F486544

General Info

Members Datasets Scaffolds Average Seq Length
950 392 1900 411

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100011909|Ga0068869_1000119094
Length 448
Sequence MRPLAAAIKIRLRECALYIAHSRIILDHTARELRSSTQRTSVPSAHPAPCEGVSTVTRPRLPTKITVWNGWTDVQAENFTRLLDQYNKEHPDVQVTQLVTPSDQVLQKVLTAVRGNSAPDVAYMFGSWSPNIAEIPQVVNMAEYVKQPDWKWDDFYPGERAAATVGDKVVGVPALVDNLAIVYNKTLFEQAGLTPPTSAAAKLTDPAKGQYGWSIPADGSEDTVWHYLPMLWEAGGDLLTPDNQHAAFNSEAGVKALTTLQQMAVTDKSLYVDTTNQEYSKLFTAGKIGMLVTGPWDLGTFSDVDYGVQIMPTYTGSAGGHQTISGPDNWVVFDNGAQRKQAAIDFVKWLTAAPQVKSTSLTTADLPTRISVGDDSAFVAELNEKQPGSEVFVHNLANAQKARPTVSQYPKISEALGQAIVSVLLGKAQPADALNTAAQTTDAALAEK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
380 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
386 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
387 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
388 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
389 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
390 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
391 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
392 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.63
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 8.32
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100011909 3300005334 Bacteria 5722
2 JGI24752J21851_1002611 3300001976 Bacteria 2399
3 JGI24746J21847_1000089 3300001977 Bacteria 10008
4 JGI24743J22301_10000709 3300001991 Bacteria 4122
5 JGI24033J26618_1000486 3300002155 Bacteria 3902
6 JGI24751J29686_10000684 3300002459 Bacteria 8434
7 JGI24751J29686_10009198 3300002459 Bacteria 2029
8 JGI24751J29686_10016832 3300002459 Bacteria 1509
9 JGI25404J52841_10001437 3300003659 Bacteria 4191
10 Ga0055540_1001155 3300003792 Bacteria 16426
11 Ga0055540_1002276 3300003792 Bacteria 10354
12 Ga0058861_11975033 3300004800 Bacteria 1991
13 Ga0058862_10034740 3300004803 Bacteria 1396
14 Ga0070658_10093466 3300005327 Bacteria 2481
15 Ga0070683_100199128 3300005329 Bacteria 1902
16 Ga0070670_100088619 3300005331 Bacteria 2660
17 Ga0068869_100068037 3300005334 Bacteria 2629
18 Ga0070680_100072410 3300005336 Bacteria 2832
19 Ga0070682_100022719 3300005337 Bacteria 3718
20 Ga0070682_100049408 3300005337 Bacteria 2622
21 Ga0068868_100000529 3300005338 Bacteria 25593
22 Ga0068868_100014372 3300005338 Bacteria 5834
23 Ga0070660_100188515 3300005339 Bacteria 1670
24 Ga0070660_100222383 3300005339 Bacteria 1535
25 Ga0070691_10011823 3300005341 Bacteria 3994
26 Ga0070661_100005479 3300005344 Bacteria 8752
27 Ga0070661_100009141 3300005344 Bacteria 6848
28 Ga0070668_100005441 3300005347 Bacteria 9451
29 Ga0070668_100055714 3300005347 Bacteria 3052
30 Ga0070675_100063813 3300005354 Bacteria 3045
31 Ga0070675_100313505 3300005354 Bacteria 1384
32 Ga0070671_100010460 3300005355 Bacteria 7442
33 Ga0070671_100013019 3300005355 Bacteria 6704
34 Ga0070671_100047247 3300005355 Bacteria 3580
35 Ga0070674_100002482 3300005356 Bacteria 10217
36 Ga0070674_100003430 3300005356 Bacteria 8897
37 Ga0070674_100021807 3300005356 Bacteria 4121
38 Ga0070673_100010279 3300005364 Bacteria 6329
39 Ga0070688_100005859 3300005365 Bacteria 6503
40 Ga0070667_100002267 3300005367 Bacteria 16931
41 Ga0070667_100105326 3300005367 Bacteria 2441
42 Ga0070667_100212282 3300005367 Bacteria 1721
43 Ga0070703_10000001 3300005406 Bacteria 202194
44 Ga0070703_10010304 3300005406 Bacteria 2634
45 Ga0070709_10000243 3300005434 Bacteria 35120
46 Ga0070709_10000794 3300005434 Bacteria 17668
47 Ga0070709_10012534 3300005434 Bacteria 4746
48 Ga0070709_10022973 3300005434 Bacteria 3656
49 Ga0070709_10079546 3300005434 Bacteria 2135
50 Ga0070709_10173787 3300005434 Bacteria 1507
51 Ga0070714_100000640 3300005435 Bacteria 24879
52 Ga0070714_100004478 3300005435 Bacteria 10525
53 Ga0070714_100040816 3300005435 Bacteria 3912
54 Ga0070714_100042573 3300005435 Bacteria 3837
55 Ga0070714_100060030 3300005435 Bacteria 3263
56 Ga0070714_100180351 3300005435 Bacteria 1921
57 Ga0070714_100180693 3300005435 Bacteria 1919
58 Ga0070713_100000428 3300005436 Bacteria 26844
59 Ga0070713_100004385 3300005436 Bacteria 9479
60 Ga0070713_100021199 3300005436 Bacteria 4993
61 Ga0070713_100023985 3300005436 Bacteria 4744
62 Ga0070713_100025930 3300005436 Bacteria 4593
63 Ga0070713_100113829 3300005436 Bacteria 2362
64 Ga0070710_10000101 3300005437 Bacteria 39498
65 Ga0070710_10000900 3300005437 Bacteria 14236
66 Ga0070710_10001923 3300005437 Bacteria 9836
67 Ga0070710_10003412 3300005437 Bacteria 7527
68 Ga0070710_10073616 3300005437 Bacteria 1976
69 Ga0070701_10003486 3300005438 Bacteria 6233
70 Ga0070701_10023934 3300005438 Bacteria 2948
71 Ga0070711_100000437 3300005439 Bacteria 21680
72 Ga0070711_100001095 3300005439 Bacteria 14465
73 Ga0070711_100001607 3300005439 Bacteria 12467
74 Ga0070711_100004296 3300005439 Bacteria 8388
75 Ga0070711_100004473 3300005439 Bacteria 8258
76 Ga0070711_100105261 3300005439 Bacteria 2060
77 Ga0070711_100147979 3300005439 Bacteria 1768
78 Ga0070705_100018343 3300005440 Bacteria 3667
79 Ga0070705_100027798 3300005440 Bacteria 3091
80 Ga0070705_100038364 3300005440 Bacteria 2710
81 Ga0070700_100008542 3300005441 Bacteria 5575
82 Ga0070700_100009104 3300005441 Bacteria 5441
83 Ga0070700_100018846 3300005441 Bacteria 3974
84 Ga0070700_100049200 3300005441 Bacteria 2616
85 Ga0070694_100015852 3300005444 Bacteria 4741
86 Ga0070694_100033732 3300005444 Bacteria 3371
87 Ga0070694_100041620 3300005444 Bacteria 3066
88 Ga0070708_100001067 3300005445 Bacteria 20944
89 Ga0070708_100287649 3300005445 Bacteria 1547
90 Ga0070663_100004269 3300005455 Bacteria 8363
91 Ga0070663_100018208 3300005455 Bacteria 4599
92 Ga0070663_100140945 3300005455 Bacteria 1841
93 Ga0070678_100009361 3300005456 Bacteria 5929
94 Ga0070678_100067738 3300005456 Bacteria 2658
95 Ga0070662_100009027 3300005457 Bacteria 6502
96 Ga0070662_100017040 3300005457 Bacteria 4889
97 Ga0070662_100044175 3300005457 Bacteria 3190
98 Ga0070681_10126386 3300005458 Bacteria 2489
99 Ga0068867_100001323 3300005459 Bacteria 17157
100 Ga0068867_100002000 3300005459 Bacteria 14225
101 Ga0068867_100149122 3300005459 Bacteria 1835
102 Ga0070685_10050343 3300005466 Bacteria 2406
103 Ga0070706_100003990 3300005467 Bacteria 14367
104 Ga0070706_100010233 3300005467 Bacteria 8717
105 Ga0070706_100030567 3300005467 Bacteria 4964
106 Ga0070706_100298265 3300005467 Bacteria 1504
107 Ga0070707_100000041 3300005468 Bacteria 111077
108 Ga0070707_100008503 3300005468 Bacteria 9535
109 Ga0070707_100011276 3300005468 Bacteria 8333
110 Ga0070707_100031450 3300005468 Bacteria 5056
111 Ga0070707_100140216 3300005468 Bacteria 2353
112 Ga0070698_100000082 3300005471 Bacteria 73573
113 Ga0070698_100030094 3300005471 Bacteria 5633
114 Ga0070698_100051050 3300005471 Bacteria 4214
115 Ga0070698_100075801 3300005471 Bacteria 3367
116 Ga0070698_100173688 3300005471 Bacteria 2095
117 Ga0070684_100003351 3300005535 Bacteria 12004
118 Ga0070684_100031025 3300005535 Bacteria 4547
119 Ga0070684_100082513 3300005535 Bacteria 2846
120 Ga0070697_100036724 3300005536 Bacteria 3958
121 Ga0070697_100049392 3300005536 Bacteria 3415
122 Ga0068853_100008397 3300005539 Bacteria 8294
123 Ga0068853_100016775 3300005539 Bacteria 6034
124 Ga0068853_100049796 3300005539 Bacteria 3601
125 Ga0068853_100069006 3300005539 Bacteria 3074
126 Ga0070672_100162157 3300005543 Bacteria 1856
127 Ga0070695_100010024 3300005545 Bacteria 5651
128 Ga0070695_100139249 3300005545 Bacteria 1681
129 Ga0070695_100182054 3300005545 Bacteria 1490
130 Ga0070696_100003305 3300005546 Bacteria 10765
131 Ga0070696_100005272 3300005546 Bacteria 8629
132 Ga0070696_100058492 3300005546 Bacteria 2692
133 Ga0070696_100063569 3300005546 Bacteria 2585
134 Ga0070693_100001858 3300005547 Bacteria 9651
135 Ga0070665_100001745 3300005548 Bacteria 24881
136 Ga0070665_100009958 3300005548 Bacteria 9614
137 Ga0070665_100022355 3300005548 Bacteria 6364
138 Ga0070665_100045725 3300005548 Bacteria 4396
139 Ga0070665_100096225 3300005548 Bacteria 2966
140 Ga0070704_100000706 3300005549 Bacteria 16275
141 Ga0070704_100004595 3300005549 Bacteria 7982
142 Ga0070704_100007803 3300005549 Bacteria 6381
143 Ga0068855_100055086 3300005563 Bacteria 4672
144 Ga0068855_100076751 3300005563 Bacteria 3876
145 Ga0070664_100002582 3300005564 Bacteria 14605
146 Ga0068857_100017591 3300005577 Bacteria 6267
147 Ga0068854_100005243 3300005578 Bacteria 8178
148 Ga0070702_100001404 3300005615 Bacteria 9838
149 Ga0070702_100017389 3300005615 Bacteria 3708
150 Ga0070702_100148897 3300005615 Unclassified 1500
151 Ga0068852_100156097 3300005616 Bacteria 2126
152 Ga0068859_100003134 3300005617 Bacteria 16809
153 Ga0068864_100020685 3300005618 Bacteria 5506
154 Ga0068864_100098059 3300005618 Bacteria 2595
155 Ga0068864_100114068 3300005618 Bacteria 2409
156 Ga0068866_10000376 3300005718 Bacteria 21007
157 Ga0068866_10013060 3300005718 Bacteria 3633
158 Ga0068866_10057117 3300005718 Bacteria 2010
159 Ga0068861_100025534 3300005719 Bacteria 4286
160 Ga0068861_100030613 3300005719 Bacteria 3946
161 Ga0068861_100052331 3300005719 Bacteria 3103
162 Ga0068870_10029598 3300005840 Bacteria 2760
163 Ga0068863_100001514 3300005841 Bacteria 22958
164 Ga0068863_100006801 3300005841 Bacteria 11207
165 Ga0068858_100002465 3300005842 Bacteria 18668
166 Ga0068858_100071177 3300005842 Bacteria 3225
167 Ga0068858_100080445 3300005842 Bacteria 3028
168 Ga0068858_100113426 3300005842 Bacteria 2531
169 Ga0068860_100025928 3300005843 Bacteria 5656
170 Ga0068860_100115207 3300005843 Bacteria 2570
171 Ga0068860_100249342 3300005843 Bacteria 1728
172 Ga0068862_100043121 3300005844 Bacteria 3845
173 Ga0081455_10001614 3300005937 Bacteria 27559
174 Ga0081455_10003773 3300005937 Bacteria 17295
175 Ga0081455_10043919 3300005937 Bacteria 3905
176 Ga0081455_10071142 3300005937 Bacteria 2885
177 Ga0081538_10000404 3300005981 Bacteria 48911
178 Ga0081540_1000505 3300005983 Bacteria 38435
179 Ga0081539_10021040 3300005985 Bacteria 4377
180 Ga0070717_10000956 3300006028 Bacteria 19241
181 Ga0070717_10007851 3300006028 Bacteria 7943
182 Ga0070717_10034864 3300006028 Bacteria 4070
183 Ga0070717_10047787 3300006028 Bacteria 3508
184 Ga0070717_10064802 3300006028 Bacteria 3036
185 Ga0075365_10015384 3300006038 Bacteria 4627
186 Ga0075365_10090040 3300006038 Bacteria 2089
187 Ga0075365_10140439 3300006038 Bacteria 1677
188 Ga0075363_100000787 3300006048 Bacteria 10932
189 Ga0075363_100060987 3300006048 Bacteria 2031
190 Ga0075363_100077904 3300006048 Bacteria 1809
191 Ga0075363_100087743 3300006048 Bacteria 1709
192 Ga0075363_100115160 3300006048 Bacteria 1497
193 Ga0075364_10000184 3300006051 Bacteria 28604
194 Ga0075364_10006965 3300006051 Bacteria 6679
195 Ga0075364_10076198 3300006051 Bacteria 2213
196 Ga0075432_10000387 3300006058 Bacteria 12750
197 Ga0075432_10004840 3300006058 Bacteria 4582
198 Ga0070715_10004042 3300006163 Bacteria 4759
199 Ga0070715_10013894 3300006163 Bacteria 2968
200 Ga0070715_10023722 3300006163 Bacteria 2407
201 Ga0070716_100000560 3300006173 Bacteria 15555
202 Ga0070716_100002661 3300006173 Bacteria 8264
203 Ga0070716_100004017 3300006173 Bacteria 6984
204 Ga0070716_100005420 3300006173 Bacteria 6179
205 Ga0070716_100006565 3300006173 Bacteria 5687
206 Ga0070712_100001062 3300006175 Bacteria 16596
207 Ga0070712_100002191 3300006175 Bacteria 12010
208 Ga0070712_100012459 3300006175 Bacteria 5406
209 Ga0070712_100017727 3300006175 Bacteria 4612
210 Ga0070712_100102759 3300006175 Bacteria 2117
211 Ga0070712_100126999 3300006175 Bacteria 1928
212 Ga0075367_10001919 3300006178 Bacteria 9229
213 Ga0075367_10088124 3300006178 Bacteria 1886
214 Ga0075369_10001370 3300006186 Bacteria 8293
215 Ga0075369_10037641 3300006186 Bacteria 2061
216 Ga0097621_100015140 3300006237 Bacteria 5795
217 Ga0097621_100073596 3300006237 Bacteria 2828
218 Ga0075370_10008783 3300006353 Bacteria 5215
219 Ga0075370_10033932 3300006353 Bacteria 2860
220 Ga0075370_10044383 3300006353 Bacteria 2513
221 Ga0068871_100018339 3300006358 Bacteria 5316
222 Ga0068871_100189674 3300006358 Bacteria 1770
223 Ga0075428_100065799 3300006844 Bacteria 3969
224 Ga0075428_100089059 3300006844 Bacteria 3366
225 Ga0075430_100051156 3300006846 Bacteria 3482
226 Ga0075431_100036726 3300006847 Bacteria 5046
227 Ga0075433_10005527 3300006852 Bacteria 9923
228 Ga0075433_10012875 3300006852 Bacteria 6777
229 Ga0075433_10163690 3300006852 Bacteria 1980
230 Ga0075434_100003943 3300006871 Bacteria 13290
231 Ga0075434_100005157 3300006871 Bacteria 11860
232 Ga0075434_100008894 3300006871 Bacteria 9348
233 Ga0075434_100014932 3300006871 Bacteria 7431
234 Ga0068865_100000828 3300006881 Bacteria 17443
235 Ga0068865_100022777 3300006881 Bacteria 4092
236 Ga0068865_100028975 3300006881 Bacteria 3669
237 Ga0068865_100029811 3300006881 Bacteria 3624
238 Ga0097620_100003133 3300006931 Bacteria 16809
239 Ga0075435_100007491 3300007076 Bacteria 7786
240 Ga0075435_100107436 3300007076 Bacteria 2318
241 Ga0105251_10017533 3300009011 Bacteria 3834
242 Ga0111539_10184592 3300009094 Bacteria 2436
243 Ga0105245_10003220 3300009098 Bacteria 14625
244 Ga0105245_10018583 3300009098 Bacteria 6080
245 Ga0105245_10107688 3300009098 Bacteria 2588
246 Ga0105245_10116217 3300009098 Bacteria 2494
247 Ga0105245_10133233 3300009098 Bacteria 2333
248 Ga0105245_10162114 3300009098 Bacteria 2123
249 Ga0105245_10171307 3300009098 Bacteria 2067
250 Ga0105247_10000334 3300009101 Bacteria 41242
251 Ga0105247_10029448 3300009101 Bacteria 3327
252 Ga0105247_10069989 3300009101 Bacteria 2191
253 Ga0114129_10004398 3300009147 Bacteria 19873
254 Ga0114129_10018631 3300009147 Bacteria 9882
255 Ga0114129_10019233 3300009147 Bacteria 9728
256 Ga0114129_10026156 3300009147 Bacteria 8264
257 Ga0114129_10039891 3300009147 Bacteria 6623
258 Ga0114129_10223859 3300009147 Bacteria 2537
259 Ga0105243_10005418 3300009148 Bacteria 9960
260 Ga0105243_10006751 3300009148 Bacteria 8853
261 Ga0105243_10007191 3300009148 Bacteria 8556
262 Ga0105243_10116559 3300009148 Bacteria 2244
263 Ga0105241_10019951 3300009174 Bacteria 4948
264 Ga0105242_10000620 3300009176 Bacteria 27832
265 Ga0105242_10002226 3300009176 Bacteria 15303
266 Ga0105242_10002528 3300009176 Bacteria 14350
267 Ga0105242_10042211 3300009176 Bacteria 3682
268 Ga0105242_10052953 3300009176 Bacteria 3313
269 Ga0105248_10004419 3300009177 Bacteria 15561
270 Ga0105248_10025304 3300009177 Bacteria 6599
271 Ga0105248_10044839 3300009177 Bacteria 4960
272 Ga0105237_10000178 3300009545 Bacteria 89960
273 Ga0105237_10002564 3300009545 Bacteria 22427
274 Ga0105237_10034235 3300009545 Bacteria 5144
275 Ga0105237_10051382 3300009545 Bacteria 4140
276 Ga0105238_10093468 3300009551 Bacteria 2995
277 Ga0105238_10195444 3300009551 Bacteria 1999
278 Ga0105249_10000767 3300009553 Bacteria 28791
279 Ga0105249_10012184 3300009553 Bacteria 7573
280 Ga0105249_10053836 3300009553 Bacteria 3678
281 Ga0105249_10108817 3300009553 Bacteria 2617
282 Ga0105249_10172159 3300009553 Bacteria 2101
283 Ga0105239_10002879 3300010375 Bacteria 21522
284 Ga0105239_10007516 3300010375 Bacteria 12498
285 Ga0105239_10030663 3300010375 Bacteria 5914
286 Ga0105239_10059987 3300010375 Bacteria 4174
287 Ga0105239_10228472 3300010375 Bacteria 2088
288 Ga0105239_10269472 3300010375 Archaea 1915
289 Ga0105246_10066414 3300011119 Bacteria 2525
290 Ga0105246_10140320 3300011119 Bacteria 1816
291 Ga0157373_10015473 3300013100 Bacteria 5577
292 Ga0157371_10099871 3300013102 Bacteria 2058
293 Ga0157370_10030713 3300013104 Bacteria 5263
294 Ga0157369_10003613 3300013105 Bacteria 18373
295 Ga0157374_10035561 3300013296 Bacteria 4558
296 Ga0157374_10067899 3300013296 Bacteria 3353
297 Ga0157374_10232882 3300013296 Bacteria 1810
298 Ga0157378_10001690 3300013297 Bacteria 19860
299 Ga0157378_10018845 3300013297 Bacteria 6066
300 Ga0157378_10019027 3300013297 Bacteria 6035
301 Ga0157378_10089398 3300013297 Bacteria 2797
302 Ga0163162_10026392 3300013306 Bacteria 5740
303 Ga0163162_10027146 3300013306 Bacteria 5661
304 Ga0163162_10174064 3300013306 Bacteria 2277
305 Ga0163162_10205789 3300013306 Bacteria 2097
306 Ga0157372_10171892 3300013307 Bacteria 2507
307 Ga0157372_10341252 3300013307 Bacteria 1745
308 Ga0157375_10003452 3300013308 Bacteria 13692
309 Ga0157375_10042351 3300013308 Bacteria 4407
310 Ga0157375_10122797 3300013308 Bacteria 2709
311 Ga0163163_10002897 3300014325 Bacteria 14510
312 Ga0163163_10008170 3300014325 Bacteria 9282
313 Ga0163163_10021984 3300014325 Bacteria 6030
314 Ga0163163_10032021 3300014325 Bacteria 5078
315 Ga0163163_10067769 3300014325 Bacteria 3549
316 Ga0163163_10385973 3300014325 Bacteria 1458
317 Ga0157380_10003813 3300014326 Bacteria 10374
318 Ga0157377_10007912 3300014745 Bacteria 5159
319 Ga0157377_10122128 3300014745 Bacteria 1580
320 Ga0157377_10146693 3300014745 Bacteria 1455
321 Ga0157379_10004932 3300014968 Bacteria 11450
322 Ga0157379_10069475 3300014968 Bacteria 3150
323 Ga0157376_10022035 3300014969 Bacteria 4957
324 Ga0157376_10023837 3300014969 Bacteria 4798
325 Ga0157376_10083979 3300014969 Bacteria 2741
326 Ga0163161_10061975 3300017792 Bacteria 2724
327 Ga0163161_10171762 3300017792 Bacteria 1658
328 Ga0206352_10246956 3300020078 Bacteria 1383
329 Ga0206353_11818343 3300020082 Bacteria 4369
330 Ga0213875_10000570 3300021388 Bacteria 30105
331 Ga0213875_10000604 3300021388 Bacteria 29093
332 Ga0224712_10040519 3300022467 Bacteria 1753
333 Ga0224712_10065178 3300022467 Bacteria 1463
334 Ga0209051_1000528 3300025303 Bacteria 47444
335 Ga0209051_1001208 3300025303 Bacteria 23322
336 Ga0209051_1006114 3300025303 Bacteria 6849
337 Ga0209051_1008439 3300025303 Bacteria 5451
338 Ga0209051_1028496 3300025303 Bacteria 2205
339 Ga0207656_10030145 3300025321 Bacteria 2239
340 Ga0207653_10000004 3300025885 Bacteria 263142
341 Ga0207653_10002058 3300025885 Bacteria 6408
342 Ga0207692_10001870 3300025898 Bacteria 7987
343 Ga0207642_10002962 3300025899 Bacteria 5313
344 Ga0207642_10012124 3300025899 Bacteria 3101
345 Ga0207642_10030974 3300025899 Bacteria 2236
346 Ga0207710_10001088 3300025900 Bacteria 13985
347 Ga0207710_10081651 3300025900 Bacteria 1501
348 Ga0207688_10000352 3300025901 Bacteria 21384
349 Ga0207688_10001514 3300025901 Bacteria 12214
350 Ga0207688_10014587 3300025901 Bacteria 4269
351 Ga0207647_10063954 3300025904 Bacteria 2237
352 Ga0207647_10079885 3300025904 Bacteria 1962
353 Ga0207685_10001280 3300025905 Bacteria 5144
354 Ga0207685_10003910 3300025905 Bacteria 3698
355 Ga0207699_10000156 3300025906 Bacteria 42514
356 Ga0207699_10002495 3300025906 Bacteria 8691
357 Ga0207699_10028701 3300025906 Bacteria 3095
358 Ga0207643_10000055 3300025908 Bacteria 73929
359 Ga0207643_10002720 3300025908 Bacteria 9565
360 Ga0207684_10000339 3300025910 Bacteria 65102
361 Ga0207684_10000911 3300025910 Bacteria 33666
362 Ga0207684_10057831 3300025910 Bacteria 3290
363 Ga0207654_10092056 3300025911 Bacteria 1851
364 Ga0207671_10008270 3300025914 Bacteria 8850
365 Ga0207671_10011790 3300025914 Bacteria 7076
366 Ga0207693_10000199 3300025915 Bacteria 54571
367 Ga0207693_10001171 3300025915 Bacteria 23404
368 Ga0207693_10001690 3300025915 Bacteria 19437
369 Ga0207693_10002490 3300025915 Bacteria 16019
370 Ga0207693_10005402 3300025915 Bacteria 10677
371 Ga0207693_10045359 3300025915 Bacteria 3454
372 Ga0207693_10061181 3300025915 Bacteria 2949
373 Ga0207693_10089600 3300025915 Bacteria 2411
374 Ga0207693_10093630 3300025915 Bacteria 2355
375 Ga0207663_10001603 3300025916 Bacteria 10631
376 Ga0207663_10005265 3300025916 Bacteria 6513
377 Ga0207663_10006245 3300025916 Bacteria 6079
378 Ga0207663_10014279 3300025916 Bacteria 4343
379 Ga0207663_10017362 3300025916 Bacteria 4008
380 Ga0207663_10021617 3300025916 Bacteria 3665
381 Ga0207662_10004973 3300025918 Bacteria 7033
382 Ga0207657_10030438 3300025919 Bacteria 4899
383 Ga0207657_10072009 3300025919 Bacteria 2925
384 Ga0207649_10020440 3300025920 Bacteria 3798
385 Ga0207649_10082505 3300025920 Bacteria 2084
386 Ga0207646_10000061 3300025922 Bacteria 151425
387 Ga0207646_10005885 3300025922 Bacteria 12805
388 Ga0207646_10007478 3300025922 Bacteria 11089
389 Ga0207646_10009346 3300025922 Bacteria 9691
390 Ga0207646_10042854 3300025922 Bacteria 4066
391 Ga0207650_10001024 3300025925 Bacteria 20982
392 Ga0207650_10020009 3300025925 Bacteria 4713
393 Ga0207659_10138959 3300025926 Bacteria 1884
394 Ga0207687_10001147 3300025927 Bacteria 18035
395 Ga0207687_10029528 3300025927 Bacteria 3689
396 Ga0207687_10165851 3300025927 Bacteria 1699
397 Ga0207700_10000063 3300025928 Bacteria 65696
398 Ga0207700_10016567 3300025928 Bacteria 4900
399 Ga0207700_10026919 3300025928 Bacteria 4018
400 Ga0207700_10029262 3300025928 Bacteria 3884
401 Ga0207700_10029504 3300025928 Bacteria 3871
402 Ga0207700_10055669 3300025928 Bacteria 2974
403 Ga0207700_10109651 3300025928 Bacteria 2219
404 Ga0207664_10000196 3300025929 Bacteria 45388
405 Ga0207664_10001029 3300025929 Bacteria 18674
406 Ga0207664_10002329 3300025929 Bacteria 12548
407 Ga0207664_10021830 3300025929 Bacteria 4770
408 Ga0207664_10024393 3300025929 Bacteria 4544
409 Ga0207664_10032064 3300025929 Bacteria 4025
410 Ga0207664_10044307 3300025929 Bacteria 3483
411 Ga0207664_10047539 3300025929 Bacteria 3371
412 Ga0207664_10056440 3300025929 Bacteria 3119
413 Ga0207664_10243144 3300025929 Bacteria 1568
414 Ga0207664_10272932 3300025929 Bacteria 1482
415 Ga0207664_10331043 3300025929 Bacteria 1345
416 Ga0207644_10005208 3300025931 Bacteria 8493
417 Ga0207644_10031027 3300025931 Bacteria 3721
418 Ga0207644_10103641 3300025931 Bacteria 2141
419 Ga0207690_10028152 3300025932 Bacteria 3559
420 Ga0207690_10054150 3300025932 Bacteria 2696
421 Ga0207706_10001128 3300025933 Bacteria 27189
422 Ga0207706_10009818 3300025933 Bacteria 8781
423 Ga0207706_10019781 3300025933 Bacteria 6054
424 Ga0207706_10022575 3300025933 Bacteria 5647
425 Ga0207686_10002468 3300025934 Bacteria 10044
426 Ga0207686_10005839 3300025934 Bacteria 6603
427 Ga0207686_10006248 3300025934 Bacteria 6406
428 Ga0207686_10037607 3300025934 Bacteria 2922
429 Ga0207709_10007186 3300025935 Bacteria 6215
430 Ga0207709_10017218 3300025935 Bacteria 4030
431 Ga0207709_10023700 3300025935 Bacteria 3496
432 Ga0207709_10034736 3300025935 Bacteria 2975
433 Ga0207709_10196818 3300025935 Unclassified 1436
434 Ga0207670_10127309 3300025936 Bacteria 1860
435 Ga0207669_10032348 3300025937 Bacteria 2936
436 Ga0207669_10057020 3300025937 Bacteria 2376
437 Ga0207669_10058311 3300025937 Bacteria 2355
438 Ga0207704_10000377 3300025938 Bacteria 20506
439 Ga0207704_10012981 3300025938 Bacteria 4153
440 Ga0207704_10044070 3300025938 Bacteria 2640
441 Ga0207704_10132560 3300025938 Bacteria 1729
442 Ga0207665_10000226 3300025939 Bacteria 38498
443 Ga0207665_10001670 3300025939 Bacteria 14929
444 Ga0207665_10005772 3300025939 Bacteria 8231
445 Ga0207665_10013801 3300025939 Bacteria 5314
446 Ga0207665_10056850 3300025939 Bacteria 2642
447 Ga0207665_10058954 3300025939 Bacteria 2597
448 Ga0207665_10059404 3300025939 Bacteria 2588
449 Ga0207665_10067547 3300025939 Bacteria 2435
450 Ga0207665_10073331 3300025939 Bacteria 2341
451 Ga0207691_10033981 3300025940 Bacteria 4746
452 Ga0207691_10040532 3300025940 Bacteria 4302
453 Ga0207711_10108185 3300025941 Bacteria 2469
454 Ga0207711_10165028 3300025941 Bacteria 2007
455 Ga0207689_10002296 3300025942 Bacteria 17905
456 Ga0207689_10009916 3300025942 Bacteria 8213
457 Ga0207689_10025969 3300025942 Bacteria 4905
458 Ga0207661_10082020 3300025944 Bacteria 2665
459 Ga0207661_10097199 3300025944 Bacteria 2465
460 Ga0207661_10104229 3300025944 Bacteria 2388
461 Ga0207679_10002946 3300025945 Bacteria 10545
462 Ga0207679_10169321 3300025945 Bacteria 1797
463 Ga0207667_10107381 3300025949 Bacteria 2880
464 Ga0207651_10050424 3300025960 Bacteria 2826
465 Ga0207712_10006309 3300025961 Bacteria 7477
466 Ga0207712_10043419 3300025961 Bacteria 3101
467 Ga0207668_10056080 3300025972 Bacteria 2742
468 Ga0207640_10003409 3300025981 Bacteria 8561
469 Ga0207658_10012179 3300025986 Bacteria 5867
470 Ga0207677_10011441 3300026023 Bacteria 5061
471 Ga0207703_10014135 3300026035 Bacteria 6223
472 Ga0207703_10018284 3300026035 Bacteria 5473
473 Ga0207703_10053855 3300026035 Bacteria 3271
474 Ga0207678_10001390 3300026067 Bacteria 22261
475 Ga0207678_10016407 3300026067 Bacteria 6503
476 Ga0207678_10032965 3300026067 Bacteria 4513
477 Ga0207678_10045686 3300026067 Bacteria 3787
478 Ga0207708_10003968 3300026075 Bacteria 10890
479 Ga0207708_10005234 3300026075 Bacteria 9557
480 Ga0207708_10005684 3300026075 Bacteria 9215
481 Ga0207708_10006707 3300026075 Bacteria 8516
482 Ga0207702_10138335 3300026078 Bacteria 2200
483 Ga0207641_10003507 3300026088 Bacteria 13886
484 Ga0207641_10071720 3300026088 Bacteria 2980
485 Ga0207648_10001355 3300026089 Bacteria 27091
486 Ga0207648_10004217 3300026089 Bacteria 14857
487 Ga0207648_10026700 3300026089 Bacteria 5129
488 Ga0207648_10103641 3300026089 Bacteria 2495
489 Ga0207676_10001452 3300026095 Bacteria 17629
490 Ga0207676_10016180 3300026095 Bacteria 5399
491 Ga0207676_10022955 3300026095 Bacteria 4594
492 Ga0207674_10000186 3300026116 Bacteria 75904
493 Ga0207674_10010966 3300026116 Bacteria 10198
494 Ga0207674_10150848 3300026116 Bacteria 2282
495 Ga0207675_100013054 3300026118 Bacteria 7753
496 Ga0207675_100015022 3300026118 Bacteria 7224
497 Ga0207675_100017867 3300026118 Bacteria 6615
498 Ga0207675_100040429 3300026118 Bacteria 4355
499 Ga0207675_100078529 3300026118 Bacteria 3092
500 Ga0207675_100163300 3300026118 Bacteria 2126
501 Ga0207683_10000201 3300026121 Bacteria 51559
502 Ga0207683_10008060 3300026121 Bacteria 9009
503 Ga0207683_10027425 3300026121 Bacteria 4922
504 Ga0207698_10205597 3300026142 Bacteria 1767
505 Ga0207428_10001001 3300027907 Bacteria 31346
506 Ga0207428_10011760 3300027907 Bacteria 7719
507 Ga0268266_10007843 3300028379 Bacteria 9563
508 Ga0268266_10065058 3300028379 Bacteria 3152
509 Ga0268266_10188837 3300028379 Bacteria 1880
510 Ga0268266_10205726 3300028379 Bacteria 1803
511 Ga0268266_10246931 3300028379 Bacteria 1649
512 Ga0268265_10121015 3300028380 Bacteria 2156
513 Ga0268264_10114403 3300028381 Bacteria 2368
514 Ga0265337_1000027 3300028556 Bacteria 68392
515 Ga0265326_10001234 3300028558 Bacteria 9119
516 Ga0265319_1001055 3300028563 Bacteria 17217
517 Ga0265334_10000773 3300028573 Bacteria 16014
518 Ga0265322_10001284 3300028654 Bacteria 8433
519 Ga0265336_10002288 3300028666 Bacteria 8003
520 Ga0265338_10000227 3300028800 Bacteria 104795
521 Ga0265338_10001512 3300028800 Bacteria 37550
522 Ga0265338_10007886 3300028800 Bacteria 13062
523 Ga0265338_10011419 3300028800 Bacteria 10257
524 Ga0265324_10004386 3300029957 Bacteria 6400
525 Ga0265332_10001185 3300031238 Bacteria 15099
526 Ga0265325_10005218 3300031241 Bacteria 8066
527 Ga0265339_10021776 3300031249 Bacteria 3723
528 Ga0265327_10008031 3300031251 Bacteria 7964
529 Ga0265316_10007705 3300031344 Bacteria 10091
530 Ga0307408_100231039 3300031548 Bacteria 1515
531 Ga0265313_10010516 3300031595 Bacteria 5839
532 Ga0265314_10010105 3300031711 Bacteria 7910
533 Ga0307405_10018316 3300031731 Bacteria 3860
534 Ga0307406_10058952 3300031901 Bacteria 2469
535 Ga0307409_100226090 3300031995 Bacteria 1693
536 Ga0307416_100017768 3300032002 Bacteria 4988
537 Ga0307415_100027908 3300032126 Bacteria 3583
538 Ga0373926_0001462 3300035083 Bacteria 7192
539 Ga0373926_0021075 3300035083 Bacteria 2254
540 Ga0373926_0032850 3300035083 Bacteria 1832
541 Ga0373934_0015454 3300035086 Bacteria 2895
542 Ga0373940_0001161 3300035088 Bacteria 4616
543 Ga0373944_0000926 3300035089 Bacteria 7259
544 Ga0373923_0009489 3300035111 Bacteria 3512
545 Ga0373923_0010272 3300035111 Bacteria 3401
546 Ga0373923_0020707 3300035111 Bacteria 2558
547 Ga0373936_0000519 3300035113 Bacteria 13160
548 Ga0373936_0004471 3300035113 Bacteria 5286
549 Ga0373936_0006048 3300035113 Bacteria 4562
550 Ga0373936_0008708 3300035113 Bacteria 3820
551 Ga0373936_0014364 3300035113 Bacteria 3025
552 Ga0373939_0005927 3300035114 Bacteria 2926
553 Ga0373941_0005711 3300035115 Bacteria 2950
554 Ga0373945_0001751 3300035116 Bacteria 6703
555 Ga0373945_0014754 3300035116 Bacteria 2622
556 Ga0373953_0003298 3300035117 Bacteria 5010
557 Ga0373954_0014349 3300035118 Bacteria 3533
558 Ga0373954_0035904 3300035118 Bacteria 2299
559 Ga0373956_0025651 3300035119 Bacteria 2549
560 Ga0373957_0015658 3300035120 Bacteria 2613
561 Ga0373957_0051606 3300035120 Bacteria 1573
562 Ga0373943_0000223 3300035170 Bacteria 23116
563 Ga0373946_0000756 3300035171 Bacteria 10990
564 Ga0373946_0000798 3300035171 Bacteria 10747
565 Ga0373955_0021637 3300035172 Bacteria 3250
566 Ga0373955_0101848 3300035172 Bacteria 1650
567 Ga0373962_0007345 3300035242 Bacteria 2697
568 Ga0373924_0008387 3300035410 Bacteria 3752
569 Ga0373924_0012085 3300035410 Bacteria 3220
570 Ga0373924_0051869 3300035410 Bacteria 1702
571 Ga0373931_0013389 3300035691 Bacteria 3994
572 Ga0373931_0022723 3300035691 Bacteria 3159
573 Ga0373935_0004598 3300035692 Bacteria 8110
574 Ga0373935_0010760 3300035692 Bacteria 5494
575 Ga0373935_0042798 3300035692 Bacteria 2848
576 Ga0373927_0003276 3300035695 Bacteria 11646
577 Ga0373927_0051849 3300035695 Bacteria 2653
578 Ga0373947_0000014 3300035725 Bacteria 135749
579 Ga0373937_0065515 3300036401 Bacteria 3344
580 Ga0373925_0000421 3300037068 Bacteria 43136
581 Ga0373925_0009690 3300037068 Bacteria 7009
582 Ga0373925_0010661 3300037068 Bacteria 6665
583 Ga0373925_0012062 3300037068 Bacteria 6257
584 Ga0373925_0045115 3300037068 Bacteria 3274
585 Ga0373925_0081599 3300037068 Bacteria 2459
586 Ga0395899_0005983 3300037312 Bacteria 9447
587 Ga0395899_0140674 3300037312 Unclassified 1717
588 Ga0395900_0033278 3300037418 Bacteria 5306
589 Ga0395900_0125814 3300037418 Bacteria 2629
590 Ga0395898_0003800 3300037466 Bacteria 16715
591 Ga0395898_0019897 3300037466 Bacteria 6826
592 Ga0395898_0019979 3300037466 Bacteria 6812
593 Ga0395905_0008955 3300037471 Bacteria 9823
594 Ga0395905_0047873 3300037471 Bacteria 4006
595 Ga0436364_0485851 3300037853 Bacteria 2704
596 Ga0436364_0824111 3300037853 Bacteria 10643
597 Ga0436364_0841117 3300037853 Bacteria 5270
598 Ga0436364_1107254 3300037853 Bacteria 1626
599 Ga0436364_1421530 3300037853 Bacteria 3172
600 Ga0436364_1435297 3300037853 Bacteria 74939
601 Ga0436364_1450559 3300037853 Bacteria 2346
602 Ga0436364_1520571 3300037853 Bacteria 46168
603 Ga0395901_0032219 3300038443 Bacteria 5408
604 Ga0439461_0000217 3300041410 Bacteria 8182
605 Ga0439466_0021262 3300041411 Bacteria 2303
606 Ga0439465_0000349 3300041413 Bacteria 13257
607 Ga0439431_0000859 3300041997 Bacteria 6579
608 Ga0439440_0014134 3300042993 Bacteria 1720
609 Ga0466969_0078576 3300044656 Bacteria 1578
610 Ga0466972_0012299 3300044658 Bacteria 4302
611 Ga0466965_0002177 3300044683 Bacteria 8246
612 Ga0466965_0022873 3300044683 Bacteria 3015
613 Ga0466966_0009549 3300044684 Bacteria 6420
614 Ga0466961_0002650 3300044693 Bacteria 11103
615 Ga0466963_0005765 3300044694 Bacteria 7282
616 Ga0466963_0040770 3300044694 Bacteria 3044
617 Ga0466964_0005286 3300044706 Bacteria 4789
618 Ga0466964_0017103 3300044706 Bacteria 2774
619 Ga0466968_0001088 3300044735 Bacteria 9619
620 Ga0466970_0016640 3300044765 Bacteria 3794
621 Ga0466957_0008856 3300044842 Bacteria 5731
622 Ga0466957_0043503 3300044842 Bacteria 2720
623 Ga0466960_0079258 3300044901 Bacteria 1651
624 Ga0466959_0001490 3300045049 Bacteria 14375
625 Ga0466959_0027893 3300045049 Bacteria 4188
626 Ga0466959_0075817 3300045049 Bacteria 2429
627 Ga0466958_0063732 3300045836 Bacteria 2248
628 Ga0466967_0010721 3300045976 Bacteria 6891
629 Ga0466967_0012654 3300045976 Bacteria 6471
630 Ga0466967_0036069 3300045976 Bacteria 4218
631 Ga0466967_0056273 3300045976 Bacteria 3467
632 Ga0466967_0056739 3300045976 Bacteria 3455
633 Ga0466967_0111964 3300045976 Bacteria 2509
634 Ga0466967_0113400 3300045976 Bacteria 2494
635 Ga0466967_0132388 3300045976 Bacteria 2316
636 Ga0466967_0158221 3300045976 Bacteria 2124
637 Ga0495592_0000455 3300046454 Bacteria 30633
638 Ga0495592_0015925 3300046454 Bacteria 5704
639 Ga0495592_0025553 3300046454 Bacteria 4482
640 Ga0495592_0068405 3300046454 Bacteria 2592
641 Ga0495603_0001901 3300046455 Bacteria 12324
642 Ga0495603_0006218 3300046455 Bacteria 7140
643 Ga0495603_0024918 3300046455 Bacteria 3618
644 Ga0495603_0040047 3300046455 Bacteria 2806
645 Ga0495603_0122091 3300046455 Bacteria 1518
646 Ga0495629_0003190 3300046459 Bacteria 12420
647 Ga0495629_0012234 3300046459 Bacteria 6215
648 Ga0495629_0190503 3300046459 Bacteria 1419
649 Ga0495638_0002264 3300046460 Bacteria 15935
650 Ga0495641_0007936 3300046461 Bacteria 6551
651 Ga0495641_0012394 3300046461 Bacteria 4773
652 Ga0495641_0044956 3300046461 Bacteria 2034
653 Ga0495651_0000174 3300046462 Bacteria 47579
654 Ga0495651_0007208 3300046462 Bacteria 8501
655 Ga0495651_0059179 3300046462 Bacteria 2938
656 Ga0495653_0000414 3300046463 Bacteria 34250
657 Ga0495580_0206685 3300046472 Unclassified 1352
658 Ga0495582_0013066 3300046473 Bacteria 4571
659 Ga0495582_0027448 3300046473 Bacteria 3121
660 Ga0495582_0033593 3300046473 Bacteria 2820
661 Ga0495582_0036446 3300046473 Bacteria 2706
662 Ga0495582_0155062 3300046473 Unclassified 1301
663 Ga0495605_0139752 3300046474 Unclassified 1087
664 Ga0495639_0019856 3300046475 Bacteria 2933
665 Ga0495662_0005395 3300046476 Bacteria 6399
666 Ga0495662_0013986 3300046476 Bacteria 3907
667 Ga0495662_0027687 3300046476 Bacteria 2738
668 Ga0495664_0000074 3300046477 Bacteria 48269
669 Ga0495664_0003697 3300046477 Bacteria 8341
670 Ga0495664_0039541 3300046477 Bacteria 2787
671 Ga0495664_0099478 3300046477 Bacteria 1751
672 Ga0495664_0113788 3300046477 Bacteria 1634
673 Ga0495664_0136094 3300046477 Unclassified 1488
674 Ga0495584_0037466 3300046491 Bacteria 2451
675 Ga0495584_0069862 3300046491 Unclassified 1765
676 Ga0495584_0089727 3300046491 Bacteria 1550
677 Ga0495594_0100555 3300046499 Bacteria 1626
678 Ga0495596_0029721 3300046500 Bacteria 2190
679 Ga0495606_0051487 3300046507 Bacteria 2685
680 Ga0495608_0000410 3300046511 Bacteria 29942
681 Ga0495608_0010194 3300046511 Bacteria 6558
682 Ga0495608_0018431 3300046511 Bacteria 4815
683 Ga0495618_0039001 3300046514 Bacteria 2986
684 Ga0495618_0071028 3300046514 Bacteria 2214
685 Ga0495618_0089619 3300046514 Bacteria 1967
686 Ga0495628_0000444 3300046516 Bacteria 37801
687 Ga0495628_0024834 3300046516 Bacteria 4902
688 Ga0495628_0101290 3300046516 Bacteria 2222
689 Ga0495628_0102534 3300046516 Bacteria 2207
690 Ga0495630_0009396 3300046517 Bacteria 7025
691 Ga0495630_0011332 3300046517 Bacteria 6451
692 Ga0495630_0016278 3300046517 Bacteria 5433
693 Ga0495630_0032481 3300046517 Bacteria 3889
694 Ga0495631_0051413 3300046518 Bacteria 1801
695 Ga0495644_0027858 3300046523 Bacteria 2139
696 Ga0495644_0028662 3300046523 Bacteria 2106
697 Ga0495648_0005458 3300046524 Bacteria 10554
698 Ga0495663_0006952 3300046525 Bacteria 3122
699 Ga0495666_0000996 3300046526 Bacteria 13421
700 Ga0495666_0068629 3300046526 Bacteria 1688
701 Ga0495652_0000665 3300046529 Bacteria 39849
702 Ga0495652_0043197 3300046529 Bacteria 3884
703 Ga0495654_0081550 3300046530 Bacteria 1516
704 Ga0495665_0009444 3300046531 Bacteria 5280
705 Ga0495665_0013989 3300046531 Bacteria 4333
706 Ga0495665_0061076 3300046531 Bacteria 1990
707 Ga0495640_0006097 3300046533 Bacteria 9555
708 Ga0495640_0018263 3300046533 Bacteria 5207
709 Ga0495586_0005340 3300046535 Bacteria 6874
710 Ga0495586_0107155 3300046535 Bacteria 1554
711 Ga0495587_0002878 3300046536 Bacteria 11528
712 Ga0495587_0019393 3300046536 Bacteria 4209
713 Ga0495587_0055100 3300046536 Bacteria 2342
714 Ga0495587_0091279 3300046536 Bacteria 1759
715 Ga0495609_0051361 3300046538 Bacteria 1836
716 Ga0495621_0023587 3300046539 Bacteria 2048
717 Ga0495645_0001127 3300046543 Bacteria 18070
718 Ga0495645_0158078 3300046543 Bacteria 1569
719 Ga0495667_0000117 3300046559 Bacteria 57725
720 Ga0495667_0000908 3300046559 Bacteria 19115
721 Ga0495667_0029518 3300046559 Bacteria 3691
722 Ga0495667_0047522 3300046559 Bacteria 2835
723 Ga0495667_0057206 3300046559 Bacteria 2564
724 Ga0495667_0068884 3300046559 Bacteria 2309
725 Ga0495667_0087160 3300046559 Bacteria 2024
726 Ga0495656_0000291 3300046615 Bacteria 17446
727 Ga0495656_0022991 3300046615 Bacteria 2448
728 Ga0495634_0001586 3300046642 Bacteria 19947
729 Ga0495634_0002700 3300046642 Bacteria 14596
730 Ga0495634_0056454 3300046642 Bacteria 2623
731 Ga0495635_0000773 3300046663 Bacteria 20815
732 Ga0495635_0011752 3300046663 Bacteria 6139
733 Ga0495635_0063839 3300046663 Bacteria 2528
734 Ga0495635_0173446 3300046663 Bacteria 1466
735 Ga0495659_0000889 3300046664 Bacteria 10637
736 Ga0495588_0001357 3300046674 Bacteria 10445
737 Ga0495657_0006991 3300046675 Bacteria 8754
738 Ga0495657_0007099 3300046675 Bacteria 8687
739 Ga0495657_0051040 3300046675 Bacteria 2778
740 Ga0495599_0000185 3300046678 Bacteria 40953
741 Ga0495599_0053041 3300046678 Bacteria 2540
742 Ga0495623_0055054 3300046679 Bacteria 2508
743 Ga0495646_0000628 3300046680 Bacteria 19227
744 Ga0495646_0018567 3300046680 Bacteria 4403
745 Ga0495646_0041034 3300046680 Bacteria 2845
746 Ga0495647_0001537 3300046681 Bacteria 7126
747 Ga0495647_0042764 3300046681 Bacteria 1731
748 Ga0495647_0058534 3300046681 Bacteria 1515
749 Ga0495658_0001438 3300046683 Bacteria 12529
750 Ga0495658_0011377 3300046683 Bacteria 4475
751 Ga0495613_0053181 3300046689 Bacteria 2980
752 Ga0495613_0108031 3300046689 Bacteria 2007
753 Ga0495624_0006757 3300046690 Bacteria 8106
754 Ga0495624_0028048 3300046690 Bacteria 3681
755 Ga0495624_0033267 3300046690 Bacteria 3339
756 Ga0495624_0086899 3300046690 Bacteria 1931
757 Ga0495671_0034988 3300046692 Bacteria 2553
758 Ga0495589_0007696 3300046794 Bacteria 5639
759 Ga0495600_0014669 3300046809 Bacteria 4940
760 Ga0495581_0004943 3300047315 Bacteria 7715
761 Ga0495581_0008059 3300047315 Bacteria 6097
762 Ga0495581_0009928 3300047315 Bacteria 5508
763 Ga0495581_0036608 3300047315 Bacteria 2839
764 Ga0495604_0016061 3300047317 Bacteria 5979
765 Ga0495604_0025456 3300047317 Bacteria 4715
766 Ga0495636_0005073 3300047318 Bacteria 5170
767 Ga0495674_0000984 3300047319 Bacteria 27406
768 Ga0495674_0002797 3300047319 Bacteria 16935
769 Ga0495674_0041283 3300047319 Bacteria 4122
770 Ga0495674_0050652 3300047319 Bacteria 3664
771 Ga0495674_0054886 3300047319 Bacteria 3497
772 Ga0495674_0107812 3300047319 Bacteria 2364
773 Ga0495672_0030900 3300047320 Bacteria 3350
774 Ga0495676_0020287 3300047321 Bacteria 5835
775 Ga0495676_0040298 3300047321 Bacteria 3856
776 Ga0495680_0000401 3300047322 Bacteria 48480
777 Ga0495680_0001586 3300047322 Bacteria 24314
778 Ga0495680_0029597 3300047322 Bacteria 4483
779 Ga0495680_0071146 3300047322 Bacteria 2649
780 Ga0495680_0167712 3300047322 Bacteria 1591
781 Ga0495675_0005713 3300047444 Bacteria 7607
782 Ga0495675_0009139 3300047444 Bacteria 6161
783 Ga0495673_0001205 3300047469 Bacteria 21534
784 Ga0495684_0000598 3300047471 Bacteria 29035
785 Ga0495684_0005984 3300047471 Bacteria 9451
786 Ga0495686_0003330 3300047472 Bacteria 14025
787 Ga0495686_0058912 3300047472 Bacteria 2393
788 Ga0495593_0015763 3300047673 Bacteria 4272
789 Ga0495593_0050767 3300047673 Bacteria 2196
790 Ga0495602_0002949 3300048088 Bacteria 17454
791 Ga0495602_0130474 3300048088 Bacteria 2005
792 Ga0495614_0001554 3300048089 Bacteria 9962
793 Ga0496100_0004799 3300048903 Bacteria 7220
794 Ga0496100_0006150 3300048903 Bacteria 6531
795 Ga0496100_0009450 3300048903 Bacteria 5482
796 Ga0496100_0042136 3300048903 Bacteria 2914
797 Ga0496100_0083030 3300048903 Bacteria 2168
798 Ga0496101_0000021 3300048904 Bacteria 217090
799 Ga0496101_0001613 3300048904 Bacteria 13562
800 Ga0496101_0056770 3300048904 Bacteria 2830
801 Ga0496102_0000001 3300048905 Bacteria 873433
802 Ga0496102_0000590 3300048905 Bacteria 38332
803 Ga0496102_0001309 3300048905 Bacteria 22360
804 Ga0496102_0010316 3300048905 Bacteria 8034
805 Ga0496102_0029162 3300048905 Bacteria 4935
806 Ga0496102_0073674 3300048905 Bacteria 3138
807 Ga0496103_0000007 3300048906 Bacteria 354915
808 Ga0496103_0015572 3300048906 Bacteria 4529
809 Ga0496103_0019054 3300048906 Bacteria 4120
810 Ga0496103_0041252 3300048906 Bacteria 2837
811 Ga0496103_0074244 3300048906 Bacteria 2131
812 Ga0496103_0156782 3300048906 Bacteria 1459
813 Ga0496104_0010504 3300048907 Bacteria 8271
814 Ga0496104_0011782 3300048907 Bacteria 7846
815 Ga0496104_0020133 3300048907 Bacteria 6112
816 Ga0496104_0091076 3300048907 Bacteria 2914
817 Ga0496104_0187398 3300048907 Bacteria 1980
818 Ga0496104_0323470 3300048907 Bacteria 1455
819 Ga0496105_0015872 3300048908 Bacteria 6008
820 Ga0496105_0031392 3300048908 Bacteria 4355
821 Ga0496105_0057685 3300048908 Bacteria 3205
822 Ga0496105_0182583 3300048908 Bacteria 1718
823 Ga0496106_0002503 3300048909 Bacteria 13678
824 Ga0496106_0003195 3300048909 Bacteria 12259
825 Ga0496106_0003386 3300048909 Bacteria 11881
826 Ga0496106_0028783 3300048909 Bacteria 4139
827 Ga0496106_0065366 3300048909 Bacteria 2769
828 Ga0496106_0107582 3300048909 Bacteria 2169
829 Ga0496107_0000321 3300048910 Bacteria 25887
830 Ga0496107_0003559 3300048910 Bacteria 10431
831 Ga0496107_0011486 3300048910 Bacteria 6170
832 Ga0496107_0016357 3300048910 Bacteria 5206
833 Ga0496107_0040227 3300048910 Bacteria 3355
834 Ga0496107_0041137 3300048910 Bacteria 3318
835 Ga0496107_0074185 3300048910 Bacteria 2475
836 Ga0496108_0000645 3300048911 Bacteria 27126
837 Ga0496108_0020996 3300048911 Bacteria 5368
838 Ga0496108_0021599 3300048911 Bacteria 5289
839 Ga0496108_0028914 3300048911 Bacteria 4587
840 Ga0496108_0093677 3300048911 Bacteria 2555
841 Ga0496108_0127244 3300048911 Bacteria 2188
842 Ga0496108_0132006 3300048911 Bacteria 2147
843 Ga0496108_0143694 3300048911 Bacteria 2056
844 Ga0496109_0016603 3300048912 Bacteria 6438
845 Ga0496109_0024888 3300048912 Bacteria 5329
846 Ga0496109_0053112 3300048912 Bacteria 3694
847 Ga0496109_0280463 3300048912 Bacteria 1570
848 Ga0496110_0002173 3300048913 Bacteria 14645
849 Ga0496110_0034997 3300048913 Bacteria 4354
850 Ga0496110_0039235 3300048913 Bacteria 4123
851 Ga0496110_0209617 3300048913 Bacteria 1771
852 Ga0496110_0231112 3300048913 Bacteria 1682
853 Ga0496111_0025718 3300048914 Bacteria 4154
854 Ga0496111_0031195 3300048914 Bacteria 3795
855 Ga0496111_0043019 3300048914 Bacteria 3245
856 Ga0496111_0072558 3300048914 Bacteria 2505
857 Ga0496111_0078746 3300048914 Bacteria 2403
858 Ga0496111_0117387 3300048914 Bacteria 1963
859 Ga0496112_0005708 3300048915 Bacteria 10813
860 Ga0496112_0117982 3300048915 Bacteria 2624
861 Ga0496113_0013407 3300048916 Bacteria 5553
862 Ga0496113_0032813 3300048916 Bacteria 3775
863 Ga0496113_0121038 3300048916 Bacteria 2046
864 Ga0496114_0000495 3300048917 Bacteria 28787
865 Ga0496114_0002288 3300048917 Bacteria 14597
866 Ga0496114_0032144 3300048917 Bacteria 4318
867 Ga0496114_0041127 3300048917 Bacteria 3830
868 Ga0496115_0001075 3300048918 Bacteria 19794
869 Ga0496115_0003085 3300048918 Bacteria 11965
870 Ga0496115_0014339 3300048918 Bacteria 6000
871 Ga0496115_0101112 3300048918 Bacteria 2363
872 Ga0496116_0000018 3300048919 Bacteria 545877
873 Ga0496116_0000166 3300048919 Bacteria 133474
874 Ga0496117_0000015 3300048920 Bacteria 583316
875 Ga0496118_0000012 3300048921 Bacteria 583316
876 Ga0496118_0051275 3300048921 Bacteria 3158
877 Ga0496119_0000454 3300048922 Bacteria 56086
878 Ga0496119_0060786 3300048922 Bacteria 2260
879 Ga0496119_0072685 3300048922 Bacteria 2008
880 Ga0496120_0001962 3300048923 Bacteria 22491
881 Ga0496120_0006298 3300048923 Bacteria 9148
882 Ga0496121_0000177 3300048924 Bacteria 141456
883 Ga0496125_0016319 3300048928 Bacteria 7136
884 Ga0496126_0001113 3300048929 Bacteria 45012
885 Ga0501034_0127982 3300049571 Bacteria 2524
886 Ga0501038_0121932 3300049574 Bacteria 2149
887 Ga0501067_0004530 3300049583 Bacteria 7678
888 Ga0501068_0110415 3300049584 Bacteria 1709
889 Ga0501070_0040248 3300049586 Bacteria 3897
890 Ga0501073_0100478 3300049589 Bacteria 2008
891 Ga0501074_0062711 3300049590 Bacteria 2677
892 Ga0501074_0133790 3300049590 Bacteria 1773
893 Ga0501077_0028597 3300049593 Bacteria 3543
894 Ga0501080_0516152 3300049742 Bacteria 1066
895 Ga0501083_0016126 3300049744 Bacteria 5233
896 Ga0501083_0038734 3300049744 Bacteria 3239
897 Ga0501044_0196617 3300049823 Bacteria 1976
898 nmdc:mga03683_3552_c1 3300050489 Bacteria 5050
899 nmdc:mga03n38_17725_c1 3300050490 Bacteria 2795
900 nmdc:mga03n38_7306_c1 3300050490 Bacteria 3903
901 nmdc:mga03n38_9110_c1 3300050490 Bacteria 3593
902 nmdc:mga00v17_1369_c1 3300050491 Bacteria 12779
903 nmdc:mga00v17_17742_c2 3300050491 Bacteria 3508
904 nmdc:mga00v17_5888_c1 3300050491 Bacteria 6476
905 nmdc:mga0yw44_15068_c1 3300050492 Bacteria 4128
906 nmdc:mga0yw44_64861_c1 3300050492 Bacteria 2249
907 nmdc:mga07m45_24287_c1 3300050496 Bacteria 3319
908 nmdc:mga07m45_69649_c1 3300050496 Bacteria 2000
909 nmdc:mga05p37_11253_c1 3300050507 Bacteria 10641
910 nmdc:mga05p37_47560_c1 3300050507 Bacteria 5275
911 nmdc:mga05p37_87829_c1 3300050507 Bacteria 3833
912 nmdc:mga09592_86124_c1 3300050508 Bacteria 2681
913 nmdc:mga08y16_140196_c1 3300050511 Bacteria 2514
914 nmdc:mga0n895_16162_c1 3300050512 Bacteria 6841
915 nmdc:mga0n895_17799_c1 3300050512 Bacteria 6560
916 nmdc:mga0n895_213832_c1 3300050512 Bacteria 1958
917 nmdc:mga0n895_39305_c1 3300050512 Bacteria 4590
918 nmdc:mga0rr50_3260_c1 3300050513 Bacteria 9300
919 nmdc:mga0a205_2637_c1 3300050515 Bacteria 15841
920 nmdc:mga0sz30_3201_c1 3300050516 Bacteria 5873
921 nmdc:mga0sz30_42494_c1 3300050516 Bacteria 1912
922 nmdc:mga0sz30_88335_c1 3300050516 Bacteria 1347
923 Ga0495601_0015602 3300053077 Bacteria 4592
924 Ga0495601_0085524 3300053077 Unclassified 2026
925 Ga0495612_0008199 3300053078 Bacteria 4245
926 Ga0500635_0004952 3300053080 Bacteria 3464
927 Ga0495655_0001501 3300053083 Bacteria 3589
928 Ga0495595_0002988 3300053084 Bacteria 6681
929 Ga0495595_0024353 3300053084 Bacteria 2674
930 Ga0495619_0001449 3300053085 Bacteria 15619
931 Ga0495619_0037454 3300053085 Bacteria 3161
932 Ga0495619_0046837 3300053085 Bacteria 2845
933 Ga0495619_0063206 3300053085 Bacteria 2466
934 Ga0500643_001154 3300053087 Bacteria 15747
935 Ga0500643_001862 3300053087 Bacteria 11500
936 Ga0500643_006474 3300053087 Bacteria 4886
937 Ga0500643_007970 3300053087 Bacteria 4207
938 Ga0500556_0001572 3300053104 Bacteria 9240
939 Ga0500562_005490 3300053108 Bacteria 3182
940 Ga0500652_007547 3300053131 Bacteria 3567
941 Ga0500645_000035 3300053730 Bacteria 113679
942 Ga0501082_0022336 3300060353 Bacteria 5450
943 2644488274 2643221687 Bacteria 6500351
944 2738704647 2738541274 Bacteria 6909446
945 2902795187 2902792274 Bacteria 7270173
946 2902811298 2902810491 Bacteria 6794147
947 2902841362 2902837492 Bacteria 6697721
948 2929216249 2929212328 Bacteria 7708288
949 2939583058 2939582691 Bacteria 7088898
950 8055072402 8055066027 Bacteria 9479577
951 Ga0068869_100011909
952 JGI24752J21851_1002611
953 JGI24746J21847_1000089
954 JGI24743J22301_10000709
955 JGI24033J26618_1000486
956 JGI24751J29686_10000684
957 JGI24751J29686_10009198
958 JGI24751J29686_10016832
959 JGI25404J52841_10001437
960 Ga0055540_1001155
961 Ga0055540_1002276
962 Ga0058861_11975033
963 Ga0058862_10034740
964 Ga0070658_10093466
965 Ga0070683_100199128
966 Ga0070670_100088619
967 Ga0068869_100068037
968 Ga0070680_100072410
969 Ga0070682_100022719
970 Ga0070682_100049408
971 Ga0068868_100000529
972 Ga0068868_100014372
973 Ga0070660_100188515
974 Ga0070660_100222383
975 Ga0070691_10011823
976 Ga0070661_100005479
977 Ga0070661_100009141
978 Ga0070668_100005441
979 Ga0070668_100055714
980 Ga0070675_100063813
981 Ga0070675_100313505
982 Ga0070671_100010460
983 Ga0070671_100013019
984 Ga0070671_100047247
985 Ga0070674_100002482
986 Ga0070674_100003430
987 Ga0070674_100021807
988 Ga0070673_100010279
989 Ga0070688_100005859
990 Ga0070667_100002267
991 Ga0070667_100105326
992 Ga0070667_100212282
993 Ga0070703_10000001
994 Ga0070703_10010304
995 Ga0070709_10000243
996 Ga0070709_10000794
997 Ga0070709_10012534
998 Ga0070709_10022973
999 Ga0070709_10079546
1000 Ga0070709_10173787
1001 Ga0070714_100000640
1002 Ga0070714_100004478
1003 Ga0070714_100040816
1004 Ga0070714_100042573
1005 Ga0070714_100060030
1006 Ga0070714_100180351
1007 Ga0070714_100180693
1008 Ga0070713_100000428
1009 Ga0070713_100004385
1010 Ga0070713_100021199
1011 Ga0070713_100023985
1012 Ga0070713_100025930
1013 Ga0070713_100113829
1014 Ga0070710_10000101
1015 Ga0070710_10000900
1016 Ga0070710_10001923
1017 Ga0070710_10003412
1018 Ga0070710_10073616
1019 Ga0070701_10003486
1020 Ga0070701_10023934
1021 Ga0070711_100000437
1022 Ga0070711_100001095
1023 Ga0070711_100001607
1024 Ga0070711_100004296
1025 Ga0070711_100004473
1026 Ga0070711_100105261
1027 Ga0070711_100147979
1028 Ga0070705_100018343
1029 Ga0070705_100027798
1030 Ga0070705_100038364
1031 Ga0070700_100008542
1032 Ga0070700_100009104
1033 Ga0070700_100018846
1034 Ga0070700_100049200
1035 Ga0070694_100015852
1036 Ga0070694_100033732
1037 Ga0070694_100041620
1038 Ga0070708_100001067
1039 Ga0070708_100287649
1040 Ga0070663_100004269
1041 Ga0070663_100018208
1042 Ga0070663_100140945
1043 Ga0070678_100009361
1044 Ga0070678_100067738
1045 Ga0070662_100009027
1046 Ga0070662_100017040
1047 Ga0070662_100044175
1048 Ga0070681_10126386
1049 Ga0068867_100001323
1050 Ga0068867_100002000
1051 Ga0068867_100149122
1052 Ga0070685_10050343
1053 Ga0070706_100003990
1054 Ga0070706_100010233
1055 Ga0070706_100030567
1056 Ga0070706_100298265
1057 Ga0070707_100000041
1058 Ga0070707_100008503
1059 Ga0070707_100011276
1060 Ga0070707_100031450
1061 Ga0070707_100140216
1062 Ga0070698_100000082
1063 Ga0070698_100030094
1064 Ga0070698_100051050
1065 Ga0070698_100075801
1066 Ga0070698_100173688
1067 Ga0070684_100003351
1068 Ga0070684_100031025
1069 Ga0070684_100082513
1070 Ga0070697_100036724
1071 Ga0070697_100049392
1072 Ga0068853_100008397
1073 Ga0068853_100016775
1074 Ga0068853_100049796
1075 Ga0068853_100069006
1076 Ga0070672_100162157
1077 Ga0070695_100010024
1078 Ga0070695_100139249
1079 Ga0070695_100182054
1080 Ga0070696_100003305
1081 Ga0070696_100005272
1082 Ga0070696_100058492
1083 Ga0070696_100063569
1084 Ga0070693_100001858
1085 Ga0070665_100001745
1086 Ga0070665_100009958
1087 Ga0070665_100022355
1088 Ga0070665_100045725
1089 Ga0070665_100096225
1090 Ga0070704_100000706
1091 Ga0070704_100004595
1092 Ga0070704_100007803
1093 Ga0068855_100055086
1094 Ga0068855_100076751
1095 Ga0070664_100002582
1096 Ga0068857_100017591
1097 Ga0068854_100005243
1098 Ga0070702_100001404
1099 Ga0070702_100017389
1100 Ga0070702_100148897
1101 Ga0068852_100156097
1102 Ga0068859_100003134
1103 Ga0068864_100020685
1104 Ga0068864_100098059
1105 Ga0068864_100114068
1106 Ga0068866_10000376
1107 Ga0068866_10013060
1108 Ga0068866_10057117
1109 Ga0068861_100025534
1110 Ga0068861_100030613
1111 Ga0068861_100052331
1112 Ga0068870_10029598
1113 Ga0068863_100001514
1114 Ga0068863_100006801
1115 Ga0068858_100002465
1116 Ga0068858_100071177
1117 Ga0068858_100080445
1118 Ga0068858_100113426
1119 Ga0068860_100025928
1120 Ga0068860_100115207
1121 Ga0068860_100249342
1122 Ga0068862_100043121
1123 Ga0081455_10001614
1124 Ga0081455_10003773
1125 Ga0081455_10043919
1126 Ga0081455_10071142
1127 Ga0081538_10000404
1128 Ga0081540_1000505
1129 Ga0081539_10021040
1130 Ga0070717_10000956
1131 Ga0070717_10007851
1132 Ga0070717_10034864
1133 Ga0070717_10047787
1134 Ga0070717_10064802
1135 Ga0075365_10015384
1136 Ga0075365_10090040
1137 Ga0075365_10140439
1138 Ga0075363_100000787
1139 Ga0075363_100060987
1140 Ga0075363_100077904
1141 Ga0075363_100087743
1142 Ga0075363_100115160
1143 Ga0075364_10000184
1144 Ga0075364_10006965
1145 Ga0075364_10076198
1146 Ga0075432_10000387
1147 Ga0075432_10004840
1148 Ga0070715_10004042
1149 Ga0070715_10013894
1150 Ga0070715_10023722
1151 Ga0070716_100000560
1152 Ga0070716_100002661
1153 Ga0070716_100004017
1154 Ga0070716_100005420
1155 Ga0070716_100006565
1156 Ga0070712_100001062
1157 Ga0070712_100002191
1158 Ga0070712_100012459
1159 Ga0070712_100017727
1160 Ga0070712_100102759
1161 Ga0070712_100126999
1162 Ga0075367_10001919
1163 Ga0075367_10088124
1164 Ga0075369_10001370
1165 Ga0075369_10037641
1166 Ga0097621_100015140
1167 Ga0097621_100073596
1168 Ga0075370_10008783
1169 Ga0075370_10033932
1170 Ga0075370_10044383
1171 Ga0068871_100018339
1172 Ga0068871_100189674
1173 Ga0075428_100065799
1174 Ga0075428_100089059
1175 Ga0075430_100051156
1176 Ga0075431_100036726
1177 Ga0075433_10005527
1178 Ga0075433_10012875
1179 Ga0075433_10163690
1180 Ga0075434_100003943
1181 Ga0075434_100005157
1182 Ga0075434_100008894
1183 Ga0075434_100014932
1184 Ga0068865_100000828
1185 Ga0068865_100022777
1186 Ga0068865_100028975
1187 Ga0068865_100029811
1188 Ga0097620_100003133
1189 Ga0075435_100007491
1190 Ga0075435_100107436
1191 Ga0105251_10017533
1192 Ga0111539_10184592
1193 Ga0105245_10003220
1194 Ga0105245_10018583
1195 Ga0105245_10107688
1196 Ga0105245_10116217
1197 Ga0105245_10133233
1198 Ga0105245_10162114
1199 Ga0105245_10171307
1200 Ga0105247_10000334
1201 Ga0105247_10029448
1202 Ga0105247_10069989
1203 Ga0114129_10004398
1204 Ga0114129_10018631
1205 Ga0114129_10019233
1206 Ga0114129_10026156
1207 Ga0114129_10039891
1208 Ga0114129_10223859
1209 Ga0105243_10005418
1210 Ga0105243_10006751
1211 Ga0105243_10007191
1212 Ga0105243_10116559
1213 Ga0105241_10019951
1214 Ga0105242_10000620
1215 Ga0105242_10002226
1216 Ga0105242_10002528
1217 Ga0105242_10042211
1218 Ga0105242_10052953
1219 Ga0105248_10004419
1220 Ga0105248_10025304
1221 Ga0105248_10044839
1222 Ga0105237_10000178
1223 Ga0105237_10002564
1224 Ga0105237_10034235
1225 Ga0105237_10051382
1226 Ga0105238_10093468
1227 Ga0105238_10195444
1228 Ga0105249_10000767
1229 Ga0105249_10012184
1230 Ga0105249_10053836
1231 Ga0105249_10108817
1232 Ga0105249_10172159
1233 Ga0105239_10002879
1234 Ga0105239_10007516
1235 Ga0105239_10030663
1236 Ga0105239_10059987
1237 Ga0105239_10228472
1238 Ga0105239_10269472
1239 Ga0105246_10066414
1240 Ga0105246_10140320
1241 Ga0157373_10015473
1242 Ga0157371_10099871
1243 Ga0157370_10030713
1244 Ga0157369_10003613
1245 Ga0157374_10035561
1246 Ga0157374_10067899
1247 Ga0157374_10232882
1248 Ga0157378_10001690
1249 Ga0157378_10018845
1250 Ga0157378_10019027
1251 Ga0157378_10089398
1252 Ga0163162_10026392
1253 Ga0163162_10027146
1254 Ga0163162_10174064
1255 Ga0163162_10205789
1256 Ga0157372_10171892
1257 Ga0157372_10341252
1258 Ga0157375_10003452
1259 Ga0157375_10042351
1260 Ga0157375_10122797
1261 Ga0163163_10002897
1262 Ga0163163_10008170
1263 Ga0163163_10021984
1264 Ga0163163_10032021
1265 Ga0163163_10067769
1266 Ga0163163_10385973
1267 Ga0157380_10003813
1268 Ga0157377_10007912
1269 Ga0157377_10122128
1270 Ga0157377_10146693
1271 Ga0157379_10004932
1272 Ga0157379_10069475
1273 Ga0157376_10022035
1274 Ga0157376_10023837
1275 Ga0157376_10083979
1276 Ga0163161_10061975
1277 Ga0163161_10171762
1278 Ga0206352_10246956
1279 Ga0206353_11818343
1280 Ga0213875_10000570
1281 Ga0213875_10000604
1282 Ga0224712_10040519
1283 Ga0224712_10065178
1284 Ga0209051_1000528
1285 Ga0209051_1001208
1286 Ga0209051_1006114
1287 Ga0209051_1008439
1288 Ga0209051_1028496
1289 Ga0207656_10030145
1290 Ga0207653_10000004
1291 Ga0207653_10002058
1292 Ga0207692_10001870
1293 Ga0207642_10002962
1294 Ga0207642_10012124
1295 Ga0207642_10030974
1296 Ga0207710_10001088
1297 Ga0207710_10081651
1298 Ga0207688_10000352
1299 Ga0207688_10001514
1300 Ga0207688_10014587
1301 Ga0207647_10063954
1302 Ga0207647_10079885
1303 Ga0207685_10001280
1304 Ga0207685_10003910
1305 Ga0207699_10000156
1306 Ga0207699_10002495
1307 Ga0207699_10028701
1308 Ga0207643_10000055
1309 Ga0207643_10002720
1310 Ga0207684_10000339
1311 Ga0207684_10000911
1312 Ga0207684_10057831
1313 Ga0207654_10092056
1314 Ga0207671_10008270
1315 Ga0207671_10011790
1316 Ga0207693_10000199
1317 Ga0207693_10001171
1318 Ga0207693_10001690
1319 Ga0207693_10002490
1320 Ga0207693_10005402
1321 Ga0207693_10045359
1322 Ga0207693_10061181
1323 Ga0207693_10089600
1324 Ga0207693_10093630
1325 Ga0207663_10001603
1326 Ga0207663_10005265
1327 Ga0207663_10006245
1328 Ga0207663_10014279
1329 Ga0207663_10017362
1330 Ga0207663_10021617
1331 Ga0207662_10004973
1332 Ga0207657_10030438
1333 Ga0207657_10072009
1334 Ga0207649_10020440
1335 Ga0207649_10082505
1336 Ga0207646_10000061
1337 Ga0207646_10005885
1338 Ga0207646_10007478
1339 Ga0207646_10009346
1340 Ga0207646_10042854
1341 Ga0207650_10001024
1342 Ga0207650_10020009
1343 Ga0207659_10138959
1344 Ga0207687_10001147
1345 Ga0207687_10029528
1346 Ga0207687_10165851
1347 Ga0207700_10000063
1348 Ga0207700_10016567
1349 Ga0207700_10026919
1350 Ga0207700_10029262
1351 Ga0207700_10029504
1352 Ga0207700_10055669
1353 Ga0207700_10109651
1354 Ga0207664_10000196
1355 Ga0207664_10001029
1356 Ga0207664_10002329
1357 Ga0207664_10021830
1358 Ga0207664_10024393
1359 Ga0207664_10032064
1360 Ga0207664_10044307
1361 Ga0207664_10047539
1362 Ga0207664_10056440
1363 Ga0207664_10243144
1364 Ga0207664_10272932
1365 Ga0207664_10331043
1366 Ga0207644_10005208
1367 Ga0207644_10031027
1368 Ga0207644_10103641
1369 Ga0207690_10028152
1370 Ga0207690_10054150
1371 Ga0207706_10001128
1372 Ga0207706_10009818
1373 Ga0207706_10019781
1374 Ga0207706_10022575
1375 Ga0207686_10002468
1376 Ga0207686_10005839
1377 Ga0207686_10006248
1378 Ga0207686_10037607
1379 Ga0207709_10007186
1380 Ga0207709_10017218
1381 Ga0207709_10023700
1382 Ga0207709_10034736
1383 Ga0207709_10196818
1384 Ga0207670_10127309
1385 Ga0207669_10032348
1386 Ga0207669_10057020
1387 Ga0207669_10058311
1388 Ga0207704_10000377
1389 Ga0207704_10012981
1390 Ga0207704_10044070
1391 Ga0207704_10132560
1392 Ga0207665_10000226
1393 Ga0207665_10001670
1394 Ga0207665_10005772
1395 Ga0207665_10013801
1396 Ga0207665_10056850
1397 Ga0207665_10058954
1398 Ga0207665_10059404
1399 Ga0207665_10067547
1400 Ga0207665_10073331
1401 Ga0207691_10033981
1402 Ga0207691_10040532
1403 Ga0207711_10108185
1404 Ga0207711_10165028
1405 Ga0207689_10002296
1406 Ga0207689_10009916
1407 Ga0207689_10025969
1408 Ga0207661_10082020
1409 Ga0207661_10097199
1410 Ga0207661_10104229
1411 Ga0207679_10002946
1412 Ga0207679_10169321
1413 Ga0207667_10107381
1414 Ga0207651_10050424
1415 Ga0207712_10006309
1416 Ga0207712_10043419
1417 Ga0207668_10056080
1418 Ga0207640_10003409
1419 Ga0207658_10012179
1420 Ga0207677_10011441
1421 Ga0207703_10014135
1422 Ga0207703_10018284
1423 Ga0207703_10053855
1424 Ga0207678_10001390
1425 Ga0207678_10016407
1426 Ga0207678_10032965
1427 Ga0207678_10045686
1428 Ga0207708_10003968
1429 Ga0207708_10005234
1430 Ga0207708_10005684
1431 Ga0207708_10006707
1432 Ga0207702_10138335
1433 Ga0207641_10003507
1434 Ga0207641_10071720
1435 Ga0207648_10001355
1436 Ga0207648_10004217
1437 Ga0207648_10026700
1438 Ga0207648_10103641
1439 Ga0207676_10001452
1440 Ga0207676_10016180
1441 Ga0207676_10022955
1442 Ga0207674_10000186
1443 Ga0207674_10010966
1444 Ga0207674_10150848
1445 Ga0207675_100013054
1446 Ga0207675_100015022
1447 Ga0207675_100017867
1448 Ga0207675_100040429
1449 Ga0207675_100078529
1450 Ga0207675_100163300
1451 Ga0207683_10000201
1452 Ga0207683_10008060
1453 Ga0207683_10027425
1454 Ga0207698_10205597
1455 Ga0207428_10001001
1456 Ga0207428_10011760
1457 Ga0268266_10007843
1458 Ga0268266_10065058
1459 Ga0268266_10188837
1460 Ga0268266_10205726
1461 Ga0268266_10246931
1462 Ga0268265_10121015
1463 Ga0268264_10114403
1464 Ga0265337_1000027
1465 Ga0265326_10001234
1466 Ga0265319_1001055
1467 Ga0265334_10000773
1468 Ga0265322_10001284
1469 Ga0265336_10002288
1470 Ga0265338_10000227
1471 Ga0265338_10001512
1472 Ga0265338_10007886
1473 Ga0265338_10011419
1474 Ga0265324_10004386
1475 Ga0265332_10001185
1476 Ga0265325_10005218
1477 Ga0265339_10021776
1478 Ga0265327_10008031
1479 Ga0265316_10007705
1480 Ga0307408_100231039
1481 Ga0265313_10010516
1482 Ga0265314_10010105
1483 Ga0307405_10018316
1484 Ga0307406_10058952
1485 Ga0307409_100226090
1486 Ga0307416_100017768
1487 Ga0307415_100027908
1488 Ga0373926_0001462
1489 Ga0373926_0021075
1490 Ga0373926_0032850
1491 Ga0373934_0015454
1492 Ga0373940_0001161
1493 Ga0373944_0000926
1494 Ga0373923_0009489
1495 Ga0373923_0010272
1496 Ga0373923_0020707
1497 Ga0373936_0000519
1498 Ga0373936_0004471
1499 Ga0373936_0006048
1500 Ga0373936_0008708
1501 Ga0373936_0014364
1502 Ga0373939_0005927
1503 Ga0373941_0005711
1504 Ga0373945_0001751
1505 Ga0373945_0014754
1506 Ga0373953_0003298
1507 Ga0373954_0014349
1508 Ga0373954_0035904
1509 Ga0373956_0025651
1510 Ga0373957_0015658
1511 Ga0373957_0051606
1512 Ga0373943_0000223
1513 Ga0373946_0000756
1514 Ga0373946_0000798
1515 Ga0373955_0021637
1516 Ga0373955_0101848
1517 Ga0373962_0007345
1518 Ga0373924_0008387
1519 Ga0373924_0012085
1520 Ga0373924_0051869
1521 Ga0373931_0013389
1522 Ga0373931_0022723
1523 Ga0373935_0004598
1524 Ga0373935_0010760
1525 Ga0373935_0042798
1526 Ga0373927_0003276
1527 Ga0373927_0051849
1528 Ga0373947_0000014
1529 Ga0373937_0065515
1530 Ga0373925_0000421
1531 Ga0373925_0009690
1532 Ga0373925_0010661
1533 Ga0373925_0012062
1534 Ga0373925_0045115
1535 Ga0373925_0081599
1536 Ga0395899_0005983
1537 Ga0395899_0140674
1538 Ga0395900_0033278
1539 Ga0395900_0125814
1540 Ga0395898_0003800
1541 Ga0395898_0019897
1542 Ga0395898_0019979
1543 Ga0395905_0008955
1544 Ga0395905_0047873
1545 Ga0436364_0485851
1546 Ga0436364_0824111
1547 Ga0436364_0841117
1548 Ga0436364_1107254
1549 Ga0436364_1421530
1550 Ga0436364_1435297
1551 Ga0436364_1450559
1552 Ga0436364_1520571
1553 Ga0395901_0032219
1554 Ga0439461_0000217
1555 Ga0439466_0021262
1556 Ga0439465_0000349
1557 Ga0439431_0000859
1558 Ga0439440_0014134
1559 Ga0466969_0078576
1560 Ga0466972_0012299
1561 Ga0466965_0002177
1562 Ga0466965_0022873
1563 Ga0466966_0009549
1564 Ga0466961_0002650
1565 Ga0466963_0005765
1566 Ga0466963_0040770
1567 Ga0466964_0005286
1568 Ga0466964_0017103
1569 Ga0466968_0001088
1570 Ga0466970_0016640
1571 Ga0466957_0008856
1572 Ga0466957_0043503
1573 Ga0466960_0079258
1574 Ga0466959_0001490
1575 Ga0466959_0027893
1576 Ga0466959_0075817
1577 Ga0466958_0063732
1578 Ga0466967_0010721
1579 Ga0466967_0012654
1580 Ga0466967_0036069
1581 Ga0466967_0056273
1582 Ga0466967_0056739
1583 Ga0466967_0111964
1584 Ga0466967_0113400
1585 Ga0466967_0132388
1586 Ga0466967_0158221
1587 Ga0495592_0000455
1588 Ga0495592_0015925
1589 Ga0495592_0025553
1590 Ga0495592_0068405
1591 Ga0495603_0001901
1592 Ga0495603_0006218
1593 Ga0495603_0024918
1594 Ga0495603_0040047
1595 Ga0495603_0122091
1596 Ga0495629_0003190
1597 Ga0495629_0012234
1598 Ga0495629_0190503
1599 Ga0495638_0002264
1600 Ga0495641_0007936
1601 Ga0495641_0012394
1602 Ga0495641_0044956
1603 Ga0495651_0000174
1604 Ga0495651_0007208
1605 Ga0495651_0059179
1606 Ga0495653_0000414
1607 Ga0495580_0206685
1608 Ga0495582_0013066
1609 Ga0495582_0027448
1610 Ga0495582_0033593
1611 Ga0495582_0036446
1612 Ga0495582_0155062
1613 Ga0495605_0139752
1614 Ga0495639_0019856
1615 Ga0495662_0005395
1616 Ga0495662_0013986
1617 Ga0495662_0027687
1618 Ga0495664_0000074
1619 Ga0495664_0003697
1620 Ga0495664_0039541
1621 Ga0495664_0099478
1622 Ga0495664_0113788
1623 Ga0495664_0136094
1624 Ga0495584_0037466
1625 Ga0495584_0069862
1626 Ga0495584_0089727
1627 Ga0495594_0100555
1628 Ga0495596_0029721
1629 Ga0495606_0051487
1630 Ga0495608_0000410
1631 Ga0495608_0010194
1632 Ga0495608_0018431
1633 Ga0495618_0039001
1634 Ga0495618_0071028
1635 Ga0495618_0089619
1636 Ga0495628_0000444
1637 Ga0495628_0024834
1638 Ga0495628_0101290
1639 Ga0495628_0102534
1640 Ga0495630_0009396
1641 Ga0495630_0011332
1642 Ga0495630_0016278
1643 Ga0495630_0032481
1644 Ga0495631_0051413
1645 Ga0495644_0027858
1646 Ga0495644_0028662
1647 Ga0495648_0005458
1648 Ga0495663_0006952
1649 Ga0495666_0000996
1650 Ga0495666_0068629
1651 Ga0495652_0000665
1652 Ga0495652_0043197
1653 Ga0495654_0081550
1654 Ga0495665_0009444
1655 Ga0495665_0013989
1656 Ga0495665_0061076
1657 Ga0495640_0006097
1658 Ga0495640_0018263
1659 Ga0495586_0005340
1660 Ga0495586_0107155
1661 Ga0495587_0002878
1662 Ga0495587_0019393
1663 Ga0495587_0055100
1664 Ga0495587_0091279
1665 Ga0495609_0051361
1666 Ga0495621_0023587
1667 Ga0495645_0001127
1668 Ga0495645_0158078
1669 Ga0495667_0000117
1670 Ga0495667_0000908
1671 Ga0495667_0029518
1672 Ga0495667_0047522
1673 Ga0495667_0057206
1674 Ga0495667_0068884
1675 Ga0495667_0087160
1676 Ga0495656_0000291
1677 Ga0495656_0022991
1678 Ga0495634_0001586
1679 Ga0495634_0002700
1680 Ga0495634_0056454
1681 Ga0495635_0000773
1682 Ga0495635_0011752
1683 Ga0495635_0063839
1684 Ga0495635_0173446
1685 Ga0495659_0000889
1686 Ga0495588_0001357
1687 Ga0495657_0006991
1688 Ga0495657_0007099
1689 Ga0495657_0051040
1690 Ga0495599_0000185
1691 Ga0495599_0053041
1692 Ga0495623_0055054
1693 Ga0495646_0000628
1694 Ga0495646_0018567
1695 Ga0495646_0041034
1696 Ga0495647_0001537
1697 Ga0495647_0042764
1698 Ga0495647_0058534
1699 Ga0495658_0001438
1700 Ga0495658_0011377
1701 Ga0495613_0053181
1702 Ga0495613_0108031
1703 Ga0495624_0006757
1704 Ga0495624_0028048
1705 Ga0495624_0033267
1706 Ga0495624_0086899
1707 Ga0495671_0034988
1708 Ga0495589_0007696
1709 Ga0495600_0014669
1710 Ga0495581_0004943
1711 Ga0495581_0008059
1712 Ga0495581_0009928
1713 Ga0495581_0036608
1714 Ga0495604_0016061
1715 Ga0495604_0025456
1716 Ga0495636_0005073
1717 Ga0495674_0000984
1718 Ga0495674_0002797
1719 Ga0495674_0041283
1720 Ga0495674_0050652
1721 Ga0495674_0054886
1722 Ga0495674_0107812
1723 Ga0495672_0030900
1724 Ga0495676_0020287
1725 Ga0495676_0040298
1726 Ga0495680_0000401
1727 Ga0495680_0001586
1728 Ga0495680_0029597
1729 Ga0495680_0071146
1730 Ga0495680_0167712
1731 Ga0495675_0005713
1732 Ga0495675_0009139
1733 Ga0495673_0001205
1734 Ga0495684_0000598
1735 Ga0495684_0005984
1736 Ga0495686_0003330
1737 Ga0495686_0058912
1738 Ga0495593_0015763
1739 Ga0495593_0050767
1740 Ga0495602_0002949
1741 Ga0495602_0130474
1742 Ga0495614_0001554
1743 Ga0496100_0004799
1744 Ga0496100_0006150
1745 Ga0496100_0009450
1746 Ga0496100_0042136
1747 Ga0496100_0083030
1748 Ga0496101_0000021
1749 Ga0496101_0001613
1750 Ga0496101_0056770
1751 Ga0496102_0000001
1752 Ga0496102_0000590
1753 Ga0496102_0001309
1754 Ga0496102_0010316
1755 Ga0496102_0029162
1756 Ga0496102_0073674
1757 Ga0496103_0000007
1758 Ga0496103_0015572
1759 Ga0496103_0019054
1760 Ga0496103_0041252
1761 Ga0496103_0074244
1762 Ga0496103_0156782
1763 Ga0496104_0010504
1764 Ga0496104_0011782
1765 Ga0496104_0020133
1766 Ga0496104_0091076
1767 Ga0496104_0187398
1768 Ga0496104_0323470
1769 Ga0496105_0015872
1770 Ga0496105_0031392
1771 Ga0496105_0057685
1772 Ga0496105_0182583
1773 Ga0496106_0002503
1774 Ga0496106_0003195
1775 Ga0496106_0003386
1776 Ga0496106_0028783
1777 Ga0496106_0065366
1778 Ga0496106_0107582
1779 Ga0496107_0000321
1780 Ga0496107_0003559
1781 Ga0496107_0011486
1782 Ga0496107_0016357
1783 Ga0496107_0040227
1784 Ga0496107_0041137
1785 Ga0496107_0074185
1786 Ga0496108_0000645
1787 Ga0496108_0020996
1788 Ga0496108_0021599
1789 Ga0496108_0028914
1790 Ga0496108_0093677
1791 Ga0496108_0127244
1792 Ga0496108_0132006
1793 Ga0496108_0143694
1794 Ga0496109_0016603
1795 Ga0496109_0024888
1796 Ga0496109_0053112
1797 Ga0496109_0280463
1798 Ga0496110_0002173
1799 Ga0496110_0034997
1800 Ga0496110_0039235
1801 Ga0496110_0209617
1802 Ga0496110_0231112
1803 Ga0496111_0025718
1804 Ga0496111_0031195
1805 Ga0496111_0043019
1806 Ga0496111_0072558
1807 Ga0496111_0078746
1808 Ga0496111_0117387
1809 Ga0496112_0005708
1810 Ga0496112_0117982
1811 Ga0496113_0013407
1812 Ga0496113_0032813
1813 Ga0496113_0121038
1814 Ga0496114_0000495
1815 Ga0496114_0002288
1816 Ga0496114_0032144
1817 Ga0496114_0041127
1818 Ga0496115_0001075
1819 Ga0496115_0003085
1820 Ga0496115_0014339
1821 Ga0496115_0101112
1822 Ga0496116_0000018
1823 Ga0496116_0000166
1824 Ga0496117_0000015
1825 Ga0496118_0000012
1826 Ga0496118_0051275
1827 Ga0496119_0000454
1828 Ga0496119_0060786
1829 Ga0496119_0072685
1830 Ga0496120_0001962
1831 Ga0496120_0006298
1832 Ga0496121_0000177
1833 Ga0496125_0016319
1834 Ga0496126_0001113
1835 Ga0501034_0127982
1836 Ga0501038_0121932
1837 Ga0501067_0004530
1838 Ga0501068_0110415
1839 Ga0501070_0040248
1840 Ga0501073_0100478
1841 Ga0501074_0062711
1842 Ga0501074_0133790
1843 Ga0501077_0028597
1844 Ga0501080_0516152
1845 Ga0501083_0016126
1846 Ga0501083_0038734
1847 Ga0501044_0196617
1848 nmdc:mga03683_3552_c1
1849 nmdc:mga03n38_17725_c1
1850 nmdc:mga03n38_7306_c1
1851 nmdc:mga03n38_9110_c1
1852 nmdc:mga00v17_1369_c1
1853 nmdc:mga00v17_17742_c2
1854 nmdc:mga00v17_5888_c1
1855 nmdc:mga0yw44_15068_c1
1856 nmdc:mga0yw44_64861_c1
1857 nmdc:mga07m45_24287_c1
1858 nmdc:mga07m45_69649_c1
1859 nmdc:mga05p37_11253_c1
1860 nmdc:mga05p37_47560_c1
1861 nmdc:mga05p37_87829_c1
1862 nmdc:mga09592_86124_c1
1863 nmdc:mga08y16_140196_c1
1864 nmdc:mga0n895_16162_c1
1865 nmdc:mga0n895_17799_c1
1866 nmdc:mga0n895_213832_c1
1867 nmdc:mga0n895_39305_c1
1868 nmdc:mga0rr50_3260_c1
1869 nmdc:mga0a205_2637_c1
1870 nmdc:mga0sz30_3201_c1
1871 nmdc:mga0sz30_42494_c1
1872 nmdc:mga0sz30_88335_c1
1873 Ga0495601_0015602
1874 Ga0495601_0085524
1875 Ga0495612_0008199
1876 Ga0500635_0004952
1877 Ga0495655_0001501
1878 Ga0495595_0002988
1879 Ga0495595_0024353
1880 Ga0495619_0001449
1881 Ga0495619_0037454
1882 Ga0495619_0046837
1883 Ga0495619_0063206
1884 Ga0500643_001154
1885 Ga0500643_001862
1886 Ga0500643_006474
1887 Ga0500643_007970
1888 Ga0500556_0001572
1889 Ga0500562_005490
1890 Ga0500652_007547
1891 Ga0500645_000035
1892 Ga0501082_0022336
1893 2644488274
1894 2738704647
1895 2902795187
1896 2902811298
1897 2902841362
1898 2929216249
1899 2939583058
1900 8055072402

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

72

357

0.92

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

81

386

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvt-assembly1.cif.gz_A crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis 0.92 35 426
7bvt-assembly1.cif.gz_A crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis 0.9109 35 426
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.8823 37 428
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.8742 37 428
1n3x-assembly1.cif.gz_A ligand-free high-affinity maltose-binding protein 0.8715 38 423
ID Description Score Start End Superfamily
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8736 37 149 3.40.190.10
4hs7A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8679 36 150 3.40.190.10
af_O53485_33_438_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8674 38 427 3.40.190.10
3n95B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8632 38 150 3.40.190.10
4rjzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8556 37 149 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A661VLR6-F1-model_v4 ABC transporter substrate-binding protein 0.8946 129 428 GO:0030313
AF-A0A0S7XGC0-F1-model_v4 ABC transporter substrate-binding protein 0.8942 27 428 GO:0015768
GO:0042956
GO:0055052
GO:1901982
AF-A0A496QBQ7-F1-model_v4 ABC transporter substrate-binding protein 0.8915 128 426 GO:0030313
AF-D8H0S8-F1-model_v4 deleted 0.8882 91 429
AF-A0A496QBQ7-F1-model_v4 ABC transporter substrate-binding protein 0.883 128 426 GO:0030313

Map