F486504

General Info

Members Datasets Scaffolds Average Seq Length
948 286 1896 120

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100904404|Ga0075428_1009044042
Length 123
Sequence MARRRSPSLTDAEARLMTVLWEKKRATVADVVAALHKPSASYSTIQTLLRILETKGYVTHGKEGRAFVYRPVIDQKQARRRALSHLVSRLFNNSPSLLVLNVLEDGQIDPKELERLRKLLVSA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
193 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
249 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
250 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
251 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
252 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
253 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
254 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
259 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
260 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 1.9
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 37.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100904404 3300006844 Bacteria 936
2 MRS1b_contig_1469820 2162886011 Bacteria 1752
3 MBSR1b_contig_4777266 2162886012 Bacteria 844
4 JGI24743J22301_10061709 3300001991 Bacteria 773
5 JGI24742J22300_10070453 3300002244 Unclassified 651
6 Ga0065714_10126792 3300005288 Bacteria 1288
7 Ga0065714_10262160 3300005288 Unclassified 755
8 Ga0065704_10353701 3300005289 Unclassified 806
9 Ga0065712_10008647 3300005290 Bacteria 3231
10 Ga0065712_10013023 3300005290 Bacteria 2499
11 Ga0065712_10020514 3300005290 Unclassified 2500
12 Ga0065712_10069175 3300005290 Bacteria 7819
13 Ga0065712_10088480 3300005290 Bacteria 2517
14 Ga0065712_10152131 3300005290 Bacteria 1347
15 Ga0065712_10172288 3300005290 Bacteria 1228
16 Ga0065712_10371940 3300005290 Unclassified 755
17 Ga0065712_10434567 3300005290 Bacteria 700
18 Ga0065712_10530676 3300005290 Unclassified 630
19 Ga0065715_10039041 3300005293 Bacteria 1513
20 Ga0065715_10098607 3300005293 Unclassified 3520
21 Ga0065715_10102805 3300005293 Bacteria 3073
22 Ga0065715_10129842 3300005293 Bacteria 2038
23 Ga0065715_10300626 3300005293 Bacteria 1042
24 Ga0065715_10328670 3300005293 Bacteria 988
25 Ga0065715_10400888 3300005293 Unclassified 882
26 Ga0065715_10506580 3300005293 Bacteria 775
27 Ga0065715_10793207 3300005293 Bacteria 613
28 Ga0065707_10133369 3300005295 Bacteria 1856
29 Ga0065707_10184427 3300005295 Bacteria 1397
30 Ga0070676_10001254 3300005328 Bacteria 12786
31 Ga0070676_10061661 3300005328 Bacteria 2229
32 Ga0070676_10122498 3300005328 Bacteria 1634
33 Ga0070676_10254472 3300005328 Unclassified 1173
34 Ga0070676_11123243 3300005328 Unclassified 595
35 Ga0070676_11171227 3300005328 Bacteria 583
36 Ga0070683_100002606 3300005329 Bacteria 14417
37 Ga0070683_100014219 3300005329 Bacteria 6956
38 Ga0070683_100135028 3300005329 Unclassified 2336
39 Ga0070683_101278293 3300005329 Bacteria 705
40 Ga0070690_100005072 3300005330 Bacteria 7381
41 Ga0070690_100041798 3300005330 Unclassified 2903
42 Ga0070690_100073766 3300005330 Bacteria 2221
43 Ga0070690_100288443 3300005330 Unclassified 1173
44 Ga0070690_100502203 3300005330 Unclassified 908
45 Ga0070670_100002622 3300005331 Bacteria 14852
46 Ga0070670_100081722 3300005331 Unclassified 2776
47 Ga0070670_100094296 3300005331 Bacteria 2574
48 Ga0070670_100134011 3300005331 Bacteria 2140
49 Ga0070670_100183950 3300005331 Unclassified 1814
50 Ga0070670_100186497 3300005331 Bacteria 1801
51 Ga0070670_101252920 3300005331 Unclassified 678
52 Ga0070677_10000949 3300005333 Bacteria 9387
53 Ga0070677_10211688 3300005333 Unclassified 942
54 Ga0070677_10346694 3300005333 Unclassified 768
55 Ga0070677_10421724 3300005333 Unclassified 708
56 Ga0070677_10573092 3300005333 Bacteria 622
57 Ga0070677_10655986 3300005333 Unclassified 587
58 Ga0068869_100001504 3300005334 Bacteria 13818
59 Ga0068869_100013890 3300005334 Bacteria 5369
60 Ga0068869_100077479 3300005334 Bacteria 2473
61 Ga0068869_100178368 3300005334 Bacteria 1664
62 Ga0068869_100298602 3300005334 Bacteria 1300
63 Ga0068869_100762470 3300005334 Unclassified 829
64 Ga0068869_101525976 3300005334 Bacteria 594
65 Ga0068869_101744548 3300005334 Unclassified 556
66 Ga0070666_10056933 3300005335 Bacteria 2641
67 Ga0070666_10238674 3300005335 Unclassified 1285
68 Ga0070666_10395698 3300005335 Unclassified 993
69 Ga0070666_10469286 3300005335 Unclassified 910
70 Ga0070666_10528958 3300005335 Unclassified 856
71 Ga0070666_11021954 3300005335 Unclassified 613
72 Ga0070680_100649830 3300005336 Unclassified 906
73 Ga0070680_101415561 3300005336 Bacteria 602
74 Ga0070682_100274440 3300005337 Bacteria 1226
75 Ga0070682_101330858 3300005337 Unclassified 611
76 Ga0068868_100077533 3300005338 Bacteria 2659
77 Ga0068868_100174911 3300005338 Bacteria 1779
78 Ga0068868_100390029 3300005338 Unclassified 1200
79 Ga0068868_100501526 3300005338 Unclassified 1063
80 Ga0068868_100939858 3300005338 Bacteria 788
81 Ga0070660_100329954 3300005339 Bacteria 1254
82 Ga0070689_100078156 3300005340 Bacteria 2594
83 Ga0070689_100086565 3300005340 Bacteria 2464
84 Ga0070689_100146787 3300005340 Bacteria 1900
85 Ga0070689_100225724 3300005340 Bacteria 1538
86 Ga0070689_100505817 3300005340 Bacteria 1036
87 Ga0070689_101477236 3300005340 Bacteria 615
88 Ga0070691_10061897 3300005341 Unclassified 1801
89 Ga0070691_10928969 3300005341 Bacteria 538
90 Ga0070687_100005082 3300005343 Bacteria 5305
91 Ga0070687_100201905 3300005343 Unclassified 1205
92 Ga0070687_100640454 3300005343 Unclassified 735
93 Ga0070661_100074073 3300005344 Unclassified 2507
94 Ga0070661_100136054 3300005344 Bacteria 1849
95 Ga0070661_100142507 3300005344 Unclassified 1807
96 Ga0070661_100196054 3300005344 Unclassified 1542
97 Ga0070661_100427631 3300005344 Bacteria 1050
98 Ga0070661_101330041 3300005344 Unclassified 603
99 Ga0070668_100156190 3300005347 Unclassified 1848
100 Ga0070668_100185586 3300005347 Bacteria 1701
101 Ga0070668_100343474 3300005347 Bacteria 1262
102 Ga0070669_100003896 3300005353 Bacteria 10793
103 Ga0070669_100037323 3300005353 Unclassified 3525
104 Ga0070669_100068660 3300005353 Bacteria 2616
105 Ga0070669_100084423 3300005353 Bacteria 2369
106 Ga0070669_100225364 3300005353 Bacteria 1483
107 Ga0070669_100232678 3300005353 Bacteria 1461
108 Ga0070669_101131191 3300005353 Unclassified 675
109 Ga0070669_101430452 3300005353 Bacteria 600
110 Ga0070669_101500392 3300005353 Unclassified 586
111 Ga0070675_100000467 3300005354 Bacteria 27614
112 Ga0070675_100012251 3300005354 Bacteria 6721
113 Ga0070675_100020016 3300005354 Bacteria 5340
114 Ga0070675_100026656 3300005354 Bacteria 4639
115 Ga0070675_100090176 3300005354 Unclassified 2567
116 Ga0070675_100127732 3300005354 Bacteria 2164
117 Ga0070675_100286729 3300005354 Bacteria 1448
118 Ga0070675_100289621 3300005354 Bacteria 1441
119 Ga0070675_100428622 3300005354 Bacteria 1183
120 Ga0070675_100477374 3300005354 Bacteria 1121
121 Ga0070675_100643506 3300005354 Unclassified 963
122 Ga0070675_100663637 3300005354 Unclassified 948
123 Ga0070675_100863365 3300005354 Unclassified 828
124 Ga0070675_100959765 3300005354 Unclassified 784
125 Ga0070675_101410508 3300005354 Unclassified 642
126 Ga0070671_100069843 3300005355 Unclassified 2930
127 Ga0070671_100140341 3300005355 Bacteria 2039
128 Ga0070674_100000491 3300005356 Bacteria 19880
129 Ga0070674_100048465 3300005356 Bacteria 2916
130 Ga0070674_100086415 3300005356 Bacteria 2253
131 Ga0070674_100204698 3300005356 Bacteria 1526
132 Ga0070674_100452298 3300005356 Bacteria 1060
133 Ga0070674_101370600 3300005356 Unclassified 632
134 Ga0070673_100030997 3300005364 Bacteria 4008
135 Ga0070673_100036753 3300005364 Bacteria 3726
136 Ga0070673_100058314 3300005364 Bacteria 3052
137 Ga0070673_100292347 3300005364 Unclassified 1432
138 Ga0070673_100421221 3300005364 Bacteria 1197
139 Ga0070673_100491193 3300005364 Bacteria 1109
140 Ga0070688_100138060 3300005365 Bacteria 1653
141 Ga0070688_100169486 3300005365 Bacteria 1505
142 Ga0070688_100375042 3300005365 Bacteria 1047
143 Ga0070688_101226225 3300005365 Unclassified 603
144 Ga0070659_100342252 3300005366 Unclassified 1253
145 Ga0070659_100424285 3300005366 Bacteria 1125
146 Ga0070659_100767298 3300005366 Unclassified 837
147 Ga0070667_100003902 3300005367 Bacteria 12662
148 Ga0070667_100141680 3300005367 Bacteria 2106
149 Ga0070667_100246560 3300005367 Unclassified 1596
150 Ga0070667_100355318 3300005367 Unclassified 1327
151 Ga0070667_101051705 3300005367 Unclassified 760
152 Ga0070667_101261596 3300005367 Unclassified 692
153 Ga0070713_100011010 3300005436 Bacteria 6565
154 Ga0070701_10026328 3300005438 Bacteria 2835
155 Ga0070701_10047076 3300005438 Bacteria 2220
156 Ga0070701_10160690 3300005438 Bacteria 1301
157 Ga0070705_100298415 3300005440 Bacteria 1153
158 Ga0070700_100020762 3300005441 Unclassified 3811
159 Ga0070700_100536723 3300005441 Unclassified 906
160 Ga0070700_100699875 3300005441 Bacteria 806
161 Ga0070700_100737593 3300005441 Unclassified 787
162 Ga0070700_101771666 3300005441 Unclassified 531
163 Ga0070694_101051413 3300005444 Unclassified 677
164 Ga0070694_101119191 3300005444 Unclassified 657
165 Ga0070663_100046636 3300005455 Bacteria 3067
166 Ga0070663_100055627 3300005455 Unclassified 2833
167 Ga0070663_101886539 3300005455 Unclassified 537
168 Ga0070678_100034080 3300005456 Unclassified 3542
169 Ga0070678_100085995 3300005456 Bacteria 2397
170 Ga0070678_100095476 3300005456 Bacteria 2291
171 Ga0070678_100245047 3300005456 Unclassified 1500
172 Ga0070678_100574119 3300005456 Unclassified 1004
173 Ga0070678_100614849 3300005456 Bacteria 971
174 Ga0070678_100718741 3300005456 Unclassified 901
175 Ga0070678_101397122 3300005456 Unclassified 653
176 Ga0070662_100079503 3300005457 Bacteria 2439
177 Ga0070662_100105400 3300005457 Bacteria 2140
178 Ga0070662_100112458 3300005457 Bacteria 2076
179 Ga0070662_100158366 3300005457 Unclassified 1769
180 Ga0070662_100416772 3300005457 Bacteria 1110
181 Ga0070662_100436160 3300005457 Bacteria 1085
182 Ga0070681_10785329 3300005458 Bacteria 869
183 Ga0070681_11713283 3300005458 Unclassified 555
184 Ga0068867_100002442 3300005459 Bacteria 13060
185 Ga0068867_100086540 3300005459 Bacteria 2371
186 Ga0070685_10004082 3300005466 Bacteria 7379
187 Ga0070685_10165628 3300005466 Bacteria 1413
188 Ga0070707_100030380 3300005468 Bacteria 5144
189 Ga0070707_100218971 3300005468 Bacteria 1854
190 Ga0070707_100483849 3300005468 Bacteria 1199
191 Ga0070698_100202919 3300005471 Bacteria 1918
192 Ga0070699_100256398 3300005518 Bacteria 1564
193 Ga0070684_100023408 3300005535 Bacteria 5166
194 Ga0070684_100111294 3300005535 Bacteria 2456
195 Ga0070672_100023268 3300005543 Unclassified 4564
196 Ga0070672_100025505 3300005543 Unclassified 4385
197 Ga0070672_100041868 3300005543 Bacteria 3524
198 Ga0070672_100043111 3300005543 Bacteria 3477
199 Ga0070672_100057400 3300005543 Unclassified 3055
200 Ga0070672_100155475 3300005543 Unclassified 1894
201 Ga0070672_100229808 3300005543 Bacteria 1558
202 Ga0070672_100243606 3300005543 Bacteria 1513
203 Ga0070672_100327169 3300005543 Unclassified 1303
204 Ga0070672_100402528 3300005543 Bacteria 1173
205 Ga0070672_101241751 3300005543 Unclassified 664
206 Ga0070686_100013076 3300005544 Unclassified 4739
207 Ga0070686_100218869 3300005544 Bacteria 1375
208 Ga0070686_100419156 3300005544 Unclassified 1022
209 Ga0070686_100481961 3300005544 Unclassified 959
210 Ga0070686_100560110 3300005544 Bacteria 895
211 Ga0070686_100650368 3300005544 Bacteria 836
212 Ga0070686_100831928 3300005544 Bacteria 746
213 Ga0070686_101574805 3300005544 Bacteria 555
214 Ga0070695_100155859 3300005545 Bacteria 1598
215 Ga0070696_101569605 3300005546 Bacteria 565
216 Ga0070693_100229151 3300005547 Bacteria 1221
217 Ga0070665_100109840 3300005548 Unclassified 2760
218 Ga0070665_100372817 3300005548 Bacteria 1434
219 Ga0070665_100496029 3300005548 Bacteria 1232
220 Ga0070665_100746417 3300005548 Bacteria 992
221 Ga0070704_100427692 3300005549 Unclassified 1135
222 Ga0070704_100487390 3300005549 Bacteria 1068
223 Ga0070704_100589979 3300005549 Unclassified 975
224 Ga0070704_100649586 3300005549 Bacteria 931
225 Ga0068855_102091389 3300005563 Bacteria 570
226 Ga0070664_100000606 3300005564 Bacteria 27440
227 Ga0070664_100002910 3300005564 Bacteria 13857
228 Ga0070664_100083267 3300005564 Bacteria 2760
229 Ga0070664_100663503 3300005564 Unclassified 970
230 Ga0070664_102147117 3300005564 Unclassified 530
231 Ga0068857_100044763 3300005577 Bacteria 3927
232 Ga0068857_101220585 3300005577 Unclassified 728
233 Ga0068857_101334974 3300005577 Unclassified 697
234 Ga0068857_101944647 3300005577 Unclassified 576
235 Ga0068854_100099104 3300005578 Bacteria 2182
236 Ga0068854_100251761 3300005578 Unclassified 1411
237 Ga0070702_100060353 3300005615 Unclassified 2204
238 Ga0070702_100347273 3300005615 Bacteria 1044
239 Ga0068852_100907317 3300005616 Bacteria 898
240 Ga0068852_100988870 3300005616 Unclassified 860
241 Ga0068859_100014295 3300005617 Bacteria 7962
242 Ga0068859_100028902 3300005617 Bacteria 5561
243 Ga0068859_100092755 3300005617 Bacteria 3071
244 Ga0068859_100127674 3300005617 Bacteria 2613
245 Ga0068859_100160498 3300005617 Bacteria 2327
246 Ga0068859_100320341 3300005617 Bacteria 1644
247 Ga0068859_102257945 3300005617 Unclassified 600
248 Ga0068859_103051866 3300005617 Unclassified 511
249 Ga0068859_103132079 3300005617 Unclassified 504
250 Ga0068864_100070686 3300005618 Unclassified 3037
251 Ga0068864_100130892 3300005618 Bacteria 2253
252 Ga0068864_100285592 3300005618 Bacteria 1541
253 Ga0068864_100479132 3300005618 Bacteria 1194
254 Ga0068864_101166344 3300005618 Unclassified 768
255 Ga0068866_10068979 3300005718 Bacteria 1861
256 Ga0068866_10371717 3300005718 Unclassified 914
257 Ga0068866_10965807 3300005718 Unclassified 603
258 Ga0068866_11008781 3300005718 Unclassified 592
259 Ga0068861_100012184 3300005719 Bacteria 5994
260 Ga0068861_100133201 3300005719 Bacteria 2020
261 Ga0068861_100181154 3300005719 Unclassified 1754
262 Ga0068861_100268232 3300005719 Bacteria 1465
263 Ga0068861_100324364 3300005719 Unclassified 1342
264 Ga0068861_100532186 3300005719 Bacteria 1068
265 Ga0068861_101915194 3300005719 Unclassified 590
266 Ga0068851_10134143 3300005834 Unclassified 1341
267 Ga0068870_10005383 3300005840 Bacteria 5586
268 Ga0068870_10005841 3300005840 Bacteria 5401
269 Ga0068870_10051187 3300005840 Unclassified 2186
270 Ga0068870_10089401 3300005840 Unclassified 1719
271 Ga0068870_10102988 3300005840 Bacteria 1617
272 Ga0068870_10327211 3300005840 Unclassified 976
273 Ga0068863_100024735 3300005841 Bacteria 5727
274 Ga0068863_100140511 3300005841 Unclassified 2308
275 Ga0068863_100216863 3300005841 Bacteria 1843
276 Ga0068863_100227996 3300005841 Unclassified 1796
277 Ga0068863_100363078 3300005841 Unclassified 1412
278 Ga0068863_100511307 3300005841 Unclassified 1183
279 Ga0068863_100871337 3300005841 Unclassified 900
280 Ga0068858_100023718 3300005842 Bacteria 5716
281 Ga0068858_100049292 3300005842 Unclassified 3900
282 Ga0068858_100059912 3300005842 Bacteria 3519
283 Ga0068858_100461759 3300005842 Bacteria 1224
284 Ga0068858_100518221 3300005842 Unclassified 1153
285 Ga0068858_100786955 3300005842 Unclassified 928
286 Ga0068858_100990700 3300005842 Unclassified 823
287 Ga0068858_101784374 3300005842 Unclassified 608
288 Ga0068860_100023778 3300005843 Bacteria 5923
289 Ga0068860_100043337 3300005843 Bacteria 4293
290 Ga0068860_100228310 3300005843 Bacteria 1809
291 Ga0068862_100060237 3300005844 Unclassified 3260
292 Ga0068862_100065619 3300005844 Bacteria 3127
293 Ga0068862_100124280 3300005844 Unclassified 2277
294 Ga0068862_100163198 3300005844 Bacteria 1990
295 Ga0068862_100296227 3300005844 Bacteria 1487
296 Ga0068862_100411399 3300005844 Unclassified 1267
297 Ga0068862_100664331 3300005844 Unclassified 1006
298 Ga0068862_100806443 3300005844 Unclassified 917
299 Ga0068862_100923557 3300005844 Unclassified 859
300 Ga0081455_10201661 3300005937 Bacteria 1489
301 Ga0081455_10230537 3300005937 Bacteria 1367
302 Ga0081539_10023342 3300005985 Bacteria 4053
303 Ga0075365_10461606 3300006038 Bacteria 897
304 Ga0075368_10011775 3300006042 Unclassified 3189
305 Ga0075368_10253908 3300006042 Bacteria 752
306 Ga0075363_100081975 3300006048 Unclassified 1765
307 Ga0075364_10001583 3300006051 Bacteria 12446
308 Ga0075364_10019608 3300006051 Bacteria 4245
309 Ga0070716_101429103 3300006173 Unclassified 563
310 Ga0075362_10001521 3300006177 Bacteria 7464
311 Ga0075362_10322772 3300006177 Bacteria 769
312 Ga0075367_10056285 3300006178 Bacteria 2336
313 Ga0075367_10259555 3300006178 Bacteria 1091
314 Ga0075366_10030941 3300006195 Unclassified 3148
315 Ga0097621_100177794 3300006237 Bacteria 1837
316 Ga0097621_100857818 3300006237 Unclassified 844
317 Ga0068871_100078898 3300006358 Unclassified 2723
318 Ga0068871_100574212 3300006358 Unclassified 1023
319 Ga0068871_100578136 3300006358 Unclassified 1020
320 Ga0068871_100951147 3300006358 Bacteria 798
321 Ga0075428_100021582 3300006844 Bacteria 7130
322 Ga0075428_100024112 3300006844 Bacteria 6731
323 Ga0075428_100030694 3300006844 Bacteria 5943
324 Ga0075428_100046023 3300006844 Bacteria 4793
325 Ga0075428_100107426 3300006844 Bacteria 3042
326 Ga0075428_100957766 3300006844 Bacteria 907
327 Ga0075428_101077953 3300006844 Unclassified 849
328 Ga0075430_100000381 3300006846 Bacteria 32603
329 Ga0075430_100017066 3300006846 Bacteria 6184
330 Ga0075430_100027629 3300006846 Unclassified 4820
331 Ga0075430_100157053 3300006846 Unclassified 1893
332 Ga0075430_100198308 3300006846 Bacteria 1667
333 Ga0075430_100245875 3300006846 Bacteria 1482
334 Ga0075430_100259165 3300006846 Bacteria 1440
335 Ga0075430_100349720 3300006846 Unclassified 1221
336 Ga0075430_100838057 3300006846 Bacteria 758
337 Ga0075431_100028983 3300006847 Bacteria 5693
338 Ga0075431_100063927 3300006847 Unclassified 3799
339 Ga0075431_100077513 3300006847 Bacteria 3430
340 Ga0075431_100217275 3300006847 Bacteria 1951
341 Ga0075431_100265425 3300006847 Bacteria 1741
342 Ga0075431_100359241 3300006847 Bacteria 1463
343 Ga0075431_101085650 3300006847 Unclassified 765
344 Ga0075431_101112488 3300006847 Bacteria 754
345 Ga0075431_101456405 3300006847 Unclassified 644
346 Ga0075433_10003919 3300006852 Bacteria 11527
347 Ga0075433_10007867 3300006852 Bacteria 8477
348 Ga0075433_10016986 3300006852 Bacteria 6015
349 Ga0075433_10052006 3300006852 Bacteria 3569
350 Ga0075433_10127222 3300006852 Bacteria 2262
351 Ga0075433_10160849 3300006852 Bacteria 1998
352 Ga0075433_10892871 3300006852 Unclassified 775
353 Ga0075434_100001674 3300006871 Bacteria 18918
354 Ga0075434_100002425 3300006871 Bacteria 16382
355 Ga0075434_100011874 3300006871 Bacteria 8234
356 Ga0075434_100127669 3300006871 Bacteria 2560
357 Ga0075434_100669260 3300006871 Bacteria 1056
358 Ga0075429_100010675 3300006880 Bacteria 7945
359 Ga0075429_100029575 3300006880 Bacteria 4757
360 Ga0075429_100033199 3300006880 Bacteria 4484
361 Ga0075429_100059027 3300006880 Unclassified 3341
362 Ga0075429_100086776 3300006880 Bacteria 2727
363 Ga0075429_100123191 3300006880 Bacteria 2267
364 Ga0075429_100303320 3300006880 Bacteria 1398
365 Ga0075429_100436955 3300006880 Bacteria 1147
366 Ga0075429_100528163 3300006880 Bacteria 1034
367 Ga0075429_100612478 3300006880 Archaea 954
368 Ga0075429_100839716 3300006880 Bacteria 804
369 Ga0075429_100973819 3300006880 Bacteria 742
370 Ga0068865_100001195 3300006881 Bacteria 15109
371 Ga0068865_100166199 3300006881 Bacteria 1687
372 Ga0068865_100428535 3300006881 Bacteria 1089
373 Ga0068865_101573658 3300006881 Unclassified 590
374 Ga0075436_100026485 3300006914 Bacteria 3993
375 Ga0097620_100014295 3300006931 Bacteria 7962
376 Ga0097620_100028899 3300006931 Bacteria 5561
377 Ga0097620_100092762 3300006931 Bacteria 3071
378 Ga0097620_100127676 3300006931 Bacteria 2613
379 Ga0097620_100160505 3300006931 Bacteria 2327
380 Ga0097620_100320361 3300006931 Bacteria 1644
381 Ga0097620_102258623 3300006931 Unclassified 600
382 Ga0097620_103053001 3300006931 Unclassified 511
383 Ga0097620_103130200 3300006931 Unclassified 504
384 Ga0075435_100000529 3300007076 Bacteria 23351
385 Ga0075435_100049031 3300007076 Bacteria 3395
386 Ga0075435_100084838 3300007076 Bacteria 2607
387 Ga0075435_100519298 3300007076 Bacteria 1030
388 Ga0075435_100987766 3300007076 Bacteria 735
389 Ga0105250_10605246 3300009092 Unclassified 508
390 Ga0105240_10128528 3300009093 Unclassified 3042
391 Ga0111539_10000494 3300009094 Bacteria 50039
392 Ga0111539_10009794 3300009094 Bacteria 12097
393 Ga0111539_10015632 3300009094 Bacteria 9436
394 Ga0111539_10018753 3300009094 Bacteria 8563
395 Ga0111539_10029112 3300009094 Bacteria 6733
396 Ga0111539_10382222 3300009094 Bacteria 1639
397 Ga0111539_10462712 3300009094 Bacteria 1477
398 Ga0111539_10552032 3300009094 Bacteria 1342
399 Ga0111539_10636789 3300009094 Unclassified 1241
400 Ga0111539_10788614 3300009094 Bacteria 1106
401 Ga0111539_12275583 3300009094 Bacteria 629
402 Ga0105245_10515069 3300009098 Bacteria 1214
403 Ga0105247_10507934 3300009101 Bacteria 879
404 Ga0114129_10003590 3300009147 Bacteria 21835
405 Ga0114129_10021096 3300009147 Bacteria 9249
406 Ga0114129_10054212 3300009147 Bacteria 5623
407 Ga0114129_10059233 3300009147 Bacteria 5355
408 Ga0114129_10178827 3300009147 Bacteria 2888
409 Ga0114129_10396758 3300009147 Bacteria 1819
410 Ga0114129_10778078 3300009147 Unclassified 1223
411 Ga0114129_11116002 3300009147 Unclassified 987
412 Ga0114129_12473771 3300009147 Unclassified 621
413 Ga0114129_12648300 3300009147 Unclassified 598
414 Ga0114129_12976913 3300009147 Bacteria 558
415 Ga0114129_13304188 3300009147 Bacteria 521
416 Ga0105243_10005296 3300009148 Bacteria 10082
417 Ga0105242_10008489 3300009176 Bacteria 7888
418 Ga0105242_10371526 3300009176 Bacteria 1326
419 Ga0105248_10022383 3300009177 Bacteria 7011
420 Ga0105248_10101388 3300009177 Bacteria 3245
421 Ga0105248_10598323 3300009177 Unclassified 1244
422 Ga0105248_11000735 3300009177 Bacteria 944
423 Ga0105248_11242140 3300009177 Bacteria 842
424 Ga0105248_11507280 3300009177 Bacteria 761
425 Ga0105248_11954321 3300009177 Unclassified 666
426 Ga0105248_11957423 3300009177 Unclassified 665
427 Ga0105248_12680255 3300009177 Bacteria 568
428 Ga0105238_10025451 3300009551 Bacteria 6033
429 Ga0105249_10006207 3300009553 Bacteria 10377
430 Ga0105249_10006397 3300009553 Bacteria 10243
431 Ga0105249_10092786 3300009553 Bacteria 2827
432 Ga0105249_10214005 3300009553 Unclassified 1893
433 Ga0105249_12513866 3300009553 Unclassified 587
434 Ga0105239_10399457 3300010375 Unclassified 1555
435 Ga0105239_11213422 3300010375 Bacteria 869
436 Ga0105239_12911687 3300010375 Unclassified 558
437 Ga0105239_13203481 3300010375 Unclassified 533
438 Ga0105246_10064683 3300011119 Bacteria 2556
439 Ga0105246_10124532 3300011119 Bacteria 1915
440 Ga0105246_10522026 3300011119 Unclassified 1012
441 Ga0105246_10760213 3300011119 Bacteria 856
442 Ga0105246_11071577 3300011119 Unclassified 734
443 Ga0157327_1068635 3300012512 Unclassified 545
444 Ga0157371_11536167 3300013102 Unclassified 520
445 Ga0157374_10620294 3300013296 Bacteria 1092
446 Ga0157378_12591470 3300013297 Unclassified 559
447 Ga0163162_10006298 3300013306 Bacteria 11493
448 Ga0163162_10384030 3300013306 Unclassified 1538
449 Ga0163162_10564827 3300013306 Unclassified 1265
450 Ga0163162_11776474 3300013306 Unclassified 705
451 Ga0157372_11759736 3300013307 Bacteria 713
452 Ga0157375_10078212 3300013308 Bacteria 3340
453 Ga0157375_10386166 3300013308 Unclassified 1567
454 Ga0157375_10391705 3300013308 Bacteria 1556
455 Ga0157375_10435600 3300013308 Bacteria 1477
456 Ga0157375_10684903 3300013308 Bacteria 1180
457 Ga0157375_11164989 3300013308 Unclassified 903
458 Ga0157375_12741978 3300013308 Unclassified 589
459 Ga0163163_10008904 3300014325 Bacteria 8939
460 Ga0163163_10030919 3300014325 Bacteria 5163
461 Ga0163163_10197293 3300014325 Bacteria 2061
462 Ga0163163_10405990 3300014325 Bacteria 1421
463 Ga0163163_11647533 3300014325 Unclassified 702
464 Ga0157380_10005599 3300014326 Bacteria 8775
465 Ga0157380_10055348 3300014326 Unclassified 3150
466 Ga0157380_10083044 3300014326 Bacteria 2623
467 Ga0157380_10191414 3300014326 Bacteria 1806
468 Ga0157380_10654259 3300014326 Bacteria 1049
469 Ga0157380_10684864 3300014326 Bacteria 1028
470 Ga0157380_10775880 3300014326 Bacteria 973
471 Ga0157380_11282644 3300014326 Unclassified 779
472 Ga0157380_11657234 3300014326 Bacteria 696
473 Ga0157380_13249353 3300014326 Bacteria 519
474 Ga0157377_10011219 3300014745 Bacteria 4465
475 Ga0157377_10095442 3300014745 Unclassified 1763
476 Ga0157377_10356751 3300014745 Unclassified 983
477 Ga0157377_10485122 3300014745 Unclassified 861
478 Ga0157377_10503830 3300014745 Unclassified 847
479 Ga0157379_10578918 3300014968 Bacteria 1046
480 Ga0157376_10102777 3300014969 Bacteria 2501
481 Ga0157376_10208364 3300014969 Unclassified 1803
482 Ga0157376_10326085 3300014969 Unclassified 1461
483 Ga0157376_12159836 3300014969 Unclassified 595
484 Ga0157376_12403090 3300014969 Bacteria 566
485 Ga0163161_11101613 3300017792 Unclassified 683
486 Ga0207673_1002977 3300025290 Bacteria 1964
487 Ga0207673_1042229 3300025290 Unclassified 641
488 Ga0207697_10000243 3300025315 Bacteria 29799
489 Ga0207697_10001333 3300025315 Bacteria 13543
490 Ga0207697_10081171 3300025315 Unclassified 1366
491 Ga0207697_10083278 3300025315 Bacteria 1349
492 Ga0207656_10129521 3300025321 Bacteria 1181
493 Ga0207682_10002151 3300025893 Bacteria 8934
494 Ga0207682_10013016 3300025893 Unclassified 3243
495 Ga0207682_10039909 3300025893 Bacteria 1910
496 Ga0207682_10560704 3300025893 Bacteria 540
497 Ga0207642_10256002 3300025899 Bacteria 996
498 Ga0207710_10235266 3300025900 Bacteria 912
499 Ga0207688_10001364 3300025901 Bacteria 12684
500 Ga0207688_10001424 3300025901 Bacteria 12474
501 Ga0207688_10386620 3300025901 Unclassified 866
502 Ga0207680_10151463 3300025903 Bacteria 1546
503 Ga0207680_10272902 3300025903 Bacteria 1173
504 Ga0207680_10370454 3300025903 Unclassified 1008
505 Ga0207645_10001527 3300025907 Bacteria 18903
506 Ga0207645_10003570 3300025907 Bacteria 11773
507 Ga0207645_10055134 3300025907 Bacteria 2538
508 Ga0207643_10008602 3300025908 Bacteria 5473
509 Ga0207643_10009092 3300025908 Bacteria 5335
510 Ga0207643_10047439 3300025908 Unclassified 2431
511 Ga0207643_10049896 3300025908 Unclassified 2372
512 Ga0207695_10106246 3300025913 Unclassified 2793
513 Ga0207662_10006061 3300025918 Bacteria 6501
514 Ga0207662_10676503 3300025918 Bacteria 722
515 Ga0207657_10263118 3300025919 Bacteria 1372
516 Ga0207649_10081925 3300025920 Bacteria 2091
517 Ga0207649_10110695 3300025920 Unclassified 1834
518 Ga0207649_10169600 3300025920 Bacteria 1519
519 Ga0207649_10228112 3300025920 Unclassified 1330
520 Ga0207649_10792105 3300025920 Bacteria 739
521 Ga0207646_10260932 3300025922 Bacteria 1566
522 Ga0207681_10003044 3300025923 Bacteria 10539
523 Ga0207681_10006275 3300025923 Bacteria 7298
524 Ga0207681_10028340 3300025923 Unclassified 3627
525 Ga0207681_10092563 3300025923 Bacteria 2161
526 Ga0207681_10212304 3300025923 Bacteria 1492
527 Ga0207681_10323916 3300025923 Unclassified 1226
528 Ga0207681_10959863 3300025923 Bacteria 717
529 Ga0207681_11241698 3300025923 Unclassified 626
530 Ga0207694_10024124 3300025924 Unclassified 4619
531 Ga0207650_10023227 3300025925 Bacteria 4396
532 Ga0207650_10056313 3300025925 Unclassified 2921
533 Ga0207650_10314187 3300025925 Bacteria 1282
534 Ga0207650_10421414 3300025925 Bacteria 1108
535 Ga0207650_11380259 3300025925 Unclassified 599
536 Ga0207659_10000086 3300025926 Bacteria 55279
537 Ga0207659_10011546 3300025926 Bacteria 5583
538 Ga0207659_10030747 3300025926 Unclassified 3672
539 Ga0207659_10055343 3300025926 Bacteria 2837
540 Ga0207659_10060249 3300025926 Bacteria 2731
541 Ga0207659_10067552 3300025926 Bacteria 2597
542 Ga0207659_10133143 3300025926 Unclassified 1921
543 Ga0207659_10144609 3300025926 Unclassified 1850
544 Ga0207659_10199527 3300025926 Bacteria 1597
545 Ga0207659_10288230 3300025926 Bacteria 1344
546 Ga0207659_10665526 3300025926 Unclassified 890
547 Ga0207659_10733591 3300025926 Bacteria 847
548 Ga0207659_11233987 3300025926 Bacteria 642
549 Ga0207644_10047653 3300025931 Unclassified 3059
550 Ga0207644_10114237 3300025931 Unclassified 2046
551 Ga0207644_10115070 3300025931 Bacteria 2039
552 Ga0207644_10130510 3300025931 Unclassified 1923
553 Ga0207690_10397186 3300025932 Bacteria 1099
554 Ga0207690_11314308 3300025932 Unclassified 604
555 Ga0207690_11420107 3300025932 Bacteria 580
556 Ga0207706_10012115 3300025933 Bacteria 7854
557 Ga0207706_10027224 3300025933 Bacteria 5113
558 Ga0207706_10049831 3300025933 Bacteria 3701
559 Ga0207706_10388523 3300025933 Unclassified 1210
560 Ga0207706_10989992 3300025933 Bacteria 707
561 Ga0207706_11146976 3300025933 Unclassified 648
562 Ga0207709_10004665 3300025935 Bacteria 7880
563 Ga0207709_10319137 3300025935 Unclassified 1162
564 Ga0207709_11048718 3300025935 Bacteria 668
565 Ga0207670_10074249 3300025936 Unclassified 2360
566 Ga0207670_10275657 3300025936 Bacteria 1309
567 Ga0207670_10725761 3300025936 Unclassified 824
568 Ga0207669_10001294 3300025937 Bacteria 10621
569 Ga0207669_10166878 3300025937 Unclassified 1562
570 Ga0207669_10295100 3300025937 Bacteria 1229
571 Ga0207669_10627497 3300025937 Unclassified 876
572 Ga0207669_10952926 3300025937 Unclassified 719
573 Ga0207669_11007960 3300025937 Bacteria 700
574 Ga0207704_10011211 3300025938 Unclassified 4405
575 Ga0207704_10047241 3300025938 Unclassified 2572
576 Ga0207704_10645164 3300025938 Unclassified 871
577 Ga0207704_11293446 3300025938 Bacteria 623
578 Ga0207691_10006915 3300025940 Bacteria 10939
579 Ga0207691_10010337 3300025940 Bacteria 8951
580 Ga0207691_10025246 3300025940 Bacteria 5580
581 Ga0207691_10047552 3300025940 Bacteria 3936
582 Ga0207691_10055051 3300025940 Bacteria 3627
583 Ga0207691_10083051 3300025940 Unclassified 2876
584 Ga0207691_10084299 3300025940 Bacteria 2853
585 Ga0207691_10090246 3300025940 Bacteria 2747
586 Ga0207691_10104700 3300025940 Unclassified 2521
587 Ga0207691_10214802 3300025940 Unclassified 1669
588 Ga0207691_10288823 3300025940 Unclassified 1411
589 Ga0207691_11039364 3300025940 Unclassified 683
590 Ga0207711_10009966 3300025941 Bacteria 7897
591 Ga0207711_10863902 3300025941 Bacteria 842
592 Ga0207711_10888563 3300025941 Unclassified 829
593 Ga0207711_11121477 3300025941 Bacteria 728
594 Ga0207689_10000745 3300025942 Bacteria 31211
595 Ga0207689_10019140 3300025942 Bacteria 5773
596 Ga0207689_10293301 3300025942 Bacteria 1347
597 Ga0207689_10716429 3300025942 Unclassified 844
598 Ga0207661_10011846 3300025944 Bacteria 6334
599 Ga0207661_10051001 3300025944 Bacteria 3300
600 Ga0207661_10599423 3300025944 Bacteria 1011
601 Ga0207679_10004503 3300025945 Bacteria 8678
602 Ga0207679_10020215 3300025945 Bacteria 4490
603 Ga0207679_10716169 3300025945 Unclassified 909
604 Ga0207679_11893542 3300025945 Unclassified 544
605 Ga0207651_10005363 3300025960 Bacteria 6574
606 Ga0207651_10011953 3300025960 Bacteria 4884
607 Ga0207651_10169247 3300025960 Bacteria 1721
608 Ga0207651_10203664 3300025960 Unclassified 1588
609 Ga0207651_10323741 3300025960 Unclassified 1289
610 Ga0207651_10348520 3300025960 Bacteria 1246
611 Ga0207712_10010423 3300025961 Bacteria 5900
612 Ga0207712_10334887 3300025961 Bacteria 1253
613 Ga0207712_10810478 3300025961 Bacteria 823
614 Ga0207712_10875321 3300025961 Bacteria 793
615 Ga0207712_11535858 3300025961 Unclassified 596
616 Ga0207668_10207240 3300025972 Bacteria 1566
617 Ga0207668_10396691 3300025972 Bacteria 1165
618 Ga0207668_10449627 3300025972 Unclassified 1099
619 Ga0207668_11847280 3300025972 Unclassified 545
620 Ga0207640_10277277 3300025981 Bacteria 1315
621 Ga0207658_10113637 3300025986 Unclassified 2146
622 Ga0207658_10332233 3300025986 Unclassified 1319
623 Ga0207658_10406133 3300025986 Bacteria 1198
624 Ga0207677_10048093 3300026023 Bacteria 2869
625 Ga0207677_10525201 3300026023 Unclassified 1027
626 Ga0207677_10578936 3300026023 Bacteria 982
627 Ga0207677_10673220 3300026023 Unclassified 915
628 Ga0207703_10021662 3300026035 Bacteria 5031
629 Ga0207703_10093003 3300026035 Unclassified 2539
630 Ga0207703_10988831 3300026035 Unclassified 807
631 Ga0207703_11151462 3300026035 Unclassified 745
632 Ga0207703_11153351 3300026035 Bacteria 745
633 Ga0207639_10606848 3300026041 Bacteria 1010
634 Ga0207678_10140724 3300026067 Unclassified 2059
635 Ga0207708_10008724 3300026075 Bacteria 7504
636 Ga0207708_10021884 3300026075 Bacteria 4824
637 Ga0207708_11558235 3300026075 Unclassified 581
638 Ga0207708_11786005 3300026075 Unclassified 540
639 Ga0207641_10004878 3300026088 Bacteria 11541
640 Ga0207641_10387521 3300026088 Unclassified 1340
641 Ga0207641_10512259 3300026088 Unclassified 1166
642 Ga0207641_10533161 3300026088 Bacteria 1143
643 Ga0207641_10937555 3300026088 Unclassified 861
644 Ga0207641_11201136 3300026088 Unclassified 758
645 Ga0207648_10002951 3300026089 Bacteria 17993
646 Ga0207648_10033722 3300026089 Unclassified 4515
647 Ga0207648_10298607 3300026089 Unclassified 1444
648 Ga0207676_10014288 3300026095 Bacteria 5709
649 Ga0207676_10437226 3300026095 Bacteria 1230
650 Ga0207676_11422976 3300026095 Bacteria 689
651 Ga0207676_11514242 3300026095 Unclassified 668
652 Ga0207674_10035556 3300026116 Bacteria 5199
653 Ga0207674_10053053 3300026116 Bacteria 4133
654 Ga0207674_10063498 3300026116 Bacteria 3728
655 Ga0207674_10831347 3300026116 Unclassified 891
656 Ga0207675_100015971 3300026118 Bacteria 7007
657 Ga0207675_100015987 3300026118 Bacteria 7004
658 Ga0207675_100119212 3300026118 Bacteria 2496
659 Ga0207675_100809454 3300026118 Bacteria 950
660 Ga0207675_100879753 3300026118 Bacteria 911
661 Ga0207675_101012406 3300026118 Unclassified 849
662 Ga0207675_101725653 3300026118 Bacteria 646
663 Ga0207683_10021404 3300026121 Bacteria 5536
664 Ga0207683_10051425 3300026121 Unclassified 3609
665 Ga0207683_10063075 3300026121 Unclassified 3264
666 Ga0207683_10095237 3300026121 Bacteria 2654
667 Ga0207683_10106049 3300026121 Bacteria 2512
668 Ga0207683_10327338 3300026121 Bacteria 1404
669 Ga0207683_10724862 3300026121 Bacteria 922
670 Ga0207683_11159943 3300026121 Bacteria 716
671 Ga0207683_11350293 3300026121 Unclassified 659
672 Ga0207683_11952319 3300026121 Unclassified 535
673 Ga0207698_10090896 3300026142 Unclassified 2497
674 Ga0209996_1061044 3300027395 Unclassified 579
675 Ga0209998_10038529 3300027717 Unclassified 1079
676 Ga0209813_10063770 3300027866 Unclassified 1183
677 Ga0209974_10142265 3300027876 Bacteria 861
678 Ga0207428_10001093 3300027907 Bacteria 29501
679 Ga0207428_10010281 3300027907 Bacteria 8363
680 Ga0207428_10022057 3300027907 Bacteria 5378
681 Ga0207428_10045763 3300027907 Unclassified 3521
682 Ga0207428_10055562 3300027907 Bacteria 3148
683 Ga0207428_10553965 3300027907 Unclassified 831
684 Ga0268266_10326475 3300028379 Bacteria 1437
685 Ga0268266_10853933 3300028379 Unclassified 880
686 Ga0268266_10904600 3300028379 Bacteria 853
687 Ga0268265_10023431 3300028380 Unclassified 4351
688 Ga0268265_10050535 3300028380 Bacteria 3133
689 Ga0268265_10175563 3300028380 Bacteria 1836
690 Ga0268265_10803745 3300028380 Unclassified 917
691 Ga0268265_11078621 3300028380 Unclassified 796
692 Ga0268265_11153195 3300028380 Bacteria 771
693 Ga0268265_11494246 3300028380 Bacteria 679
694 Ga0268264_10561579 3300028381 Bacteria 1121
695 Ga0268264_10606575 3300028381 Bacteria 1079
696 Ga0268264_10955898 3300028381 Unclassified 862
697 Ga0307408_100138673 3300031548 Bacteria 1906
698 Ga0307408_100304921 3300031548 Bacteria 1335
699 Ga0307408_100748457 3300031548 Unclassified 882
700 Ga0307405_10496514 3300031731 Unclassified 977
701 Ga0307405_11028835 3300031731 Unclassified 704
702 Ga0307413_10104206 3300031824 Unclassified 1883
703 Ga0307406_10360641 3300031901 Bacteria 1139
704 Ga0307406_10542220 3300031901 Bacteria 950
705 Ga0307412_10128359 3300031911 Unclassified 1838
706 Ga0307412_10254917 3300031911 Unclassified 1364
707 Ga0307412_10568930 3300031911 Unclassified 955
708 Ga0307409_100282199 3300031995 Unclassified 1536
709 Ga0307409_101053729 3300031995 Unclassified 833
710 Ga0307416_100036917 3300032002 Bacteria 3754
711 Ga0307416_100127029 3300032002 Bacteria 2286
712 Ga0307416_100867176 3300032002 Unclassified 1001
713 Ga0307416_101301490 3300032002 Unclassified 833
714 Ga0307411_10033923 3300032005 Unclassified 3171
715 Ga0307411_10081278 3300032005 Bacteria 2231
716 Ga0307411_10133841 3300032005 Unclassified 1816
717 Ga0307415_100060940 3300032126 Bacteria 2610
718 Ga0373939_0309712 3300035114 Unclassified 632
719 Ga0373961_0125007 3300035241 Bacteria 856
720 Ga0373925_0627984 3300037068 Bacteria 885
721 Ga0395901_1834254 3300038443 Unclassified 555
722 Ga0439453_0004485 3300041408 Unclassified 2076
723 Ga0451807_1190959 3300041486 Unclassified 606
724 Ga0451853_3787570 3300041512 Unclassified 635
725 Ga0439443_054018 3300042003 Bacteria 708
726 Ga0450923_163231 3300042125 Bacteria 543
727 Ga0439435_0025628 3300042436 Unclassified 1565
728 Ga0439435_0219206 3300042436 Unclassified 632
729 Ga0439444_0158341 3300042437 Unclassified 551
730 Ga0439464_0003225 3300042439 Bacteria 4103
731 Ga0439464_0065349 3300042439 Unclassified 1070
732 Ga0439464_0080670 3300042439 Bacteria 971
733 Ga0439464_0182660 3300042439 Unclassified 665
734 Ga0439464_0189327 3300042439 Bacteria 654
735 Ga0439460_0071442 3300042461 Bacteria 1076
736 Ga0439440_0059592 3300042993 Unclassified 972
737 Ga0439440_0154906 3300042993 Bacteria 658
738 Ga0439440_0184126 3300042993 Bacteria 613
739 Ga0453683_0784739 3300044673 Unclassified 627
740 Ga0451576_0210835 3300045051 Unclassified 2029
741 Ga0451576_0224478 3300045051 Bacteria 1961
742 Ga0451576_0294160 3300045051 Bacteria 1698
743 Ga0451576_0967183 3300045051 Bacteria 893
744 Ga0451576_0978122 3300045051 Bacteria 887
745 Ga0451576_2457787 3300045051 Unclassified 532
746 Ga0495603_0249843 3300046455 Bacteria 1021
747 Ga0495629_0060157 3300046459 Bacteria 2655
748 Ga0495629_0878821 3300046459 Unclassified 588
749 Ga0495582_0707872 3300046473 Unclassified 583
750 Ga0495594_0346308 3300046499 Unclassified 846
751 Ga0495598_0052935 3300046537 Unclassified 1228
752 Ga0495621_0058729 3300046539 Unclassified 1392
753 Ga0495633_0138160 3300046558 Unclassified 1127
754 Ga0495656_0271662 3300046615 Bacteria 862
755 Ga0495656_0762560 3300046615 Unclassified 522
756 Ga0495659_0571344 3300046664 Unclassified 500
757 Ga0495658_0152028 3300046683 Bacteria 1422
758 Ga0495658_0940082 3300046683 Unclassified 552
759 Ga0495676_0118714 3300047321 Bacteria 1928
760 Ga0496104_0002583 3300048907 Bacteria 15617
761 Ga0496104_1746660 3300048907 Unclassified 524
762 Ga0496105_0022020 3300048908 Bacteria 5160
763 Ga0496106_0128359 3300048909 Bacteria 1987
764 Ga0496106_1029313 3300048909 Bacteria 647
765 Ga0496108_0013109 3300048911 Bacteria 6757
766 Ga0496108_0490231 3300048911 Bacteria 1073
767 Ga0496108_0891746 3300048911 Unclassified 764
768 Ga0496109_0002509 3300048912 Bacteria 15396
769 Ga0496109_0009658 3300048912 Bacteria 8230
770 Ga0496109_0085461 3300048912 Unclassified 2912
771 Ga0496110_0000061 3300048913 Bacteria 53551
772 Ga0496110_0169124 3300048913 Unclassified 1983
773 Ga0496111_0012063 3300048914 Bacteria 5842
774 Ga0496112_0006189 3300048915 Bacteria 10470
775 Ga0496112_0766301 3300048915 Bacteria 891
776 Ga0496113_0147258 3300048916 Bacteria 1856
777 Ga0501295_115936 3300049518 Unclassified 640
778 Ga0501299_004990 3300049522 Bacteria 2017
779 Ga0501299_028897 3300049522 Unclassified 1059
780 Ga0501031_0094390 3300049568 Bacteria 1952
781 Ga0501033_0135909 3300049570 Bacteria 1779
782 Ga0501034_1234645 3300049571 Unclassified 625
783 Ga0501036_0230677 3300049572 Bacteria 1554
784 Ga0501037_0156150 3300049573 Bacteria 1628
785 Ga0501038_0102695 3300049574 Bacteria 2378
786 Ga0501039_0137293 3300049575 Bacteria 1920
787 Ga0501039_1127612 3300049575 Unclassified 608
788 Ga0501040_0020220 3300049576 Unclassified 4435
789 Ga0501040_0222687 3300049576 Bacteria 1342
790 Ga0501041_0367804 3300049577 Bacteria 909
791 Ga0501041_0378147 3300049577 Bacteria 896
792 Ga0501042_0061085 3300049578 Bacteria 2692
793 Ga0501042_0113762 3300049578 Bacteria 1948
794 Ga0501042_0163954 3300049578 Bacteria 1604
795 Ga0501043_0468183 3300049579 Unclassified 945
796 Ga0501046_0024632 3300049580 Unclassified 4934
797 Ga0501046_0126748 3300049580 Bacteria 1939
798 Ga0501047_0372988 3300049581 Unclassified 1262
799 Ga0501047_0991786 3300049581 Unclassified 653
800 Ga0501048_0311940 3300049582 Bacteria 1120
801 Ga0501048_0430993 3300049582 Unclassified 944
802 Ga0501048_1308639 3300049582 Unclassified 521
803 Ga0501067_0276733 3300049583 Unclassified 935
804 Ga0501070_1381809 3300049586 Unclassified 536
805 Ga0501071_0104754 3300049587 Bacteria 2088
806 Ga0501071_0320611 3300049587 Bacteria 1177
807 Ga0501071_0536835 3300049587 Bacteria 898
808 Ga0501071_0960059 3300049587 Bacteria 660
809 Ga0501072_0024535 3300049588 Unclassified 4691
810 Ga0501073_0005683 3300049589 Bacteria 9328
811 Ga0501073_0334243 3300049589 Unclassified 1046
812 Ga0501074_0134555 3300049590 Bacteria 1768
813 Ga0501074_1049673 3300049590 Bacteria 573
814 Ga0501075_0101550 3300049591 Bacteria 2184
815 Ga0501075_0577788 3300049591 Bacteria 857
816 Ga0501076_0015782 3300049592 Bacteria 5713
817 Ga0501076_0687399 3300049592 Unclassified 845
818 Ga0501076_0887563 3300049592 Bacteria 735
819 Ga0501076_0975604 3300049592 Unclassified 698
820 Ga0501077_0070067 3300049593 Bacteria 2223
821 Ga0501216_046188 3300049660 Unclassified 846
822 Ga0501217_044277 3300049661 Bacteria 1143
823 Ga0501227_248471 3300049665 Unclassified 507
824 Ga0501233_144279 3300049668 Unclassified 660
825 Ga0501235_050778 3300049669 Unclassified 961
826 Ga0501248_005214 3300049678 Unclassified 1013
827 Ga0501249_065460 3300049679 Unclassified 845
828 Ga0501249_073587 3300049679 Unclassified 799
829 Ga0501253_081790 3300049683 Bacteria 730
830 Ga0501258_044451 3300049687 Unclassified 602
831 Ga0501221_042440 3300049704 Unclassified 997
832 Ga0501080_0291858 3300049742 Unclassified 1481
833 Ga0501080_0510290 3300049742 Bacteria 1074
834 Ga0501081_0123386 3300049743 Bacteria 1847
835 Ga0501081_0278281 3300049743 Unclassified 1225
836 Ga0501268_144191 3300049765 Unclassified 545
837 Ga0501270_119741 3300049767 Unclassified 571
838 Ga0501271_048274 3300049768 Bacteria 572
839 Ga0501283_042271 3300049779 Unclassified 792
840 Ga0501035_0273577 3300049822 Bacteria 1429
841 Ga0501035_0487202 3300049822 Bacteria 1016
842 Ga0501044_1595068 3300049823 Bacteria 517
843 Ga0501045_0034590 3300049824 Bacteria 3668
844 Ga0501045_0209695 3300049824 Bacteria 1451
845 Ga0501045_0969744 3300049824 Bacteria 624
846 Ga0501045_0993402 3300049824 Bacteria 615
847 Ga0501212_076545 3300049851 Bacteria 600
848 nmdc:mga03683_25790_c1 3300050489 Bacteria 2313
849 nmdc:mga03683_317489_c1 3300050489 Bacteria 733
850 nmdc:mga03n38_603718_c1 3300050490 Bacteria 625
851 nmdc:mga00v17_1837_c1 3300050491 Bacteria 10988
852 nmdc:mga00v17_89851_c1 3300050491 Unclassified 1928
853 nmdc:mga0yw44_711315_c1 3300050492 Bacteria 682
854 nmdc:mga0k408_189755_c1 3300050493 Unclassified 1226
855 nmdc:mga0k408_25276_c1 3300050493 Bacteria 3363
856 nmdc:mga0k408_74332_c1 3300050493 Unclassified 1986
857 nmdc:mga06z11_130292_c1 3300050494 Unclassified 1412
858 nmdc:mga06z11_232385_c1 3300050494 Bacteria 1081
859 nmdc:mga06z11_232796_c1 3300050494 Bacteria 1080
860 nmdc:mga06z11_837333_c1 3300050494 Bacteria 560
861 nmdc:mga04h51_101623_c1 3300050495 Bacteria 1048
862 nmdc:mga04h51_266645_c1 3300050495 Bacteria 690
863 nmdc:mga04h51_28481_c1 3300050495 Unclassified 1743
864 nmdc:mga07m45_131687_c1 3300050496 Unclassified 1447
865 nmdc:mga05p37_1078419_c1 3300050507 Unclassified 844
866 nmdc:mga05p37_149856_c1 3300050507 Bacteria 2854
867 nmdc:mga05p37_1955933_c1 3300050507 Bacteria 557
868 nmdc:mga05p37_204_c1 3300050507 Bacteria 59503
869 nmdc:mga05p37_21846_c1 3300050507 Bacteria 7753
870 nmdc:mga05p37_249894_c1 3300050507 Unclassified 2128
871 nmdc:mga05p37_308502_c1 3300050507 Bacteria 1670
872 nmdc:mga05p37_365347_c1 3300050507 Bacteria 1695
873 nmdc:mga05p37_383064_c1 3300050507 Bacteria 1647
874 nmdc:mga05p37_402605_c1 3300050507 Bacteria 1598
875 nmdc:mga05p37_558179_c1 3300050507 Bacteria 1302
876 nmdc:mga05p37_87632_c1 3300050507 Unclassified 3837
877 nmdc:mga09592_148115_c1 3300050508 Archaea 2024
878 nmdc:mga09592_212510_c1 3300050508 Bacteria 1676
879 nmdc:mga09592_217861_c1 3300050508 Bacteria 1654
880 nmdc:mga09592_25295_c1 3300050508 Bacteria 4913
881 nmdc:mga09592_294748_c1 3300050508 Bacteria 1406
882 nmdc:mga09592_306025_c1 3300050508 Bacteria 1378
883 nmdc:mga09592_371726_c1 3300050508 Bacteria 1237
884 nmdc:mga09592_4012_c1 3300050508 Bacteria 11875
885 nmdc:mga09592_51759_c1 3300050508 Unclassified 3465
886 nmdc:mga09592_552234_c1 3300050508 Bacteria 989
887 nmdc:mga09592_575677_c1 3300050508 Bacteria 966
888 nmdc:mga09592_762883_c1 3300050508 Unclassified 820
889 nmdc:mga0qj67_10410_c1 3300050509 Bacteria 6950
890 nmdc:mga0qj67_1864_c1 3300050509 Bacteria 14953
891 nmdc:mga0qj67_239168_c1 3300050509 Unclassified 1473
892 nmdc:mga0qj67_2398_c1 3300050509 Bacteria 13351
893 nmdc:mga0qj67_3605_c1 3300050509 Bacteria 11175
894 nmdc:mga0qj67_368787_c1 3300050509 Bacteria 1160
895 nmdc:mga0qj67_451374_c1 3300050509 Bacteria 1036
896 nmdc:mga0qj67_57445_c1 3300050509 Bacteria 1667
897 nmdc:mga0qj67_613340_c1 3300050509 Bacteria 870
898 nmdc:mga06r32_112143_c1 3300050510 Bacteria 2684
899 nmdc:mga06r32_119712_c1 3300050510 Unclassified 2596
900 nmdc:mga06r32_125717_c1 3300050510 Bacteria 2533
901 nmdc:mga06r32_1805021_c1 3300050510 Unclassified 547
902 nmdc:mga06r32_28985_c1 3300050510 Bacteria 5184
903 nmdc:mga06r32_3600_c1 3300050510 Bacteria 13825
904 nmdc:mga06r32_37503_c1 3300050510 Bacteria 4584
905 nmdc:mga06r32_534850_c1 3300050510 Bacteria 1147
906 nmdc:mga06r32_547596_c1 3300050510 Bacteria 1131
907 nmdc:mga06r32_895601_c1 3300050510 Bacteria 844
908 nmdc:mga08y16_113617_c1 3300050511 Bacteria 2819
909 nmdc:mga08y16_11949_c1 3300050511 Bacteria 9119
910 nmdc:mga08y16_1524647_c1 3300050511 Bacteria 628
911 nmdc:mga08y16_20403_c1 3300050511 Bacteria 6995
912 nmdc:mga08y16_2654_c1 3300050511 Bacteria 18387
913 nmdc:mga08y16_27946_c1 3300050511 Bacteria 5947
914 nmdc:mga08y16_31734_c1 3300050511 Bacteria 5555
915 nmdc:mga08y16_389868_c1 3300050511 Unclassified 1427
916 nmdc:mga08y16_451907_c1 3300050511 Bacteria 1310
917 nmdc:mga08y16_476045_c1 3300050511 Bacteria 1271
918 nmdc:mga08y16_477740_c1 3300050511 Bacteria 1268
919 nmdc:mga08y16_673411_c1 3300050511 Bacteria 1036
920 nmdc:mga08y16_959215_c1 3300050511 Unclassified 838
921 nmdc:mga0n895_142848_c1 3300050512 Unclassified 2422
922 nmdc:mga0n895_24981_c1 3300050512 Bacteria 5639
923 nmdc:mga0n895_281_c1 3300050512 Bacteria 33522
924 nmdc:mga0n895_49927_c1 3300050512 Bacteria 4101
925 nmdc:mga0n895_944902_c1 3300050512 Unclassified 846
926 nmdc:mga0rr50_1480730_c1 3300050513 Unclassified 574
927 nmdc:mga0rr50_22406_c1 3300050513 Bacteria 4335
928 nmdc:mga0rr50_29634_c1 3300050513 Bacteria 3863
929 nmdc:mga0rr50_31140_c1 3300050513 Bacteria 3785
930 nmdc:mga0rr50_459032_c1 3300050513 Bacteria 1080
931 nmdc:mga0rr50_68342_c1 3300050513 Bacteria 2702
932 nmdc:mga08x19_140274_c1 3300050514 Bacteria 1632
933 nmdc:mga0a205_1238_c1 3300050515 Bacteria 21394
934 nmdc:mga0a205_142451_c1 3300050515 Bacteria 2297
935 nmdc:mga0a205_159292_c1 3300050515 Bacteria 2155
936 nmdc:mga0a205_200576_c1 3300050515 Bacteria 1886
937 nmdc:mga0a205_469_c1 3300050515 Bacteria 31359
938 nmdc:mga0a205_5624_c1 3300050515 Bacteria 10014
939 nmdc:mga0a205_930193_c1 3300050515 Unclassified 716
940 nmdc:mga0a205_9598_c1 3300050515 Bacteria 8857
941 Ga0501084_0089822 3300054114 Bacteria 2579
942 Ga0501084_0160258 3300054114 Bacteria 1898
943 Ga0590071_124746 3300059421 Unclassified 659
944 Ga0501082_0627586 3300060353 Bacteria 940
945 Ga0501082_0645857 3300060353 Bacteria 926
946 Ga0530510_0093050 3300061734 Bacteria 2200
947 Ga0530510_0257544 3300061734 Bacteria 1301
948 Ga0530510_0644592 3300061734 Bacteria 806
949 Ga0075428_100904404
950 MRS1b_contig_1469820
951 MBSR1b_contig_4777266
952 JGI24743J22301_10061709
953 JGI24742J22300_10070453
954 Ga0065714_10126792
955 Ga0065714_10262160
956 Ga0065704_10353701
957 Ga0065712_10008647
958 Ga0065712_10013023
959 Ga0065712_10020514
960 Ga0065712_10069175
961 Ga0065712_10088480
962 Ga0065712_10152131
963 Ga0065712_10172288
964 Ga0065712_10371940
965 Ga0065712_10434567
966 Ga0065712_10530676
967 Ga0065715_10039041
968 Ga0065715_10098607
969 Ga0065715_10102805
970 Ga0065715_10129842
971 Ga0065715_10300626
972 Ga0065715_10328670
973 Ga0065715_10400888
974 Ga0065715_10506580
975 Ga0065715_10793207
976 Ga0065707_10133369
977 Ga0065707_10184427
978 Ga0070676_10001254
979 Ga0070676_10061661
980 Ga0070676_10122498
981 Ga0070676_10254472
982 Ga0070676_11123243
983 Ga0070676_11171227
984 Ga0070683_100002606
985 Ga0070683_100014219
986 Ga0070683_100135028
987 Ga0070683_101278293
988 Ga0070690_100005072
989 Ga0070690_100041798
990 Ga0070690_100073766
991 Ga0070690_100288443
992 Ga0070690_100502203
993 Ga0070670_100002622
994 Ga0070670_100081722
995 Ga0070670_100094296
996 Ga0070670_100134011
997 Ga0070670_100183950
998 Ga0070670_100186497
999 Ga0070670_101252920
1000 Ga0070677_10000949
1001 Ga0070677_10211688
1002 Ga0070677_10346694
1003 Ga0070677_10421724
1004 Ga0070677_10573092
1005 Ga0070677_10655986
1006 Ga0068869_100001504
1007 Ga0068869_100013890
1008 Ga0068869_100077479
1009 Ga0068869_100178368
1010 Ga0068869_100298602
1011 Ga0068869_100762470
1012 Ga0068869_101525976
1013 Ga0068869_101744548
1014 Ga0070666_10056933
1015 Ga0070666_10238674
1016 Ga0070666_10395698
1017 Ga0070666_10469286
1018 Ga0070666_10528958
1019 Ga0070666_11021954
1020 Ga0070680_100649830
1021 Ga0070680_101415561
1022 Ga0070682_100274440
1023 Ga0070682_101330858
1024 Ga0068868_100077533
1025 Ga0068868_100174911
1026 Ga0068868_100390029
1027 Ga0068868_100501526
1028 Ga0068868_100939858
1029 Ga0070660_100329954
1030 Ga0070689_100078156
1031 Ga0070689_100086565
1032 Ga0070689_100146787
1033 Ga0070689_100225724
1034 Ga0070689_100505817
1035 Ga0070689_101477236
1036 Ga0070691_10061897
1037 Ga0070691_10928969
1038 Ga0070687_100005082
1039 Ga0070687_100201905
1040 Ga0070687_100640454
1041 Ga0070661_100074073
1042 Ga0070661_100136054
1043 Ga0070661_100142507
1044 Ga0070661_100196054
1045 Ga0070661_100427631
1046 Ga0070661_101330041
1047 Ga0070668_100156190
1048 Ga0070668_100185586
1049 Ga0070668_100343474
1050 Ga0070669_100003896
1051 Ga0070669_100037323
1052 Ga0070669_100068660
1053 Ga0070669_100084423
1054 Ga0070669_100225364
1055 Ga0070669_100232678
1056 Ga0070669_101131191
1057 Ga0070669_101430452
1058 Ga0070669_101500392
1059 Ga0070675_100000467
1060 Ga0070675_100012251
1061 Ga0070675_100020016
1062 Ga0070675_100026656
1063 Ga0070675_100090176
1064 Ga0070675_100127732
1065 Ga0070675_100286729
1066 Ga0070675_100289621
1067 Ga0070675_100428622
1068 Ga0070675_100477374
1069 Ga0070675_100643506
1070 Ga0070675_100663637
1071 Ga0070675_100863365
1072 Ga0070675_100959765
1073 Ga0070675_101410508
1074 Ga0070671_100069843
1075 Ga0070671_100140341
1076 Ga0070674_100000491
1077 Ga0070674_100048465
1078 Ga0070674_100086415
1079 Ga0070674_100204698
1080 Ga0070674_100452298
1081 Ga0070674_101370600
1082 Ga0070673_100030997
1083 Ga0070673_100036753
1084 Ga0070673_100058314
1085 Ga0070673_100292347
1086 Ga0070673_100421221
1087 Ga0070673_100491193
1088 Ga0070688_100138060
1089 Ga0070688_100169486
1090 Ga0070688_100375042
1091 Ga0070688_101226225
1092 Ga0070659_100342252
1093 Ga0070659_100424285
1094 Ga0070659_100767298
1095 Ga0070667_100003902
1096 Ga0070667_100141680
1097 Ga0070667_100246560
1098 Ga0070667_100355318
1099 Ga0070667_101051705
1100 Ga0070667_101261596
1101 Ga0070713_100011010
1102 Ga0070701_10026328
1103 Ga0070701_10047076
1104 Ga0070701_10160690
1105 Ga0070705_100298415
1106 Ga0070700_100020762
1107 Ga0070700_100536723
1108 Ga0070700_100699875
1109 Ga0070700_100737593
1110 Ga0070700_101771666
1111 Ga0070694_101051413
1112 Ga0070694_101119191
1113 Ga0070663_100046636
1114 Ga0070663_100055627
1115 Ga0070663_101886539
1116 Ga0070678_100034080
1117 Ga0070678_100085995
1118 Ga0070678_100095476
1119 Ga0070678_100245047
1120 Ga0070678_100574119
1121 Ga0070678_100614849
1122 Ga0070678_100718741
1123 Ga0070678_101397122
1124 Ga0070662_100079503
1125 Ga0070662_100105400
1126 Ga0070662_100112458
1127 Ga0070662_100158366
1128 Ga0070662_100416772
1129 Ga0070662_100436160
1130 Ga0070681_10785329
1131 Ga0070681_11713283
1132 Ga0068867_100002442
1133 Ga0068867_100086540
1134 Ga0070685_10004082
1135 Ga0070685_10165628
1136 Ga0070707_100030380
1137 Ga0070707_100218971
1138 Ga0070707_100483849
1139 Ga0070698_100202919
1140 Ga0070699_100256398
1141 Ga0070684_100023408
1142 Ga0070684_100111294
1143 Ga0070672_100023268
1144 Ga0070672_100025505
1145 Ga0070672_100041868
1146 Ga0070672_100043111
1147 Ga0070672_100057400
1148 Ga0070672_100155475
1149 Ga0070672_100229808
1150 Ga0070672_100243606
1151 Ga0070672_100327169
1152 Ga0070672_100402528
1153 Ga0070672_101241751
1154 Ga0070686_100013076
1155 Ga0070686_100218869
1156 Ga0070686_100419156
1157 Ga0070686_100481961
1158 Ga0070686_100560110
1159 Ga0070686_100650368
1160 Ga0070686_100831928
1161 Ga0070686_101574805
1162 Ga0070695_100155859
1163 Ga0070696_101569605
1164 Ga0070693_100229151
1165 Ga0070665_100109840
1166 Ga0070665_100372817
1167 Ga0070665_100496029
1168 Ga0070665_100746417
1169 Ga0070704_100427692
1170 Ga0070704_100487390
1171 Ga0070704_100589979
1172 Ga0070704_100649586
1173 Ga0068855_102091389
1174 Ga0070664_100000606
1175 Ga0070664_100002910
1176 Ga0070664_100083267
1177 Ga0070664_100663503
1178 Ga0070664_102147117
1179 Ga0068857_100044763
1180 Ga0068857_101220585
1181 Ga0068857_101334974
1182 Ga0068857_101944647
1183 Ga0068854_100099104
1184 Ga0068854_100251761
1185 Ga0070702_100060353
1186 Ga0070702_100347273
1187 Ga0068852_100907317
1188 Ga0068852_100988870
1189 Ga0068859_100014295
1190 Ga0068859_100028902
1191 Ga0068859_100092755
1192 Ga0068859_100127674
1193 Ga0068859_100160498
1194 Ga0068859_100320341
1195 Ga0068859_102257945
1196 Ga0068859_103051866
1197 Ga0068859_103132079
1198 Ga0068864_100070686
1199 Ga0068864_100130892
1200 Ga0068864_100285592
1201 Ga0068864_100479132
1202 Ga0068864_101166344
1203 Ga0068866_10068979
1204 Ga0068866_10371717
1205 Ga0068866_10965807
1206 Ga0068866_11008781
1207 Ga0068861_100012184
1208 Ga0068861_100133201
1209 Ga0068861_100181154
1210 Ga0068861_100268232
1211 Ga0068861_100324364
1212 Ga0068861_100532186
1213 Ga0068861_101915194
1214 Ga0068851_10134143
1215 Ga0068870_10005383
1216 Ga0068870_10005841
1217 Ga0068870_10051187
1218 Ga0068870_10089401
1219 Ga0068870_10102988
1220 Ga0068870_10327211
1221 Ga0068863_100024735
1222 Ga0068863_100140511
1223 Ga0068863_100216863
1224 Ga0068863_100227996
1225 Ga0068863_100363078
1226 Ga0068863_100511307
1227 Ga0068863_100871337
1228 Ga0068858_100023718
1229 Ga0068858_100049292
1230 Ga0068858_100059912
1231 Ga0068858_100461759
1232 Ga0068858_100518221
1233 Ga0068858_100786955
1234 Ga0068858_100990700
1235 Ga0068858_101784374
1236 Ga0068860_100023778
1237 Ga0068860_100043337
1238 Ga0068860_100228310
1239 Ga0068862_100060237
1240 Ga0068862_100065619
1241 Ga0068862_100124280
1242 Ga0068862_100163198
1243 Ga0068862_100296227
1244 Ga0068862_100411399
1245 Ga0068862_100664331
1246 Ga0068862_100806443
1247 Ga0068862_100923557
1248 Ga0081455_10201661
1249 Ga0081455_10230537
1250 Ga0081539_10023342
1251 Ga0075365_10461606
1252 Ga0075368_10011775
1253 Ga0075368_10253908
1254 Ga0075363_100081975
1255 Ga0075364_10001583
1256 Ga0075364_10019608
1257 Ga0070716_101429103
1258 Ga0075362_10001521
1259 Ga0075362_10322772
1260 Ga0075367_10056285
1261 Ga0075367_10259555
1262 Ga0075366_10030941
1263 Ga0097621_100177794
1264 Ga0097621_100857818
1265 Ga0068871_100078898
1266 Ga0068871_100574212
1267 Ga0068871_100578136
1268 Ga0068871_100951147
1269 Ga0075428_100021582
1270 Ga0075428_100024112
1271 Ga0075428_100030694
1272 Ga0075428_100046023
1273 Ga0075428_100107426
1274 Ga0075428_100957766
1275 Ga0075428_101077953
1276 Ga0075430_100000381
1277 Ga0075430_100017066
1278 Ga0075430_100027629
1279 Ga0075430_100157053
1280 Ga0075430_100198308
1281 Ga0075430_100245875
1282 Ga0075430_100259165
1283 Ga0075430_100349720
1284 Ga0075430_100838057
1285 Ga0075431_100028983
1286 Ga0075431_100063927
1287 Ga0075431_100077513
1288 Ga0075431_100217275
1289 Ga0075431_100265425
1290 Ga0075431_100359241
1291 Ga0075431_101085650
1292 Ga0075431_101112488
1293 Ga0075431_101456405
1294 Ga0075433_10003919
1295 Ga0075433_10007867
1296 Ga0075433_10016986
1297 Ga0075433_10052006
1298 Ga0075433_10127222
1299 Ga0075433_10160849
1300 Ga0075433_10892871
1301 Ga0075434_100001674
1302 Ga0075434_100002425
1303 Ga0075434_100011874
1304 Ga0075434_100127669
1305 Ga0075434_100669260
1306 Ga0075429_100010675
1307 Ga0075429_100029575
1308 Ga0075429_100033199
1309 Ga0075429_100059027
1310 Ga0075429_100086776
1311 Ga0075429_100123191
1312 Ga0075429_100303320
1313 Ga0075429_100436955
1314 Ga0075429_100528163
1315 Ga0075429_100612478
1316 Ga0075429_100839716
1317 Ga0075429_100973819
1318 Ga0068865_100001195
1319 Ga0068865_100166199
1320 Ga0068865_100428535
1321 Ga0068865_101573658
1322 Ga0075436_100026485
1323 Ga0097620_100014295
1324 Ga0097620_100028899
1325 Ga0097620_100092762
1326 Ga0097620_100127676
1327 Ga0097620_100160505
1328 Ga0097620_100320361
1329 Ga0097620_102258623
1330 Ga0097620_103053001
1331 Ga0097620_103130200
1332 Ga0075435_100000529
1333 Ga0075435_100049031
1334 Ga0075435_100084838
1335 Ga0075435_100519298
1336 Ga0075435_100987766
1337 Ga0105250_10605246
1338 Ga0105240_10128528
1339 Ga0111539_10000494
1340 Ga0111539_10009794
1341 Ga0111539_10015632
1342 Ga0111539_10018753
1343 Ga0111539_10029112
1344 Ga0111539_10382222
1345 Ga0111539_10462712
1346 Ga0111539_10552032
1347 Ga0111539_10636789
1348 Ga0111539_10788614
1349 Ga0111539_12275583
1350 Ga0105245_10515069
1351 Ga0105247_10507934
1352 Ga0114129_10003590
1353 Ga0114129_10021096
1354 Ga0114129_10054212
1355 Ga0114129_10059233
1356 Ga0114129_10178827
1357 Ga0114129_10396758
1358 Ga0114129_10778078
1359 Ga0114129_11116002
1360 Ga0114129_12473771
1361 Ga0114129_12648300
1362 Ga0114129_12976913
1363 Ga0114129_13304188
1364 Ga0105243_10005296
1365 Ga0105242_10008489
1366 Ga0105242_10371526
1367 Ga0105248_10022383
1368 Ga0105248_10101388
1369 Ga0105248_10598323
1370 Ga0105248_11000735
1371 Ga0105248_11242140
1372 Ga0105248_11507280
1373 Ga0105248_11954321
1374 Ga0105248_11957423
1375 Ga0105248_12680255
1376 Ga0105238_10025451
1377 Ga0105249_10006207
1378 Ga0105249_10006397
1379 Ga0105249_10092786
1380 Ga0105249_10214005
1381 Ga0105249_12513866
1382 Ga0105239_10399457
1383 Ga0105239_11213422
1384 Ga0105239_12911687
1385 Ga0105239_13203481
1386 Ga0105246_10064683
1387 Ga0105246_10124532
1388 Ga0105246_10522026
1389 Ga0105246_10760213
1390 Ga0105246_11071577
1391 Ga0157327_1068635
1392 Ga0157371_11536167
1393 Ga0157374_10620294
1394 Ga0157378_12591470
1395 Ga0163162_10006298
1396 Ga0163162_10384030
1397 Ga0163162_10564827
1398 Ga0163162_11776474
1399 Ga0157372_11759736
1400 Ga0157375_10078212
1401 Ga0157375_10386166
1402 Ga0157375_10391705
1403 Ga0157375_10435600
1404 Ga0157375_10684903
1405 Ga0157375_11164989
1406 Ga0157375_12741978
1407 Ga0163163_10008904
1408 Ga0163163_10030919
1409 Ga0163163_10197293
1410 Ga0163163_10405990
1411 Ga0163163_11647533
1412 Ga0157380_10005599
1413 Ga0157380_10055348
1414 Ga0157380_10083044
1415 Ga0157380_10191414
1416 Ga0157380_10654259
1417 Ga0157380_10684864
1418 Ga0157380_10775880
1419 Ga0157380_11282644
1420 Ga0157380_11657234
1421 Ga0157380_13249353
1422 Ga0157377_10011219
1423 Ga0157377_10095442
1424 Ga0157377_10356751
1425 Ga0157377_10485122
1426 Ga0157377_10503830
1427 Ga0157379_10578918
1428 Ga0157376_10102777
1429 Ga0157376_10208364
1430 Ga0157376_10326085
1431 Ga0157376_12159836
1432 Ga0157376_12403090
1433 Ga0163161_11101613
1434 Ga0207673_1002977
1435 Ga0207673_1042229
1436 Ga0207697_10000243
1437 Ga0207697_10001333
1438 Ga0207697_10081171
1439 Ga0207697_10083278
1440 Ga0207656_10129521
1441 Ga0207682_10002151
1442 Ga0207682_10013016
1443 Ga0207682_10039909
1444 Ga0207682_10560704
1445 Ga0207642_10256002
1446 Ga0207710_10235266
1447 Ga0207688_10001364
1448 Ga0207688_10001424
1449 Ga0207688_10386620
1450 Ga0207680_10151463
1451 Ga0207680_10272902
1452 Ga0207680_10370454
1453 Ga0207645_10001527
1454 Ga0207645_10003570
1455 Ga0207645_10055134
1456 Ga0207643_10008602
1457 Ga0207643_10009092
1458 Ga0207643_10047439
1459 Ga0207643_10049896
1460 Ga0207695_10106246
1461 Ga0207662_10006061
1462 Ga0207662_10676503
1463 Ga0207657_10263118
1464 Ga0207649_10081925
1465 Ga0207649_10110695
1466 Ga0207649_10169600
1467 Ga0207649_10228112
1468 Ga0207649_10792105
1469 Ga0207646_10260932
1470 Ga0207681_10003044
1471 Ga0207681_10006275
1472 Ga0207681_10028340
1473 Ga0207681_10092563
1474 Ga0207681_10212304
1475 Ga0207681_10323916
1476 Ga0207681_10959863
1477 Ga0207681_11241698
1478 Ga0207694_10024124
1479 Ga0207650_10023227
1480 Ga0207650_10056313
1481 Ga0207650_10314187
1482 Ga0207650_10421414
1483 Ga0207650_11380259
1484 Ga0207659_10000086
1485 Ga0207659_10011546
1486 Ga0207659_10030747
1487 Ga0207659_10055343
1488 Ga0207659_10060249
1489 Ga0207659_10067552
1490 Ga0207659_10133143
1491 Ga0207659_10144609
1492 Ga0207659_10199527
1493 Ga0207659_10288230
1494 Ga0207659_10665526
1495 Ga0207659_10733591
1496 Ga0207659_11233987
1497 Ga0207644_10047653
1498 Ga0207644_10114237
1499 Ga0207644_10115070
1500 Ga0207644_10130510
1501 Ga0207690_10397186
1502 Ga0207690_11314308
1503 Ga0207690_11420107
1504 Ga0207706_10012115
1505 Ga0207706_10027224
1506 Ga0207706_10049831
1507 Ga0207706_10388523
1508 Ga0207706_10989992
1509 Ga0207706_11146976
1510 Ga0207709_10004665
1511 Ga0207709_10319137
1512 Ga0207709_11048718
1513 Ga0207670_10074249
1514 Ga0207670_10275657
1515 Ga0207670_10725761
1516 Ga0207669_10001294
1517 Ga0207669_10166878
1518 Ga0207669_10295100
1519 Ga0207669_10627497
1520 Ga0207669_10952926
1521 Ga0207669_11007960
1522 Ga0207704_10011211
1523 Ga0207704_10047241
1524 Ga0207704_10645164
1525 Ga0207704_11293446
1526 Ga0207691_10006915
1527 Ga0207691_10010337
1528 Ga0207691_10025246
1529 Ga0207691_10047552
1530 Ga0207691_10055051
1531 Ga0207691_10083051
1532 Ga0207691_10084299
1533 Ga0207691_10090246
1534 Ga0207691_10104700
1535 Ga0207691_10214802
1536 Ga0207691_10288823
1537 Ga0207691_11039364
1538 Ga0207711_10009966
1539 Ga0207711_10863902
1540 Ga0207711_10888563
1541 Ga0207711_11121477
1542 Ga0207689_10000745
1543 Ga0207689_10019140
1544 Ga0207689_10293301
1545 Ga0207689_10716429
1546 Ga0207661_10011846
1547 Ga0207661_10051001
1548 Ga0207661_10599423
1549 Ga0207679_10004503
1550 Ga0207679_10020215
1551 Ga0207679_10716169
1552 Ga0207679_11893542
1553 Ga0207651_10005363
1554 Ga0207651_10011953
1555 Ga0207651_10169247
1556 Ga0207651_10203664
1557 Ga0207651_10323741
1558 Ga0207651_10348520
1559 Ga0207712_10010423
1560 Ga0207712_10334887
1561 Ga0207712_10810478
1562 Ga0207712_10875321
1563 Ga0207712_11535858
1564 Ga0207668_10207240
1565 Ga0207668_10396691
1566 Ga0207668_10449627
1567 Ga0207668_11847280
1568 Ga0207640_10277277
1569 Ga0207658_10113637
1570 Ga0207658_10332233
1571 Ga0207658_10406133
1572 Ga0207677_10048093
1573 Ga0207677_10525201
1574 Ga0207677_10578936
1575 Ga0207677_10673220
1576 Ga0207703_10021662
1577 Ga0207703_10093003
1578 Ga0207703_10988831
1579 Ga0207703_11151462
1580 Ga0207703_11153351
1581 Ga0207639_10606848
1582 Ga0207678_10140724
1583 Ga0207708_10008724
1584 Ga0207708_10021884
1585 Ga0207708_11558235
1586 Ga0207708_11786005
1587 Ga0207641_10004878
1588 Ga0207641_10387521
1589 Ga0207641_10512259
1590 Ga0207641_10533161
1591 Ga0207641_10937555
1592 Ga0207641_11201136
1593 Ga0207648_10002951
1594 Ga0207648_10033722
1595 Ga0207648_10298607
1596 Ga0207676_10014288
1597 Ga0207676_10437226
1598 Ga0207676_11422976
1599 Ga0207676_11514242
1600 Ga0207674_10035556
1601 Ga0207674_10053053
1602 Ga0207674_10063498
1603 Ga0207674_10831347
1604 Ga0207675_100015971
1605 Ga0207675_100015987
1606 Ga0207675_100119212
1607 Ga0207675_100809454
1608 Ga0207675_100879753
1609 Ga0207675_101012406
1610 Ga0207675_101725653
1611 Ga0207683_10021404
1612 Ga0207683_10051425
1613 Ga0207683_10063075
1614 Ga0207683_10095237
1615 Ga0207683_10106049
1616 Ga0207683_10327338
1617 Ga0207683_10724862
1618 Ga0207683_11159943
1619 Ga0207683_11350293
1620 Ga0207683_11952319
1621 Ga0207698_10090896
1622 Ga0209996_1061044
1623 Ga0209998_10038529
1624 Ga0209813_10063770
1625 Ga0209974_10142265
1626 Ga0207428_10001093
1627 Ga0207428_10010281
1628 Ga0207428_10022057
1629 Ga0207428_10045763
1630 Ga0207428_10055562
1631 Ga0207428_10553965
1632 Ga0268266_10326475
1633 Ga0268266_10853933
1634 Ga0268266_10904600
1635 Ga0268265_10023431
1636 Ga0268265_10050535
1637 Ga0268265_10175563
1638 Ga0268265_10803745
1639 Ga0268265_11078621
1640 Ga0268265_11153195
1641 Ga0268265_11494246
1642 Ga0268264_10561579
1643 Ga0268264_10606575
1644 Ga0268264_10955898
1645 Ga0307408_100138673
1646 Ga0307408_100304921
1647 Ga0307408_100748457
1648 Ga0307405_10496514
1649 Ga0307405_11028835
1650 Ga0307413_10104206
1651 Ga0307406_10360641
1652 Ga0307406_10542220
1653 Ga0307412_10128359
1654 Ga0307412_10254917
1655 Ga0307412_10568930
1656 Ga0307409_100282199
1657 Ga0307409_101053729
1658 Ga0307416_100036917
1659 Ga0307416_100127029
1660 Ga0307416_100867176
1661 Ga0307416_101301490
1662 Ga0307411_10033923
1663 Ga0307411_10081278
1664 Ga0307411_10133841
1665 Ga0307415_100060940
1666 Ga0373939_0309712
1667 Ga0373961_0125007
1668 Ga0373925_0627984
1669 Ga0395901_1834254
1670 Ga0439453_0004485
1671 Ga0451807_1190959
1672 Ga0451853_3787570
1673 Ga0439443_054018
1674 Ga0450923_163231
1675 Ga0439435_0025628
1676 Ga0439435_0219206
1677 Ga0439444_0158341
1678 Ga0439464_0003225
1679 Ga0439464_0065349
1680 Ga0439464_0080670
1681 Ga0439464_0182660
1682 Ga0439464_0189327
1683 Ga0439460_0071442
1684 Ga0439440_0059592
1685 Ga0439440_0154906
1686 Ga0439440_0184126
1687 Ga0453683_0784739
1688 Ga0451576_0210835
1689 Ga0451576_0224478
1690 Ga0451576_0294160
1691 Ga0451576_0967183
1692 Ga0451576_0978122
1693 Ga0451576_2457787
1694 Ga0495603_0249843
1695 Ga0495629_0060157
1696 Ga0495629_0878821
1697 Ga0495582_0707872
1698 Ga0495594_0346308
1699 Ga0495598_0052935
1700 Ga0495621_0058729
1701 Ga0495633_0138160
1702 Ga0495656_0271662
1703 Ga0495656_0762560
1704 Ga0495659_0571344
1705 Ga0495658_0152028
1706 Ga0495658_0940082
1707 Ga0495676_0118714
1708 Ga0496104_0002583
1709 Ga0496104_1746660
1710 Ga0496105_0022020
1711 Ga0496106_0128359
1712 Ga0496106_1029313
1713 Ga0496108_0013109
1714 Ga0496108_0490231
1715 Ga0496108_0891746
1716 Ga0496109_0002509
1717 Ga0496109_0009658
1718 Ga0496109_0085461
1719 Ga0496110_0000061
1720 Ga0496110_0169124
1721 Ga0496111_0012063
1722 Ga0496112_0006189
1723 Ga0496112_0766301
1724 Ga0496113_0147258
1725 Ga0501295_115936
1726 Ga0501299_004990
1727 Ga0501299_028897
1728 Ga0501031_0094390
1729 Ga0501033_0135909
1730 Ga0501034_1234645
1731 Ga0501036_0230677
1732 Ga0501037_0156150
1733 Ga0501038_0102695
1734 Ga0501039_0137293
1735 Ga0501039_1127612
1736 Ga0501040_0020220
1737 Ga0501040_0222687
1738 Ga0501041_0367804
1739 Ga0501041_0378147
1740 Ga0501042_0061085
1741 Ga0501042_0113762
1742 Ga0501042_0163954
1743 Ga0501043_0468183
1744 Ga0501046_0024632
1745 Ga0501046_0126748
1746 Ga0501047_0372988
1747 Ga0501047_0991786
1748 Ga0501048_0311940
1749 Ga0501048_0430993
1750 Ga0501048_1308639
1751 Ga0501067_0276733
1752 Ga0501070_1381809
1753 Ga0501071_0104754
1754 Ga0501071_0320611
1755 Ga0501071_0536835
1756 Ga0501071_0960059
1757 Ga0501072_0024535
1758 Ga0501073_0005683
1759 Ga0501073_0334243
1760 Ga0501074_0134555
1761 Ga0501074_1049673
1762 Ga0501075_0101550
1763 Ga0501075_0577788
1764 Ga0501076_0015782
1765 Ga0501076_0687399
1766 Ga0501076_0887563
1767 Ga0501076_0975604
1768 Ga0501077_0070067
1769 Ga0501216_046188
1770 Ga0501217_044277
1771 Ga0501227_248471
1772 Ga0501233_144279
1773 Ga0501235_050778
1774 Ga0501248_005214
1775 Ga0501249_065460
1776 Ga0501249_073587
1777 Ga0501253_081790
1778 Ga0501258_044451
1779 Ga0501221_042440
1780 Ga0501080_0291858
1781 Ga0501080_0510290
1782 Ga0501081_0123386
1783 Ga0501081_0278281
1784 Ga0501268_144191
1785 Ga0501270_119741
1786 Ga0501271_048274
1787 Ga0501283_042271
1788 Ga0501035_0273577
1789 Ga0501035_0487202
1790 Ga0501044_1595068
1791 Ga0501045_0034590
1792 Ga0501045_0209695
1793 Ga0501045_0969744
1794 Ga0501045_0993402
1795 Ga0501212_076545
1796 nmdc:mga03683_25790_c1
1797 nmdc:mga03683_317489_c1
1798 nmdc:mga03n38_603718_c1
1799 nmdc:mga00v17_1837_c1
1800 nmdc:mga00v17_89851_c1
1801 nmdc:mga0yw44_711315_c1
1802 nmdc:mga0k408_189755_c1
1803 nmdc:mga0k408_25276_c1
1804 nmdc:mga0k408_74332_c1
1805 nmdc:mga06z11_130292_c1
1806 nmdc:mga06z11_232385_c1
1807 nmdc:mga06z11_232796_c1
1808 nmdc:mga06z11_837333_c1
1809 nmdc:mga04h51_101623_c1
1810 nmdc:mga04h51_266645_c1
1811 nmdc:mga04h51_28481_c1
1812 nmdc:mga07m45_131687_c1
1813 nmdc:mga05p37_1078419_c1
1814 nmdc:mga05p37_149856_c1
1815 nmdc:mga05p37_1955933_c1
1816 nmdc:mga05p37_204_c1
1817 nmdc:mga05p37_21846_c1
1818 nmdc:mga05p37_249894_c1
1819 nmdc:mga05p37_308502_c1
1820 nmdc:mga05p37_365347_c1
1821 nmdc:mga05p37_383064_c1
1822 nmdc:mga05p37_402605_c1
1823 nmdc:mga05p37_558179_c1
1824 nmdc:mga05p37_87632_c1
1825 nmdc:mga09592_148115_c1
1826 nmdc:mga09592_212510_c1
1827 nmdc:mga09592_217861_c1
1828 nmdc:mga09592_25295_c1
1829 nmdc:mga09592_294748_c1
1830 nmdc:mga09592_306025_c1
1831 nmdc:mga09592_371726_c1
1832 nmdc:mga09592_4012_c1
1833 nmdc:mga09592_51759_c1
1834 nmdc:mga09592_552234_c1
1835 nmdc:mga09592_575677_c1
1836 nmdc:mga09592_762883_c1
1837 nmdc:mga0qj67_10410_c1
1838 nmdc:mga0qj67_1864_c1
1839 nmdc:mga0qj67_239168_c1
1840 nmdc:mga0qj67_2398_c1
1841 nmdc:mga0qj67_3605_c1
1842 nmdc:mga0qj67_368787_c1
1843 nmdc:mga0qj67_451374_c1
1844 nmdc:mga0qj67_57445_c1
1845 nmdc:mga0qj67_613340_c1
1846 nmdc:mga06r32_112143_c1
1847 nmdc:mga06r32_119712_c1
1848 nmdc:mga06r32_125717_c1
1849 nmdc:mga06r32_1805021_c1
1850 nmdc:mga06r32_28985_c1
1851 nmdc:mga06r32_3600_c1
1852 nmdc:mga06r32_37503_c1
1853 nmdc:mga06r32_534850_c1
1854 nmdc:mga06r32_547596_c1
1855 nmdc:mga06r32_895601_c1
1856 nmdc:mga08y16_113617_c1
1857 nmdc:mga08y16_11949_c1
1858 nmdc:mga08y16_1524647_c1
1859 nmdc:mga08y16_20403_c1
1860 nmdc:mga08y16_2654_c1
1861 nmdc:mga08y16_27946_c1
1862 nmdc:mga08y16_31734_c1
1863 nmdc:mga08y16_389868_c1
1864 nmdc:mga08y16_451907_c1
1865 nmdc:mga08y16_476045_c1
1866 nmdc:mga08y16_477740_c1
1867 nmdc:mga08y16_673411_c1
1868 nmdc:mga08y16_959215_c1
1869 nmdc:mga0n895_142848_c1
1870 nmdc:mga0n895_24981_c1
1871 nmdc:mga0n895_281_c1
1872 nmdc:mga0n895_49927_c1
1873 nmdc:mga0n895_944902_c1
1874 nmdc:mga0rr50_1480730_c1
1875 nmdc:mga0rr50_22406_c1
1876 nmdc:mga0rr50_29634_c1
1877 nmdc:mga0rr50_31140_c1
1878 nmdc:mga0rr50_459032_c1
1879 nmdc:mga0rr50_68342_c1
1880 nmdc:mga08x19_140274_c1
1881 nmdc:mga0a205_1238_c1
1882 nmdc:mga0a205_142451_c1
1883 nmdc:mga0a205_159292_c1
1884 nmdc:mga0a205_200576_c1
1885 nmdc:mga0a205_469_c1
1886 nmdc:mga0a205_5624_c1
1887 nmdc:mga0a205_930193_c1
1888 nmdc:mga0a205_9598_c1
1889 Ga0501084_0089822
1890 Ga0501084_0160258
1891 Ga0590071_124746
1892 Ga0501082_0627586
1893 Ga0501082_0645857
1894 Ga0530510_0093050
1895 Ga0530510_0257544
1896 Ga0530510_0644592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

122

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9542 9 57
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.933 8 56
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9313 4 56
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9299 4 56
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8985 9 56
ID Description Score Start End Superfamily
4a6eA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9516 9 57 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9396 4 55 1.10.10.10
af_P0C0A2_317_386_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 4 56 1.10.10.10
2rgvB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9339 11 57 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9337 4 57 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A062XK61-F1-model_v4 deleted 0.8823 1 64
AF-A0A3M2BFY9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.8811 2 74 GO:0003677
GO:0045892
AF-A0A3F3LEU3-F1-model_v4 deleted 0.8663 1 73
AF-A0A264DXP0-F1-model_v4 deleted 0.8515 2 69
AF-A0A0G1A9K5-F1-model_v4 Penicillinase repressor 0.8247 1 86 GO:0003677
GO:0045892

Map