | |||
| 1523 | Ga0373935_0004598 | |||
| 1524 | Ga0373935_0010760 | |||
| 1525 | Ga0373935_0042798 | |||
| 1526 | Ga0373927_0003276 | |||
| 1527 | Ga0373927_0051849 | |||
| 1528 | Ga0373947_0000014 | |||
| 1529 | Ga0373937_0065515 | |||
| 1530 | Ga0373925_0000421 | |||
| 1531 | Ga0373925_0009690 | |||
| 1532 | Ga0373925_0010661 | |||
| 1533 | Ga0373925_0012062 | |||
| 1534 | Ga0373925_0045115 | |||
| 1535 | Ga0373925_0081599 | |||
| 1536 | Ga0395899_0005983 | |||
| 1537 | Ga0395899_0140674 | |||
| 1538 | Ga0395900_0033278 | |||
| 1539 | Ga0395900_0125814 | |||
| 1540 | Ga0395898_0003800 | |||
| 1541 | Ga0395898_0019897 | |||
| 1542 | Ga0395898_0019979 | |||
| 1543 | Ga0395905_0008955 | |||
| 1544 | Ga0395905_0047873 | |||
| 1545 | Ga0436364_0485851 | |||
| 1546 | Ga0436364_0824111 | |||
| 1547 | Ga0436364_0841117 | |||
| 1548 | Ga0436364_1107254 | |||
| 1549 | Ga0436364_1421530 | |||
| 1550 | Ga0436364_1435297 | |||
| 1551 | Ga0436364_1450559 | |||
| 1552 | Ga0436364_1520571 | |||
| 1553 | Ga0395901_0032219 | |||
| 1554 | Ga0439461_0000217 | |||
| 1555 | Ga0439466_0021262 | |||
| 1556 | Ga0439465_0000349 | |||
| 1557 | Ga0439431_0000859 | |||
| 1558 | Ga0439440_0014134 | |||
| 1559 | Ga0466969_0078576 | |||
| 1560 | Ga0466972_0012299 | |||
| 1561 | Ga0466965_0002177 | |||
| 1562 | Ga0466965_0022873 | |||
| 1563 | Ga0466966_0009549 | |||
| 1564 | Ga0466961_0002650 | |||
| 1565 | Ga0466963_0005765 | |||
| 1566 | Ga0466963_0040770 | |||
| 1567 | Ga0466964_0005286 | |||
| 1568 | Ga0466964_0017103 | |||
| 1569 | Ga0466968_0001088 | |||
| 1570 | Ga0466970_0016640 | |||
| 1571 | Ga0466957_0008856 | |||
| 1572 | Ga0466957_0043503 | |||
| 1573 | Ga0466960_0079258 | |||
| 1574 | Ga0466959_0001490 | |||
| 1575 | Ga0466959_0027893 | |||
| 1576 | Ga0466959_0075817 | |||
| 1577 | Ga0466958_0063732 | |||
| 1578 | Ga0466967_0010721 | |||
| 1579 | Ga0466967_0012654 | |||
| 1580 | Ga0466967_0036069 | |||
| 1581 | Ga0466967_0056273 | |||
| 1582 | Ga0466967_0056739 | |||
| 1583 | Ga0466967_0111964 | |||
| 1584 | Ga0466967_0113400 | |||
| 1585 | Ga0466967_0132388 | |||
| 1586 | Ga0466967_0158221 | |||
| 1587 | Ga0495592_0000455 | |||
| 1588 | Ga0495592_0015925 | |||
| 1589 | Ga0495592_0025553 | |||
| 1590 | Ga0495592_0068405 | |||
| 1591 | Ga0495603_0001901 | |||
| 1592 | Ga0495603_0006218 | |||
| 1593 | Ga0495603_0024918 | |||
| 1594 | Ga0495603_0040047 | |||
| 1595 | Ga0495603_0122091 | |||
| 1596 | Ga0495629_0003190 | |||
| 1597 | Ga0495629_0012234 | |||
| 1598 | Ga0495629_0190503 | |||
| 1599 | Ga0495638_0002264 | |||
| 1600 | Ga0495641_0007936 | |||
| 1601 | Ga0495641_0012394 | |||
| 1602 | Ga0495641_0044956 | |||
| 1603 | Ga0495651_0000174 | |||
| 1604 | Ga0495651_0007208 | |||
| 1605 | Ga0495651_0059179 | |||
| 1606 | Ga0495653_0000414 | |||
| 1607 | Ga0495580_0206685 | |||
| 1608 | Ga0495582_0013066 | |||
| 1609 | Ga0495582_0027448 | |||
| 1610 | Ga0495582_0033593 | |||
| 1611 | Ga0495582_0036446 | |||
| 1612 | Ga0495582_0155062 | |||
| 1613 | Ga0495605_0139752 | |||
| 1614 | Ga0495639_0019856 | |||
| 1615 | Ga0495662_0005395 | |||
| 1616 | Ga0495662_0013986 | |||
| 1617 | Ga0495662_0027687 | |||
| 1618 | Ga0495664_0000074 | |||
| 1619 | Ga0495664_0003697 | |||
| 1620 | Ga0495664_0039541 | |||
| 1621 | Ga0495664_0099478 | |||
| 1622 | Ga0495664_0113788 | |||
| 1623 | Ga0495664_0136094 | |||
| 1624 | Ga0495584_0037466 | |||
| 1625 | Ga0495584_0069862 | |||
| 1626 | Ga0495584_0089727 | |||
| 1627 | Ga0495594_0100555 | |||
| 1628 | Ga0495596_0029721 | |||
| 1629 | Ga0495606_0051487 | |||
| 1630 | Ga0495608_0000410 | |||
| 1631 | Ga0495608_0010194 | |||
| 1632 | Ga0495608_0018431 | |||
| 1633 | Ga0495618_0039001 | |||
| 1634 | Ga0495618_0071028 | |||
| 1635 | Ga0495618_0089619 | |||
| 1636 | Ga0495628_0000444 | |||
| 1637 | Ga0495628_0024834 | |||
| 1638 | Ga0495628_0101290 | |||
| 1639 | Ga0495628_0102534 | |||
| 1640 | Ga0495630_0009396 | |||
| 1641 | Ga0495630_0011332 | |||
| 1642 | Ga0495630_0016278 | |||
| 1643 | Ga0495630_0032481 | |||
| 1644 | Ga0495631_0051413 | |||
| 1645 | Ga0495644_0027858 | |||
| 1646 | Ga0495644_0028662 | |||
| 1647 | Ga0495648_0005458 | |||
| 1648 | Ga0495663_0006952 | |||
| 1649 | Ga0495666_0000996 | |||
| 1650 | Ga0495666_0068629 | |||
| 1651 | Ga0495652_0000665 | |||
| 1652 | Ga0495652_0043197 | |||
| 1653 | Ga0495654_0081550 | |||
| 1654 | Ga0495665_0009444 | |||
| 1655 | Ga0495665_0013989 | |||
| 1656 | Ga0495665_0061076 | |||
| 1657 | Ga0495640_0006097 | |||
| 1658 | Ga0495640_0018263 | |||
| 1659 | Ga0495586_0005340 | |||
| 1660 | Ga0495586_0107155 | |||
| 1661 | Ga0495587_0002878 | |||
| 1662 | Ga0495587_0019393 | |||
| 1663 | Ga0495587_0055100 | |||
| 1664 | Ga0495587_0091279 | |||
| 1665 | Ga0495609_0051361 | |||
| 1666 | Ga0495621_0023587 | |||
| 1667 | Ga0495645_0001127 | |||
| 1668 | Ga0495645_0158078 | |||
| 1669 | Ga0495667_0000117 | |||
| 1670 | Ga0495667_0000908 | |||
| 1671 | Ga0495667_0029518 | |||
| 1672 | Ga0495667_0047522 | |||
| 1673 | Ga0495667_0057206 | |||
| 1674 | Ga0495667_0068884 | |||
| 1675 | Ga0495667_0087160 | |||
| 1676 | Ga0495656_0000291 | |||
| 1677 | Ga0495656_0022991 | |||
| 1678 | Ga0495634_0001586 | |||
| 1679 | Ga0495634_0002700 | |||
| 1680 | Ga0495634_0056454 | |||
| 1681 | Ga0495635_0000773 | |||
| 1682 | Ga0495635_0011752 | |||
| 1683 | Ga0495635_0063839 | |||
| 1684 | Ga0495635_0173446 | |||
| 1685 | Ga0495659_0000889 | |||
| 1686 | Ga0495588_0001357 | |||
| 1687 | Ga0495657_0006991 | |||
| 1688 | Ga0495657_0007099 | |||
| 1689 | Ga0495657_0051040 | |||
| 1690 | Ga0495599_0000185 | |||
| 1691 | Ga0495599_0053041 | |||
| 1692 | Ga0495623_0055054 | |||
| 1693 | Ga0495646_0000628 | |||
| 1694 | Ga0495646_0018567 | |||
| 1695 | Ga0495646_0041034 | |||
| 1696 | Ga0495647_0001537 | |||
| 1697 | Ga0495647_0042764 | |||
| 1698 | Ga0495647_0058534 | |||
| 1699 | Ga0495658_0001438 | |||
| 1700 | Ga0495658_0011377 | |||
| 1701 | Ga0495613_0053181 | |||
| 1702 | Ga0495613_0108031 | |||
| 1703 | Ga0495624_0006757 | |||
| 1704 | Ga0495624_0028048 | |||
| 1705 | Ga0495624_0033267 | |||
| 1706 | Ga0495624_0086899 | |||
| 1707 | Ga0495671_0034988 | |||
| 1708 | Ga0495589_0007696 | |||
| 1709 | Ga0495600_0014669 | |||
| 1710 | Ga0495581_0004943 | |||
| 1711 | Ga0495581_0008059 | |||
| 1712 | Ga0495581_0009928 | |||
| 1713 | Ga0495581_0036608 | |||
| 1714 | Ga0495604_0016061 | |||
| 1715 | Ga0495604_0025456 | |||
| 1716 | Ga0495636_0005073 | |||
| 1717 | Ga0495674_0000984 | |||
| 1718 | Ga0495674_0002797 | |||
| 1719 | Ga0495674_0041283 | |||
| 1720 | Ga0495674_0050652 | |||
| 1721 | Ga0495674_0054886 | |||
| 1722 | Ga0495674_0107812 | |||
| 1723 | Ga0495672_0030900 | |||
| 1724 | Ga0495676_0020287 | |||
| 1725 | Ga0495676_0040298 | |||
| 1726 | Ga0495680_0000401 | |||
| 1727 | Ga0495680_0001586 | |||
| 1728 | Ga0495680_0029597 | |||
| 1729 | Ga0495680_0071146 | |||
| 1730 | Ga0495680_0167712 | |||
| 1731 | Ga0495675_0005713 | |||
| 1732 | Ga0495675_0009139 | |||
| 1733 | Ga0495673_0001205 | |||
| 1734 | Ga0495684_0000598 | |||
| 1735 | Ga0495684_0005984 | |||
| 1736 | Ga0495686_0003330 | |||
| 1737 | Ga0495686_0058912 | |||
| 1738 | Ga0495593_0015763 | |||
| 1739 | Ga0495593_0050767 | |||
| 1740 | Ga0495602_0002949 | |||
| 1741 | Ga0495602_0130474 | |||
| 1742 | Ga0495614_0001554 | |||
| 1743 | Ga0496100_0004799 | |||
| 1744 | Ga0496100_0006150 | |||
| 1745 | Ga0496100_0009450 | |||
| 1746 | Ga0496100_0042136 | |||
| 1747 | Ga0496100_0083030 | |||
| 1748 | Ga0496101_0000021 | |||
| 1749 | Ga0496101_0001613 | |||
| 1750 | Ga0496101_0056770 | |||
| 1751 | Ga0496102_0000001 | |||
| 1752 | Ga0496102_0000590 | |||
| 1753 | Ga0496102_0001309 | |||
| 1754 | Ga0496102_0010316 | |||
| 1755 | Ga0496102_0029162 | |||
| 1756 | Ga0496102_0073674 | |||
| 1757 | Ga0496103_0000007 | |||
| 1758 | Ga0496103_0015572 | |||
| 1759 | Ga0496103_0019054 | |||
| 1760 | Ga0496103_0041252 | |||
| 1761 | Ga0496103_0074244 | |||
| 1762 | Ga0496103_0156782 | |||
| 1763 | Ga0496104_0010504 | |||
| 1764 | Ga0496104_0011782 | |||
| 1765 | Ga0496104_0020133 | |||
| 1766 | Ga0496104_0091076 | |||
| 1767 | Ga0496104_0187398 | |||
| 1768 | Ga0496104_0323470 | |||
| 1769 | Ga0496105_0015872 | |||
| 1770 | Ga0496105_0031392 | |||
| 1771 | Ga0496105_0057685 | |||
| 1772 | Ga0496105_0182583 | |||
| 1773 | Ga0496106_0002503 | |||
| 1774 | Ga0496106_0003195 | |||
| 1775 | Ga0496106_0003386 | |||
| 1776 | Ga0496106_0028783 | |||
| 1777 | Ga0496106_0065366 | |||
| 1778 | Ga0496106_0107582 | |||
| 1779 | Ga0496107_0000321 | |||
| 1780 | Ga0496107_0003559 | |||
| 1781 | Ga0496107_0011486 | |||
| 1782 | Ga0496107_0016357 | |||
| 1783 | Ga0496107_0040227 | |||
| 1784 | Ga0496107_0041137 | |||
| 1785 | Ga0496107_0074185 | |||
| 1786 | Ga0496108_0000645 | |||
| 1787 | Ga0496108_0020996 | |||
| 1788 | Ga0496108_0021599 | |||
| 1789 | Ga0496108_0028914 | |||
| 1790 | Ga0496108_0093677 | |||
| 1791 | Ga0496108_0127244 | |||
| 1792 | Ga0496108_0132006 | |||
| 1793 | Ga0496108_0143694 | |||
| 1794 | Ga0496109_0016603 | |||
| 1795 | Ga0496109_0024888 | |||
| 1796 | Ga0496109_0053112 | |||
| 1797 | Ga0496109_0280463 | |||
| 1798 | Ga0496110_0002173 | |||
| 1799 | Ga0496110_0034997 | |||
| 1800 | Ga0496110_0039235 | |||
| 1801 | Ga0496110_0209617 | |||
| 1802 | Ga0496110_0231112 | |||
| 1803 | Ga0496111_0025718 | |||
| 1804 | Ga0496111_0031195 | |||
| 1805 | Ga0496111_0043019 | |||
| 1806 | Ga0496111_0072558 | |||
| 1807 | Ga0496111_0078746 | |||
| 1808 | Ga0496111_0117387 | |||
| 1809 | Ga0496112_0005708 | |||
| 1810 | Ga0496112_0117982 | |||
| 1811 | Ga0496113_0013407 | |||
| 1812 | Ga0496113_0032813 | |||
| 1813 | Ga0496113_0121038 | |||
| 1814 | Ga0496114_0000495 | |||
| 1815 | Ga0496114_0002288 | |||
| 1816 | Ga0496114_0032144 | |||
| 1817 | Ga0496114_0041127 | |||
| 1818 | Ga0496115_0001075 | |||
| 1819 | Ga0496115_0003085 | |||
| 1820 | Ga0496115_0014339 | |||
| 1821 | Ga0496115_0101112 | |||
| 1822 | Ga0496116_0000018 | |||
| 1823 | Ga0496116_0000166 | |||
| 1824 | Ga0496117_0000015 | |||
| 1825 | Ga0496118_0000012 | |||
| 1826 | Ga0496118_0051275 | |||
| 1827 | Ga0496119_0000454 | |||
| 1828 | Ga0496119_0060786 | |||
| 1829 | Ga0496119_0072685 | |||
| 1830 | Ga0496120_0001962 | |||
| 1831 | Ga0496120_0006298 | |||
| 1832 | Ga0496121_0000177 | |||
| 1833 | Ga0496125_0016319 | |||
| 1834 | Ga0496126_0001113 | |||
| 1835 | Ga0501034_0127982 | |||
| 1836 | Ga0501038_0121932 | |||
| 1837 | Ga0501067_0004530 | |||
| 1838 | Ga0501068_0110415 | |||
| 1839 | Ga0501070_0040248 | |||
| 1840 | Ga0501073_0100478 | |||
| 1841 | Ga0501074_0062711 | |||
| 1842 | Ga0501074_0133790 | |||
| 1843 | Ga0501077_0028597 | |||
| 1844 | Ga0501080_0516152 | |||
| 1845 | Ga0501083_0016126 | |||
| 1846 | Ga0501083_0038734 | |||
| 1847 | Ga0501044_0196617 | |||
| 1848 | nmdc:mga03683_3552_c1 | |||
| 1849 | nmdc:mga03n38_17725_c1 | |||
| 1850 | nmdc:mga03n38_7306_c1 | |||
| 1851 | nmdc:mga03n38_9110_c1 | |||
| 1852 | nmdc:mga00v17_1369_c1 | |||
| 1853 | nmdc:mga00v17_17742_c2 | |||
| 1854 | nmdc:mga00v17_5888_c1 | |||
| 1855 | nmdc:mga0yw44_15068_c1 | |||
| 1856 | nmdc:mga0yw44_64861_c1 | |||
| 1857 | nmdc:mga07m45_24287_c1 | |||
| 1858 | nmdc:mga07m45_69649_c1 | |||
| 1859 | nmdc:mga05p37_11253_c1 | |||
| 1860 | nmdc:mga05p37_47560_c1 | |||
| 1861 | nmdc:mga05p37_87829_c1 | |||
| 1862 | nmdc:mga09592_86124_c1 | |||
| 1863 | nmdc:mga08y16_140196_c1 | |||
| 1864 | nmdc:mga0n895_16162_c1 | |||
| 1865 | nmdc:mga0n895_17799_c1 | |||
| 1866 | nmdc:mga0n895_213832_c1 | |||
| 1867 | nmdc:mga0n895_39305_c1 | |||
| 1868 | nmdc:mga0rr50_3260_c1 | |||
| 1869 | nmdc:mga0a205_2637_c1 | |||
| 1870 | nmdc:mga0sz30_3201_c1 | |||
| 1871 | nmdc:mga0sz30_42494_c1 | |||
| 1872 | nmdc:mga0sz30_88335_c1 | |||
| 1873 | Ga0495601_0015602 | |||
| 1874 | Ga0495601_0085524 | |||
| 1875 | Ga0495612_0008199 | |||
| 1876 | Ga0500635_0004952 | |||
| 1877 | Ga0495655_0001501 | |||
| 1878 | Ga0495595_0002988 | |||
| 1879 | Ga0495595_0024353 | |||
| 1880 | Ga0495619_0001449 | |||
| 1881 | Ga0495619_0037454 | |||
| 1882 | Ga0495619_0046837 | |||
| 1883 | Ga0495619_0063206 | |||
| 1884 | Ga0500643_001154 | |||
| 1885 | Ga0500643_001862 | |||
| 1886 | Ga0500643_006474 | |||
| 1887 | Ga0500643_007970 | |||
| 1888 | Ga0500556_0001572 | |||
| 1889 | Ga0500562_005490 | |||
| 1890 | Ga0500652_007547 | |||
| 1891 | Ga0500645_000035 | |||
| 1892 | Ga0501082_0022336 | |||
| 1893 | 2644488274 | |||
| 1894 | 2738704647 | |||
| 1895 | 2902795187 | |||
| 1896 | 2902811298 | |||
| 1897 | 2902841362 | |||
| 1898 | 2929216249 | |||
| 1899 | 2939583058 | |||
| 1900 | 8055072402 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bvt-assembly1.cif.gz_A | crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis | 0.92 | 35 | 426 |
| 7bvt-assembly1.cif.gz_A | crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis | 0.9109 | 35 | 426 |
| 3uor-assembly2.cif.gz_B | the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri | 0.8823 | 37 | 428 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.8742 | 37 | 428 |
| 1n3x-assembly1.cif.gz_A | ligand-free high-affinity maltose-binding protein | 0.8715 | 38 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uorB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8736 | 37 | 149 | 3.40.190.10 |
| 4hs7A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8679 | 36 | 150 | 3.40.190.10 |
| af_O53485_33_438_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8674 | 38 | 427 | 3.40.190.10 |
| 3n95B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8632 | 38 | 150 | 3.40.190.10 |
| 4rjzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8556 | 37 | 149 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661VLR6-F1-model_v4 | ABC transporter substrate-binding protein | 0.8946 | 129 | 428 |
GO:0030313
|
| AF-A0A0S7XGC0-F1-model_v4 | ABC transporter substrate-binding protein | 0.8942 | 27 | 428 |
GO:0015768
GO:0042956 GO:0055052 GO:1901982 |
| AF-A0A496QBQ7-F1-model_v4 | ABC transporter substrate-binding protein | 0.8915 | 128 | 426 |
GO:0030313
|
| AF-D8H0S8-F1-model_v4 | deleted | 0.8882 | 91 | 429 |
|
| AF-A0A496QBQ7-F1-model_v4 | ABC transporter substrate-binding protein | 0.883 | 128 | 426 |
GO:0030313
|