F486518

General Info

Members Datasets Scaffolds Average Seq Length
948 398 836 447

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000113|Ga0496102_0000113_43506_45011
Length 501
Sequence LRAQQLRQVLNLLPTALVWLDLEQQHARNFSVKWFLRVKPDKAPPRSFLQKRIQMTTASKVLWGEGLFLRPQHFQQQDQYHEHRLHESVKALHPYAWGVSHLQLDREALASNTLRVLELSLIFPDGEIFNAPRNDDLPEAVDLSQLAPGQTFTYYAALPALKHFGGNFTPSGQAANGARFAQGTRETADLYTQAAQADLIYLKKSLRLVSESEPRDAYVSIPLVRLRRVSTGGFEADPTFVPPSLSIRSAPLLFLQLRRLMDALQAKVSALHGHHREPSKNVIEYRSGDMSTFWLLHTASTAFATLTHYFQHPTLHPERLYEQLLGLAGSLMTFSKNHVLSDLPAYQHTDPGPSFAKLHLIIRELLDTVISSKYFAIALNETKPSYHHGMLDSGKIDERTALYLAVAADMPALELVDVVPLRFKVGAPDDVEKFVLAAMPGVRLQHAPQVPAAVPVRPDTYYFTLDSKGPMYERMLQAQSISIYVPSGMRGLKLELVAVAS

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2519103095 Burkholderia sp. KJ006 Isolate Nodule
9 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
10 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
11 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
12 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
13 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
14 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
15 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
16 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
20 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
21 2643221556 Massilia sp. Root1485 Isolate Unclassified
22 2643221594 Achromobacter sp. Root170 Isolate Unclassified
23 2643221638 Duganella sp. Root336D2 Isolate Unclassified
24 2643221645 Massilia sp. Root351 Isolate Unclassified
25 2643221684 Massilia sp. Root133 Isolate Unclassified
26 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
27 2738541280 Massilia sp. GV090 Isolate Unclassified
28 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
29 2738541297 Duganella sp. GV083 Isolate Unclassified
30 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
31 2738541300 Massilia sp. GV016 Isolate Unclassified
32 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
33 2738541357 Duganella sp. GV053 Isolate Unclassified
34 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
35 2738543003 Duganella sp. GV066 Isolate Unclassified
36 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
37 2738543018 Massilia sp. GV045 Isolate Unclassified
38 2738543026 Duganella sp. GV089 Isolate Unclassified
39 2738543029 Duganella sp. GV039 Isolate Unclassified
40 2738543030 Massilia sp. GV097 Isolate Unclassified
41 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
42 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
43 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
44 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
45 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
46 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
47 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
48 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
49 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
50 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
51 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
52 2818991450 Burkholderia sp. 604 Isolate Unclassified
53 2818991452 Burkholderia cepacia 561 Isolate Unclassified
54 2821131069 Duganella sp. 1224 Isolate Unclassified
55 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
56 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
57 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
58 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
59 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
60 2842711865 Duganella sp. R-73148 Isolate Unclassified
61 2855730933 Achromobacter sp. HZ28 Isolate Nodule
62 2855767633 Achromobacter sp. HZ34 Isolate Nodule
63 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
64 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
65 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
66 2857558681 Duganella sp. R-74565 Isolate Unclassified
67 2858950400 Achromobacter sp. K91 Isolate Unclassified
68 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
69 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
70 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
71 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
72 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
73 2904424332 Duganella sp. 1411 Isolate Rhizosphere
74 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
75 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
76 2904564687 Burkholderia sp. 571 Isolate Unclassified
77 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
78 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
79 2919476304 Duganella sp. 3397 Isolate Unclassified
80 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
81 2928058823 Ralstonia sp. 1138 Isolate Unclassified
82 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
83 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
84 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
85 2928163908 Burkholderia sp. 567 Isolate Unclassified
86 2928170801 Burkholderia sp. 572 Isolate Unclassified
87 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
88 2928536128 Burkholderia sola 565 Isolate Unclassified
89 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
90 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
91 2941479691
92 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
93 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
94 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
95 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
96 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
97 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
100 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
101 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
102 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
103 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
104 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
105 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
106 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
107 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
110 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
113 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
114 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
115 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
116 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
117 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
118 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
119 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
120 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
121 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
122 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
123 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
124 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
125 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
126 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
127 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
131 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
132 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
133 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
136 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
137 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
138 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
153 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
163 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
196 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
205 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
370 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
372 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
373 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
378 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
384 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
385 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
386 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
387 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
388 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
389 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
390 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
391 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
392 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
393 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
394 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
395 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
396 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
397 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
398 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.03
Metatranscriptomes 1.16
Isolates 11.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.51
Nodule 1.79
Rhizoplane 2.43
Rhizosphere 65.61
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000194 3300001915 Bacteria 17891
2 JGI24740J21852_10000120 3300001979 Bacteria 29185
3 JGI24740J21852_10000697 3300001979 Bacteria 14550
4 JGI24740J21852_10001098 3300001979 Bacteria 12228
5 JGI24737J22298_10013144 3300001990 Bacteria 2697
6 JGI24735J21928_10000692 3300002067 Bacteria 11954
7 JGI24735J21928_10006341 3300002067 Bacteria 3902
8 JGI24735J21928_10011765 3300002067 Bacteria 2771
9 JGI24738J21930_10000921 3300002075 Bacteria 8474
10 JGI25156J39149_1001759 3300002705 Bacteria 8618
11 JGI25156J39149_1002214 3300002705 Bacteria 7219
12 JGI25156J39149_1002592 3300002705 Bacteria 6379
13 JGI25156J39149_1006972 3300002705 Bacteria 3026
14 JGI25154J39366_1000688 3300002738 Bacteria 15496
15 JGI25154J39366_1001418 3300002738 Bacteria 8581
16 JGI25152J39213_1000092 3300002773 Bacteria 62842
17 JGI25150J39212_1000467 3300002774 Bacteria 17695
18 JGI25150J39212_1003019 3300002774 Bacteria 4041
19 JGI25150J39212_1004377 3300002774 Bacteria 3149
20 JGI25159J45721_1000449 3300002987 Bacteria 19041
21 JGI25159J45721_1004076 3300002987 Bacteria 4958
22 JGI25159J45721_1004366 3300002987 Bacteria 4710
23 JGI25151J46595_10000077 3300003187 Bacteria 133862
24 JGI25151J46595_10000541 3300003187 Bacteria 34978
25 JGI25165J46597_1000418 3300003214 Bacteria 44003
26 rootL2_10007766 3300003322 Bacteria 7140
27 rootL2_10093398 3300003322 Bacteria 4867
28 rootH1_10142808 3300003323 Bacteria 4514
29 rootH1_10211972 3300003323 Bacteria 3373
30 JGI25160J50197_1000083 3300003354 Bacteria 97669
31 JGI25160J50197_1001330 3300003354 Bacteria 12467
32 JGI25161J50226_1003485 3300003374 Bacteria 3581
33 JGI25161J50226_1004512 3300003374 Bacteria 2903
34 Ga0006556J51387_1034511 3300003479 Bacteria 2270
35 Ga0055538_1003118 3300003751 Bacteria 2176
36 Ga0055538_1003122 3300003751 Bacteria 2176
37 Ga0055539_1000101 3300003752 Bacteria 99892
38 Ga0055533_1000091 3300003756 Bacteria 120504
39 Ga0055533_1000465 3300003756 Bacteria 15285
40 Ga0055533_1002554 3300003756 Bacteria 4072
41 Ga0055533_1004796 3300003756 Bacteria 2333
42 Ga0055532_1000037 3300003758 Bacteria 205054
43 Ga0055532_1000045 3300003758 Bacteria 186314
44 Ga0055525_1000503 3300003759 Bacteria 19614
45 Ga0055525_1000582 3300003759 Bacteria 15973
46 Ga0055527_1000027 3300003760 Bacteria 186314
47 Ga0055535_1000018 3300003761 Bacteria 243804
48 Ga0055535_1000033 3300003761 Bacteria 186314
49 Ga0055542_1000050 3300003762 Bacteria 186314
50 Ga0055542_1001592 3300003762 Bacteria 10518
51 Ga0055542_1007149 3300003762 Bacteria 2302
52 Ga0055529_1000041 3300003763 Bacteria 226495
53 Ga0055529_1000061 3300003763 Bacteria 186314
54 Ga0055529_1002426 3300003763 Bacteria 3622
55 Ga0055526_1000001 3300003771 Bacteria 669703
56 Ga0055526_1000144 3300003771 Bacteria 62451
57 Ga0055526_1000580 3300003771 Bacteria 28731
58 Ga0055526_1001674 3300003771 Bacteria 15546
59 Ga0055526_1007301 3300003771 Bacteria 5780
60 Ga0055537_1000004 3300003773 Bacteria 167383
61 Ga0055537_1001117 3300003773 Bacteria 11587
62 Ga0055537_1002014 3300003773 Bacteria 7221
63 Ga0055524_1000585 3300003775 Bacteria 26445
64 Ga0055524_1001916 3300003775 Bacteria 11254
65 Ga0055524_1002675 3300003775 Bacteria 9026
66 Ga0055524_1006646 3300003775 Bacteria 5000
67 Ga0055536_1000428 3300003781 Bacteria 30020
68 Ga0055534_1000095 3300003784 Bacteria 68059
69 Ga0055534_1002974 3300003784 Bacteria 5594
70 Ga0055528_1000050 3300003790 Bacteria 93078
71 Ga0055528_1000756 3300003790 Bacteria 22562
72 Ga0055528_1004056 3300003790 Bacteria 7153
73 Ga0055530_10002865 3300003791 Bacteria 10505
74 Ga0055531_10004622 3300003794 Bacteria 8275
75 Ga0055531_10013593 3300003794 Bacteria 3738
76 Ga0055541_1000371 3300003841 Bacteria 13768
77 Ga0055541_1001958 3300003841 Bacteria 4250
78 Ga0055541_1005637 3300003841 Bacteria 2176
79 Ga0058692_1003017 3300003856 Bacteria 5385
80 Ga0055543_1002941 3300004625 Bacteria 5307
81 Ga0055543_1004284 3300004625 Bacteria 3928
82 Ga0065165_1000003 3300005262 Bacteria 390701
83 Ga0065165_1000488 3300005262 Bacteria 61235
84 Ga0065165_1001740 3300005262 Bacteria 21739
85 Ga0065165_1002969 3300005262 Bacteria 12901
86 Ga0065704_10146009 3300005289 Bacteria 1466
87 Ga0070658_10006304 3300005327 Bacteria 9609
88 Ga0070658_10008844 3300005327 Bacteria 8097
89 Ga0070660_100000144 3300005339 Bacteria 45562
90 Ga0070660_100000616 3300005339 Bacteria 23774
91 Ga0070660_100027876 3300005339 Bacteria 4220
92 Ga0070661_100001251 3300005344 Bacteria 17830
93 Ga0070661_100001281 3300005344 Bacteria 17666
94 Ga0070659_100000156 3300005366 Bacteria 52480
95 Ga0070659_100108921 3300005366 Bacteria 2235
96 Ga0070667_100089172 3300005367 Bacteria 2649
97 Ga0070663_100000049 3300005455 Bacteria 52979
98 Ga0070663_100042047 3300005455 Bacteria 3209
99 Ga0070662_100003180 3300005457 Bacteria 10206
100 Ga0068855_100004241 3300005563 Bacteria 17504
101 Ga0068855_100005032 3300005563 Bacteria 16131
102 Ga0068855_100018077 3300005563 Bacteria 8472
103 Ga0068855_100018234 3300005563 Bacteria 8431
104 Ga0070664_100000026 3300005564 Bacteria 92731
105 Ga0070664_100099725 3300005564 Bacteria 2524
106 Ga0068857_100094439 3300005577 Bacteria 2678
107 Ga0068857_100122337 3300005577 Bacteria 2344
108 Ga0068854_100000041 3300005578 Bacteria 93231
109 Ga0068856_100000643 3300005614 Bacteria 37835
110 Ga0068856_100285133 3300005614 Bacteria 1668
111 Ga0068852_100082788 3300005616 Bacteria 2852
112 Ga0068862_100126670 3300005844 Bacteria 2255
113 Ga0075366_10000634 3300006195 Bacteria 16518
114 Ga0075366_10024111 3300006195 Bacteria 3548
115 Ga0075370_10001064 3300006353 Bacteria 11419
116 Ga0068865_100050032 3300006881 Bacteria 2885
117 Ga0105251_10000495 3300009011 Bacteria 37283
118 Ga0105244_10013629 3300009036 Bacteria 4738
119 Ga0105244_10030658 3300009036 Bacteria 2860
120 Ga0105250_10003303 3300009092 Bacteria 7673
121 Ga0105240_10000656 3300009093 Bacteria 63756
122 Ga0105240_10005256 3300009093 Bacteria 19332
123 Ga0105240_10025772 3300009093 Bacteria 7722
124 Ga0105240_10056042 3300009093 Bacteria 4933
125 Ga0105240_10091361 3300009093 Bacteria 3720
126 Ga0105240_10246918 3300009093 Bacteria 2066
127 Ga0105243_10005556 3300009148 Bacteria 9820
128 Ga0105243_10010429 3300009148 Bacteria 7055
129 Ga0105241_10015393 3300009174 Bacteria 5601
130 Ga0105237_10004293 3300009545 Bacteria 16521
131 Ga0105237_10020911 3300009545 Bacteria 6736
132 Ga0105238_10003697 3300009551 Bacteria 15227
133 Ga0105239_10002437 3300010375 Bacteria 23713
134 Ga0105239_10048934 3300010375 Bacteria 4634
135 Ga0157347_1000898 3300012502 Bacteria 2157
136 Ga0157373_10002963 3300013100 Bacteria 12859
137 Ga0157373_10003193 3300013100 Bacteria 12392
138 Ga0157371_10000179 3300013102 Bacteria 92737
139 Ga0157371_10000709 3300013102 Bacteria 39124
140 Ga0157370_10000138 3300013104 Bacteria 87858
141 Ga0157370_10000328 3300013104 Bacteria 59681
142 Ga0157370_10002267 3300013104 Bacteria 23355
143 Ga0157370_10004860 3300013104 Bacteria 15255
144 Ga0157369_10000206 3300013105 Bacteria 81958
145 Ga0157369_10000953 3300013105 Bacteria 36714
146 Ga0157369_10004423 3300013105 Bacteria 16592
147 Ga0157369_10007857 3300013105 Bacteria 12269
148 Ga0157369_10018247 3300013105 Bacteria 7868
149 Ga0157369_10059098 3300013105 Bacteria 4135
150 Ga0157374_10000540 3300013296 Bacteria 33817
151 Ga0157374_10066727 3300013296 Bacteria 3382
152 Ga0157372_10000208 3300013307 Bacteria 65462
153 Ga0182008_10000228 3300014497 Bacteria 43946
154 Ga0182008_10030982 3300014497 Bacteria 2694
155 Ga0182006_1000142 3300015261 Bacteria 76916
156 Ga0182006_1001902 3300015261 Bacteria 11908
157 Ga0182006_1008412 3300015261 Bacteria 4675
158 Ga0182007_10000231 3300015262 Bacteria 37454
159 Ga0182007_10001752 3300015262 Bacteria 11417
160 Ga0182007_10032922 3300015262 Bacteria 1758
161 Ga0182005_1000090 3300015265 Bacteria 68199
162 Ga0183361_10004 3300016635 Bacteria 484183
163 Ga0163161_10000154 3300017792 Bacteria 63473
164 Ga0206351_10102888 3300020077 Bacteria 24688
165 Ga0206353_11627597 3300020082 Bacteria 2186
166 Ga0154015_1642150 3300020610 Bacteria 12207
167 Ga0224712_10000305 3300022467 Bacteria 9177
168 Ga0209436_100083 3300025208 Bacteria 47160
169 Ga0209436_100656 3300025208 Bacteria 14766
170 Ga0209436_100965 3300025208 Bacteria 11236
171 Ga0209784_100070 3300025224 Bacteria 152262
172 Ga0209784_100553 3300025224 Bacteria 13432
173 Ga0209784_100800 3300025224 Bacteria 7428
174 Ga0209566_100084 3300025225 Bacteria 152262
175 Ga0209566_100327 3300025225 Bacteria 42805
176 Ga0209566_100360 3300025225 Bacteria 38280
177 Ga0209566_101204 3300025225 Bacteria 9118
178 Ga0209674_100074 3300025226 Bacteria 223554
179 Ga0209674_100089 3300025226 Bacteria 178751
180 Ga0209674_100102 3300025226 Bacteria 155582
181 Ga0209674_100138 3300025226 Bacteria 110735
182 Ga0209674_104607 3300025226 Bacteria 2203
183 Ga0209672_100053 3300025228 Bacteria 223599
184 Ga0209672_100054 3300025228 Bacteria 222217
185 Ga0209672_100072 3300025228 Bacteria 167942
186 Ga0209672_100169 3300025228 Bacteria 55248
187 Ga0209147_100005 3300025229 Bacteria 1036530
188 Ga0209147_100070 3300025229 Bacteria 223535
189 Ga0209147_100085 3300025229 Bacteria 185813
190 Ga0209147_100100 3300025229 Bacteria 162747
191 Ga0209147_100376 3300025229 Bacteria 31161
192 Ga0209563_100102 3300025230 Bacteria 152262
193 Ga0209563_100394 3300025230 Bacteria 15674
194 Ga0209563_103739 3300025230 Bacteria 3066
195 Ga0209563_107130 3300025230 Bacteria 1858
196 Ga0209437_102620 3300025233 Bacteria 3440
197 Ga0209258_100007 3300025242 Bacteria 1036530
198 Ga0209258_100094 3300025242 Bacteria 223535
199 Ga0209258_100168 3300025242 Bacteria 145329
200 Ga0209258_100397 3300025242 Bacteria 54750
201 Ga0207425_1000017 3300025245 Bacteria 423851
202 Ga0207425_1000262 3300025245 Bacteria 38967
203 Ga0207425_1000462 3300025245 Bacteria 26096
204 Ga0209646_1000023 3300025246 Bacteria 441100
205 Ga0209646_1000412 3300025246 Bacteria 24516
206 Ga0209026_1002591 3300025250 Bacteria 6643
207 Ga0209677_100062 3300025253 Bacteria 152262
208 Ga0209677_106045 3300025253 Bacteria 2983
209 Ga0209148_1000100 3300025254 Bacteria 223604
210 Ga0209148_1000119 3300025254 Bacteria 188079
211 Ga0209148_1000676 3300025254 Bacteria 28602
212 Ga0209148_1000969 3300025254 Bacteria 18698
213 Ga0209148_1004315 3300025254 Bacteria 3533
214 Ga0209759_1000009 3300025256 Bacteria 446623
215 Ga0209759_1000036 3300025256 Bacteria 261374
216 Ga0209759_1000150 3300025256 Bacteria 120839
217 Ga0209759_1001282 3300025256 Bacteria 15037
218 Ga0209759_1002505 3300025256 Bacteria 8010
219 Ga0209129_1000039 3300025258 Bacteria 322444
220 Ga0209129_1000088 3300025258 Bacteria 179071
221 Ga0209129_1000805 3300025258 Bacteria 19803
222 Ga0209129_1001319 3300025258 Bacteria 14048
223 Ga0209129_1012165 3300025258 Bacteria 1997
224 Ga0209233_1000144 3300025261 Bacteria 190024
225 Ga0209565_1000018 3300025263 Bacteria 460940
226 Ga0209565_1001673 3300025263 Bacteria 9238
227 Ga0209565_1004041 3300025263 Bacteria 4572
228 Ga0209565_1004883 3300025263 Bacteria 4002
229 Ga0209565_1005084 3300025263 Bacteria 3878
230 Ga0209565_1007572 3300025263 Bacteria 2917
231 Ga0209455_1000011 3300025272 Bacteria 947242
232 Ga0209455_1000090 3300025272 Bacteria 223604
233 Ga0209455_1000217 3300025272 Bacteria 80610
234 Ga0209673_1000090 3300025273 Bacteria 202223
235 Ga0209673_1000098 3300025273 Bacteria 193352
236 Ga0209130_1000036 3300025284 Bacteria 284111
237 Ga0209130_1000836 3300025284 Bacteria 25748
238 Ga0209130_1001017 3300025284 Bacteria 21623
239 Ga0209130_1005479 3300025284 Bacteria 4382
240 Ga0209675_1000005 3300025291 Bacteria 849192
241 Ga0209675_1002548 3300025291 Bacteria 9256
242 Ga0209675_1007792 3300025291 Bacteria 4038
243 Ga0209675_1007799 3300025291 Bacteria 4035
244 Ga0209676_1000209 3300025292 Bacteria 130388
245 Ga0209676_1002330 3300025292 Bacteria 13739
246 Ga0209025_1000003 3300025294 Bacteria 1366495
247 Ga0209025_1000813 3300025294 Bacteria 50077
248 Ga0209025_1001297 3300025294 Bacteria 34120
249 Ga0209564_1000002 3300025295 Bacteria 1636803
250 Ga0209564_1000011 3300025295 Bacteria 822327
251 Ga0209564_1000078 3300025295 Bacteria 275766
252 Ga0209564_1000508 3300025295 Bacteria 63967
253 Ga0209564_1001781 3300025295 Bacteria 19938
254 Ga0209564_1003200 3300025295 Bacteria 11500
255 Ga0209564_1015094 3300025295 Bacteria 3163
256 Ga0209758_1000137 3300025297 Bacteria 176734
257 Ga0209758_1000625 3300025297 Bacteria 54181
258 Ga0209050_1000803 3300025298 Bacteria 44309
259 Ga0209050_1003876 3300025298 Bacteria 10626
260 Ga0209050_1008446 3300025298 Bacteria 5504
261 Ga0209256_1000070 3300025299 Bacteria 245034
262 Ga0209256_1000189 3300025299 Bacteria 117922
263 Ga0209256_1001219 3300025299 Bacteria 28671
264 Ga0209256_1004212 3300025299 Bacteria 9238
265 Ga0209256_1008141 3300025299 Bacteria 4935
266 Ga0207426_1000004 3300025302 Bacteria 1047900
267 Ga0207426_1001076 3300025302 Bacteria 25584
268 Ga0209051_1000156 3300025303 Bacteria 128246
269 Ga0209257_1000355 3300025304 Bacteria 93718
270 Ga0209257_1005802 3300025304 Bacteria 8395
271 Ga0207713_1002778 3300025735 Bacteria 12368
272 Ga0207647_10000268 3300025904 Bacteria 42845
273 Ga0207647_10002039 3300025904 Bacteria 15439
274 Ga0207647_10010211 3300025904 Bacteria 6633
275 Ga0207647_10031198 3300025904 Bacteria 3431
276 Ga0207705_10000507 3300025909 Bacteria 33098
277 Ga0207705_10003924 3300025909 Bacteria 11310
278 Ga0207705_10022476 3300025909 Bacteria 4497
279 Ga0207654_10017596 3300025911 Bacteria 3740
280 Ga0207695_10001731 3300025913 Bacteria 34763
281 Ga0207695_10002973 3300025913 Bacteria 24453
282 Ga0207695_10009514 3300025913 Bacteria 12018
283 Ga0207695_10204926 3300025913 Bacteria 1885
284 Ga0207671_10029941 3300025914 Bacteria 4062
285 Ga0207657_10000096 3300025919 Bacteria 85043
286 Ga0207657_10000131 3300025919 Bacteria 75479
287 Ga0207657_10093923 3300025919 Bacteria 2498
288 Ga0207649_10001200 3300025920 Bacteria 15627
289 Ga0207694_10003396 3300025924 Bacteria 12683
290 Ga0207690_10000074 3300025932 Bacteria 87516
291 Ga0207709_10000340 3300025935 Bacteria 48573
292 Ga0207709_10003792 3300025935 Bacteria 8878
293 Ga0207679_10000048 3300025945 Bacteria 119671
294 Ga0207679_10152488 3300025945 Bacteria 1883
295 Ga0207667_10002648 3300025949 Bacteria 22125
296 Ga0207667_10003392 3300025949 Bacteria 19655
297 Ga0207667_10005862 3300025949 Bacteria 14961
298 Ga0207667_10012499 3300025949 Bacteria 9773
299 Ga0207667_10179493 3300025949 Bacteria 2175
300 Ga0207640_10000056 3300025981 Bacteria 94316
301 Ga0207658_10038699 3300025986 Bacteria 3438
302 Ga0207678_10000044 3300026067 Bacteria 92689
303 Ga0207678_10000061 3300026067 Bacteria 85413
304 Ga0207702_10000118 3300026078 Bacteria 92740
305 Ga0207702_10157197 3300026078 Bacteria 2073
306 Ga0207674_10019497 3300026116 Bacteria 7344
307 Ga0207698_10030662 3300026142 Bacteria 3871
308 Ga0209371_1000141 3300027312 Bacteria 118767
309 Ga0268265_10125247 3300028380 Bacteria 2125
310 Ga0268256_1000205 3300030500 Bacteria 67044
311 Ga0265327_10000205 3300031251 Bacteria 123596
312 Ga0265316_10000005 3300031344 Bacteria 304442
313 Ga0265316_10075731 3300031344 Bacteria 2587
314 Ga0307408_100004943 3300031548 Bacteria 8962
315 Ga0307405_10127124 3300031731 Bacteria 1754
316 Ga0307518_10039321 3300031838 Bacteria 3439
317 Ga0307412_10000041 3300031911 Bacteria 179188
318 Ga0307412_10000129 3300031911 Bacteria 55318
319 Ga0307412_10005486 3300031911 Bacteria 7122
320 Ga0307416_100000430 3300032002 Bacteria 21423
321 Ga0307416_100006332 3300032002 Bacteria 7398
322 Ga0307414_10026340 3300032004 Bacteria 3741
323 Ga0373931_0010548 3300035691 Bacteria 4441
324 Ga0395899_0000008 3300037312 Bacteria 567572
325 Ga0395899_0030833 3300037312 Bacteria 4031
326 Ga0395899_0086569 3300037312 Bacteria 2275
327 Ga0395900_0000081 3300037418 Bacteria 174128
328 Ga0395900_0000253 3300037418 Bacteria 83308
329 Ga0395900_0000403 3300037418 Bacteria 62180
330 Ga0395900_0000852 3300037418 Bacteria 40196
331 Ga0395900_0002738 3300037418 Bacteria 19257
332 Ga0395900_0004089 3300037418 Bacteria 15554
333 Ga0395900_0013083 3300037418 Bacteria 8476
334 Ga0395900_0210135 3300037418 Bacteria 1965
335 Ga0395900_0238718 3300037418 Bacteria 1824
336 Ga0395898_0000119 3300037466 Bacteria 209937
337 Ga0395898_0001709 3300037466 Bacteria 29129
338 Ga0395898_0001722 3300037466 Bacteria 28960
339 Ga0395898_0003327 3300037466 Bacteria 18055
340 Ga0395898_0013903 3300037466 Bacteria 8272
341 Ga0395898_0132252 3300037466 Bacteria 2389
342 Ga0395898_0191237 3300037466 Bacteria 1955
343 Ga0395898_0311158 3300037466 Bacteria 1502
344 Ga0395905_0000103 3300037471 Bacteria 143491
345 Ga0395905_0005065 3300037471 Bacteria 13559
346 Ga0395905_0062048 3300037471 Bacteria 3496
347 Ga0395905_0137809 3300037471 Bacteria 2296
348 Ga0395905_0235727 3300037471 Bacteria 1710
349 Ga0395901_0000003 3300038443 Bacteria 701538
350 Ga0395901_0000083 3300038443 Bacteria 128816
351 Ga0395901_0000513 3300038443 Bacteria 44797
352 Ga0395901_0001547 3300038443 Bacteria 23837
353 Ga0395901_0051907 3300038443 Bacteria 4262
354 Ga0395901_0084725 3300038443 Bacteria 3312
355 Ga0395901_0087544 3300038443 Bacteria 3256
356 Ga0395901_0108385 3300038443 Bacteria 2916
357 Ga0395901_0111671 3300038443 Bacteria 2870
358 Ga0395901_0304951 3300038443 Bacteria 1650
359 Ga0400483_054056 3300039062 Bacteria 2986
360 Ga0439448_0001226 3300042005 Bacteria 6555
361 Ga0450904_000236 3300042139 Bacteria 12074
362 Ga0466969_0006601 3300044656 Bacteria 6168
363 Ga0466969_0009992 3300044656 Bacteria 5031
364 Ga0466969_0011180 3300044656 Bacteria 4752
365 Ga0466969_0067610 3300044656 Bacteria 1724
366 Ga0466972_0003987 3300044658 Bacteria 7354
367 Ga0466965_0000232 3300044683 Bacteria 17839
368 Ga0466965_0006542 3300044683 Bacteria 5302
369 Ga0466966_0000032 3300044684 Bacteria 102181
370 Ga0466966_0002601 3300044684 Bacteria 11834
371 Ga0466966_0011885 3300044684 Bacteria 5767
372 Ga0466966_0032793 3300044684 Bacteria 3362
373 Ga0466966_0067163 3300044684 Bacteria 2253
374 Ga0466961_0000657 3300044693 Bacteria 21722
375 Ga0466961_0020603 3300044693 Bacteria 4243
376 Ga0466961_0023220 3300044693 Bacteria 3989
377 Ga0466961_0026695 3300044693 Bacteria 3713
378 Ga0466961_0031539 3300044693 Bacteria 3407
379 Ga0466961_0035716 3300044693 Bacteria 3191
380 Ga0466961_0079650 3300044693 Bacteria 2074
381 Ga0466963_0002456 3300044694 Bacteria 10363
382 Ga0466963_0005994 3300044694 Bacteria 7163
383 Ga0466963_0007860 3300044694 Bacteria 6384
384 Ga0466964_0000065 3300044706 Bacteria 23014
385 Ga0466964_0000830 3300044706 Bacteria 10114
386 Ga0466964_0013794 3300044706 Bacteria 3068
387 Ga0466971_0005046 3300044719 Bacteria 5714
388 Ga0466971_0009656 3300044719 Bacteria 4210
389 Ga0466971_0078566 3300044719 Bacteria 1503
390 Ga0466968_0010197 3300044735 Bacteria 3635
391 Ga0466970_0012648 3300044765 Bacteria 4318
392 Ga0466957_0002651 3300044842 Bacteria 9653
393 Ga0466957_0006103 3300044842 Bacteria 6802
394 Ga0466957_0031806 3300044842 Bacteria 3156
395 Ga0466957_0038144 3300044842 Bacteria 2894
396 Ga0466959_0003280 3300045049 Bacteria 10550
397 Ga0466959_0005369 3300045049 Bacteria 8773
398 Ga0466959_0022443 3300045049 Bacteria 4666
399 Ga0466959_0038267 3300045049 Bacteria 3544
400 Ga0466959_0065456 3300045049 Bacteria 2637
401 Ga0466958_0000632 3300045836 Bacteria 15102
402 Ga0466958_0019247 3300045836 Bacteria 3973
403 Ga0466958_0022805 3300045836 Bacteria 3669
404 Ga0466958_0027455 3300045836 Bacteria 3369
405 Ga0466958_0065769 3300045836 Bacteria 2212
406 Ga0466958_0095685 3300045836 Bacteria 1841
407 Ga0466967_0004757 3300045976 Bacteria 9242
408 Ga0466967_0041485 3300045976 Bacteria 3968
409 Ga0495617_005442 3300046452 Bacteria 4511
410 Ga0495627_000163 3300046453 Bacteria 75819
411 Ga0495627_005823 3300046453 Bacteria 4903
412 Ga0495603_0005055 3300046455 Bacteria 7883
413 Ga0495590_0000001 3300046457 Bacteria 762984
414 Ga0495590_0000009 3300046457 Bacteria 320425
415 Ga0495590_0002335 3300046457 Bacteria 7885
416 Ga0495590_0009957 3300046457 Bacteria 3594
417 Ga0495590_0013310 3300046457 Bacteria 3028
418 Ga0495591_000408 3300046458 Bacteria 35919
419 Ga0495591_011800 3300046458 Bacteria 3285
420 Ga0495629_0000090 3300046459 Bacteria 80615
421 Ga0495638_0000017 3300046460 Bacteria 391117
422 Ga0495653_0000080 3300046463 Bacteria 80818
423 Ga0495653_0003933 3300046463 Bacteria 12013
424 Ga0495653_0024890 3300046463 Bacteria 4817
425 Ga0495653_0028956 3300046463 Bacteria 4427
426 Ga0495653_0037047 3300046463 Bacteria 3836
427 Ga0495653_0133635 3300046463 Bacteria 1753
428 Ga0495650_0000329 3300046471 Bacteria 84971
429 Ga0495650_0000382 3300046471 Bacteria 76019
430 Ga0495650_0000383 3300046471 Bacteria 75998
431 Ga0495650_0003397 3300046471 Bacteria 11653
432 Ga0495650_0006792 3300046471 Bacteria 7060
433 Ga0495650_0008810 3300046471 Bacteria 5830
434 Ga0495650_0011784 3300046471 Bacteria 4753
435 Ga0495650_0024388 3300046471 Bacteria 2857
436 Ga0495580_0019025 3300046472 Bacteria 5106
437 Ga0495580_0154293 3300046472 Bacteria 1590
438 Ga0495582_0001835 3300046473 Bacteria 11999
439 Ga0495582_0002030 3300046473 Bacteria 11346
440 Ga0495582_0007822 3300046473 Bacteria 5910
441 Ga0495605_0000381 3300046474 Bacteria 41604
442 Ga0495605_0002438 3300046474 Bacteria 11505
443 Ga0495605_0004462 3300046474 Bacteria 8209
444 Ga0495605_0008169 3300046474 Bacteria 5917
445 Ga0495605_0009224 3300046474 Bacteria 5545
446 Ga0495605_0010330 3300046474 Bacteria 5226
447 Ga0495605_0011069 3300046474 Bacteria 5039
448 Ga0495605_0021138 3300046474 Bacteria 3451
449 Ga0495605_0065624 3300046474 Bacteria 1726
450 Ga0495584_0000008 3300046491 Bacteria 283067
451 Ga0495584_0000107 3300046491 Bacteria 56834
452 Ga0495584_0000200 3300046491 Bacteria 42723
453 Ga0495584_0001991 3300046491 Bacteria 11751
454 Ga0495585_0000183 3300046492 Bacteria 66586
455 Ga0495585_0000401 3300046492 Bacteria 41899
456 Ga0495585_0001623 3300046492 Bacteria 17284
457 Ga0495585_0001858 3300046492 Bacteria 15964
458 Ga0495585_0002882 3300046492 Bacteria 11949
459 Ga0495585_0012144 3300046492 Bacteria 5080
460 Ga0495585_0029307 3300046492 Bacteria 3134
461 Ga0495585_0034945 3300046492 Bacteria 2841
462 Ga0495585_0052824 3300046492 Bacteria 2249
463 Ga0495585_0066000 3300046492 Bacteria 1982
464 Ga0495594_0011868 3300046499 Bacteria 4532
465 Ga0495596_0000097 3300046500 Bacteria 62327
466 Ga0495596_0000173 3300046500 Bacteria 44841
467 Ga0495596_0000829 3300046500 Bacteria 18702
468 Ga0495596_0003661 3300046500 Bacteria 7694
469 Ga0495596_0005978 3300046500 Bacteria 5675
470 Ga0495596_0008654 3300046500 Bacteria 4514
471 Ga0495596_0009533 3300046500 Bacteria 4268
472 Ga0495596_0017942 3300046500 Bacteria 2922
473 Ga0495596_0021653 3300046500 Bacteria 2621
474 Ga0495596_0023749 3300046500 Bacteria 2486
475 Ga0495596_0036320 3300046500 Bacteria 1952
476 Ga0495607_0000440 3300046501 Bacteria 41872
477 Ga0495607_0008109 3300046501 Bacteria 7211
478 Ga0495607_0008310 3300046501 Bacteria 7098
479 Ga0495607_0014693 3300046501 Bacteria 5089
480 Ga0495607_0023128 3300046501 Bacteria 3893
481 Ga0495607_0031500 3300046501 Bacteria 3246
482 Ga0495583_0000040 3300046506 Bacteria 236558
483 Ga0495583_0000270 3300046506 Bacteria 85327
484 Ga0495583_0000713 3300046506 Bacteria 42667
485 Ga0495583_0000836 3300046506 Bacteria 37615
486 Ga0495583_0000951 3300046506 Bacteria 33709
487 Ga0495583_0006232 3300046506 Bacteria 7849
488 Ga0495583_0009904 3300046506 Bacteria 5637
489 Ga0495583_0011989 3300046506 Bacteria 4939
490 Ga0495606_0000001 3300046507 Bacteria 592123
491 Ga0495606_0000232 3300046507 Bacteria 98402
492 Ga0495606_0000439 3300046507 Bacteria 68784
493 Ga0495606_0002884 3300046507 Bacteria 19011
494 Ga0495606_0003859 3300046507 Bacteria 15476
495 Ga0495606_0006853 3300046507 Bacteria 10399
496 Ga0495606_0018336 3300046507 Bacteria 5253
497 Ga0495606_0018465 3300046507 Bacteria 5227
498 Ga0495606_0023368 3300046507 Bacteria 4479
499 Ga0495606_0035630 3300046507 Bacteria 3399
500 Ga0495608_0044959 3300046511 Bacteria 2945
501 Ga0495610_0000003 3300046512 Bacteria 1203910
502 Ga0495610_0001429 3300046512 Bacteria 21119
503 Ga0495610_0001768 3300046512 Bacteria 18900
504 Ga0495610_0003238 3300046512 Bacteria 12876
505 Ga0495610_0014724 3300046512 Bacteria 4580
506 Ga0495610_0031372 3300046512 Bacteria 2773
507 Ga0495616_0000033 3300046513 Bacteria 130486
508 Ga0495616_0000291 3300046513 Bacteria 40582
509 Ga0495616_0002440 3300046513 Bacteria 12348
510 Ga0495616_0026570 3300046513 Bacteria 3079
511 Ga0495616_0030556 3300046513 Bacteria 2829
512 Ga0495616_0045517 3300046513 Bacteria 2220
513 Ga0495620_0020860 3300046515 Bacteria 3191
514 Ga0495620_0028877 3300046515 Bacteria 2573
515 Ga0495628_0105372 3300046516 Bacteria 2172
516 Ga0495631_0001793 3300046518 Bacteria 12729
517 Ga0495631_0004342 3300046518 Bacteria 7560
518 Ga0495631_0004577 3300046518 Bacteria 7339
519 Ga0495631_0005043 3300046518 Bacteria 6955
520 Ga0495631_0019315 3300046518 Bacteria 3196
521 Ga0495631_0026212 3300046518 Bacteria 2679
522 Ga0495631_0037971 3300046518 Bacteria 2143
523 Ga0495632_0000017 3300046519 Bacteria 228941
524 Ga0495632_0000823 3300046519 Bacteria 27328
525 Ga0495632_0000990 3300046519 Bacteria 24801
526 Ga0495632_0002935 3300046519 Bacteria 12508
527 Ga0495632_0009604 3300046519 Bacteria 5814
528 Ga0495632_0023517 3300046519 Bacteria 3290
529 Ga0495637_0000003 3300046520 Bacteria 623293
530 Ga0495637_0006168 3300046520 Bacteria 6030
531 Ga0495643_0000235 3300046522 Bacteria 83550
532 Ga0495643_0000426 3300046522 Bacteria 54838
533 Ga0495643_0001320 3300046522 Bacteria 23471
534 Ga0495643_0002034 3300046522 Bacteria 16827
535 Ga0495643_0092885 3300046522 Bacteria 1554
536 Ga0495644_0000762 3300046523 Bacteria 13257
537 Ga0495644_0001143 3300046523 Bacteria 10893
538 Ga0495644_0004703 3300046523 Bacteria 5366
539 Ga0495644_0005347 3300046523 Bacteria 5015
540 Ga0495644_0009951 3300046523 Bacteria 3663
541 Ga0495644_0013673 3300046523 Bacteria 3113
542 Ga0495648_0000030 3300046524 Bacteria 216178
543 Ga0495648_0000040 3300046524 Bacteria 184782
544 Ga0495648_0000829 3300046524 Bacteria 32659
545 Ga0495648_0004238 3300046524 Bacteria 12312
546 Ga0495648_0005529 3300046524 Bacteria 10487
547 Ga0495648_0010515 3300046524 Bacteria 7040
548 Ga0495648_0016317 3300046524 Bacteria 5359
549 Ga0495648_0019883 3300046524 Bacteria 4702
550 Ga0495648_0070445 3300046524 Bacteria 2031
551 Ga0495648_0085729 3300046524 Bacteria 1778
552 Ga0495663_0001841 3300046525 Bacteria 6539
553 Ga0495663_0002010 3300046525 Bacteria 6251
554 Ga0495666_0000765 3300046526 Bacteria 14832
555 Ga0495666_0016240 3300046526 Bacteria 3708
556 Ga0495642_0000073 3300046528 Bacteria 59175
557 Ga0495642_0000751 3300046528 Bacteria 15961
558 Ga0495642_0001577 3300046528 Bacteria 9983
559 Ga0495642_0006748 3300046528 Bacteria 4400
560 Ga0495642_0016989 3300046528 Bacteria 2840
561 Ga0495642_0019114 3300046528 Bacteria 2683
562 Ga0495642_0023960 3300046528 Bacteria 2413
563 Ga0495652_0002797 3300046529 Bacteria 17608
564 Ga0495652_0009813 3300046529 Bacteria 8680
565 Ga0495652_0012823 3300046529 Bacteria 7549
566 Ga0495654_0004709 3300046530 Bacteria 8037
567 Ga0495654_0026037 3300046530 Bacteria 3011
568 Ga0495665_0004698 3300046531 Bacteria 7365
569 Ga0495665_0072900 3300046531 Bacteria 1808
570 Ga0495586_0003117 3300046535 Bacteria 8927
571 Ga0495586_0055206 3300046535 Bacteria 2153
572 Ga0495609_0000423 3300046538 Bacteria 35296
573 Ga0495609_0003820 3300046538 Bacteria 8469
574 Ga0495609_0007571 3300046538 Bacteria 5399
575 Ga0495609_0014124 3300046538 Bacteria 3759
576 Ga0495609_0029967 3300046538 Bacteria 2476
577 Ga0495609_0033147 3300046538 Bacteria 2345
578 Ga0495609_0061304 3300046538 Bacteria 1662
579 Ga0495597_0000247 3300046542 Bacteria 49379
580 Ga0495597_0000483 3300046542 Bacteria 33315
581 Ga0495597_0001404 3300046542 Bacteria 17390
582 Ga0495597_0001505 3300046542 Bacteria 16648
583 Ga0495597_0003476 3300046542 Bacteria 9149
584 Ga0495597_0012187 3300046542 Bacteria 4154
585 Ga0495597_0022828 3300046542 Bacteria 2898
586 Ga0495597_0030115 3300046542 Bacteria 2475
587 Ga0495645_0004925 3300046543 Bacteria 9135
588 Ga0495645_0082012 3300046543 Bacteria 2313
589 Ga0495622_0001354 3300046557 Bacteria 12531
590 Ga0495633_0000141 3300046558 Bacteria 95989
591 Ga0495633_0000946 3300046558 Bacteria 24324
592 Ga0495633_0000972 3300046558 Bacteria 23529
593 Ga0495633_0001595 3300046558 Bacteria 17190
594 Ga0495633_0024055 3300046558 Bacteria 3013
595 Ga0495633_0043931 3300046558 Bacteria 2119
596 Ga0495633_0098395 3300046558 Bacteria 1358
597 Ga0495656_0010009 3300046615 Bacteria 3432
598 Ga0495656_0039179 3300046615 Bacteria 1967
599 Ga0495668_0000372 3300046616 Bacteria 59316
600 Ga0495668_0001345 3300046616 Bacteria 24163
601 Ga0495668_0001521 3300046616 Bacteria 22039
602 Ga0495668_0004172 3300046616 Bacteria 10424
603 Ga0495668_0004350 3300046616 Bacteria 10119
604 Ga0495668_0005221 3300046616 Bacteria 8906
605 Ga0495668_0010629 3300046616 Bacteria 5562
606 Ga0495668_0016996 3300046616 Bacteria 4225
607 Ga0495668_0036248 3300046616 Bacteria 2763
608 Ga0495668_0057794 3300046616 Bacteria 2140
609 Ga0495668_0107379 3300046616 Bacteria 1526
610 Ga0495634_0029714 3300046642 Bacteria 3782
611 Ga0495611_0000714 3300046648 Bacteria 18780
612 Ga0495611_0001185 3300046648 Bacteria 13536
613 Ga0495611_0001563 3300046648 Bacteria 11213
614 Ga0495611_0036042 3300046648 Bacteria 2193
615 Ga0495625_0000244 3300046660 Bacteria 85455
616 Ga0495625_0002740 3300046660 Bacteria 18658
617 Ga0495625_0003610 3300046660 Bacteria 15197
618 Ga0495625_0022739 3300046660 Bacteria 4801
619 Ga0495625_0028510 3300046660 Bacteria 4187
620 Ga0495625_0040382 3300046660 Bacteria 3404
621 Ga0495625_0085898 3300046660 Bacteria 2183
622 Ga0495625_0094102 3300046660 Bacteria 2068
623 Ga0495635_0006603 3300046663 Bacteria 8097
624 Ga0495659_0000213 3300046664 Bacteria 24899
625 Ga0495661_0000457 3300046665 Bacteria 43317
626 Ga0495661_0001600 3300046665 Bacteria 18619
627 Ga0495661_0003470 3300046665 Bacteria 11633
628 Ga0495661_0029166 3300046665 Bacteria 3524
629 Ga0495661_0037113 3300046665 Bacteria 3044
630 Ga0495661_0046283 3300046665 Bacteria 2657
631 Ga0495661_0051845 3300046665 Bacteria 2475
632 Ga0495661_0063319 3300046665 Bacteria 2187
633 Ga0495661_0084164 3300046665 Bacteria 1826
634 Ga0495661_0086479 3300046665 Bacteria 1794
635 Ga0495588_0000201 3300046674 Bacteria 59959
636 Ga0495588_0005834 3300046674 Bacteria 5510
637 Ga0495588_0012958 3300046674 Bacteria 3958
638 Ga0495599_0016623 3300046678 Bacteria 4568
639 Ga0495599_0049812 3300046678 Bacteria 2625
640 Ga0495623_0006865 3300046679 Bacteria 7403
641 Ga0495623_0100419 3300046679 Bacteria 1763
642 Ga0495646_0013320 3300046680 Bacteria 5225
643 Ga0495669_0000015 3300046684 Bacteria 140309
644 Ga0495669_0000391 3300046684 Bacteria 21822
645 Ga0495669_0001817 3300046684 Bacteria 8723
646 Ga0495669_0002273 3300046684 Bacteria 7883
647 Ga0495669_0012062 3300046684 Bacteria 3674
648 Ga0495624_0004165 3300046690 Bacteria 10626
649 Ga0495670_0000086 3300046691 Bacteria 41361
650 Ga0495670_0000352 3300046691 Bacteria 22004
651 Ga0495670_0006247 3300046691 Bacteria 5846
652 Ga0495670_0010083 3300046691 Bacteria 4645
653 Ga0495670_0031136 3300046691 Bacteria 2651
654 Ga0495671_0000270 3300046692 Bacteria 43565
655 Ga0495671_0000657 3300046692 Bacteria 25047
656 Ga0495671_0007692 3300046692 Bacteria 6119
657 Ga0495671_0067179 3300046692 Bacteria 1763
658 Ga0495649_0000581 3300046694 Bacteria 30656
659 Ga0495649_0000879 3300046694 Bacteria 24095
660 Ga0495649_0010065 3300046694 Bacteria 5590
661 Ga0495649_0021523 3300046694 Bacteria 3611
662 Ga0495649_0024087 3300046694 Bacteria 3397
663 Ga0495589_0000584 3300046794 Bacteria 25027
664 Ga0495589_0001008 3300046794 Bacteria 17087
665 Ga0495589_0003363 3300046794 Bacteria 8674
666 Ga0495589_0004556 3300046794 Bacteria 7363
667 Ga0495589_0007375 3300046794 Bacteria 5758
668 Ga0495589_0019052 3300046794 Bacteria 3520
669 Ga0495600_0003391 3300046809 Bacteria 9375
670 Ga0495660_0000079 3300046810 Bacteria 104002
671 Ga0495660_0006719 3300046810 Bacteria 6795
672 Ga0495660_0018979 3300046810 Bacteria 3948
673 Ga0495660_0026790 3300046810 Bacteria 3264
674 Ga0495581_0001752 3300047315 Bacteria 12110
675 Ga0495581_0014849 3300047315 Bacteria 4517
676 Ga0495604_0008524 3300047317 Bacteria 8095
677 Ga0495604_0070383 3300047317 Bacteria 2649
678 Ga0495604_0120124 3300047317 Bacteria 1903
679 Ga0495636_0013452 3300047318 Bacteria 3248
680 Ga0495636_0021727 3300047318 Bacteria 2592
681 Ga0495674_0013974 3300047319 Bacteria 7530
682 Ga0495672_0000021 3300047320 Bacteria 422795
683 Ga0495672_0000169 3300047320 Bacteria 94803
684 Ga0495672_0000257 3300047320 Bacteria 74176
685 Ga0495672_0000338 3300047320 Bacteria 60333
686 Ga0495672_0000597 3300047320 Bacteria 40721
687 Ga0495672_0001037 3300047320 Bacteria 28565
688 Ga0495672_0001684 3300047320 Bacteria 21407
689 Ga0495672_0007377 3300047320 Bacteria 8280
690 Ga0495672_0016952 3300047320 Bacteria 4882
691 Ga0495672_0030583 3300047320 Bacteria 3375
692 Ga0495676_0000054 3300047321 Bacteria 93905
693 Ga0495676_0022324 3300047321 Bacteria 5507
694 Ga0495680_0007534 3300047322 Bacteria 9957
695 Ga0495683_0000178 3300047323 Bacteria 62322
696 Ga0495683_0001403 3300047323 Bacteria 15901
697 Ga0495683_0001893 3300047323 Bacteria 13101
698 Ga0495683_0002625 3300047323 Bacteria 10747
699 Ga0495683_0024724 3300047323 Bacteria 3081
700 Ga0495683_0029098 3300047323 Bacteria 2823
701 Ga0495687_000036 3300047443 Bacteria 255427
702 Ga0495687_000355 3300047443 Bacteria 58149
703 Ga0495687_000534 3300047443 Bacteria 45469
704 Ga0495687_001518 3300047443 Bacteria 21170
705 Ga0495687_051433 3300047443 Bacteria 1748
706 Ga0495675_0008686 3300047444 Bacteria 6301
707 Ga0495675_0036251 3300047444 Bacteria 3146
708 Ga0495675_0040703 3300047444 Bacteria 2961
709 Ga0495677_0000122 3300047445 Bacteria 37378
710 Ga0495677_0005046 3300047445 Bacteria 5031
711 Ga0495677_0005707 3300047445 Bacteria 4716
712 Ga0495677_0009020 3300047445 Bacteria 3689
713 Ga0495677_0009264 3300047445 Bacteria 3638
714 Ga0495677_0010216 3300047445 Bacteria 3450
715 Ga0495677_0015528 3300047445 Bacteria 2766
716 Ga0495677_0016615 3300047445 Bacteria 2671
717 Ga0495679_000026 3300047446 Bacteria 196639
718 Ga0495679_001146 3300047446 Bacteria 15850
719 Ga0495679_005844 3300047446 Bacteria 5402
720 Ga0495679_015417 3300047446 Bacteria 2796
721 Ga0495679_029447 3300047446 Bacteria 1791
722 Ga0495685_003023 3300047447 Bacteria 5325
723 Ga0495685_006634 3300047447 Bacteria 3798
724 Ga0495673_0000016 3300047469 Bacteria 580643
725 Ga0495673_0000159 3300047469 Bacteria 116007
726 Ga0495681_0000731 3300047470 Bacteria 25243
727 Ga0495681_0002909 3300047470 Bacteria 12101
728 Ga0495681_0008490 3300047470 Bacteria 6438
729 Ga0495681_0029707 3300047470 Bacteria 2794
730 Ga0495681_0048893 3300047470 Bacteria 2002
731 Ga0495686_0000148 3300047472 Bacteria 137236
732 Ga0495686_0000211 3300047472 Bacteria 107517
733 Ga0495686_0009680 3300047472 Bacteria 6919
734 Ga0495686_0023034 3300047472 Bacteria 4114
735 Ga0495593_0003070 3300047673 Bacteria 10053
736 Ga0495593_0010156 3300047673 Bacteria 5448
737 Ga0495602_0020757 3300048088 Bacteria 6486
738 Ga0495602_0065168 3300048088 Bacteria 3145
739 Ga0495602_0122255 3300048088 Bacteria 2092
740 Ga0495602_0248407 3300048088 Bacteria 1327
741 Ga0495614_0000395 3300048089 Bacteria 17725
742 Ga0495614_0024192 3300048089 Bacteria 2622
743 Ga0495615_0000319 3300048090 Bacteria 8144
744 Ga0495615_0014910 3300048090 Bacteria 1651
745 Ga0495626_0000005 3300048091 Bacteria 337534
746 Ga0495626_0000628 3300048091 Bacteria 34342
747 Ga0495626_0001481 3300048091 Bacteria 18515
748 Ga0495626_0001680 3300048091 Bacteria 17051
749 Ga0495626_0002332 3300048091 Bacteria 13395
750 Ga0495626_0003666 3300048091 Bacteria 9746
751 Ga0495626_0010953 3300048091 Bacteria 4815
752 Ga0495626_0014800 3300048091 Bacteria 4009
753 Ga0495626_0015051 3300048091 Bacteria 3965
754 Ga0495626_0021688 3300048091 Bacteria 3182
755 Ga0495626_0023343 3300048091 Bacteria 3046
756 Ga0495626_0032541 3300048091 Bacteria 2504
757 Ga0495626_0039082 3300048091 Bacteria 2247
758 Ga0496100_0007037 3300048903 Bacteria 6171
759 Ga0496100_0043006 3300048903 Bacteria 2887
760 Ga0496101_0010110 3300048904 Bacteria 6222
761 Ga0496101_0015756 3300048904 Bacteria 5102
762 Ga0496102_0000113 3300048905 Bacteria 114531
763 Ga0496102_0000498 3300048905 Bacteria 43162
764 Ga0496102_0019184 3300048905 Bacteria 6020
765 Ga0496103_0013324 3300048906 Bacteria 4873
766 Ga0496106_0000824 3300048909 Bacteria 22499
767 Ga0496107_0115002 3300048910 Bacteria 1980
768 Ga0496109_0005364 3300048912 Bacteria 10719
769 Ga0496110_0052338 3300048913 Bacteria 3588
770 Ga0496111_0022480 3300048914 Bacteria 4416
771 Ga0496113_0016054 3300048916 Bacteria 5167
772 Ga0496113_0018812 3300048916 Bacteria 4818
773 Ga0496115_0034652 3300048918 Bacteria 3990
774 Ga0496116_0003023 3300048919 Bacteria 17032
775 Ga0496116_0085350 3300048919 Bacteria 1941
776 Ga0496117_0000045 3300048920 Bacteria 301047
777 Ga0496117_0019031 3300048920 Bacteria 5657
778 Ga0496117_0027464 3300048920 Bacteria 4435
779 Ga0496118_0000041 3300048921 Bacteria 301047
780 Ga0496118_0002435 3300048921 Bacteria 25049
781 Ga0496118_0003719 3300048921 Bacteria 18884
782 Ga0496118_0006458 3300048921 Bacteria 12874
783 Ga0496118_0013894 3300048921 Bacteria 7574
784 Ga0496118_0043171 3300048921 Bacteria 3548
785 Ga0496119_0004603 3300048922 Bacteria 13617
786 Ga0496119_0064249 3300048922 Bacteria 2180
787 Ga0496120_0007098 3300048923 Bacteria 8404
788 Ga0496121_0000394 3300048924 Bacteria 88832
789 Ga0496121_0001068 3300048924 Bacteria 48493
790 Ga0496121_0002658 3300048924 Bacteria 26800
791 Ga0496121_0005839 3300048924 Bacteria 15603
792 Ga0496122_0000046 3300048925 Bacteria 274640
793 Ga0496122_0000483 3300048925 Bacteria 82763
794 Ga0496122_0001428 3300048925 Bacteria 38705
795 Ga0496122_0007303 3300048925 Bacteria 12340
796 Ga0496122_0031253 3300048925 Bacteria 4437
797 Ga0496122_0033799 3300048925 Bacteria 4199
798 Ga0496122_0117249 3300048925 Bacteria 1729
799 Ga0496123_0000082 3300048926 Bacteria 188909
800 Ga0496123_0000902 3300048926 Bacteria 46987
801 Ga0496123_0004370 3300048926 Bacteria 14921
802 Ga0496123_0012571 3300048926 Bacteria 7205
803 Ga0496123_0018336 3300048926 Bacteria 5572
804 Ga0496124_0007777 3300048927 Bacteria 11324
805 Ga0496124_0018293 3300048927 Bacteria 6566
806 Ga0496124_0020870 3300048927 Bacteria 6043
807 Ga0496124_0060810 3300048927 Bacteria 3168
808 Ga0496124_0110323 3300048927 Bacteria 2215
809 Ga0496124_0196259 3300048927 Bacteria 1539
810 Ga0496125_0000095 3300048928 Bacteria 208094
811 Ga0496125_0005271 3300048928 Bacteria 14479
812 Ga0496125_0010565 3300048928 Bacteria 9331
813 Ga0496126_0002836 3300048929 Bacteria 22693
814 Ga0496126_0042637 3300048929 Bacteria 4190
815 Ga0496126_0055371 3300048929 Bacteria 3589
816 Ga0496126_0095407 3300048929 Bacteria 2609
817 Ga0501308_001075 3300049128 Bacteria 2074
818 Ga0495678_000117 3300049459 Bacteria 94597
819 Ga0495678_000342 3300049459 Bacteria 48420
820 Ga0495678_001541 3300049459 Bacteria 17802
821 Ga0495678_002185 3300049459 Bacteria 13736
822 Ga0495678_016566 3300049459 Bacteria 3365
823 Ga0501315_001166 3300049531 Bacteria 2156
824 Ga0501227_001706 3300049665 Bacteria 4872
825 Ga0501269_000438 3300049766 Bacteria 9298
826 Ga0501279_001239 3300049775 Bacteria 3354
827 Ga0501035_0001236 3300049822 Bacteria 26534
828 nmdc:mga0k408_13225_c1 3300050493 Bacteria 4523
829 nmdc:mga0k408_837_c1 3300050493 Bacteria 16976
830 nmdc:mga07m45_4736_c1 3300050496 Bacteria 6684
831 Ga0500586_007502 3300053145 Bacteria 2913
832 Ga0587083_0000406 3300059505 Bacteria 3706
833 Ga0587091_006249 3300059511 Bacteria 1664
834 Ga0587067_000155 3300059640 Bacteria 4821
835 Ga0587072_000294 3300059643 Bacteria 4658
836 Ga0466962_0010276 3300061719 Bacteria 4494

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0210135 Ga0395900_0210135_774_1919 381
2 3300025920 Ga0207649_10001200 Ga0207649_1000120011 390
3 3300037471 Ga0395905_0137809 Ga0395905_0137809_17_1219 400
4 3300038443 Ga0395901_0304951 Ga0395901_0304951_420_1637 400
5 3300046507 Ga0495606_0002884 Ga0495606_0002884_6296_7510 402
6 3300046518 Ga0495631_0037971 Ga0495631_0037971_623_1837 402
7 3300046558 Ga0495633_0098395 Ga0495633_0098395_107_1321 402
8 3300046616 Ga0495668_0016996 Ga0495668_0016996_524_1738 402
9 3300046665 Ga0495661_0084164 Ga0495661_0084164_319_1533 402
10 3300048088 Ga0495602_0248407 Ga0495602_0248407_97_1317 403
11 3300046474 Ga0495605_0065624 Ga0495605_0065624_502_1716 404
12 3300046616 Ga0495668_0107379 Ga0495668_0107379_297_1511 404
13 iso_pu_bacteria 2858950400 2858955040 410
14 3300045836 Ga0466958_0095685 Ga0466958_0095685_30_1277 415
15 3300046538 Ga0495609_0029967 Ga0495609_0029967_1189_2445 418
16 3300032002 Ga0307416_100006332 Ga0307416_1000063322 419
17 3300046458 Ga0495591_011800 Ga0495591_011800_1671_3008 426
18 3300046474 Ga0495605_0010330 Ga0495605_0010330_2259_3596 426
19 3300046501 Ga0495607_0014693 Ga0495607_0014693_1666_3003 426
20 3300046507 Ga0495606_0023368 Ga0495606_0023368_463_1800 426
21 3300046519 Ga0495632_0023517 Ga0495632_0023517_1874_3211 426
22 3300046523 Ga0495644_0001143 Ga0495644_0001143_1453_2790 426
23 3300046538 Ga0495609_0007571 Ga0495609_0007571_3607_4944 426
24 3300046616 Ga0495668_0010629 Ga0495668_0010629_2671_4008 426
25 3300046665 Ga0495661_0029166 Ga0495661_0029166_1926_3263 426
26 3300046684 Ga0495669_0001817 Ga0495669_0001817_3745_5082 426
27 3300046691 Ga0495670_0010083 Ga0495670_0010083_2461_3798 426
28 3300047323 Ga0495683_0029098 Ga0495683_0029098_277_1614 426
29 3300047447 Ga0495685_006634 Ga0495685_006634_42_1379 426
30 3300048091 Ga0495626_0021688 Ga0495626_0021688_1082_2419 426
31 3300048091 Ga0495626_0039082 Ga0495626_0039082_681_2021 427
32 3300048905 Ga0496102_0000498 Ga0496102_0000498_37470_38807 429
33 3300047318 Ga0495636_0021727 Ga0495636_0021727_1013_2353 430
34 iso_pu_bacteria 2900634093 2900641262 430
35 3300003323 rootH1_10211972 rootH1_102119721 432
36 3300031251 Ga0265327_10000205 Ga0265327_10000205106 432
37 3300032004 Ga0307414_10026340 Ga0307414_100263403 432
38 3300037471 Ga0395905_0005065 Ga0395905_0005065_3373_4734 434
39 3300046529 Ga0495652_0002797 Ga0495652_0002797_6633_7937 434
40 3300046543 Ga0495645_0004925 Ga0495645_0004925_2786_4090 434
41 3300048919 Ga0496116_0003023 Ga0496116_0003023_3122_4429 434
42 3300048925 Ga0496122_0000046 Ga0496122_0000046_142617_143924 434
43 3300048926 Ga0496123_0000082 Ga0496123_0000082_104513_105820 434
44 3300048928 Ga0496125_0010565 Ga0496125_0010565_1688_2995 434
45 3300048929 Ga0496126_0095407 Ga0496126_0095407_1177_2484 434
46 3300046471 Ga0495650_0024388 Ga0495650_0024388_1318_2655 435
47 3300046506 Ga0495583_0009904 Ga0495583_0009904_916_2253 435
48 3300047470 Ga0495681_0000731 Ga0495681_0000731_8279_9616 435
49 3300048918 Ga0496115_0034652 Ga0496115_0034652_1321_2658 435
50 3300048921 Ga0496118_0013894 Ga0496118_0013894_3032_4342 435
51 3300048922 Ga0496119_0004603 Ga0496119_0004603_6778_8088 435
52 3300048923 Ga0496120_0007098 Ga0496120_0007098_5848_7158 435
53 3300048924 Ga0496121_0000394 Ga0496121_0000394_46365_47675 435
54 3300048927 Ga0496124_0196259 Ga0496124_0196259_154_1464 435
55 3300048928 Ga0496125_0000095 Ga0496125_0000095_116984_118294 435
56 3300048929 Ga0496126_0042637 Ga0496126_0042637_797_2107 435
57 3300037418 Ga0395900_0000253 Ga0395900_0000253_12259_13608 436
58 3300037466 Ga0395898_0001722 Ga0395898_0001722_13615_14964 436
59 3300031344 Ga0265316_10000005 Ga0265316_1000000577 437
60 3300002738 JGI25154J39366_1000688 JGI25154J39366_10006888 438
61 3300025246 Ga0209646_1000023 Ga0209646_1000023181 438
62 3300046507 Ga0495606_0000232 Ga0495606_0000232_41426_42778 439
63 iso_pu_bacteria 2821131069 2821132021 439
64 3300025945 Ga0207679_10152488 Ga0207679_101524882 440
65 3300044706 Ga0466964_0000065 Ga0466964_0000065_2842_4203 440
66 3300045976 Ga0466967_0041485 Ga0466967_0041485_155_1516 440
67 3300048920 Ga0496117_0027464 Ga0496117_0027464_1009_2334 440
68 3300048921 Ga0496118_0006458 Ga0496118_0006458_8020_9345 440
69 3300048922 Ga0496119_0064249 Ga0496119_0064249_34_1359 440
70 3300046543 Ga0495645_0082012 Ga0495645_0082012_422_1783 441
71 iso_pu_bacteria 2643221556 2643798741 441
72 iso_pu_bacteria 2643221684 2644471162 441
73 iso_pu_bacteria 2738541297 2738830089 441
74 iso_pu_bacteria 2738541357 2739153885 441
75 iso_pu_bacteria 2738543003 2739195805 441
76 iso_pu_bacteria 2738543026 2739322281 441
77 iso_pu_bacteria 2738543029 2739340522 441
78 iso_pu_bacteria 8047673197 8047678309 441
79 3300037466 Ga0395898_0132252 Ga0395898_0132252_454_1797 442
80 3300042005 Ga0439448_0001226 Ga0439448_0001226_4109_5497 442
81 3300045976 Ga0466967_0004757 Ga0466967_0004757_7350_8693 442
82 3300046472 Ga0495580_0154293 Ga0495580_0154293_12_1340 442
83 3300048910 Ga0496107_0115002 Ga0496107_0115002_508_1851 442
84 iso_pu_bacteria 2643221554 2643789370 442
85 iso_pu_bacteria 2643221638 2644216165 442
86 iso_pu_bacteria 2643221645 2644253165 442
87 iso_pu_bacteria 2738541280 2738742154 442
88 iso_pu_bacteria 2738541300 2738841319 442
89 iso_pu_bacteria 2738543018 2739272189 442
90 iso_pu_bacteria 2738543030 2739341233 442
91 iso_pu_bacteria 2808606418 2809146264 442
92 iso_pu_bacteria 2842711865 2842712733 442
93 3300005563 Ga0068855_100018234 Ga0068855_1000182345 443
94 3300044719 Ga0466971_0078566 Ga0466971_0078566_15_1346 443
95 3300046507 Ga0495606_0000001 Ga0495606_0000001_475176_476507 443
96 3300046522 Ga0495643_0092885 Ga0495643_0092885_21_1412 443
97 3300046558 Ga0495633_0024055 Ga0495633_0024055_39_1370 443
98 3300046616 Ga0495668_0001521 Ga0495668_0001521_4851_6182 443
99 3300047472 Ga0495686_0009680 Ga0495686_0009680_4216_5547 443
100 iso_pu_bacteria 2513237166 2514052178 443
101 iso_pu_bacteria 2599185292 2599905536 443
102 iso_pu_bacteria 2643221594 2643982226 443
103 iso_pu_bacteria 2765235838 2765569479 443
104 iso_pu_bacteria 2808606395 2809034340 443
105 iso_pu_bacteria 2839094727 2839095653 443
106 iso_pu_bacteria 2855730933 2855736772 443
107 iso_pu_bacteria 2855767633 2855773709 443
108 iso_pu_bacteria 2881412998 2881417545 443
109 iso_pu_bacteria 2919046199 2919049121 443
110 iso_pu_bacteria 2941479691 2941480121 443
111 3300025233 Ga0209437_102620 Ga0209437_1026202 444
112 3300046457 Ga0495590_0013310 Ga0495590_0013310_867_2213 444
113 3300046463 Ga0495653_0000080 Ga0495653_0000080_72422_73762 444
114 3300046463 Ga0495653_0133635 Ga0495653_0133635_79_1416 444
115 3300046500 Ga0495596_0009533 Ga0495596_0009533_2241_3587 444
116 3300046506 Ga0495583_0006232 Ga0495583_0006232_542_1888 444
117 3300046507 Ga0495606_0000439 Ga0495606_0000439_24275_25615 444
118 3300046518 Ga0495631_0001793 Ga0495631_0001793_6260_7606 444
119 3300046520 Ga0495637_0006168 Ga0495637_0006168_3201_4547 444
120 3300046524 Ga0495648_0010515 Ga0495648_0010515_5259_6602 444
121 3300046542 Ga0495597_0000247 Ga0495597_0000247_46430_47776 444
122 3300046542 Ga0495597_0001404 Ga0495597_0001404_7351_8694 444
123 3300046616 Ga0495668_0005221 Ga0495668_0005221_6306_7652 444
124 3300046660 Ga0495625_0003610 Ga0495625_0003610_6277_7623 444
125 3300046692 Ga0495671_0007692 Ga0495671_0007692_358_1704 444
126 3300046794 Ga0495589_0000584 Ga0495589_0000584_5915_7261 444
127 3300047443 Ga0495687_001518 Ga0495687_001518_6122_7468 444
128 3300047446 Ga0495679_001146 Ga0495679_001146_8346_9692 444
129 3300047447 Ga0495685_003023 Ga0495685_003023_1413_2759 444
130 3300048091 Ga0495626_0002332 Ga0495626_0002332_874_2217 444
131 3300048925 Ga0496122_0031253 Ga0496122_0031253_1797_3137 444
132 3300048926 Ga0496123_0018336 Ga0496123_0018336_2423_3763 444
133 3300049459 Ga0495678_000342 Ga0495678_000342_5920_7266 444
134 iso_pu_bacteria 2513237150 2513952383 444
135 iso_pu_bacteria 2513237151 2513961752 444
136 iso_pu_bacteria 2513237165 2514041728 444
137 iso_pu_bacteria 2515154123 2515688680 444
138 iso_pu_bacteria 2515154189 2516022503 444
139 iso_pu_bacteria 2519103095 2519457616 444
140 iso_pu_bacteria 2521172590 2521559991 444
141 iso_pu_bacteria 2526164713 2527078402 444
142 iso_pu_bacteria 2582581311 2585294062 444
143 iso_pu_bacteria 2596583598 2597030585 444
144 iso_pu_bacteria 2599185178 2599447899 444
145 iso_pu_bacteria 2599185239 2599741139 444
146 iso_pu_bacteria 2599185240 2599747694 444
147 iso_pu_bacteria 2599185355 2600209699 444
148 iso_pu_bacteria 2600255067 2600812296 444
149 iso_pu_bacteria 2600255292 2601668972 444
150 iso_pu_bacteria 2675903129 2676745876 444
151 iso_pu_bacteria 2738541296 2738823567 444
152 iso_pu_bacteria 2738541298 2738835958 444
153 iso_pu_bacteria 2738541306 2738877435 444
154 iso_pu_bacteria 2738543002 2739189141 444
155 iso_pu_bacteria 2738543008 2739224028 444
156 iso_pu_bacteria 2744054900 2746091573 444
157 iso_pu_bacteria 2744054901 2746099272 444
158 iso_pu_bacteria 2808606384 2808972939 444
159 iso_pu_bacteria 2808606390 2809007896 444
160 iso_pu_bacteria 2808606391 2809015464 444
161 iso_pu_bacteria 2816332253 2817259813 444
162 iso_pu_bacteria 2816332256 2817277475 444
163 iso_pu_bacteria 2816332286 2817456606 444
164 iso_pu_bacteria 2818991450 2819624399 444
165 iso_pu_bacteria 2818991452 2819636994 444
166 iso_pu_bacteria 2834641062 2834642086 444
167 iso_pu_bacteria 2842324504 2842330321 444
168 iso_pu_bacteria 2842348783 2842355062 444
169 iso_pu_bacteria 2842454564 2842460378 444
170 iso_pu_bacteria 2856287931 2856289103 444
171 iso_pu_bacteria 2857357740 2857358652 444
172 iso_pu_bacteria 2857547612 2857551314 444
173 iso_pu_bacteria 2857558681 2857564493 444
174 iso_pu_bacteria 2863421361 2863426405 444
175 iso_pu_bacteria 2870068957 2870069290 444
176 iso_pu_bacteria 2883087390 2883089855 444
177 iso_pu_bacteria 2904424332 2904425202 444
178 iso_pu_bacteria 2904434214 2904436393 444
179 iso_pu_bacteria 2904483920 2904489795 444
180 iso_pu_bacteria 2904564687 2904569482 444
181 iso_pu_bacteria 2904571731 2904576681 444
182 iso_pu_bacteria 2919476304 2919477900 444
183 iso_pu_bacteria 2919527303 2919532861 444
184 iso_pu_bacteria 2928058823 2928058917 444
185 iso_pu_bacteria 2928108538 2928111717 444
186 iso_pu_bacteria 2928135762 2928138957 444
187 iso_pu_bacteria 2928157003 2928163146 444
188 iso_pu_bacteria 2928163908 2928170106 444
189 iso_pu_bacteria 2928170801 2928176217 444
190 iso_pu_bacteria 2928503688 2928509862 444
191 iso_pu_bacteria 2928536128 2928542103 444
192 iso_pu_bacteria 2932410948 2932416458 444
193 iso_pu_bacteria 2932416698 2932417141 444
194 iso_pu_bacteria 2945909444 2945914724 444
195 iso_pu_bacteria 2945934425 2945939822 444
196 iso_pu_bacteria 2945984333 2945989870 444
197 iso_pu_bacteria 2981990288 2981995999 444
198 iso_pu_bacteria 2990703756 2990706943 444
199 iso_pu_bacteria 641736154 642415937 444
200 iso_pu_bacteria 642555113 642615996 444
201 iso_pu_bacteria 644736347 644751052 444
202 iso_pu_bacteria 8003400568 8003403161 444
203 iso_pu_bacteria 8018845410 8018848807 444
204 iso_pu_bacteria 8020807995 8020810783 444
205 iso_pu_bacteria 8020938398 8020938950 444
206 iso_pu_bacteria 8020945358 8020950417 444
207 iso_pu_bacteria 8020953355 8020953507 444
208 iso_pu_bacteria 8021120328 8021127896 444
209 iso_pu_bacteria 8039098773 8039102005 444
210 iso_pu_bacteria 8040167225 8040172630 444
211 iso_pu_bacteria 8040173305 8040176411 444
212 iso_pu_bacteria 8055266321 8055270386 444
213 3300002774 JGI25150J39212_1004377 JGI25150J39212_10043772 445
214 3300003322 rootL2_10093398 rootL2_100933983 445
215 3300003771 Ga0055526_1000144 Ga0055526_100014442 445
216 3300005262 Ga0065165_1000488 Ga0065165_100048839 445
217 3300005339 Ga0070660_100027876 Ga0070660_1000278762 445
218 3300005563 Ga0068855_100018077 Ga0068855_1000180774 445
219 3300005564 Ga0070664_100099725 Ga0070664_1000997252 445
220 3300006881 Ga0068865_100050032 Ga0068865_1000500322 445
221 3300025245 Ga0207425_1000262 Ga0207425_10002622 445
222 3300025294 Ga0209025_1001297 Ga0209025_100129716 445
223 3300025295 Ga0209564_1000011 Ga0209564_1000011223 445
224 3300025297 Ga0209758_1000625 Ga0209758_100062513 445
225 3300025909 Ga0207705_10003924 Ga0207705_100039249 445
226 3300025911 Ga0207654_10017596 Ga0207654_100175963 445
227 3300025919 Ga0207657_10093923 Ga0207657_100939232 445
228 3300025949 Ga0207667_10003392 Ga0207667_100033926 445
229 3300025949 Ga0207667_10179493 Ga0207667_101794932 445
230 3300037312 Ga0395899_0030833 Ga0395899_0030833_2041_3396 445
231 3300037418 Ga0395900_0000081 Ga0395900_0000081_128335_129687 445
232 3300037418 Ga0395900_0004089 Ga0395900_0004089_5523_6878 445
233 3300037418 Ga0395900_0013083 Ga0395900_0013083_6547_7932 445
234 3300037466 Ga0395898_0013903 Ga0395898_0013903_1056_2411 445
235 3300037466 Ga0395898_0311158 Ga0395898_0311158_74_1426 445
236 3300037471 Ga0395905_0062048 Ga0395905_0062048_1055_2401 445
237 3300037471 Ga0395905_0235727 Ga0395905_0235727_282_1634 445
238 3300038443 Ga0395901_0000083 Ga0395901_0000083_29129_30481 445
239 3300038443 Ga0395901_0001547 Ga0395901_0001547_19190_20545 445
240 3300038443 Ga0395901_0051907 Ga0395901_0051907_1274_2626 445
241 3300044693 Ga0466961_0026695 Ga0466961_0026695_666_2015 445
242 3300044693 Ga0466961_0031539 Ga0466961_0031539_336_1718 445
243 3300044706 Ga0466964_0000830 Ga0466964_0000830_270_1625 445
244 3300044735 Ga0466968_0010197 Ga0466968_0010197_1515_2870 445
245 3300045049 Ga0466959_0005369 Ga0466959_0005369_1830_3179 445
246 3300045836 Ga0466958_0019247 Ga0466958_0019247_1469_2818 445
247 3300046453 Ga0495627_000163 Ga0495627_000163_17047_18384 445
248 3300046453 Ga0495627_005823 Ga0495627_005823_2745_4088 445
249 3300046457 Ga0495590_0000009 Ga0495590_0000009_7882_9219 445
250 3300046457 Ga0495590_0009957 Ga0495590_0009957_2148_3497 445
251 3300046463 Ga0495653_0037047 Ga0495653_0037047_2366_3712 445
252 3300046471 Ga0495650_0000329 Ga0495650_0000329_2070_3407 445
253 3300046471 Ga0495650_0000382 Ga0495650_0000382_66637_67980 445
254 3300046471 Ga0495650_0008810 Ga0495650_0008810_2824_4167 445
255 3300046474 Ga0495605_0000381 Ga0495605_0000381_25388_26737 445
256 3300046491 Ga0495584_0000107 Ga0495584_0000107_46741_48093 445
257 3300046492 Ga0495585_0001623 Ga0495585_0001623_6670_8007 445
258 3300046492 Ga0495585_0001858 Ga0495585_0001858_12375_13718 445
259 3300046492 Ga0495585_0052824 Ga0495585_0052824_857_2194 445
260 3300046499 Ga0495594_0011868 Ga0495594_0011868_1293_2630 445
261 3300046500 Ga0495596_0003661 Ga0495596_0003661_449_1786 445
262 3300046500 Ga0495596_0005978 Ga0495596_0005978_1903_3240 445
263 3300046507 Ga0495606_0035630 Ga0495606_0035630_383_1735 445
264 3300046512 Ga0495610_0000003 Ga0495610_0000003_1171264_1172607 445
265 3300046513 Ga0495616_0000291 Ga0495616_0000291_32571_33908 445
266 3300046513 Ga0495616_0026570 Ga0495616_0026570_37_1374 445
267 3300046518 Ga0495631_0004577 Ga0495631_0004577_1801_3138 445
268 3300046518 Ga0495631_0005043 Ga0495631_0005043_5519_6856 445
269 3300046518 Ga0495631_0019315 Ga0495631_0019315_252_1589 445
270 3300046518 Ga0495631_0026212 Ga0495631_0026212_1213_2562 445
271 3300046519 Ga0495632_0000990 Ga0495632_0000990_6620_7957 445
272 3300046523 Ga0495644_0004703 Ga0495644_0004703_218_1555 445
273 3300046523 Ga0495644_0009951 Ga0495644_0009951_1122_2459 445
274 3300046524 Ga0495648_0004238 Ga0495648_0004238_7424_8773 445
275 3300046524 Ga0495648_0005529 Ga0495648_0005529_44_1387 445
276 3300046524 Ga0495648_0016317 Ga0495648_0016317_2230_3573 445
277 3300046524 Ga0495648_0085729 Ga0495648_0085729_392_1735 445
278 3300046528 Ga0495642_0000073 Ga0495642_0000073_49757_51094 445
279 3300046528 Ga0495642_0000751 Ga0495642_0000751_6768_8105 445
280 3300046528 Ga0495642_0001577 Ga0495642_0001577_275_1627 445
281 3300046528 Ga0495642_0016989 Ga0495642_0016989_793_2139 445
282 3300046530 Ga0495654_0004709 Ga0495654_0004709_1364_2701 445
283 3300046530 Ga0495654_0026037 Ga0495654_0026037_1092_2435 445
284 3300046531 Ga0495665_0072900 Ga0495665_0072900_165_1511 445
285 3300046535 Ga0495586_0003117 Ga0495586_0003117_4523_5869 445
286 3300046538 Ga0495609_0014124 Ga0495609_0014124_2303_3646 445
287 3300046542 Ga0495597_0000483 Ga0495597_0000483_25684_27021 445
288 3300046616 Ga0495668_0001345 Ga0495668_0001345_21626_22969 445
289 3300046616 Ga0495668_0004350 Ga0495668_0004350_1757_3094 445
290 3300046648 Ga0495611_0000714 Ga0495611_0000714_4021_5358 445
291 3300046663 Ga0495635_0006603 Ga0495635_0006603_4496_5842 445
292 3300046665 Ga0495661_0000457 Ga0495661_0000457_6789_8135 445
293 3300046665 Ga0495661_0003470 Ga0495661_0003470_4734_6071 445
294 3300046665 Ga0495661_0086479 Ga0495661_0086479_316_1665 445
295 3300046674 Ga0495588_0000201 Ga0495588_0000201_57968_59320 445
296 3300046674 Ga0495588_0012958 Ga0495588_0012958_2430_3767 445
297 3300046684 Ga0495669_0000391 Ga0495669_0000391_18746_20083 445
298 3300046684 Ga0495669_0002273 Ga0495669_0002273_4931_6268 445
299 3300046684 Ga0495669_0012062 Ga0495669_0012062_706_2043 445
300 3300046691 Ga0495670_0006247 Ga0495670_0006247_4315_5652 445
301 3300046692 Ga0495671_0000270 Ga0495671_0000270_66_1409 445
302 3300046692 Ga0495671_0067179 Ga0495671_0067179_355_1698 445
303 3300046694 Ga0495649_0000581 Ga0495649_0000581_3220_4557 445
304 3300046694 Ga0495649_0024087 Ga0495649_0024087_1403_2740 445
305 3300046794 Ga0495589_0001008 Ga0495589_0001008_9512_10861 445
306 3300046794 Ga0495589_0003363 Ga0495589_0003363_5541_6884 445
307 3300046810 Ga0495660_0000079 Ga0495660_0000079_68209_69558 445
308 3300046810 Ga0495660_0006719 Ga0495660_0006719_2894_4231 445
309 3300046810 Ga0495660_0018979 Ga0495660_0018979_44_1387 445
310 3300047317 Ga0495604_0008524 Ga0495604_0008524_4257_5603 445
311 3300047317 Ga0495604_0070383 Ga0495604_0070383_129_1475 445
312 3300047320 Ga0495672_0000597 Ga0495672_0000597_2089_3432 445
313 3300047320 Ga0495672_0007377 Ga0495672_0007377_2570_3919 445
314 3300047321 Ga0495676_0000054 Ga0495676_0000054_6832_8178 445
315 3300047323 Ga0495683_0001403 Ga0495683_0001403_74_1417 445
316 3300047323 Ga0495683_0002625 Ga0495683_0002625_7738_9081 445
317 3300047443 Ga0495687_000036 Ga0495687_000036_54781_56133 445
318 3300047443 Ga0495687_000355 Ga0495687_000355_49864_51255 445
319 3300047443 Ga0495687_000534 Ga0495687_000534_13646_14995 445
320 3300047444 Ga0495675_0036251 Ga0495675_0036251_1608_2954 445
321 3300047445 Ga0495677_0005707 Ga0495677_0005707_3247_4584 445
322 3300047445 Ga0495677_0009020 Ga0495677_0009020_52_1401 445
323 3300047445 Ga0495677_0010216 Ga0495677_0010216_1645_2982 445
324 3300047446 Ga0495679_029447 Ga0495679_029447_335_1678 445
325 3300047469 Ga0495673_0000016 Ga0495673_0000016_27072_28415 445
326 3300047472 Ga0495686_0000148 Ga0495686_0000148_36522_37859 445
327 3300047673 Ga0495593_0003070 Ga0495593_0003070_4326_5672 445
328 3300048089 Ga0495614_0000395 Ga0495614_0000395_1314_2660 445
329 3300048090 Ga0495615_0014910 Ga0495615_0014910_51_1400 445
330 3300048091 Ga0495626_0000628 Ga0495626_0000628_30306_31655 445
331 3300048091 Ga0495626_0010953 Ga0495626_0010953_2539_3876 445
332 3300048903 Ga0496100_0043006 Ga0496100_0043006_118_1464 445
333 3300048904 Ga0496101_0015756 Ga0496101_0015756_446_1792 445
334 3300048909 Ga0496106_0000824 Ga0496106_0000824_5155_6507 445
335 3300048912 Ga0496109_0005364 Ga0496109_0005364_2861_4207 445
336 3300048916 Ga0496113_0016054 Ga0496113_0016054_1150_2496 445
337 3300048916 Ga0496113_0018812 Ga0496113_0018812_535_1920 445
338 3300048925 Ga0496122_0000483 Ga0496122_0000483_51823_53169 445
339 3300048925 Ga0496122_0001428 Ga0496122_0001428_30163_31548 445
340 3300048925 Ga0496122_0033799 Ga0496122_0033799_2679_4028 445
341 3300048925 Ga0496122_0117249 Ga0496122_0117249_65_1408 445
342 3300048926 Ga0496123_0000902 Ga0496123_0000902_16782_18128 445
343 3300048926 Ga0496123_0004370 Ga0496123_0004370_1068_2417 445
344 3300048926 Ga0496123_0012571 Ga0496123_0012571_4466_5851 445
345 3300048927 Ga0496124_0018293 Ga0496124_0018293_5149_6534 445
346 3300048927 Ga0496124_0020870 Ga0496124_0020870_821_2170 445
347 3300048927 Ga0496124_0110323 Ga0496124_0110323_80_1417 445
348 3300048928 Ga0496125_0005271 Ga0496125_0005271_8161_9507 445
349 3300048929 Ga0496126_0055371 Ga0496126_0055371_1233_2582 445
350 3300049128 Ga0501308_001075 Ga0501308_001075_57_1406 445
351 3300049459 Ga0495678_000117 Ga0495678_000117_85158_86495 445
352 3300049822 Ga0501035_0001236 Ga0501035_0001236_14831_16183 445
353 3300053145 Ga0500586_007502 Ga0500586_007502_1075_2418 445
354 3300061719 Ga0466962_0010276 Ga0466962_0010276_192_1574 445
355 3300002773 JGI25152J39213_1000092 JGI25152J39213_100009231 446
356 3300002774 JGI25150J39212_1000467 JGI25150J39212_10004672 446
357 3300002774 JGI25150J39212_1003019 JGI25150J39212_10030192 446
358 3300002987 JGI25159J45721_1000449 JGI25159J45721_10004492 446
359 3300002987 JGI25159J45721_1004076 JGI25159J45721_10040762 446
360 3300002987 JGI25159J45721_1004366 JGI25159J45721_10043663 446
361 3300003354 JGI25160J50197_1001330 JGI25160J50197_10013309 446
362 3300003374 JGI25161J50226_1003485 JGI25161J50226_10034852 446
363 3300003374 JGI25161J50226_1004512 JGI25161J50226_10045122 446
364 3300003762 Ga0055542_1007149 Ga0055542_10071492 446
365 3300003771 Ga0055526_1000001 Ga0055526_1000001433 446
366 3300003771 Ga0055526_1000580 Ga0055526_100058019 446
367 3300003771 Ga0055526_1001674 Ga0055526_100167413 446
368 3300003771 Ga0055526_1007301 Ga0055526_10073014 446
369 3300003773 Ga0055537_1000004 Ga0055537_1000004133 446
370 3300003773 Ga0055537_1001117 Ga0055537_10011177 446
371 3300003773 Ga0055537_1002014 Ga0055537_10020145 446
372 3300003775 Ga0055524_1000585 Ga0055524_100058526 446
373 3300003775 Ga0055524_1001916 Ga0055524_10019162 446
374 3300003775 Ga0055524_1002675 Ga0055524_10026755 446
375 3300003775 Ga0055524_1006646 Ga0055524_10066463 446
376 3300003784 Ga0055534_1000095 Ga0055534_10000958 446
377 3300003784 Ga0055534_1002974 Ga0055534_10029743 446
378 3300003790 Ga0055528_1000050 Ga0055528_100005062 446
379 3300003790 Ga0055528_1004056 Ga0055528_10040563 446
380 3300003791 Ga0055530_10002865 Ga0055530_100028654 446
381 3300003794 Ga0055531_10004622 Ga0055531_100046221 446
382 3300003794 Ga0055531_10013593 Ga0055531_100135933 446
383 3300004625 Ga0055543_1002941 Ga0055543_10029413 446
384 3300004625 Ga0055543_1004284 Ga0055543_10042844 446
385 3300005262 Ga0065165_1000003 Ga0065165_1000003242 446
386 3300005262 Ga0065165_1002969 Ga0065165_10029699 446
387 3300009036 Ga0105244_10030658 Ga0105244_100306583 446
388 3300025208 Ga0209436_100083 Ga0209436_10008333 446
389 3300025208 Ga0209436_100656 Ga0209436_1006569 446
390 3300025208 Ga0209436_100965 Ga0209436_1009653 446
391 3300025245 Ga0207425_1000017 Ga0207425_1000017140 446
392 3300025245 Ga0207425_1000462 Ga0207425_10004623 446
393 3300025254 Ga0209148_1000969 Ga0209148_10009698 446
394 3300025258 Ga0209129_1000039 Ga0209129_1000039259 446
395 3300025258 Ga0209129_1000088 Ga0209129_100008825 446
396 3300025258 Ga0209129_1000805 Ga0209129_10008057 446
397 3300025258 Ga0209129_1012165 Ga0209129_10121652 446
398 3300025263 Ga0209565_1000018 Ga0209565_1000018148 446
399 3300025263 Ga0209565_1001673 Ga0209565_10016736 446
400 3300025263 Ga0209565_1004041 Ga0209565_10040413 446
401 3300025263 Ga0209565_1004883 Ga0209565_10048833 446
402 3300025263 Ga0209565_1005084 Ga0209565_10050844 446
403 3300025263 Ga0209565_1007572 Ga0209565_10075723 446
404 3300025273 Ga0209673_1000090 Ga0209673_100009029 446
405 3300025284 Ga0209130_1000036 Ga0209130_100003691 446
406 3300025284 Ga0209130_1000836 Ga0209130_10008363 446
407 3300025284 Ga0209130_1001017 Ga0209130_10010179 446
408 3300025291 Ga0209675_1000005 Ga0209675_1000005148 446
409 3300025291 Ga0209675_1002548 Ga0209675_10025483 446
410 3300025291 Ga0209675_1007792 Ga0209675_10077923 446
411 3300025291 Ga0209675_1007799 Ga0209675_10077993 446
412 3300025295 Ga0209564_1000002 Ga0209564_1000002135 446
413 3300025295 Ga0209564_1000078 Ga0209564_1000078116 446
414 3300025295 Ga0209564_1000508 Ga0209564_100050833 446
415 3300025295 Ga0209564_1003200 Ga0209564_10032009 446
416 3300025295 Ga0209564_1015094 Ga0209564_10150943 446
417 3300025297 Ga0209758_1000137 Ga0209758_100013737 446
418 3300025298 Ga0209050_1000803 Ga0209050_10008038 446
419 3300025298 Ga0209050_1003876 Ga0209050_10038768 446
420 3300025299 Ga0209256_1000070 Ga0209256_1000070137 446
421 3300025299 Ga0209256_1000189 Ga0209256_100018929 446
422 3300025299 Ga0209256_1001219 Ga0209256_100121921 446
423 3300025299 Ga0209256_1004212 Ga0209256_10042123 446
424 3300025299 Ga0209256_1008141 Ga0209256_10081413 446
425 3300025302 Ga0207426_1001076 Ga0207426_100107614 446
426 3300025304 Ga0209257_1000355 Ga0209257_10003556 446
427 3300031548 Ga0307408_100004943 Ga0307408_1000049435 446
428 3300031838 Ga0307518_10039321 Ga0307518_100393213 446
429 3300032002 Ga0307416_100000430 Ga0307416_10000043014 446
430 3300042139 Ga0450904_000236 Ga0450904_000236_7433_8773 446
431 3300046452 Ga0495617_005442 Ga0495617_005442_2865_4205 446
432 3300046457 Ga0495590_0000001 Ga0495590_0000001_2271_3626 446
433 3300046460 Ga0495638_0000017 Ga0495638_0000017_354981_356336 446
434 3300046471 Ga0495650_0000383 Ga0495650_0000383_68335_69675 446
435 3300046471 Ga0495650_0006792 Ga0495650_0006792_1647_3002 446
436 3300046474 Ga0495605_0002438 Ga0495605_0002438_6208_7548 446
437 3300046474 Ga0495605_0011069 Ga0495605_0011069_1675_3015 446
438 3300046491 Ga0495584_0000008 Ga0495584_0000008_142914_144254 446
439 3300046491 Ga0495584_0001991 Ga0495584_0001991_1801_3141 446
440 3300046492 Ga0495585_0000183 Ga0495585_0000183_57561_58901 446
441 3300046492 Ga0495585_0034945 Ga0495585_0034945_514_1854 446
442 3300046492 Ga0495585_0066000 Ga0495585_0066000_383_1723 446
443 3300046500 Ga0495596_0000097 Ga0495596_0000097_49946_51286 446
444 3300046500 Ga0495596_0000173 Ga0495596_0000173_23667_25007 446
445 3300046500 Ga0495596_0000829 Ga0495596_0000829_11105_12445 446
446 3300046500 Ga0495596_0017942 Ga0495596_0017942_649_1989 446
447 3300046500 Ga0495596_0023749 Ga0495596_0023749_1057_2397 446
448 3300046501 Ga0495607_0008109 Ga0495607_0008109_393_1733 446
449 3300046501 Ga0495607_0008310 Ga0495607_0008310_3645_4994 446
450 3300046501 Ga0495607_0031500 Ga0495607_0031500_935_2275 446
451 3300046506 Ga0495583_0000270 Ga0495583_0000270_81867_83222 446
452 3300046506 Ga0495583_0000836 Ga0495583_0000836_9000_10340 446
453 3300046507 Ga0495606_0003859 Ga0495606_0003859_1783_3132 446
454 3300046507 Ga0495606_0006853 Ga0495606_0006853_3545_4885 446
455 3300046507 Ga0495606_0018465 Ga0495606_0018465_1579_2928 446
456 3300046512 Ga0495610_0003238 Ga0495610_0003238_11106_12455 446
457 3300046512 Ga0495610_0014724 Ga0495610_0014724_1519_2868 446
458 3300046512 Ga0495610_0031372 Ga0495610_0031372_645_1994 446
459 3300046513 Ga0495616_0002440 Ga0495616_0002440_1353_2693 446
460 3300046513 Ga0495616_0045517 Ga0495616_0045517_254_1594 446
461 3300046519 Ga0495632_0000823 Ga0495632_0000823_19184_20524 446
462 3300046519 Ga0495632_0002935 Ga0495632_0002935_5528_6868 446
463 3300046522 Ga0495643_0000426 Ga0495643_0000426_5345_6685 446
464 3300046522 Ga0495643_0001320 Ga0495643_0001320_19748_21097 446
465 3300046522 Ga0495643_0002034 Ga0495643_0002034_2240_3595 446
466 3300046523 Ga0495644_0000762 Ga0495644_0000762_6480_7820 446
467 3300046523 Ga0495644_0005347 Ga0495644_0005347_3171_4511 446
468 3300046523 Ga0495644_0013673 Ga0495644_0013673_465_1805 446
469 3300046524 Ga0495648_0000030 Ga0495648_0000030_60523_61863 446
470 3300046524 Ga0495648_0000040 Ga0495648_0000040_34875_36230 446
471 3300046524 Ga0495648_0000829 Ga0495648_0000829_26039_27379 446
472 3300046524 Ga0495648_0070445 Ga0495648_0070445_65_1414 446
473 3300046528 Ga0495642_0019114 Ga0495642_0019114_195_1535 446
474 3300046538 Ga0495609_0000423 Ga0495609_0000423_27788_29128 446
475 3300046538 Ga0495609_0003820 Ga0495609_0003820_3734_5074 446
476 3300046538 Ga0495609_0033147 Ga0495609_0033147_758_2107 446
477 3300046542 Ga0495597_0001505 Ga0495597_0001505_2125_3480 446
478 3300046542 Ga0495597_0012187 Ga0495597_0012187_2214_3563 446
479 3300046542 Ga0495597_0030115 Ga0495597_0030115_369_1709 446
480 3300046557 Ga0495622_0001354 Ga0495622_0001354_8824_10179 446
481 3300046558 Ga0495633_0000141 Ga0495633_0000141_92273_93628 446
482 3300046558 Ga0495633_0001595 Ga0495633_0001595_14248_15597 446
483 3300046558 Ga0495633_0043931 Ga0495633_0043931_322_1662 446
484 3300046615 Ga0495656_0010009 Ga0495656_0010009_1438_2778 446
485 3300046616 Ga0495668_0000372 Ga0495668_0000372_36814_38169 446
486 3300046616 Ga0495668_0057794 Ga0495668_0057794_261_1601 446
487 3300046648 Ga0495611_0036042 Ga0495611_0036042_96_1436 446
488 3300046660 Ga0495625_0000244 Ga0495625_0000244_2281_3636 446
489 3300046660 Ga0495625_0022739 Ga0495625_0022739_1526_2875 446
490 3300046660 Ga0495625_0040382 Ga0495625_0040382_1985_3334 446
491 3300046660 Ga0495625_0085898 Ga0495625_0085898_580_1929 446
492 3300046664 Ga0495659_0000213 Ga0495659_0000213_1983_3332 446
493 3300046674 Ga0495588_0005834 Ga0495588_0005834_3657_4997 446
494 3300046691 Ga0495670_0031136 Ga0495670_0031136_934_2274 446
495 3300046692 Ga0495671_0000657 Ga0495671_0000657_2027_3376 446
496 3300046694 Ga0495649_0000879 Ga0495649_0000879_8778_10118 446
497 3300046794 Ga0495589_0019052 Ga0495589_0019052_16_1356 446
498 3300047320 Ga0495672_0000169 Ga0495672_0000169_34205_35554 446
499 3300047320 Ga0495672_0000257 Ga0495672_0000257_66595_67935 446
500 3300047320 Ga0495672_0001684 Ga0495672_0001684_2059_3408 446
501 3300047320 Ga0495672_0030583 Ga0495672_0030583_247_1587 446
502 3300047323 Ga0495683_0001893 Ga0495683_0001893_3714_5054 446
503 3300047323 Ga0495683_0024724 Ga0495683_0024724_1406_2746 446
504 3300047445 Ga0495677_0009264 Ga0495677_0009264_470_1810 446
505 3300047446 Ga0495679_015417 Ga0495679_015417_514_1854 446
506 3300047470 Ga0495681_0029707 Ga0495681_0029707_885_2225 446
507 3300047470 Ga0495681_0048893 Ga0495681_0048893_238_1578 446
508 3300047472 Ga0495686_0000211 Ga0495686_0000211_35649_36995 446
509 3300047472 Ga0495686_0023034 Ga0495686_0023034_2138_3484 446
510 3300047673 Ga0495593_0010156 Ga0495593_0010156_2399_3739 446
511 3300048091 Ga0495626_0001481 Ga0495626_0001481_2344_3684 446
512 3300048091 Ga0495626_0014800 Ga0495626_0014800_326_1666 446
513 3300048091 Ga0495626_0015051 Ga0495626_0015051_1560_2900 446
514 3300048091 Ga0495626_0023343 Ga0495626_0023343_231_1571 446
515 3300048927 Ga0496124_0007777 Ga0496124_0007777_8438_9790 446
516 3300049459 Ga0495678_001541 Ga0495678_001541_2112_3461 446
517 3300049459 Ga0495678_016566 Ga0495678_016566_851_2191 446
518 3300049531 Ga0501315_001166 Ga0501315_001166_22_1362 446
519 3300049665 Ga0501227_001706 Ga0501227_001706_1891_3231 446
520 3300049775 Ga0501279_001239 Ga0501279_001239_411_1751 446
521 3300003187 JGI25151J46595_10000077 JGI25151J46595_10000077107 447
522 3300003322 rootL2_10007766 rootL2_100077663 447
523 3300003354 JGI25160J50197_1000083 JGI25160J50197_10000833 447
524 3300005262 Ga0065165_1001740 Ga0065165_100174015 447
525 3300006195 Ga0075366_10000634 Ga0075366_100006346 447
526 3300009093 Ga0105240_10246918 Ga0105240_102469182 447
527 3300016635 Ga0183361_10004 Ga0183361_1000412 447
528 3300025284 Ga0209130_1005479 Ga0209130_10054793 447
529 3300025292 Ga0209676_1002330 Ga0209676_100233010 447
530 3300025294 Ga0209025_1000003 Ga0209025_100000314 447
531 3300025298 Ga0209050_1008446 Ga0209050_10084464 447
532 3300025302 Ga0207426_1000004 Ga0207426_1000004150 447
533 3300031344 Ga0265316_10075731 Ga0265316_100757312 447
534 3300031911 Ga0307412_10000129 Ga0307412_1000012938 447
535 3300035691 Ga0373931_0010548 Ga0373931_0010548_930_2276 447
536 3300037418 Ga0395900_0238718 Ga0395900_0238718_199_1596 447
537 3300037471 Ga0395905_0000103 Ga0395905_0000103_108413_109756 447
538 3300038443 Ga0395901_0087544 Ga0395901_0087544_592_1983 447
539 3300038443 Ga0395901_0111671 Ga0395901_0111671_1429_2835 447
540 3300044706 Ga0466964_0013794 Ga0466964_0013794_1634_3040 447
541 3300046455 Ga0495603_0005055 Ga0495603_0005055_1253_2656 447
542 3300046458 Ga0495591_000408 Ga0495591_000408_8274_9677 447
543 3300046474 Ga0495605_0008169 Ga0495605_0008169_2485_3888 447
544 3300046491 Ga0495584_0000200 Ga0495584_0000200_33330_34733 447
545 3300046492 Ga0495585_0000401 Ga0495585_0000401_6756_8153 447
546 3300046492 Ga0495585_0012144 Ga0495585_0012144_575_1978 447
547 3300046500 Ga0495596_0021653 Ga0495596_0021653_969_2372 447
548 3300046501 Ga0495607_0000440 Ga0495607_0000440_7686_9089 447
549 3300046506 Ga0495583_0000040 Ga0495583_0000040_91168_92514 447
550 3300046506 Ga0495583_0000713 Ga0495583_0000713_33075_34478 447
551 3300046506 Ga0495583_0011989 Ga0495583_0011989_2616_3959 447
552 3300046512 Ga0495610_0001429 Ga0495610_0001429_5731_7134 447
553 3300046518 Ga0495631_0004342 Ga0495631_0004342_3555_4958 447
554 3300046519 Ga0495632_0000017 Ga0495632_0000017_167874_169271 447
555 3300046519 Ga0495632_0009604 Ga0495632_0009604_2619_4022 447
556 3300046520 Ga0495637_0000003 Ga0495637_0000003_292179_293582 447
557 3300046524 Ga0495648_0019883 Ga0495648_0019883_866_2257 447
558 3300046525 Ga0495663_0001841 Ga0495663_0001841_53_1399 447
559 3300046525 Ga0495663_0002010 Ga0495663_0002010_2979_4322 447
560 3300046528 Ga0495642_0006748 Ga0495642_0006748_1445_2848 447
561 3300046528 Ga0495642_0023960 Ga0495642_0023960_723_2120 447
562 3300046538 Ga0495609_0061304 Ga0495609_0061304_109_1512 447
563 3300046542 Ga0495597_0003476 Ga0495597_0003476_4141_5538 447
564 3300046558 Ga0495633_0000946 Ga0495633_0000946_2426_3829 447
565 3300046615 Ga0495656_0039179 Ga0495656_0039179_447_1793 447
566 3300046616 Ga0495668_0036248 Ga0495668_0036248_993_2396 447
567 3300046648 Ga0495611_0001563 Ga0495611_0001563_8091_9494 447
568 3300046665 Ga0495661_0001600 Ga0495661_0001600_1013_2410 447
569 3300046665 Ga0495661_0037113 Ga0495661_0037113_744_2123 447
570 3300046665 Ga0495661_0046283 Ga0495661_0046283_1089_2486 447
571 3300046665 Ga0495661_0063319 Ga0495661_0063319_335_1726 447
572 3300046684 Ga0495669_0000015 Ga0495669_0000015_86744_88156 447
573 3300046691 Ga0495670_0000086 Ga0495670_0000086_6147_7544 447
574 3300046694 Ga0495649_0010065 Ga0495649_0010065_4082_5494 447
575 3300046794 Ga0495589_0004556 Ga0495589_0004556_3956_5359 447
576 3300046794 Ga0495589_0007375 Ga0495589_0007375_2213_3610 447
577 3300046810 Ga0495660_0026790 Ga0495660_0026790_1587_2990 447
578 3300047318 Ga0495636_0013452 Ga0495636_0013452_490_1833 447
579 3300047320 Ga0495672_0000338 Ga0495672_0000338_26124_27527 447
580 3300047320 Ga0495672_0001037 Ga0495672_0001037_22869_24266 447
581 3300047323 Ga0495683_0000178 Ga0495683_0000178_34796_36199 447
582 3300047445 Ga0495677_0005046 Ga0495677_0005046_1481_2878 447
583 3300047446 Ga0495679_005844 Ga0495679_005844_3509_4912 447
584 3300047470 Ga0495681_0002909 Ga0495681_0002909_2050_3447 447
585 3300047470 Ga0495681_0008490 Ga0495681_0008490_1527_2930 447
586 3300048090 Ga0495615_0000319 Ga0495615_0000319_657_2003 447
587 3300048903 Ga0496100_0007037 Ga0496100_0007037_2046_3389 447
588 3300048904 Ga0496101_0010110 Ga0496101_0010110_2038_3381 447
589 3300048905 Ga0496102_0000113 Ga0496102_0000113_43506_45011 447
590 3300048905 Ga0496102_0019184 Ga0496102_0019184_2101_3444 447
591 3300048920 Ga0496117_0019031 Ga0496117_0019031_2774_4117 447
592 3300048921 Ga0496118_0003719 Ga0496118_0003719_14839_16182 447
593 3300048924 Ga0496121_0005839 Ga0496121_0005839_3017_4360 447
594 3300050493 nmdc:mga0k408_837_c1 nmdc:mga0k408_837_c1_5002_6399 447
595 3300001915 JGI24741J21665_1000194 JGI24741J21665_10001948 448
596 3300001979 JGI24740J21852_10000120 JGI24740J21852_1000012011 448
597 3300001979 JGI24740J21852_10000697 JGI24740J21852_100006975 448
598 3300001979 JGI24740J21852_10001098 JGI24740J21852_100010983 448
599 3300001990 JGI24737J22298_10013144 JGI24737J22298_100131442 448
600 3300002067 JGI24735J21928_10000692 JGI24735J21928_100006923 448
601 3300002067 JGI24735J21928_10006341 JGI24735J21928_100063413 448
602 3300002067 JGI24735J21928_10011765 JGI24735J21928_100117653 448
603 3300002075 JGI24738J21930_10000921 JGI24738J21930_100009219 448
604 3300002705 JGI25156J39149_1001759 JGI25156J39149_10017593 448
605 3300002705 JGI25156J39149_1002214 JGI25156J39149_10022143 448
606 3300002705 JGI25156J39149_1002592 JGI25156J39149_10025924 448
607 3300002705 JGI25156J39149_1006972 JGI25156J39149_10069722 448
608 3300002738 JGI25154J39366_1001418 JGI25154J39366_10014183 448
609 3300003187 JGI25151J46595_10000541 JGI25151J46595_1000054120 448
610 3300003214 JGI25165J46597_1000418 JGI25165J46597_10004183 448
611 3300003323 rootH1_10142808 rootH1_101428083 448
612 3300003479 Ga0006556J51387_1034511 Ga0006556J51387_10345112 448
613 3300003751 Ga0055538_1003118 Ga0055538_10031181 448
614 3300003751 Ga0055538_1003122 Ga0055538_10031222 448
615 3300003752 Ga0055539_1000101 Ga0055539_100010184 448
616 3300003756 Ga0055533_1000091 Ga0055533_1000091102 448
617 3300003756 Ga0055533_1000465 Ga0055533_100046511 448
618 3300003756 Ga0055533_1002554 Ga0055533_10025544 448
619 3300003756 Ga0055533_1004796 Ga0055533_10047961 448
620 3300003758 Ga0055532_1000037 Ga0055532_1000037127 448
621 3300003758 Ga0055532_1000045 Ga0055532_1000045103 448
622 3300003759 Ga0055525_1000503 Ga0055525_100050316 448
623 3300003759 Ga0055525_1000582 Ga0055525_10005828 448
624 3300003760 Ga0055527_1000027 Ga0055527_1000027103 448
625 3300003761 Ga0055535_1000018 Ga0055535_1000018127 448
626 3300003761 Ga0055535_1000033 Ga0055535_1000033103 448
627 3300003762 Ga0055542_1000050 Ga0055542_1000050103 448
628 3300003762 Ga0055542_1001592 Ga0055542_100159210 448
629 3300003763 Ga0055529_1000041 Ga0055529_1000041127 448
630 3300003763 Ga0055529_1000061 Ga0055529_1000061103 448
631 3300003763 Ga0055529_1002426 Ga0055529_10024264 448
632 3300003781 Ga0055536_1000428 Ga0055536_100042811 448
633 3300003790 Ga0055528_1000756 Ga0055528_100075610 448
634 3300003841 Ga0055541_1000371 Ga0055541_10003713 448
635 3300003841 Ga0055541_1001958 Ga0055541_10019584 448
636 3300003841 Ga0055541_1005637 Ga0055541_10056372 448
637 3300003856 Ga0058692_1003017 Ga0058692_10030175 448
638 3300005289 Ga0065704_10146009 Ga0065704_101460091 448
639 3300005327 Ga0070658_10006304 Ga0070658_100063047 448
640 3300005327 Ga0070658_10008844 Ga0070658_100088448 448
641 3300005339 Ga0070660_100000144 Ga0070660_1000001447 448
642 3300005339 Ga0070660_100000616 Ga0070660_10000061615 448
643 3300005344 Ga0070661_100001251 Ga0070661_10000125110 448
644 3300005344 Ga0070661_100001281 Ga0070661_1000012813 448
645 3300005366 Ga0070659_100000156 Ga0070659_1000001567 448
646 3300005366 Ga0070659_100108921 Ga0070659_1001089212 448
647 3300005367 Ga0070667_100089172 Ga0070667_1000891721 448
648 3300005455 Ga0070663_100000049 Ga0070663_10000004926 448
649 3300005455 Ga0070663_100042047 Ga0070663_1000420473 448
650 3300005457 Ga0070662_100003180 Ga0070662_1000031808 448
651 3300005563 Ga0068855_100004241 Ga0068855_10000424112 448
652 3300005563 Ga0068855_100005032 Ga0068855_1000050329 448
653 3300005564 Ga0070664_100000026 Ga0070664_10000002626 448
654 3300005577 Ga0068857_100094439 Ga0068857_1000944392 448
655 3300005577 Ga0068857_100122337 Ga0068857_1001223372 448
656 3300005578 Ga0068854_100000041 Ga0068854_10000004131 448
657 3300005614 Ga0068856_100000643 Ga0068856_10000064317 448
658 3300005614 Ga0068856_100285133 Ga0068856_1002851332 448
659 3300005616 Ga0068852_100082788 Ga0068852_1000827883 448
660 3300005844 Ga0068862_100126670 Ga0068862_1001266701 448
661 3300006195 Ga0075366_10024111 Ga0075366_100241112 448
662 3300006353 Ga0075370_10001064 Ga0075370_100010645 448
663 3300009011 Ga0105251_10000495 Ga0105251_1000049525 448
664 3300009036 Ga0105244_10013629 Ga0105244_100136293 448
665 3300009092 Ga0105250_10003303 Ga0105250_100033032 448
666 3300009093 Ga0105240_10000656 Ga0105240_1000065617 448
667 3300009093 Ga0105240_10005256 Ga0105240_1000525614 448
668 3300009093 Ga0105240_10025772 Ga0105240_100257725 448
669 3300009093 Ga0105240_10056042 Ga0105240_100560425 448
670 3300009093 Ga0105240_10091361 Ga0105240_100913612 448
671 3300009148 Ga0105243_10005556 Ga0105243_100055565 448
672 3300009148 Ga0105243_10010429 Ga0105243_100104296 448
673 3300009174 Ga0105241_10015393 Ga0105241_100153935 448
674 3300009545 Ga0105237_10004293 Ga0105237_100042933 448
675 3300009545 Ga0105237_10020911 Ga0105237_100209113 448
676 3300009551 Ga0105238_10003697 Ga0105238_100036973 448
677 3300010375 Ga0105239_10002437 Ga0105239_100024379 448
678 3300010375 Ga0105239_10048934 Ga0105239_100489343 448
679 3300012502 Ga0157347_1000898 Ga0157347_10008982 448
680 3300013100 Ga0157373_10002963 Ga0157373_100029638 448
681 3300013100 Ga0157373_10003193 Ga0157373_100031933 448
682 3300013102 Ga0157371_10000179 Ga0157371_1000017926 448
683 3300013102 Ga0157371_10000709 Ga0157371_100007093 448
684 3300013104 Ga0157370_10000138 Ga0157370_1000013848 448
685 3300013104 Ga0157370_10000328 Ga0157370_1000032810 448
686 3300013104 Ga0157370_10002267 Ga0157370_1000226710 448
687 3300013104 Ga0157370_10004860 Ga0157370_1000486013 448
688 3300013105 Ga0157369_10000206 Ga0157369_1000020623 448
689 3300013105 Ga0157369_10000953 Ga0157369_1000095310 448
690 3300013105 Ga0157369_10004423 Ga0157369_100044233 448
691 3300013105 Ga0157369_10007857 Ga0157369_1000785710 448
692 3300013105 Ga0157369_10018247 Ga0157369_100182476 448
693 3300013105 Ga0157369_10059098 Ga0157369_100590983 448
694 3300013296 Ga0157374_10000540 Ga0157374_1000054013 448
695 3300013296 Ga0157374_10066727 Ga0157374_100667274 448
696 3300013307 Ga0157372_10000208 Ga0157372_100002088 448
697 3300014497 Ga0182008_10000228 Ga0182008_1000022818 448
698 3300014497 Ga0182008_10030982 Ga0182008_100309822 448
699 3300015261 Ga0182006_1000142 Ga0182006_100014218 448
700 3300015261 Ga0182006_1001902 Ga0182006_10019025 448
701 3300015261 Ga0182006_1008412 Ga0182006_10084124 448
702 3300015262 Ga0182007_10000231 Ga0182007_1000023111 448
703 3300015262 Ga0182007_10001752 Ga0182007_100017528 448
704 3300015262 Ga0182007_10032922 Ga0182007_100329222 448
705 3300015265 Ga0182005_1000090 Ga0182005_100009018 448
706 3300017792 Ga0163161_10000154 Ga0163161_1000015435 448
707 3300020077 Ga0206351_10102888 Ga0206351_1010288811 448
708 3300020082 Ga0206353_11627597 Ga0206353_116275972 448
709 3300020610 Ga0154015_1642150 Ga0154015_16421507 448
710 3300022467 Ga0224712_10000305 Ga0224712_100003054 448
711 3300025224 Ga0209784_100070 Ga0209784_10007052 448
712 3300025224 Ga0209784_100553 Ga0209784_1005531 448
713 3300025224 Ga0209784_100800 Ga0209784_1008005 448
714 3300025225 Ga0209566_100084 Ga0209566_10008481 448
715 3300025225 Ga0209566_100327 Ga0209566_10032747 448
716 3300025225 Ga0209566_100360 Ga0209566_10036016 448
717 3300025225 Ga0209566_101204 Ga0209566_1012043 448
718 3300025226 Ga0209674_100074 Ga0209674_100074103 448
719 3300025226 Ga0209674_100089 Ga0209674_100089145 448
720 3300025226 Ga0209674_100102 Ga0209674_10010294 448
721 3300025226 Ga0209674_100138 Ga0209674_10013820 448
722 3300025226 Ga0209674_104607 Ga0209674_1046072 448
723 3300025228 Ga0209672_100053 Ga0209672_100053103 448
724 3300025228 Ga0209672_100054 Ga0209672_10005479 448
725 3300025228 Ga0209672_100072 Ga0209672_10007293 448
726 3300025228 Ga0209672_100169 Ga0209672_1001693 448
727 3300025229 Ga0209147_100005 Ga0209147_100005822 448
728 3300025229 Ga0209147_100070 Ga0209147_100070103 448
729 3300025229 Ga0209147_100085 Ga0209147_100085111 448
730 3300025229 Ga0209147_100100 Ga0209147_10010085 448
731 3300025229 Ga0209147_100376 Ga0209147_10037632 448
732 3300025230 Ga0209563_100102 Ga0209563_10010252 448
733 3300025230 Ga0209563_100394 Ga0209563_10039413 448
734 3300025230 Ga0209563_103739 Ga0209563_1037391 448
735 3300025230 Ga0209563_107130 Ga0209563_1071302 448
736 3300025242 Ga0209258_100007 Ga0209258_100007822 448
737 3300025242 Ga0209258_100094 Ga0209258_100094103 448
738 3300025242 Ga0209258_100168 Ga0209258_100168110 448
739 3300025242 Ga0209258_100397 Ga0209258_10039757 448
740 3300025246 Ga0209646_1000412 Ga0209646_10004123 448
741 3300025250 Ga0209026_1002591 Ga0209026_10025915 448
742 3300025253 Ga0209677_100062 Ga0209677_10006252 448
743 3300025253 Ga0209677_106045 Ga0209677_1060453 448
744 3300025254 Ga0209148_1000100 Ga0209148_1000100103 448
745 3300025254 Ga0209148_1000119 Ga0209148_1000119167 448
746 3300025254 Ga0209148_1000676 Ga0209148_10006766 448
747 3300025254 Ga0209148_1004315 Ga0209148_10043154 448
748 3300025256 Ga0209759_1000009 Ga0209759_1000009103 448
749 3300025256 Ga0209759_1000036 Ga0209759_100003674 448
750 3300025256 Ga0209759_1000150 Ga0209759_10001503 448
751 3300025256 Ga0209759_1001282 Ga0209759_100128210 448
752 3300025256 Ga0209759_1002505 Ga0209759_10025052 448
753 3300025258 Ga0209129_1001319 Ga0209129_10013193 448
754 3300025261 Ga0209233_1000144 Ga0209233_1000144103 448
755 3300025272 Ga0209455_1000011 Ga0209455_1000011747 448
756 3300025272 Ga0209455_1000090 Ga0209455_1000090103 448
757 3300025272 Ga0209455_1000217 Ga0209455_100021793 448
758 3300025273 Ga0209673_1000098 Ga0209673_100009883 448
759 3300025292 Ga0209676_1000209 Ga0209676_100020925 448
760 3300025294 Ga0209025_1000813 Ga0209025_100081340 448
761 3300025295 Ga0209564_1001781 Ga0209564_10017813 448
762 3300025303 Ga0209051_1000156 Ga0209051_100015688 448
763 3300025304 Ga0209257_1005802 Ga0209257_10058026 448
764 3300025735 Ga0207713_1002778 Ga0207713_10027785 448
765 3300025904 Ga0207647_10000268 Ga0207647_1000026816 448
766 3300025904 Ga0207647_10002039 Ga0207647_1000203913 448
767 3300025904 Ga0207647_10010211 Ga0207647_100102115 448
768 3300025904 Ga0207647_10031198 Ga0207647_100311983 448
769 3300025909 Ga0207705_10000507 Ga0207705_1000050716 448
770 3300025909 Ga0207705_10022476 Ga0207705_100224762 448
771 3300025913 Ga0207695_10001731 Ga0207695_100017313 448
772 3300025913 Ga0207695_10002973 Ga0207695_1000297320 448
773 3300025913 Ga0207695_10009514 Ga0207695_100095143 448
774 3300025913 Ga0207695_10204926 Ga0207695_102049262 448
775 3300025914 Ga0207671_10029941 Ga0207671_100299413 448
776 3300025919 Ga0207657_10000096 Ga0207657_100000967 448
777 3300025919 Ga0207657_10000131 Ga0207657_1000013153 448
778 3300025924 Ga0207694_10003396 Ga0207694_100033963 448
779 3300025932 Ga0207690_10000074 Ga0207690_1000007472 448
780 3300025935 Ga0207709_10000340 Ga0207709_1000034027 448
781 3300025935 Ga0207709_10003792 Ga0207709_100037926 448
782 3300025945 Ga0207679_10000048 Ga0207679_1000004826 448
783 3300025949 Ga0207667_10002648 Ga0207667_100026484 448
784 3300025949 Ga0207667_10005862 Ga0207667_100058624 448
785 3300025949 Ga0207667_10012499 Ga0207667_1001249915 448
786 3300025981 Ga0207640_10000056 Ga0207640_1000005625 448
787 3300025986 Ga0207658_10038699 Ga0207658_100386991 448
788 3300026067 Ga0207678_10000044 Ga0207678_1000004450 448
789 3300026067 Ga0207678_10000061 Ga0207678_1000006177 448
790 3300026078 Ga0207702_10000118 Ga0207702_1000011850 448
791 3300026078 Ga0207702_10157197 Ga0207702_101571971 448
792 3300026116 Ga0207674_10019497 Ga0207674_100194976 448
793 3300026142 Ga0207698_10030662 Ga0207698_100306622 448
794 3300027312 Ga0209371_1000141 Ga0209371_100014149 448
795 3300028380 Ga0268265_10125247 Ga0268265_101252472 448
796 3300030500 Ga0268256_1000205 Ga0268256_100020533 448
797 3300031731 Ga0307405_10127124 Ga0307405_101271242 448
798 3300031911 Ga0307412_10000041 Ga0307412_1000004166 448
799 3300031911 Ga0307412_10005486 Ga0307412_100054865 448
800 3300037312 Ga0395899_0000008 Ga0395899_0000008_332433_333779 448
801 3300037312 Ga0395899_0086569 Ga0395899_0086569_352_1698 448
802 3300037418 Ga0395900_0000403 Ga0395900_0000403_47340_48725 448
803 3300037418 Ga0395900_0000852 Ga0395900_0000852_18433_19779 448
804 3300037418 Ga0395900_0002738 Ga0395900_0002738_4925_6271 448
805 3300037466 Ga0395898_0000119 Ga0395898_0000119_15183_16568 448
806 3300037466 Ga0395898_0001709 Ga0395898_0001709_15275_16621 448
807 3300037466 Ga0395898_0003327 Ga0395898_0003327_10936_12282 448
808 3300037466 Ga0395898_0191237 Ga0395898_0191237_106_1452 448
809 3300038443 Ga0395901_0000003 Ga0395901_0000003_463320_464666 448
810 3300038443 Ga0395901_0000513 Ga0395901_0000513_16147_17493 448
811 3300038443 Ga0395901_0084725 Ga0395901_0084725_43_1389 448
812 3300038443 Ga0395901_0108385 Ga0395901_0108385_129_1475 448
813 3300039062 Ga0400483_054056 Ga0400483_054056_542_1888 448
814 3300044656 Ga0466969_0006601 Ga0466969_0006601_3029_4375 448
815 3300044656 Ga0466969_0009992 Ga0466969_0009992_814_2160 448
816 3300044656 Ga0466969_0011180 Ga0466969_0011180_3330_4676 448
817 3300044656 Ga0466969_0067610 Ga0466969_0067610_244_1590 448
818 3300044658 Ga0466972_0003987 Ga0466972_0003987_3288_4637 448
819 3300044683 Ga0466965_0000232 Ga0466965_0000232_15671_17017 448
820 3300044683 Ga0466965_0006542 Ga0466965_0006542_3178_4524 448
821 3300044684 Ga0466966_0000032 Ga0466966_0000032_45937_47283 448
822 3300044684 Ga0466966_0002601 Ga0466966_0002601_4970_6316 448
823 3300044684 Ga0466966_0011885 Ga0466966_0011885_1862_3208 448
824 3300044684 Ga0466966_0032793 Ga0466966_0032793_311_1657 448
825 3300044684 Ga0466966_0067163 Ga0466966_0067163_102_1448 448
826 3300044693 Ga0466961_0000657 Ga0466961_0000657_15109_16455 448
827 3300044693 Ga0466961_0020603 Ga0466961_0020603_466_1812 448
828 3300044693 Ga0466961_0023220 Ga0466961_0023220_2630_3976 448
829 3300044693 Ga0466961_0035716 Ga0466961_0035716_359_1705 448
830 3300044693 Ga0466961_0079650 Ga0466961_0079650_270_1616 448
831 3300044694 Ga0466963_0002456 Ga0466963_0002456_4749_6095 448
832 3300044694 Ga0466963_0005994 Ga0466963_0005994_2492_3838 448
833 3300044694 Ga0466963_0007860 Ga0466963_0007860_1702_3048 448
834 3300044719 Ga0466971_0005046 Ga0466971_0005046_2696_4042 448
835 3300044719 Ga0466971_0009656 Ga0466971_0009656_2207_3553 448
836 3300044765 Ga0466970_0012648 Ga0466970_0012648_1242_2588 448
837 3300044842 Ga0466957_0002651 Ga0466957_0002651_3914_5260 448
838 3300044842 Ga0466957_0006103 Ga0466957_0006103_4291_5637 448
839 3300044842 Ga0466957_0031806 Ga0466957_0031806_222_1568 448
840 3300044842 Ga0466957_0038144 Ga0466957_0038144_671_2017 448
841 3300045049 Ga0466959_0003280 Ga0466959_0003280_842_2188 448
842 3300045049 Ga0466959_0022443 Ga0466959_0022443_2201_3547 448
843 3300045049 Ga0466959_0038267 Ga0466959_0038267_1412_2758 448
844 3300045049 Ga0466959_0065456 Ga0466959_0065456_1018_2364 448
845 3300045836 Ga0466958_0000632 Ga0466958_0000632_1204_2550 448
846 3300045836 Ga0466958_0022805 Ga0466958_0022805_512_1858 448
847 3300045836 Ga0466958_0027455 Ga0466958_0027455_1825_3171 448
848 3300045836 Ga0466958_0065769 Ga0466958_0065769_44_1390 448
849 3300046457 Ga0495590_0002335 Ga0495590_0002335_4989_6335 448
850 3300046459 Ga0495629_0000090 Ga0495629_0000090_57861_59207 448
851 3300046463 Ga0495653_0003933 Ga0495653_0003933_194_1540 448
852 3300046463 Ga0495653_0024890 Ga0495653_0024890_2633_3982 448
853 3300046463 Ga0495653_0028956 Ga0495653_0028956_298_1644 448
854 3300046471 Ga0495650_0003397 Ga0495650_0003397_1466_2848 448
855 3300046471 Ga0495650_0011784 Ga0495650_0011784_809_2155 448
856 3300046472 Ga0495580_0019025 Ga0495580_0019025_1586_2932 448
857 3300046473 Ga0495582_0001835 Ga0495582_0001835_2273_3697 448
858 3300046473 Ga0495582_0002030 Ga0495582_0002030_9547_10896 448
859 3300046473 Ga0495582_0007822 Ga0495582_0007822_3376_4722 448
860 3300046474 Ga0495605_0004462 Ga0495605_0004462_5806_7197 448
861 3300046474 Ga0495605_0009224 Ga0495605_0009224_3520_4866 448
862 3300046474 Ga0495605_0021138 Ga0495605_0021138_209_1633 448
863 3300046492 Ga0495585_0002882 Ga0495585_0002882_5733_7079 448
864 3300046492 Ga0495585_0029307 Ga0495585_0029307_899_2251 448
865 3300046500 Ga0495596_0008654 Ga0495596_0008654_2037_3383 448
866 3300046500 Ga0495596_0036320 Ga0495596_0036320_387_1733 448
867 3300046501 Ga0495607_0023128 Ga0495607_0023128_169_1515 448
868 3300046506 Ga0495583_0000951 Ga0495583_0000951_25034_26386 448
869 3300046507 Ga0495606_0018336 Ga0495606_0018336_3098_4444 448
870 3300046511 Ga0495608_0044959 Ga0495608_0044959_1420_2766 448
871 3300046512 Ga0495610_0001768 Ga0495610_0001768_17401_18747 448
872 3300046513 Ga0495616_0000033 Ga0495616_0000033_111454_112806 448
873 3300046513 Ga0495616_0030556 Ga0495616_0030556_518_1942 448
874 3300046515 Ga0495620_0020860 Ga0495620_0020860_1519_2865 448
875 3300046515 Ga0495620_0028877 Ga0495620_0028877_603_1949 448
876 3300046516 Ga0495628_0105372 Ga0495628_0105372_438_1784 448
877 3300046522 Ga0495643_0000235 Ga0495643_0000235_42949_44301 448
878 3300046526 Ga0495666_0000765 Ga0495666_0000765_9160_10506 448
879 3300046526 Ga0495666_0016240 Ga0495666_0016240_1428_2774 448
880 3300046529 Ga0495652_0009813 Ga0495652_0009813_5656_7002 448
881 3300046529 Ga0495652_0012823 Ga0495652_0012823_5745_7094 448
882 3300046531 Ga0495665_0004698 Ga0495665_0004698_352_1698 448
883 3300046535 Ga0495586_0055206 Ga0495586_0055206_457_1803 448
884 3300046542 Ga0495597_0022828 Ga0495597_0022828_1286_2638 448
885 3300046558 Ga0495633_0000972 Ga0495633_0000972_64_1410 448
886 3300046616 Ga0495668_0004172 Ga0495668_0004172_2937_4289 448
887 3300046642 Ga0495634_0029714 Ga0495634_0029714_188_1537 448
888 3300046648 Ga0495611_0001185 Ga0495611_0001185_496_1848 448
889 3300046660 Ga0495625_0002740 Ga0495625_0002740_14928_16310 448
890 3300046660 Ga0495625_0028510 Ga0495625_0028510_2186_3532 448
891 3300046660 Ga0495625_0094102 Ga0495625_0094102_305_1651 448
892 3300046665 Ga0495661_0051845 Ga0495661_0051845_227_1573 448
893 3300046678 Ga0495599_0016623 Ga0495599_0016623_1358_2704 448
894 3300046678 Ga0495599_0049812 Ga0495599_0049812_882_2228 448
895 3300046679 Ga0495623_0006865 Ga0495623_0006865_4996_6345 448
896 3300046679 Ga0495623_0100419 Ga0495623_0100419_194_1540 448
897 3300046680 Ga0495646_0013320 Ga0495646_0013320_2347_3693 448
898 3300046690 Ga0495624_0004165 Ga0495624_0004165_6041_7387 448
899 3300046691 Ga0495670_0000352 Ga0495670_0000352_4731_6077 448
900 3300046694 Ga0495649_0021523 Ga0495649_0021523_1239_2585 448
901 3300046809 Ga0495600_0003391 Ga0495600_0003391_5683_7029 448
902 3300047315 Ga0495581_0001752 Ga0495581_0001752_1154_2500 448
903 3300047315 Ga0495581_0014849 Ga0495581_0014849_1955_3379 448
904 3300047317 Ga0495604_0120124 Ga0495604_0120124_364_1710 448
905 3300047319 Ga0495674_0013974 Ga0495674_0013974_6042_7388 448
906 3300047320 Ga0495672_0000021 Ga0495672_0000021_308941_310287 448
907 3300047320 Ga0495672_0016952 Ga0495672_0016952_1885_3231 448
908 3300047321 Ga0495676_0022324 Ga0495676_0022324_3968_5314 448
909 3300047322 Ga0495680_0007534 Ga0495680_0007534_6922_8268 448
910 3300047443 Ga0495687_051433 Ga0495687_051433_315_1661 448
911 3300047444 Ga0495675_0008686 Ga0495675_0008686_3593_4942 448
912 3300047444 Ga0495675_0040703 Ga0495675_0040703_256_1602 448
913 3300047445 Ga0495677_0000122 Ga0495677_0000122_3988_5376 448
914 3300047445 Ga0495677_0015528 Ga0495677_0015528_51_1475 448
915 3300047445 Ga0495677_0016615 Ga0495677_0016615_396_1748 448
916 3300047446 Ga0495679_000026 Ga0495679_000026_68912_70258 448
917 3300047469 Ga0495673_0000159 Ga0495673_0000159_1817_3163 448
918 3300048088 Ga0495602_0020757 Ga0495602_0020757_4386_5735 448
919 3300048088 Ga0495602_0065168 Ga0495602_0065168_297_1643 448
920 3300048088 Ga0495602_0122255 Ga0495602_0122255_221_1567 448
921 3300048089 Ga0495614_0024192 Ga0495614_0024192_1083_2429 448
922 3300048091 Ga0495626_0000005 Ga0495626_0000005_44872_46263 448
923 3300048091 Ga0495626_0001680 Ga0495626_0001680_11797_13149 448
924 3300048091 Ga0495626_0003666 Ga0495626_0003666_7481_8872 448
925 3300048091 Ga0495626_0032541 Ga0495626_0032541_543_1940 448
926 3300048906 Ga0496103_0013324 Ga0496103_0013324_2287_3633 448
927 3300048913 Ga0496110_0052338 Ga0496110_0052338_1396_2757 448
928 3300048914 Ga0496111_0022480 Ga0496111_0022480_683_2029 448
929 3300048919 Ga0496116_0085350 Ga0496116_0085350_65_1411 448
930 3300048920 Ga0496117_0000045 Ga0496117_0000045_274509_275855 448
931 3300048921 Ga0496118_0000041 Ga0496118_0000041_274509_275855 448
932 3300048921 Ga0496118_0002435 Ga0496118_0002435_8738_10084 448
933 3300048921 Ga0496118_0043171 Ga0496118_0043171_1834_3180 448
934 3300048924 Ga0496121_0001068 Ga0496121_0001068_37928_39373 448
935 3300048924 Ga0496121_0002658 Ga0496121_0002658_20495_21841 448
936 3300048925 Ga0496122_0007303 Ga0496122_0007303_3690_5036 448
937 3300048927 Ga0496124_0060810 Ga0496124_0060810_191_1537 448
938 3300048929 Ga0496126_0002836 Ga0496126_0002836_18321_19667 448
939 3300049459 Ga0495678_002185 Ga0495678_002185_6359_7705 448
940 3300049766 Ga0501269_000438 Ga0501269_000438_5973_7319 448
941 3300050493 nmdc:mga0k408_13225_c1 nmdc:mga0k408_13225_c1_1350_2696 448
942 3300050496 nmdc:mga07m45_4736_c1 nmdc:mga07m45_4736_c1_4456_5802 448
943 3300059505 Ga0587083_0000406 Ga0587083_0000406_1870_3216 448
944 3300059511 Ga0587091_006249 Ga0587091_006249_147_1493 448
945 3300059640 Ga0587067_000155 Ga0587067_000155_931_2277 448
946 3300059643 Ga0587072_000294 Ga0587072_000294_1428_2774 448
947 iso_pu_bacteria 2508501125 2509130692 448
948 iso_pu_bacteria 8055301274 8055306425 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05936

T6SS_VasE

Bacterial Type VI secretion, VC_A0110, EvfL, ImpJ, VasE

73

499

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n38-assembly1.cif.gz_B structure of the type vi secretion system tssk-tssf-tssg baseplate subcomplex revealed by cryo-electron microscopy - full map sharpened 0.9009 6 314
6n38-assembly1.cif.gz_D structure of the type vi secretion system tssk-tssf-tssg baseplate subcomplex revealed by cryo-electron microscopy - full map sharpened 0.895 6 314
5mwn-assembly1.cif.gz_C structure of the eaec t6ss component tssk n-terminal domain in complex with llama nanobodies nbk18 and nbk27 0.8841 6 314
6n38-assembly1.cif.gz_B structure of the type vi secretion system tssk-tssf-tssg baseplate subcomplex revealed by cryo-electron microscopy - full map sharpened 0.8811 6 314
6n38-assembly1.cif.gz_D structure of the type vi secretion system tssk-tssf-tssg baseplate subcomplex revealed by cryo-electron microscopy - full map sharpened 0.8809 6 314
ID Description Score Start End Superfamily
af_Q9SB59_29_174_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.598 199 318 1.20.140.40
af_Q84X19_1_116_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5947 201 312 1.20.140.40
af_I1N7G8_11_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5922 201 319 1.20.140.40
af_K7LKV5_39_184_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5878 199 320 1.20.140.40
af_I1K0Z5_29_183_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5822 201 318 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A2V8LVG2-F1-model_v4 Uncharacterized protein 0.9674 354 438
AF-A0A139DLC7-F1-model_v4 Type VI secretion system protein ImpJ 0.9654 357 448
AF-A0A7B4Q2B0-F1-model_v4 Type VI secretion system contractile sheath small subunit 0.9626 345 448
AF-A0A139DLC7-F1-model_v4 Type VI secretion system protein ImpJ 0.9554 357 448
AF-A0A7X2MSG8-F1-model_v4 Type VI secretion system baseplate subunit TssK 0.9508 358 440

Feature Viewer

pLDDT pTM Quality
87.39 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map