F486497

General Info

Members Datasets Scaffolds Average Seq Length
947 299 1894 125

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_1298000_c1|nmdc:mga09592_1298000_c1_107_559
Length 150
Sequence LRAKFGEPYPIGTPQPDMAKVLVVEDNPANMTLATFLLENAGHTVLKALDAETGVTLAGSEQPDLILMDIQLPGMDGLKAAALLKGDAVTREIPVIALTALAMKGDEERIRAAGCDGYIAKPLSYKDFLSTVSAELAKRAASSGVINALK

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
283 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
284 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
285 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
286 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 3.17
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_1298000_c1 3300050508 Unclassified 598
2 JGI24751J29686_10142424 3300002459 Bacteria 508
3 Ga0065712_10071559 3300005290 Bacteria 5187
4 Ga0065712_10284786 3300005290 Bacteria 888
5 Ga0065715_10092479 3300005293 Bacteria 5103
6 Ga0065715_10830777 3300005293 Bacteria 568
7 Ga0065707_10269019 3300005295 Bacteria 1076
8 Ga0070658_10120531 3300005327 Bacteria 2179
9 Ga0070658_10260485 3300005327 Bacteria 1473
10 Ga0070658_10466838 3300005327 Bacteria 1088
11 Ga0070658_11567787 3300005327 Bacteria 571
12 Ga0070676_10178694 3300005328 Bacteria 1378
13 Ga0070676_10264324 3300005328 Bacteria 1153
14 Ga0070676_10816923 3300005328 Bacteria 689
15 Ga0070683_100014607 3300005329 Bacteria 6876
16 Ga0070683_100070942 3300005329 Bacteria 3250
17 Ga0070683_100098391 3300005329 Bacteria 2753
18 Ga0070683_100150716 3300005329 Bacteria 2205
19 Ga0070683_100156899 3300005329 Bacteria 2158
20 Ga0070683_100168202 3300005329 Bacteria 2080
21 Ga0070683_100202966 3300005329 Bacteria 1883
22 Ga0070683_101999114 3300005329 Bacteria 557
23 Ga0070690_100025033 3300005330 Bacteria 3675
24 Ga0070690_100094401 3300005330 Bacteria 1974
25 Ga0070690_101519249 3300005330 Bacteria 541
26 Ga0070670_100099201 3300005331 Bacteria 2506
27 Ga0070670_100186196 3300005331 Bacteria 1803
28 Ga0070670_100258781 3300005331 Bacteria 1517
29 Ga0070670_101348373 3300005331 Bacteria 653
30 Ga0070677_10159291 3300005333 Bacteria 1058
31 Ga0070677_10925558 3300005333 Bacteria 505
32 Ga0068869_100038662 3300005334 Bacteria 3403
33 Ga0068869_100584248 3300005334 Bacteria 942
34 Ga0068869_100965866 3300005334 Bacteria 740
35 Ga0068869_101036214 3300005334 Bacteria 716
36 Ga0070666_10626441 3300005335 Bacteria 786
37 Ga0070666_11320995 3300005335 Bacteria 538
38 Ga0070680_100000997 3300005336 Bacteria 20130
39 Ga0070680_100077949 3300005336 Bacteria 2730
40 Ga0070680_100095247 3300005336 Bacteria 2467
41 Ga0070680_100135202 3300005336 Bacteria 2065
42 Ga0070680_100262673 3300005336 Bacteria 1461
43 Ga0070680_100410497 3300005336 Bacteria 1155
44 Ga0070680_100512489 3300005336 Bacteria 1027
45 Ga0070680_100942443 3300005336 Bacteria 745
46 Ga0070680_101138020 3300005336 Bacteria 675
47 Ga0070680_101163573 3300005336 Bacteria 667
48 Ga0070680_101197569 3300005336 Bacteria 657
49 Ga0070682_100000499 3300005337 Bacteria 24624
50 Ga0070682_100061267 3300005337 Bacteria 2381
51 Ga0070682_101023724 3300005337 Bacteria 687
52 Ga0070682_101219913 3300005337 Bacteria 636
53 Ga0070682_101357627 3300005337 Bacteria 606
54 Ga0068868_100191921 3300005338 Bacteria 1699
55 Ga0068868_100861894 3300005338 Bacteria 821
56 Ga0068868_100895094 3300005338 Bacteria 806
57 Ga0070660_100101022 3300005339 Bacteria 2285
58 Ga0070660_100509333 3300005339 Bacteria 1002
59 Ga0070660_100571343 3300005339 Bacteria 944
60 Ga0070689_100044673 3300005340 Unclassified 3409
61 Ga0070689_100157805 3300005340 Bacteria 1832
62 Ga0070689_100261497 3300005340 Bacteria 1431
63 Ga0070689_100544242 3300005340 Bacteria 999
64 Ga0070689_101094077 3300005340 Bacteria 712
65 Ga0070691_10506414 3300005341 Bacteria 699
66 Ga0070687_100021405 3300005343 Bacteria 3039
67 Ga0070687_100086581 3300005343 Bacteria 1723
68 Ga0070687_100138540 3300005343 Bacteria 1414
69 Ga0070687_100589613 3300005343 Bacteria 762
70 Ga0070661_100090672 3300005344 Bacteria 2264
71 Ga0070661_100179705 3300005344 Bacteria 1609
72 Ga0070661_100703302 3300005344 Bacteria 824
73 Ga0070692_10114180 3300005345 Bacteria 1498
74 Ga0070692_10341268 3300005345 Bacteria 928
75 Ga0070668_100055632 3300005347 Bacteria 3054
76 Ga0070668_100130371 3300005347 Bacteria 2018
77 Ga0070668_100151493 3300005347 Bacteria 1876
78 Ga0070668_100456924 3300005347 Bacteria 1099
79 Ga0070669_100022591 3300005353 Bacteria 4498
80 Ga0070669_100058426 3300005353 Bacteria 2830
81 Ga0070669_100475048 3300005353 Bacteria 1034
82 Ga0070669_100491672 3300005353 Bacteria 1017
83 Ga0070669_101273654 3300005353 Bacteria 636
84 Ga0070675_100047781 3300005354 Bacteria 3507
85 Ga0070675_100069505 3300005354 Bacteria 2917
86 Ga0070675_100411038 3300005354 Bacteria 1209
87 Ga0070671_100195308 3300005355 Bacteria 1716
88 Ga0070671_100246378 3300005355 Bacteria 1517
89 Ga0070671_100769714 3300005355 Bacteria 837
90 Ga0070671_101057071 3300005355 Bacteria 712
91 Ga0070674_100008359 3300005356 Bacteria 6161
92 Ga0070674_100080357 3300005356 Bacteria 2328
93 Ga0070674_100083863 3300005356 Bacteria 2284
94 Ga0070674_100084215 3300005356 Bacteria 2280
95 Ga0070674_100150258 3300005356 Bacteria 1757
96 Ga0070674_100232994 3300005356 Bacteria 1438
97 Ga0070674_101850141 3300005356 Bacteria 548
98 Ga0070673_100004493 3300005364 Bacteria 8826
99 Ga0070673_100028433 3300005364 Bacteria 4158
100 Ga0070673_100112881 3300005364 Bacteria 2256
101 Ga0070673_100145248 3300005364 Unclassified 2005
102 Ga0070673_100303370 3300005364 Bacteria 1406
103 Ga0070673_100463542 3300005364 Bacteria 1141
104 Ga0070673_101207129 3300005364 Bacteria 709
105 Ga0070673_101779531 3300005364 Unclassified 584
106 Ga0070688_100004216 3300005365 Bacteria 7472
107 Ga0070688_100168991 3300005365 Bacteria 1508
108 Ga0070659_100192065 3300005366 Bacteria 1679
109 Ga0070659_100625793 3300005366 Bacteria 927
110 Ga0070659_101926094 3300005366 Bacteria 530
111 Ga0070667_100022726 3300005367 Bacteria 5200
112 Ga0070667_100147473 3300005367 Bacteria 2064
113 Ga0070667_100464123 3300005367 Bacteria 1158
114 Ga0070703_10003812 3300005406 Bacteria 4267
115 Ga0070709_10309789 3300005434 Bacteria 1155
116 Ga0070709_10949131 3300005434 Bacteria 682
117 Ga0070714_100065119 3300005435 Bacteria 3138
118 Ga0070710_10960893 3300005437 Unclassified 620
119 Ga0070701_10041541 3300005438 Bacteria 2344
120 Ga0070701_10639875 3300005438 Bacteria 709
121 Ga0070701_10650516 3300005438 Bacteria 704
122 Ga0070705_100002708 3300005440 Bacteria 8848
123 Ga0070705_100014443 3300005440 Bacteria 4062
124 Ga0070705_100017613 3300005440 Bacteria 3731
125 Ga0070705_100547558 3300005440 Bacteria 886
126 Ga0070705_101544907 3300005440 Bacteria 557
127 Ga0070700_100324678 3300005441 Bacteria 1132
128 Ga0070700_100379626 3300005441 Bacteria 1056
129 Ga0070694_100021148 3300005444 Bacteria 4154
130 Ga0070694_100066788 3300005444 Bacteria 2467
131 Ga0070694_100108183 3300005444 Bacteria 1977
132 Ga0070694_100109472 3300005444 Bacteria 1966
133 Ga0070694_100759928 3300005444 Bacteria 792
134 Ga0070694_100797725 3300005444 Bacteria 774
135 Ga0070694_100811156 3300005444 Bacteria 768
136 Ga0070708_100000280 3300005445 Bacteria 38345
137 Ga0070708_100888526 3300005445 Bacteria 837
138 Ga0070663_100821812 3300005455 Bacteria 798
139 Ga0070678_100511904 3300005456 Bacteria 1060
140 Ga0070678_101716325 3300005456 Bacteria 591
141 Ga0070662_100208006 3300005457 Bacteria 1556
142 Ga0070662_100375981 3300005457 Bacteria 1169
143 Ga0070662_100474554 3300005457 Bacteria 1041
144 Ga0070662_100574322 3300005457 Bacteria 946
145 Ga0070662_101113322 3300005457 Bacteria 678
146 Ga0070681_10031585 3300005458 Bacteria 5316
147 Ga0070681_10130107 3300005458 Bacteria 2449
148 Ga0070681_10522532 3300005458 Bacteria 1100
149 Ga0070681_10901716 3300005458 Bacteria 802
150 Ga0068867_100024892 3300005459 Bacteria 4292
151 Ga0068867_100087176 3300005459 Bacteria 2363
152 Ga0068867_100129049 3300005459 Bacteria 1963
153 Ga0068867_100413600 3300005459 Bacteria 1141
154 Ga0068867_100669593 3300005459 Bacteria 912
155 Ga0068867_100695024 3300005459 Bacteria 897
156 Ga0068867_101427040 3300005459 Bacteria 643
157 Ga0068867_102024032 3300005459 Bacteria 545
158 Ga0068867_102312422 3300005459 Bacteria 511
159 Ga0070685_10023204 3300005466 Bacteria 3395
160 Ga0070685_10039718 3300005466 Bacteria 2675
161 Ga0070706_100097103 3300005467 Bacteria 2736
162 Ga0070706_100208258 3300005467 Bacteria 1826
163 Ga0070706_100501905 3300005467 Bacteria 1129
164 Ga0070706_101568116 3300005467 Bacteria 601
165 Ga0070707_100006461 3300005468 Bacteria 10892
166 Ga0070707_100053667 3300005468 Bacteria 3865
167 Ga0070707_100081789 3300005468 Bacteria 3119
168 Ga0070707_100133966 3300005468 Bacteria 2410
169 Ga0070698_100000766 3300005471 Bacteria 34785
170 Ga0070698_100040301 3300005471 Bacteria 4801
171 Ga0070698_100141710 3300005471 Bacteria 2355
172 Ga0070698_100301200 3300005471 Bacteria 1534
173 Ga0070698_100462144 3300005471 Bacteria 1205
174 Ga0070698_100568904 3300005471 Bacteria 1073
175 Ga0070698_100969151 3300005471 Bacteria 797
176 Ga0070698_101511188 3300005471 Bacteria 623
177 Ga0070699_100000148 3300005518 Bacteria 66426
178 Ga0070699_100027934 3300005518 Bacteria 4867
179 Ga0070699_100032427 3300005518 Bacteria 4511
180 Ga0070699_100096316 3300005518 Bacteria 2592
181 Ga0070699_100144422 3300005518 Bacteria 2102
182 Ga0070699_100674535 3300005518 Bacteria 944
183 Ga0070699_101065149 3300005518 Bacteria 742
184 Ga0070699_101394836 3300005518 Bacteria 643
185 Ga0070699_101840579 3300005518 Bacteria 554
186 Ga0070679_100000837 3300005530 Bacteria 26775
187 Ga0070679_100082257 3300005530 Bacteria 3210
188 Ga0070679_100293355 3300005530 Bacteria 1577
189 Ga0070679_100319211 3300005530 Bacteria 1503
190 Ga0070679_100394660 3300005530 Bacteria 1330
191 Ga0070684_100111250 3300005535 Bacteria 2456
192 Ga0070684_100177022 3300005535 Bacteria 1939
193 Ga0070684_100535958 3300005535 Bacteria 1086
194 Ga0070697_100021158 3300005536 Bacteria 5153
195 Ga0070697_100036353 3300005536 Bacteria 3978
196 Ga0070697_100217569 3300005536 Bacteria 1627
197 Ga0070697_100422892 3300005536 Bacteria 1158
198 Ga0070697_100485648 3300005536 Bacteria 1079
199 Ga0070697_100522584 3300005536 Bacteria 1039
200 Ga0070697_101547843 3300005536 Bacteria 593
201 Ga0068853_100325637 3300005539 Bacteria 1425
202 Ga0068853_100424985 3300005539 Bacteria 1246
203 Ga0068853_100479122 3300005539 Bacteria 1173
204 Ga0068853_100672072 3300005539 Bacteria 987
205 Ga0070672_100156081 3300005543 Bacteria 1890
206 Ga0070672_100279922 3300005543 Bacteria 1410
207 Ga0070672_100490186 3300005543 Bacteria 1062
208 Ga0070672_101306011 3300005543 Bacteria 648
209 Ga0070686_100077079 3300005544 Bacteria 2197
210 Ga0070686_100216098 3300005544 Bacteria 1383
211 Ga0070686_100356372 3300005544 Bacteria 1101
212 Ga0070695_100029690 3300005545 Bacteria 3399
213 Ga0070695_100044017 3300005545 Bacteria 2840
214 Ga0070695_100139996 3300005545 Bacteria 1677
215 Ga0070695_100234522 3300005545 Bacteria 1328
216 Ga0070695_100318703 3300005545 Bacteria 1155
217 Ga0070695_100845117 3300005545 Bacteria 736
218 Ga0070695_101356860 3300005545 Bacteria 589
219 Ga0070696_100007356 3300005546 Bacteria 7353
220 Ga0070696_100044198 3300005546 Bacteria 3084
221 Ga0070696_100071259 3300005546 Bacteria 2445
222 Ga0070696_100123373 3300005546 Bacteria 1877
223 Ga0070696_100130277 3300005546 Bacteria 1829
224 Ga0070696_100132779 3300005546 Bacteria 1813
225 Ga0070696_100219894 3300005546 Bacteria 1425
226 Ga0070696_100231927 3300005546 Bacteria 1389
227 Ga0070696_100575534 3300005546 Bacteria 905
228 Ga0070696_100658375 3300005546 Bacteria 850
229 Ga0070693_100027783 3300005547 Bacteria 3070
230 Ga0070693_100077903 3300005547 Bacteria 1969
231 Ga0070693_100109262 3300005547 Bacteria 1698
232 Ga0070693_100338417 3300005547 Bacteria 1026
233 Ga0070693_100339684 3300005547 Unclassified 1024
234 Ga0070665_100113617 3300005548 Bacteria 2711
235 Ga0070665_100199102 3300005548 Bacteria 2004
236 Ga0070665_100352669 3300005548 Bacteria 1477
237 Ga0070665_100478565 3300005548 Bacteria 1256
238 Ga0070704_100009528 3300005549 Bacteria 5875
239 Ga0070704_100011592 3300005549 Bacteria 5412
240 Ga0070704_100023068 3300005549 Bacteria 4057
241 Ga0070704_100026586 3300005549 Bacteria 3826
242 Ga0070704_100094436 3300005549 Bacteria 2237
243 Ga0070704_100149746 3300005549 Bacteria 1833
244 Ga0070704_100236116 3300005549 Bacteria 1494
245 Ga0070704_100356329 3300005549 Bacteria 1236
246 Ga0070704_100364888 3300005549 Bacteria 1223
247 Ga0070704_100478623 3300005549 Bacteria 1077
248 Ga0070704_100625867 3300005549 Bacteria 948
249 Ga0070704_100740339 3300005549 Bacteria 874
250 Ga0070704_100881139 3300005549 Bacteria 804
251 Ga0070704_101175056 3300005549 Bacteria 699
252 Ga0070704_101218897 3300005549 Unclassified 687
253 Ga0068855_100049314 3300005563 Bacteria 4966
254 Ga0068855_100259766 3300005563 Bacteria 1935
255 Ga0068855_101102799 3300005563 Bacteria 830
256 Ga0068855_102144580 3300005563 Bacteria 562
257 Ga0070664_100008844 3300005564 Bacteria 8160
258 Ga0070664_100017454 3300005564 Bacteria 5893
259 Ga0070664_100030702 3300005564 Bacteria 4484
260 Ga0070664_100031434 3300005564 Bacteria 4436
261 Ga0070664_100150997 3300005564 Bacteria 2051
262 Ga0070664_100233420 3300005564 Bacteria 1649
263 Ga0070664_100237293 3300005564 Unclassified 1636
264 Ga0070664_100654682 3300005564 Bacteria 976
265 Ga0070664_101300668 3300005564 Bacteria 687
266 Ga0068857_100025069 3300005577 Bacteria 5253
267 Ga0068857_100090863 3300005577 Bacteria 2732
268 Ga0068857_100399872 3300005577 Bacteria 1278
269 Ga0068857_101365107 3300005577 Bacteria 689
270 Ga0068854_100143340 3300005578 Bacteria 1835
271 Ga0068854_100355889 3300005578 Bacteria 1200
272 Ga0068854_100418746 3300005578 Bacteria 1112
273 Ga0068854_100485655 3300005578 Bacteria 1038
274 Ga0068854_101033726 3300005578 Bacteria 729
275 Ga0068854_101245656 3300005578 Bacteria 668
276 Ga0070702_100569321 3300005615 Bacteria 844
277 Ga0068852_100016540 3300005616 Bacteria 5757
278 Ga0068852_100283692 3300005616 Bacteria 1597
279 Ga0068852_100789010 3300005616 Bacteria 963
280 Ga0068859_100005996 3300005617 Bacteria 12345
281 Ga0068859_100129916 3300005617 Bacteria 2590
282 Ga0068859_100284749 3300005617 Bacteria 1745
283 Ga0068859_100572247 3300005617 Bacteria 1223
284 Ga0068859_100679017 3300005617 Bacteria 1121
285 Ga0068859_100685913 3300005617 Bacteria 1115
286 Ga0068859_102106240 3300005617 Bacteria 623
287 Ga0068864_100012127 3300005618 Bacteria 7120
288 Ga0068864_100108785 3300005618 Bacteria 2467
289 Ga0068864_100270591 3300005618 Bacteria 1583
290 Ga0068864_101278815 3300005618 Bacteria 734
291 Ga0068864_101438611 3300005618 Bacteria 692
292 Ga0068866_10002930 3300005718 Bacteria 7039
293 Ga0068866_10030642 3300005718 Bacteria 2584
294 Ga0068866_10056801 3300005718 Bacteria 2014
295 Ga0068866_10057150 3300005718 Bacteria 2009
296 Ga0068866_10220067 3300005718 Bacteria 1145
297 Ga0068866_10489597 3300005718 Bacteria 812
298 Ga0068866_10527348 3300005718 Bacteria 786
299 Ga0068861_100003626 3300005719 Bacteria 10285
300 Ga0068861_100093499 3300005719 Bacteria 2378
301 Ga0068861_100147200 3300005719 Bacteria 1928
302 Ga0068861_100485336 3300005719 Bacteria 1114
303 Ga0068861_100843906 3300005719 Bacteria 863
304 Ga0068861_101178178 3300005719 Unclassified 740
305 Ga0068861_101270506 3300005719 Bacteria 715
306 Ga0068861_101307375 3300005719 Bacteria 705
307 Ga0068870_10006664 3300005840 Bacteria 5104
308 Ga0068870_10098597 3300005840 Bacteria 1647
309 Ga0068870_10611243 3300005840 Bacteria 742
310 Ga0068863_100219131 3300005841 Bacteria 1833
311 Ga0068863_101584258 3300005841 Bacteria 664
312 Ga0068858_100087487 3300005842 Bacteria 2897
313 Ga0068858_100241232 3300005842 Bacteria 1715
314 Ga0068858_100414419 3300005842 Bacteria 1295
315 Ga0068858_100648451 3300005842 Bacteria 1026
316 Ga0068858_100720944 3300005842 Bacteria 971
317 Ga0068858_100929844 3300005842 Bacteria 851
318 Ga0068858_100990391 3300005842 Bacteria 824
319 Ga0068860_100024438 3300005843 Bacteria 5838
320 Ga0068860_100116974 3300005843 Bacteria 2551
321 Ga0068860_100305282 3300005843 Bacteria 1560
322 Ga0068860_100450958 3300005843 Bacteria 1279
323 Ga0068860_100785850 3300005843 Bacteria 965
324 Ga0068860_102413478 3300005843 Bacteria 546
325 Ga0068862_100032524 3300005844 Bacteria 4407
326 Ga0068862_100287236 3300005844 Bacteria 1509
327 Ga0068862_100293796 3300005844 Bacteria 1493
328 Ga0068862_100316854 3300005844 Bacteria 1438
329 Ga0068862_100336146 3300005844 Bacteria 1398
330 Ga0068862_100366274 3300005844 Bacteria 1340
331 Ga0068862_100452380 3300005844 Bacteria 1211
332 Ga0068862_101018700 3300005844 Unclassified 820
333 Ga0068862_101096847 3300005844 Bacteria 791
334 Ga0068862_101663259 3300005844 Bacteria 646
335 Ga0075365_10028098 3300006038 Bacteria 3585
336 Ga0070715_10261953 3300006163 Bacteria 908
337 Ga0070716_100167049 3300006173 Unclassified 1432
338 Ga0070716_100256937 3300006173 Bacteria 1193
339 Ga0070716_100600124 3300006173 Bacteria 828
340 Ga0097621_100022723 3300006237 Bacteria 4872
341 Ga0097621_100245362 3300006237 Bacteria 1567
342 Ga0097621_100441049 3300006237 Bacteria 1172
343 Ga0097621_100752479 3300006237 Bacteria 900
344 Ga0068871_100019549 3300006358 Bacteria 5174
345 Ga0068871_100161774 3300006358 Bacteria 1915
346 Ga0068871_100476555 3300006358 Bacteria 1122
347 Ga0068871_101768266 3300006358 Bacteria 587
348 Ga0075428_101396988 3300006844 Bacteria 735
349 Ga0075430_100042842 3300006846 Bacteria 3827
350 Ga0075431_100820471 3300006847 Bacteria 902
351 Ga0075433_10184430 3300006852 Bacteria 1856
352 Ga0075434_100086205 3300006871 Bacteria 3140
353 Ga0075429_100419400 3300006880 Bacteria 1172
354 Ga0075429_100861174 3300006880 Bacteria 793
355 Ga0068865_100009846 3300006881 Bacteria 5938
356 Ga0068865_100046522 3300006881 Bacteria 2977
357 Ga0068865_100324242 3300006881 Unclassified 1240
358 Ga0068865_100381130 3300006881 Bacteria 1150
359 Ga0068865_100540160 3300006881 Bacteria 977
360 Ga0075436_100049578 3300006914 Bacteria 2898
361 Ga0097620_100005996 3300006931 Bacteria 12345
362 Ga0097620_100129913 3300006931 Bacteria 2590
363 Ga0097620_100284758 3300006931 Bacteria 1745
364 Ga0097620_100572217 3300006931 Bacteria 1223
365 Ga0097620_100679038 3300006931 Bacteria 1121
366 Ga0097620_100685925 3300006931 Bacteria 1115
367 Ga0097620_102106164 3300006931 Bacteria 623
368 Ga0075435_100096259 3300007076 Bacteria 2448
369 Ga0075435_101071972 3300007076 Unclassified 704
370 Ga0075435_101103182 3300007076 Bacteria 694
371 Ga0105240_10165354 3300009093 Bacteria 2625
372 Ga0105240_10837133 3300009093 Bacteria 994
373 Ga0111539_10351704 3300009094 Bacteria 1715
374 Ga0105245_10010181 3300009098 Bacteria 8187
375 Ga0105245_10063418 3300009098 Bacteria 3336
376 Ga0105245_10176172 3300009098 Bacteria 2040
377 Ga0105245_10371327 3300009098 Bacteria 1422
378 Ga0105245_10400948 3300009098 Bacteria 1371
379 Ga0105245_11259525 3300009098 Bacteria 788
380 Ga0105245_11318578 3300009098 Bacteria 771
381 Ga0105245_12256191 3300009098 Bacteria 598
382 Ga0105247_10007822 3300009101 Bacteria 6542
383 Ga0105247_10127503 3300009101 Bacteria 1655
384 Ga0105247_10647687 3300009101 Bacteria 789
385 Ga0105247_11262402 3300009101 Bacteria 591
386 Ga0105247_11639582 3300009101 Bacteria 530
387 Ga0114129_10032342 3300009147 Bacteria 7394
388 Ga0114129_10529967 3300009147 Bacteria 1534
389 Ga0114129_11394255 3300009147 Bacteria 865
390 Ga0105243_10006313 3300009148 Bacteria 9161
391 Ga0105243_10008947 3300009148 Bacteria 7656
392 Ga0105243_10061539 3300009148 Bacteria 3003
393 Ga0105243_10113128 3300009148 Bacteria 2275
394 Ga0105243_10340928 3300009148 Bacteria 1373
395 Ga0105243_10424372 3300009148 Bacteria 1241
396 Ga0105243_10698079 3300009148 Bacteria 989
397 Ga0105243_11211015 3300009148 Bacteria 769
398 Ga0105243_12362227 3300009148 Bacteria 570
399 Ga0105243_12702031 3300009148 Bacteria 537
400 Ga0105241_10031186 3300009174 Bacteria 3990
401 Ga0105241_10351769 3300009174 Bacteria 1279
402 Ga0105241_10737572 3300009174 Bacteria 902
403 Ga0105241_12397540 3300009174 Bacteria 527
404 Ga0105242_10001731 3300009176 Bacteria 17235
405 Ga0105242_10007694 3300009176 Bacteria 8292
406 Ga0105242_10063636 3300009176 Bacteria 3038
407 Ga0105242_10074807 3300009176 Bacteria 2819
408 Ga0105242_10075960 3300009176 Bacteria 2799
409 Ga0105242_10200201 3300009176 Bacteria 1774
410 Ga0105242_10293568 3300009176 Bacteria 1481
411 Ga0105242_10349285 3300009176 Bacteria 1365
412 Ga0105242_10673342 3300009176 Bacteria 1009
413 Ga0105242_10782392 3300009176 Bacteria 943
414 Ga0105242_11317343 3300009176 Bacteria 746
415 Ga0105242_12364314 3300009176 Bacteria 578
416 Ga0105248_10013383 3300009177 Bacteria 9030
417 Ga0105248_10020675 3300009177 Bacteria 7294
418 Ga0105248_10035985 3300009177 Bacteria 5537
419 Ga0105248_10124050 3300009177 Bacteria 2913
420 Ga0105248_10127966 3300009177 Bacteria 2865
421 Ga0105248_10150007 3300009177 Bacteria 2630
422 Ga0105248_10177339 3300009177 Bacteria 2401
423 Ga0105248_10211271 3300009177 Bacteria 2186
424 Ga0105248_10211338 3300009177 Bacteria 2186
425 Ga0105248_10213350 3300009177 Bacteria 2175
426 Ga0105248_10317118 3300009177 Bacteria 1756
427 Ga0105248_10516179 3300009177 Bacteria 1347
428 Ga0105248_11202054 3300009177 Bacteria 857
429 Ga0105248_11524487 3300009177 Bacteria 757
430 Ga0105248_11614322 3300009177 Bacteria 735
431 Ga0105248_11729790 3300009177 Bacteria 709
432 Ga0105248_12753862 3300009177 Bacteria 561
433 Ga0105248_12755802 3300009177 Bacteria 561
434 Ga0105238_10432334 3300009551 Bacteria 1312
435 Ga0105238_11929824 3300009551 Bacteria 624
436 Ga0105249_10041426 3300009553 Bacteria 4187
437 Ga0105249_10046510 3300009553 Bacteria 3949
438 Ga0105249_10233509 3300009553 Bacteria 1815
439 Ga0105249_10520728 3300009553 Bacteria 1236
440 Ga0105249_11164026 3300009553 Bacteria 842
441 Ga0105249_12955517 3300009553 Bacteria 546
442 Ga0099796_10176113 3300010159 Bacteria 856
443 Ga0105239_10912468 3300010375 Bacteria 1008
444 Ga0105246_10240588 3300011119 Bacteria 1430
445 Ga0105246_10411867 3300011119 Bacteria 1125
446 Ga0105246_12490914 3300011119 Unclassified 509
447 Ga0157373_10079977 3300013100 Bacteria 2305
448 Ga0157373_10443384 3300013100 Bacteria 934
449 Ga0157369_10157414 3300013105 Bacteria 2399
450 Ga0157369_10549793 3300013105 Bacteria 1193
451 Ga0157369_12530967 3300013105 Bacteria 519
452 Ga0157374_10609305 3300013296 Bacteria 1102
453 Ga0157374_11412386 3300013296 Bacteria 719
454 Ga0157378_10027498 3300013297 Bacteria 5019
455 Ga0157378_10038678 3300013297 Bacteria 4229
456 Ga0157378_10117321 3300013297 Bacteria 2449
457 Ga0157378_10121354 3300013297 Bacteria 2409
458 Ga0157378_10155494 3300013297 Bacteria 2134
459 Ga0157378_10219292 3300013297 Bacteria 1808
460 Ga0157378_10624133 3300013297 Bacteria 1091
461 Ga0157378_10924819 3300013297 Bacteria 904
462 Ga0157378_11096409 3300013297 Bacteria 833
463 Ga0157378_11115704 3300013297 Bacteria 826
464 Ga0157378_11221895 3300013297 Bacteria 791
465 Ga0163162_10016927 3300013306 Bacteria 7131
466 Ga0163162_10504196 3300013306 Bacteria 1341
467 Ga0163162_10781836 3300013306 Bacteria 1073
468 Ga0163162_11257810 3300013306 Bacteria 840
469 Ga0163162_13496774 3300013306 Bacteria 500
470 Ga0157372_10001889 3300013307 Bacteria 22727
471 Ga0157372_10055528 3300013307 Bacteria 4423
472 Ga0157372_10449094 3300013307 Bacteria 1502
473 Ga0157372_12301982 3300013307 Bacteria 619
474 Ga0157372_13112164 3300013307 Bacteria 530
475 Ga0157375_10103348 3300013308 Bacteria 2936
476 Ga0157375_10170956 3300013308 Bacteria 2321
477 Ga0157375_10181104 3300013308 Bacteria 2258
478 Ga0157375_10427200 3300013308 Bacteria 1491
479 Ga0157375_10442706 3300013308 Bacteria 1465
480 Ga0157375_10744858 3300013308 Bacteria 1131
481 Ga0157375_10790923 3300013308 Bacteria 1098
482 Ga0163163_10008318 3300014325 Bacteria 9210
483 Ga0163163_10188332 3300014325 Unclassified 2112
484 Ga0163163_10404746 3300014325 Bacteria 1423
485 Ga0163163_10825991 3300014325 Bacteria 990
486 Ga0163163_12850278 3300014325 Bacteria 539
487 Ga0157380_10005322 3300014326 Bacteria 8992
488 Ga0157380_10006772 3300014326 Bacteria 8100
489 Ga0157380_10078207 3300014326 Bacteria 2698
490 Ga0157380_11063596 3300014326 Bacteria 846
491 Ga0157380_12033505 3300014326 Bacteria 637
492 Ga0157377_10145344 3300014745 Bacteria 1461
493 Ga0157377_10236004 3300014745 Bacteria 1178
494 Ga0157377_11149429 3300014745 Bacteria 598
495 Ga0157379_10016559 3300014968 Bacteria 6483
496 Ga0157379_11909322 3300014968 Bacteria 585
497 Ga0157376_10027019 3300014969 Bacteria 4544
498 Ga0157376_10385977 3300014969 Bacteria 1350
499 Ga0157376_10455014 3300014969 Bacteria 1249
500 Ga0157376_11150974 3300014969 Bacteria 803
501 Ga0163161_10046007 3300017792 Bacteria 3148
502 Ga0163161_10195801 3300017792 Bacteria 1556
503 Ga0163161_10426747 3300017792 Bacteria 1068
504 Ga0207697_10108439 3300025315 Bacteria 1188
505 Ga0207656_10068245 3300025321 Bacteria 1575
506 Ga0207653_10019055 3300025885 Bacteria 2163
507 Ga0207682_10289598 3300025893 Bacteria 767
508 Ga0207642_10052150 3300025899 Bacteria 1854
509 Ga0207642_10076151 3300025899 Bacteria 1614
510 Ga0207642_10100344 3300025899 Unclassified 1452
511 Ga0207642_10104345 3300025899 Bacteria 1430
512 Ga0207642_10106430 3300025899 Bacteria 1419
513 Ga0207642_10405755 3300025899 Bacteria 816
514 Ga0207642_10619741 3300025899 Bacteria 675
515 Ga0207710_10015102 3300025900 Bacteria 3261
516 Ga0207710_10385615 3300025900 Bacteria 718
517 Ga0207680_10082338 3300025903 Bacteria 2025
518 Ga0207647_10332163 3300025904 Bacteria 862
519 Ga0207685_10216090 3300025905 Bacteria 909
520 Ga0207685_10335148 3300025905 Unclassified 758
521 Ga0207645_10047637 3300025907 Bacteria 2737
522 Ga0207645_10078521 3300025907 Bacteria 2115
523 Ga0207645_10111868 3300025907 Bacteria 1768
524 Ga0207645_10553894 3300025907 Bacteria 780
525 Ga0207645_10761998 3300025907 Bacteria 658
526 Ga0207643_10018568 3300025908 Bacteria 3807
527 Ga0207643_10146964 3300025908 Bacteria 1411
528 Ga0207705_10040024 3300025909 Bacteria 3360
529 Ga0207705_10496692 3300025909 Unclassified 947
530 Ga0207705_11414501 3300025909 Bacteria 528
531 Ga0207684_10124716 3300025910 Bacteria 2209
532 Ga0207684_10195739 3300025910 Bacteria 1744
533 Ga0207684_11234291 3300025910 Bacteria 618
534 Ga0207707_10002650 3300025912 Bacteria 15996
535 Ga0207707_10215422 3300025912 Bacteria 1672
536 Ga0207707_10447756 3300025912 Bacteria 1105
537 Ga0207707_10482743 3300025912 Bacteria 1058
538 Ga0207707_10634567 3300025912 Bacteria 902
539 Ga0207695_10344938 3300025913 Bacteria 1377
540 Ga0207695_10802996 3300025913 Bacteria 821
541 Ga0207660_10025499 3300025917 Bacteria 4013
542 Ga0207660_10027149 3300025917 Bacteria 3904
543 Ga0207660_10030177 3300025917 Bacteria 3725
544 Ga0207660_10116666 3300025917 Bacteria 2017
545 Ga0207660_10211928 3300025917 Bacteria 1517
546 Ga0207660_10834809 3300025917 Bacteria 752
547 Ga0207660_10916835 3300025917 Bacteria 715
548 Ga0207660_11031584 3300025917 Bacteria 671
549 Ga0207660_11510879 3300025917 Bacteria 542
550 Ga0207662_10007207 3300025918 Bacteria 6048
551 Ga0207662_10123035 3300025918 Bacteria 1628
552 Ga0207662_10283392 3300025918 Bacteria 1097
553 Ga0207662_10400786 3300025918 Bacteria 930
554 Ga0207662_10549501 3300025918 Bacteria 800
555 Ga0207662_10679194 3300025918 Bacteria 721
556 Ga0207657_10018259 3300025919 Bacteria 6706
557 Ga0207657_10454929 3300025919 Bacteria 1004
558 Ga0207649_10047344 3300025920 Bacteria 2646
559 Ga0207649_10750266 3300025920 Bacteria 759
560 Ga0207652_10004748 3300025921 Bacteria 11015
561 Ga0207652_10026650 3300025921 Bacteria 4817
562 Ga0207652_10124114 3300025921 Bacteria 2299
563 Ga0207652_10303448 3300025921 Bacteria 1441
564 Ga0207652_10616812 3300025921 Bacteria 972
565 Ga0207652_10705918 3300025921 Bacteria 900
566 Ga0207646_10001909 3300025922 Bacteria 25104
567 Ga0207646_10020376 3300025922 Bacteria 6146
568 Ga0207646_10048888 3300025922 Bacteria 3790
569 Ga0207646_10076769 3300025922 Bacteria 2986
570 Ga0207646_11603320 3300025922 Unclassified 561
571 Ga0207681_10031727 3300025923 Bacteria 3452
572 Ga0207681_10101123 3300025923 Bacteria 2079
573 Ga0207681_10139452 3300025923 Bacteria 1804
574 Ga0207694_11036063 3300025924 Bacteria 694
575 Ga0207650_10175530 3300025925 Bacteria 1705
576 Ga0207650_10177015 3300025925 Bacteria 1698
577 Ga0207650_10290556 3300025925 Bacteria 1333
578 Ga0207650_10356562 3300025925 Bacteria 1204
579 Ga0207650_10358611 3300025925 Bacteria 1201
580 Ga0207650_10820568 3300025925 Bacteria 788
581 Ga0207659_10334437 3300025926 Bacteria 1253
582 Ga0207659_10833243 3300025926 Bacteria 793
583 Ga0207687_10288322 3300025927 Bacteria 1318
584 Ga0207687_10834777 3300025927 Bacteria 787
585 Ga0207664_10055111 3300025929 Bacteria 3154
586 Ga0207644_10031226 3300025931 Bacteria 3710
587 Ga0207644_10346690 3300025931 Bacteria 1205
588 Ga0207690_10094490 3300025932 Bacteria 2121
589 Ga0207706_10051235 3300025933 Bacteria 3646
590 Ga0207706_10069560 3300025933 Bacteria 3096
591 Ga0207706_10125820 3300025933 Bacteria 2254
592 Ga0207706_10993855 3300025933 Bacteria 705
593 Ga0207686_10009492 3300025934 Bacteria 5279
594 Ga0207686_10016100 3300025934 Bacteria 4191
595 Ga0207686_10020990 3300025934 Bacteria 3740
596 Ga0207686_10032454 3300025934 Bacteria 3108
597 Ga0207686_10459256 3300025934 Bacteria 981
598 Ga0207686_10749490 3300025934 Bacteria 779
599 Ga0207686_11830278 3300025934 Bacteria 503
600 Ga0207709_10012061 3300025935 Bacteria 4765
601 Ga0207709_10091584 3300025935 Bacteria 1988
602 Ga0207709_10174276 3300025935 Bacteria 1512
603 Ga0207709_10426915 3300025935 Bacteria 1019
604 Ga0207670_10362566 3300025936 Bacteria 1150
605 Ga0207670_10394328 3300025936 Bacteria 1105
606 Ga0207670_10435171 3300025936 Bacteria 1055
607 Ga0207670_11004954 3300025936 Bacteria 702
608 Ga0207669_10021938 3300025937 Bacteria 3382
609 Ga0207669_10117263 3300025937 Bacteria 1799
610 Ga0207669_10408068 3300025937 Bacteria 1066
611 Ga0207669_10439606 3300025937 Bacteria 1031
612 Ga0207669_10873151 3300025937 Bacteria 750
613 Ga0207704_10012093 3300025938 Bacteria 4275
614 Ga0207704_10066357 3300025938 Bacteria 2265
615 Ga0207704_10415646 3300025938 Bacteria 1065
616 Ga0207691_10074169 3300025940 Bacteria 3069
617 Ga0207691_10173222 3300025940 Unclassified 1889
618 Ga0207691_10199525 3300025940 Bacteria 1742
619 Ga0207691_10657092 3300025940 Bacteria 885
620 Ga0207691_10684318 3300025940 Bacteria 865
621 Ga0207691_11146859 3300025940 Bacteria 646
622 Ga0207711_10009730 3300025941 Bacteria 8000
623 Ga0207711_10013459 3300025941 Bacteria 6796
624 Ga0207711_10051458 3300025941 Bacteria 3527
625 Ga0207711_10064458 3300025941 Bacteria 3165
626 Ga0207711_10069831 3300025941 Bacteria 3046
627 Ga0207711_10131763 3300025941 Bacteria 2242
628 Ga0207711_10228897 3300025941 Bacteria 1702
629 Ga0207711_10269520 3300025941 Bacteria 1566
630 Ga0207711_10523399 3300025941 Bacteria 1106
631 Ga0207711_11146704 3300025941 Bacteria 718
632 Ga0207711_11287451 3300025941 Bacteria 673
633 Ga0207689_10051142 3300025942 Bacteria 3406
634 Ga0207689_10084520 3300025942 Bacteria 2608
635 Ga0207689_10315244 3300025942 Bacteria 1297
636 Ga0207689_10514052 3300025942 Bacteria 1004
637 Ga0207689_10720973 3300025942 Bacteria 841
638 Ga0207661_10006492 3300025944 Bacteria 8270
639 Ga0207661_10064919 3300025944 Bacteria 2961
640 Ga0207661_10139563 3300025944 Bacteria 2085
641 Ga0207661_10256365 3300025944 Bacteria 1556
642 Ga0207661_10665394 3300025944 Bacteria 957
643 Ga0207661_11073800 3300025944 Bacteria 741
644 Ga0207679_10016488 3300025945 Bacteria 4907
645 Ga0207679_10019804 3300025945 Bacteria 4530
646 Ga0207679_10085794 3300025945 Bacteria 2419
647 Ga0207679_10512934 3300025945 Bacteria 1071
648 Ga0207679_10530297 3300025945 Bacteria 1054
649 Ga0207679_10569941 3300025945 Bacteria 1018
650 Ga0207667_10095989 3300025949 Bacteria 3060
651 Ga0207667_10371768 3300025949 Bacteria 1457
652 Ga0207651_10022140 3300025960 Bacteria 3879
653 Ga0207651_10044403 3300025960 Bacteria 2974
654 Ga0207651_10093905 3300025960 Bacteria 2204
655 Ga0207651_10243234 3300025960 Bacteria 1468
656 Ga0207651_10812923 3300025960 Bacteria 829
657 Ga0207651_10884367 3300025960 Bacteria 795
658 Ga0207651_11750273 3300025960 Bacteria 559
659 Ga0207712_10049501 3300025961 Bacteria 2928
660 Ga0207712_10173096 3300025961 Bacteria 1689
661 Ga0207712_10852699 3300025961 Bacteria 803
662 Ga0207712_11099881 3300025961 Bacteria 707
663 Ga0207668_10070289 3300025972 Bacteria 2496
664 Ga0207668_10087312 3300025972 Bacteria 2281
665 Ga0207668_10207095 3300025972 Bacteria 1566
666 Ga0207668_10259812 3300025972 Bacteria 1414
667 Ga0207640_10066928 3300025981 Bacteria 2402
668 Ga0207640_10143186 3300025981 Bacteria 1745
669 Ga0207640_10176126 3300025981 Bacteria 1599
670 Ga0207640_10433213 3300025981 Bacteria 1079
671 Ga0207640_10747963 3300025981 Bacteria 843
672 Ga0207658_10086948 3300025986 Bacteria 2413
673 Ga0207658_11164956 3300025986 Bacteria 704
674 Ga0207658_11382392 3300025986 Bacteria 644
675 Ga0207677_10028141 3300026023 Bacteria 3550
676 Ga0207677_10141672 3300026023 Bacteria 1842
677 Ga0207677_10347645 3300026023 Bacteria 1241
678 Ga0207677_10679778 3300026023 Bacteria 911
679 Ga0207677_10888129 3300026023 Bacteria 803
680 Ga0207677_11235836 3300026023 Bacteria 685
681 Ga0207677_11431483 3300026023 Bacteria 637
682 Ga0207703_10005090 3300026035 Bacteria 10633
683 Ga0207703_10109581 3300026035 Bacteria 2354
684 Ga0207703_10257820 3300026035 Bacteria 1575
685 Ga0207703_10266762 3300026035 Bacteria 1549
686 Ga0207703_10626474 3300026035 Bacteria 1019
687 Ga0207703_10780821 3300026035 Bacteria 911
688 Ga0207703_11711948 3300026035 Bacteria 605
689 Ga0207639_10161393 3300026041 Bacteria 1889
690 Ga0207639_10420962 3300026041 Bacteria 1207
691 Ga0207639_11348568 3300026041 Bacteria 669
692 Ga0207678_10027841 3300026067 Bacteria 4935
693 Ga0207678_10749383 3300026067 Bacteria 861
694 Ga0207708_10014453 3300026075 Bacteria 5909
695 Ga0207708_10019568 3300026075 Bacteria 5105
696 Ga0207708_10054048 3300026075 Bacteria 3061
697 Ga0207708_10342963 3300026075 Bacteria 1224
698 Ga0207708_10353328 3300026075 Bacteria 1206
699 Ga0207708_10584226 3300026075 Bacteria 945
700 Ga0207641_10089670 3300026088 Bacteria 2688
701 Ga0207641_10524481 3300026088 Bacteria 1153
702 Ga0207641_10655149 3300026088 Bacteria 1031
703 Ga0207641_10737523 3300026088 Bacteria 972
704 Ga0207641_12033571 3300026088 Bacteria 576
705 Ga0207648_10061013 3300026089 Bacteria 3288
706 Ga0207648_10152535 3300026089 Bacteria 2039
707 Ga0207648_10185600 3300026089 Bacteria 1842
708 Ga0207648_10246779 3300026089 Bacteria 1591
709 Ga0207648_10401278 3300026089 Bacteria 1242
710 Ga0207648_10441973 3300026089 Bacteria 1183
711 Ga0207648_10947608 3300026089 Bacteria 805
712 Ga0207648_10995156 3300026089 Bacteria 785
713 Ga0207648_11380126 3300026089 Bacteria 662
714 Ga0207676_10036069 3300026095 Bacteria 3759
715 Ga0207676_10041523 3300026095 Bacteria 3532
716 Ga0207676_10114355 3300026095 Bacteria 2264
717 Ga0207676_10841389 3300026095 Bacteria 897
718 Ga0207676_11110534 3300026095 Bacteria 782
719 Ga0207676_11542524 3300026095 Bacteria 662
720 Ga0207674_10006815 3300026116 Bacteria 13399
721 Ga0207674_10007951 3300026116 Bacteria 12311
722 Ga0207674_10010253 3300026116 Bacteria 10638
723 Ga0207674_10016170 3300026116 Bacteria 8171
724 Ga0207674_10102541 3300026116 Bacteria 2841
725 Ga0207674_10228657 3300026116 Bacteria 1808
726 Ga0207675_100005501 3300026118 Bacteria 12120
727 Ga0207675_100027077 3300026118 Bacteria 5338
728 Ga0207675_100091653 3300026118 Bacteria 2858
729 Ga0207675_100108865 3300026118 Bacteria 2614
730 Ga0207675_100124167 3300026118 Bacteria 2444
731 Ga0207675_100148787 3300026118 Bacteria 2228
732 Ga0207675_100176375 3300026118 Bacteria 2045
733 Ga0207675_100289901 3300026118 Bacteria 1592
734 Ga0207675_101037219 3300026118 Bacteria 839
735 Ga0207683_10029082 3300026121 Bacteria 4782
736 Ga0207683_10381277 3300026121 Bacteria 1296
737 Ga0207683_10861970 3300026121 Bacteria 841
738 Ga0207683_11659060 3300026121 Bacteria 588
739 Ga0207698_10011925 3300026142 Bacteria 5661
740 Ga0207698_10163413 3300026142 Bacteria 1950
741 Ga0207698_10361985 3300026142 Bacteria 1374
742 Ga0207698_12009086 3300026142 Bacteria 592
743 Ga0268266_10042157 3300028379 Bacteria 3897
744 Ga0268266_10074919 3300028379 Bacteria 2939
745 Ga0268265_10003201 3300028380 Bacteria 11886
746 Ga0268265_10133364 3300028380 Bacteria 2068
747 Ga0268265_10160352 3300028380 Bacteria 1910
748 Ga0268265_10168137 3300028380 Bacteria 1871
749 Ga0268265_10244186 3300028380 Bacteria 1586
750 Ga0268265_10290676 3300028380 Bacteria 1467
751 Ga0268265_10375220 3300028380 Bacteria 1306
752 Ga0268265_10588024 3300028380 Bacteria 1062
753 Ga0268265_11107853 3300028380 Bacteria 786
754 Ga0268265_11257653 3300028380 Bacteria 739
755 Ga0268265_11755936 3300028380 Bacteria 627
756 Ga0268265_12646624 3300028380 Bacteria 507
757 Ga0268264_10234056 3300028381 Bacteria 1698
758 Ga0268264_10276915 3300028381 Bacteria 1570
759 Ga0268264_10307732 3300028381 Bacteria 1494
760 Ga0268264_10776178 3300028381 Bacteria 956
761 Ga0268264_10870597 3300028381 Bacteria 903
762 Ga0268264_11235344 3300028381 Bacteria 757
763 Ga0268264_11924309 3300028381 Bacteria 601
764 Ga0268264_12042110 3300028381 Bacteria 582
765 Ga0265319_1184062 3300028563 Bacteria 643
766 Ga0265318_10154581 3300028577 Bacteria 841
767 Ga0265338_10011337 3300028800 Bacteria 10311
768 Ga0307511_10068812 3300030521 Bacteria 2610
769 Ga0265330_10156447 3300031235 Bacteria 968
770 Ga0265332_10033825 3300031238 Bacteria 2224
771 Ga0265332_10153162 3300031238 Bacteria 964
772 Ga0265320_10092417 3300031240 Bacteria 1401
773 Ga0265325_10224130 3300031241 Bacteria 859
774 Ga0265340_10044498 3300031247 Bacteria 2172
775 Ga0265331_10276883 3300031250 Bacteria 752
776 Ga0265331_10425538 3300031250 Unclassified 596
777 Ga0307509_10070678 3300031507 Bacteria 3644
778 Ga0265314_10046574 3300031711 Bacteria 3058
779 Ga0265314_10114384 3300031711 Bacteria 1709
780 Ga0307405_10117759 3300031731 Bacteria 1812
781 Ga0307405_10500099 3300031731 Bacteria 974
782 Ga0307413_10408482 3300031824 Bacteria 1066
783 Ga0307410_10571356 3300031852 Bacteria 940
784 Ga0307406_10107282 3300031901 Bacteria 1915
785 Ga0307406_11684482 3300031901 Bacteria 562
786 Ga0307407_11266786 3300031903 Bacteria 578
787 Ga0307409_101283534 3300031995 Bacteria 757
788 Ga0307416_100031842 3300032002 Bacteria 3976
789 Ga0307416_100036276 3300032002 Bacteria 3779
790 Ga0307416_102737954 3300032002 Bacteria 589
791 Ga0307411_10071665 3300032005 Bacteria 2350
792 Ga0307411_10381841 3300032005 Bacteria 1159
793 Ga0307415_100090573 3300032126 Bacteria 2213
794 Ga0307415_100341923 3300032126 Bacteria 1256
795 Ga0307415_100634861 3300032126 Bacteria 955
796 Ga0307415_100642767 3300032126 Bacteria 950
797 Ga0373934_0000815 3300035086 Bacteria 11262
798 Ga0373923_0025277 3300035111 Bacteria 2352
799 Ga0373936_0429117 3300035113 Bacteria 609
800 Ga0373945_0401610 3300035116 Bacteria 601
801 Ga0373954_0277782 3300035118 Bacteria 826
802 Ga0373956_0374587 3300035119 Bacteria 679
803 Ga0373943_0426439 3300035170 Bacteria 768
804 Ga0373955_0000938 3300035172 Bacteria 12482
805 Ga0373924_0012115 3300035410 Bacteria 3216
806 Ga0373931_1183221 3300035691 Bacteria 523
807 Ga0373935_0090714 3300035692 Bacteria 2001
808 Ga0373935_0459486 3300035692 Bacteria 921
809 Ga0373947_0503941 3300035725 Bacteria 823
810 Ga0373937_0000357 3300036401 Bacteria 42470
811 Ga0373937_0916384 3300036401 Bacteria 825
812 Ga0373925_0193759 3300037068 Bacteria 1614
813 Ga0373925_1141254 3300037068 Bacteria 641
814 Ga0395899_0050610 3300037312 Bacteria 3084
815 Ga0395900_0139693 3300037418 Bacteria 2481
816 Ga0395898_0098069 3300037466 Bacteria 2814
817 Ga0395905_0033247 3300037471 Bacteria 4845
818 Ga0395901_0041568 3300038443 Bacteria 4765
819 Ga0451793_1530940 3300041452 Bacteria 1952
820 Ga0451798_0845512 3300041458 Bacteria 595
821 Ga0451807_0790791 3300041486 Bacteria 2457
822 Ga0451807_1189504 3300041486 Bacteria 939
823 Ga0451807_2760709 3300041486 Bacteria 2571
824 Ga0439449_0002401 3300042007 Bacteria 7329
825 Ga0439462_0036635 3300042015 Bacteria 1305
826 Ga0439462_0126351 3300042015 Bacteria 713
827 Ga0450923_035312 3300042125 Bacteria 1034
828 Ga0439446_0144682 3300042156 Bacteria 778
829 Ga0439444_0050536 3300042437 Bacteria 844
830 Ga0439444_0065246 3300042437 Bacteria 768
831 Ga0451577_0195259 3300042876 Bacteria 1826
832 Ga0451577_0744748 3300042876 Bacteria 886
833 Ga0453684_0192227 3300044712 Bacteria 2386
834 Ga0466971_0441409 3300044719 Bacteria 638
835 Ga0451576_0206236 3300045051 Bacteria 2053
836 Ga0451576_2098904 3300045051 Bacteria 581
837 Ga0495592_0016234 3300046454 Bacteria 5650
838 Ga0495592_0073047 3300046454 Bacteria 2495
839 Ga0495629_0287239 3300046459 Bacteria 1128
840 Ga0495629_0412380 3300046459 Bacteria 917
841 Ga0495651_0000098 3300046462 Bacteria 63881
842 Ga0495651_0592647 3300046462 Bacteria 700
843 Ga0495653_0000168 3300046463 Bacteria 54127
844 Ga0495582_0011103 3300046473 Bacteria 4959
845 Ga0495582_0085679 3300046473 Bacteria 1753
846 Ga0495639_0039185 3300046475 Bacteria 2130
847 Ga0495608_0004664 3300046511 Bacteria 9800
848 Ga0495618_0098434 3300046514 Bacteria 1871
849 Ga0495628_0058932 3300046516 Bacteria 3016
850 Ga0495630_0003348 3300046517 Bacteria 11165
851 Ga0495630_0315656 3300046517 Bacteria 1195
852 Ga0495643_0347487 3300046522 Bacteria 665
853 Ga0495663_0013771 3300046525 Bacteria 2262
854 Ga0495663_0043204 3300046525 Bacteria 1376
855 Ga0495663_0186536 3300046525 Bacteria 720
856 Ga0495652_0011033 3300046529 Bacteria 8188
857 Ga0495665_0073585 3300046531 Bacteria 1799
858 Ga0495586_0190735 3300046535 Bacteria 1161
859 Ga0495587_0000808 3300046536 Bacteria 20871
860 Ga0495621_0006207 3300046539 Bacteria 3476
861 Ga0495621_0078576 3300046539 Bacteria 1227
862 Ga0495621_0110980 3300046539 Bacteria 1052
863 Ga0495645_0000106 3300046543 Bacteria 57528
864 Ga0495645_0016060 3300046543 Bacteria 5338
865 Ga0495645_0080033 3300046543 Bacteria 2346
866 Ga0495645_0414975 3300046543 Bacteria 855
867 Ga0495667_0000570 3300046559 Bacteria 23526
868 Ga0495634_0652495 3300046642 Bacteria 608
869 Ga0495657_0003960 3300046675 Bacteria 11885
870 Ga0495657_0066703 3300046675 Bacteria 2364
871 Ga0495599_0010947 3300046678 Bacteria 5562
872 Ga0495599_0031543 3300046678 Bacteria 3326
873 Ga0495599_0484399 3300046678 Bacteria 729
874 Ga0495623_0000509 3300046679 Bacteria 25753
875 Ga0495646_0108854 3300046680 Bacteria 1579
876 Ga0495658_0032272 3300046683 Bacteria 2859
877 Ga0495658_0642618 3300046683 Bacteria 680
878 Ga0495669_0100660 3300046684 Bacteria 1342
879 Ga0495669_0303456 3300046684 Bacteria 770
880 Ga0495613_0402710 3300046689 Bacteria 933
881 Ga0495613_0619461 3300046689 Bacteria 719
882 Ga0495600_0000944 3300046809 Bacteria 15646
883 Ga0495581_0781249 3300047315 Bacteria 548
884 Ga0495604_0002016 3300047317 Bacteria 16374
885 Ga0495604_0250385 3300047317 Bacteria 1208
886 Ga0495604_0987654 3300047317 Bacteria 522
887 Ga0495674_0152908 3300047319 Bacteria 1934
888 Ga0495674_0382309 3300047319 Bacteria 1139
889 Ga0495680_0041242 3300047322 Bacteria 3672
890 Ga0495680_0484235 3300047322 Bacteria 842
891 Ga0495675_0030845 3300047444 Bacteria 3420
892 Ga0495675_0150694 3300047444 Unclassified 1437
893 Ga0495677_0089492 3300047445 Bacteria 1159
894 Ga0495684_0037228 3300047471 Bacteria 3731
895 Ga0495684_0126312 3300047471 Bacteria 1924
896 Ga0495593_0343497 3300047673 Bacteria 746
897 Ga0495602_0210020 3300048088 Bacteria 1478
898 Ga0495615_0013968 3300048090 Bacteria 1687
899 Ga0496100_0028208 3300048903 Bacteria 3461
900 Ga0496102_1752566 3300048905 Bacteria 539
901 Ga0496104_0249524 3300048907 Bacteria 1688
902 Ga0496104_0282038 3300048907 Bacteria 1574
903 Ga0496104_0517218 3300048907 Bacteria 1105
904 Ga0496104_0580603 3300048907 Bacteria 1031
905 Ga0496106_1555731 3300048909 Bacteria 507
906 Ga0496108_0048777 3300048911 Bacteria 3541
907 Ga0496108_0069171 3300048911 Bacteria 2979
908 Ga0496108_0123989 3300048911 Bacteria 2217
909 Ga0496108_0540242 3300048911 Bacteria 1017
910 Ga0496109_0095642 3300048912 Bacteria 2751
911 Ga0496110_0269422 3300048913 Bacteria 1550
912 Ga0496110_0769358 3300048913 Bacteria 867
913 Ga0496110_1053518 3300048913 Bacteria 721
914 Ga0496111_0170189 3300048914 Bacteria 1619
915 Ga0496112_0174223 3300048915 Bacteria 2116
916 Ga0496112_0207343 3300048915 Bacteria 1918
917 Ga0496112_0247424 3300048915 Bacteria 1735
918 Ga0496112_0266072 3300048915 Bacteria 1663
919 Ga0496112_1426619 3300048915 Bacteria 607
920 Ga0496113_0123886 3300048916 Bacteria 2023
921 Ga0496113_0631036 3300048916 Bacteria 857
922 Ga0496114_0161935 3300048917 Bacteria 1946
923 Ga0496114_0493676 3300048917 Bacteria 1083
924 Ga0496121_0542975 3300048924 Bacteria 729
925 Ga0501298_019005 3300049521 Bacteria 1270
926 Ga0501299_012200 3300049522 Bacteria 1463
927 Ga0501202_031979 3300049652 Bacteria 1103
928 Ga0501243_118615 3300049675 Bacteria 547
929 Ga0501245_072184 3300049708 Bacteria 652
930 nmdc:mga0yw44_71063_c1 3300050492 Bacteria 2160
931 nmdc:mga05p37_264477_c1 3300050507 Bacteria 2057
932 nmdc:mga06r32_1809748_c1 3300050510 Bacteria 546
933 nmdc:mga06r32_91127_c1 3300050510 Bacteria 2979
934 nmdc:mga08y16_451391_c1 3300050511 Bacteria 1311
935 nmdc:mga0n895_773555_c1 3300050512 Unclassified 952
936 nmdc:mga0rr50_1176336_c1 3300050513 Unclassified 652
937 nmdc:mga08x19_1103526_c1 3300050514 Bacteria 563
938 nmdc:mga0a205_131884_c1 3300050515 Bacteria 2399
939 Ga0495601_0028603 3300053077 Bacteria 3453
940 Ga0495612_0009710 3300053078 Bacteria 3897
941 Ga0495595_0015720 3300053084 Bacteria 3230
942 Ga0495595_0085950 3300053084 Bacteria 1504
943 Ga0495595_0350931 3300053084 Bacteria 745
944 Ga0495619_0300194 3300053085 Bacteria 1112
945 Ga0495619_0478820 3300053085 Bacteria 857
946 Ga0495619_0692987 3300053085 Bacteria 693
947 Ga0500650_0354363 3300053098 Bacteria 641
948 nmdc:mga09592_1298000_c1
949 JGI24751J29686_10142424
950 Ga0065712_10071559
951 Ga0065712_10284786
952 Ga0065715_10092479
953 Ga0065715_10830777
954 Ga0065707_10269019
955 Ga0070658_10120531
956 Ga0070658_10260485
957 Ga0070658_10466838
958 Ga0070658_11567787
959 Ga0070676_10178694
960 Ga0070676_10264324
961 Ga0070676_10816923
962 Ga0070683_100014607
963 Ga0070683_100070942
964 Ga0070683_100098391
965 Ga0070683_100150716
966 Ga0070683_100156899
967 Ga0070683_100168202
968 Ga0070683_100202966
969 Ga0070683_101999114
970 Ga0070690_100025033
971 Ga0070690_100094401
972 Ga0070690_101519249
973 Ga0070670_100099201
974 Ga0070670_100186196
975 Ga0070670_100258781
976 Ga0070670_101348373
977 Ga0070677_10159291
978 Ga0070677_10925558
979 Ga0068869_100038662
980 Ga0068869_100584248
981 Ga0068869_100965866
982 Ga0068869_101036214
983 Ga0070666_10626441
984 Ga0070666_11320995
985 Ga0070680_100000997
986 Ga0070680_100077949
987 Ga0070680_100095247
988 Ga0070680_100135202
989 Ga0070680_100262673
990 Ga0070680_100410497
991 Ga0070680_100512489
992 Ga0070680_100942443
993 Ga0070680_101138020
994 Ga0070680_101163573
995 Ga0070680_101197569
996 Ga0070682_100000499
997 Ga0070682_100061267
998 Ga0070682_101023724
999 Ga0070682_101219913
1000 Ga0070682_101357627
1001 Ga0068868_100191921
1002 Ga0068868_100861894
1003 Ga0068868_100895094
1004 Ga0070660_100101022
1005 Ga0070660_100509333
1006 Ga0070660_100571343
1007 Ga0070689_100044673
1008 Ga0070689_100157805
1009 Ga0070689_100261497
1010 Ga0070689_100544242
1011 Ga0070689_101094077
1012 Ga0070691_10506414
1013 Ga0070687_100021405
1014 Ga0070687_100086581
1015 Ga0070687_100138540
1016 Ga0070687_100589613
1017 Ga0070661_100090672
1018 Ga0070661_100179705
1019 Ga0070661_100703302
1020 Ga0070692_10114180
1021 Ga0070692_10341268
1022 Ga0070668_100055632
1023 Ga0070668_100130371
1024 Ga0070668_100151493
1025 Ga0070668_100456924
1026 Ga0070669_100022591
1027 Ga0070669_100058426
1028 Ga0070669_100475048
1029 Ga0070669_100491672
1030 Ga0070669_101273654
1031 Ga0070675_100047781
1032 Ga0070675_100069505
1033 Ga0070675_100411038
1034 Ga0070671_100195308
1035 Ga0070671_100246378
1036 Ga0070671_100769714
1037 Ga0070671_101057071
1038 Ga0070674_100008359
1039 Ga0070674_100080357
1040 Ga0070674_100083863
1041 Ga0070674_100084215
1042 Ga0070674_100150258
1043 Ga0070674_100232994
1044 Ga0070674_101850141
1045 Ga0070673_100004493
1046 Ga0070673_100028433
1047 Ga0070673_100112881
1048 Ga0070673_100145248
1049 Ga0070673_100303370
1050 Ga0070673_100463542
1051 Ga0070673_101207129
1052 Ga0070673_101779531
1053 Ga0070688_100004216
1054 Ga0070688_100168991
1055 Ga0070659_100192065
1056 Ga0070659_100625793
1057 Ga0070659_101926094
1058 Ga0070667_100022726
1059 Ga0070667_100147473
1060 Ga0070667_100464123
1061 Ga0070703_10003812
1062 Ga0070709_10309789
1063 Ga0070709_10949131
1064 Ga0070714_100065119
1065 Ga0070710_10960893
1066 Ga0070701_10041541
1067 Ga0070701_10639875
1068 Ga0070701_10650516
1069 Ga0070705_100002708
1070 Ga0070705_100014443
1071 Ga0070705_100017613
1072 Ga0070705_100547558
1073 Ga0070705_101544907
1074 Ga0070700_100324678
1075 Ga0070700_100379626
1076 Ga0070694_100021148
1077 Ga0070694_100066788
1078 Ga0070694_100108183
1079 Ga0070694_100109472
1080 Ga0070694_100759928
1081 Ga0070694_100797725
1082 Ga0070694_100811156
1083 Ga0070708_100000280
1084 Ga0070708_100888526
1085 Ga0070663_100821812
1086 Ga0070678_100511904
1087 Ga0070678_101716325
1088 Ga0070662_100208006
1089 Ga0070662_100375981
1090 Ga0070662_100474554
1091 Ga0070662_100574322
1092 Ga0070662_101113322
1093 Ga0070681_10031585
1094 Ga0070681_10130107
1095 Ga0070681_10522532
1096 Ga0070681_10901716
1097 Ga0068867_100024892
1098 Ga0068867_100087176
1099 Ga0068867_100129049
1100 Ga0068867_100413600
1101 Ga0068867_100669593
1102 Ga0068867_100695024
1103 Ga0068867_101427040
1104 Ga0068867_102024032
1105 Ga0068867_102312422
1106 Ga0070685_10023204
1107 Ga0070685_10039718
1108 Ga0070706_100097103
1109 Ga0070706_100208258
1110 Ga0070706_100501905
1111 Ga0070706_101568116
1112 Ga0070707_100006461
1113 Ga0070707_100053667
1114 Ga0070707_100081789
1115 Ga0070707_100133966
1116 Ga0070698_100000766
1117 Ga0070698_100040301
1118 Ga0070698_100141710
1119 Ga0070698_100301200
1120 Ga0070698_100462144
1121 Ga0070698_100568904
1122 Ga0070698_100969151
1123 Ga0070698_101511188
1124 Ga0070699_100000148
1125 Ga0070699_100027934
1126 Ga0070699_100032427
1127 Ga0070699_100096316
1128 Ga0070699_100144422
1129 Ga0070699_100674535
1130 Ga0070699_101065149
1131 Ga0070699_101394836
1132 Ga0070699_101840579
1133 Ga0070679_100000837
1134 Ga0070679_100082257
1135 Ga0070679_100293355
1136 Ga0070679_100319211
1137 Ga0070679_100394660
1138 Ga0070684_100111250
1139 Ga0070684_100177022
1140 Ga0070684_100535958
1141 Ga0070697_100021158
1142 Ga0070697_100036353
1143 Ga0070697_100217569
1144 Ga0070697_100422892
1145 Ga0070697_100485648
1146 Ga0070697_100522584
1147 Ga0070697_101547843
1148 Ga0068853_100325637
1149 Ga0068853_100424985
1150 Ga0068853_100479122
1151 Ga0068853_100672072
1152 Ga0070672_100156081
1153 Ga0070672_100279922
1154 Ga0070672_100490186
1155 Ga0070672_101306011
1156 Ga0070686_100077079
1157 Ga0070686_100216098
1158 Ga0070686_100356372
1159 Ga0070695_100029690
1160 Ga0070695_100044017
1161 Ga0070695_100139996
1162 Ga0070695_100234522
1163 Ga0070695_100318703
1164 Ga0070695_100845117
1165 Ga0070695_101356860
1166 Ga0070696_100007356
1167 Ga0070696_100044198
1168 Ga0070696_100071259
1169 Ga0070696_100123373
1170 Ga0070696_100130277
1171 Ga0070696_100132779
1172 Ga0070696_100219894
1173 Ga0070696_100231927
1174 Ga0070696_100575534
1175 Ga0070696_100658375
1176 Ga0070693_100027783
1177 Ga0070693_100077903
1178 Ga0070693_100109262
1179 Ga0070693_100338417
1180 Ga0070693_100339684
1181 Ga0070665_100113617
1182 Ga0070665_100199102
1183 Ga0070665_100352669
1184 Ga0070665_100478565
1185 Ga0070704_100009528
1186 Ga0070704_100011592
1187 Ga0070704_100023068
1188 Ga0070704_100026586
1189 Ga0070704_100094436
1190 Ga0070704_100149746
1191 Ga0070704_100236116
1192 Ga0070704_100356329
1193 Ga0070704_100364888
1194 Ga0070704_100478623
1195 Ga0070704_100625867
1196 Ga0070704_100740339
1197 Ga0070704_100881139
1198 Ga0070704_101175056
1199 Ga0070704_101218897
1200 Ga0068855_100049314
1201 Ga0068855_100259766
1202 Ga0068855_101102799
1203 Ga0068855_102144580
1204 Ga0070664_100008844
1205 Ga0070664_100017454
1206 Ga0070664_100030702
1207 Ga0070664_100031434
1208 Ga0070664_100150997
1209 Ga0070664_100233420
1210 Ga0070664_100237293
1211 Ga0070664_100654682
1212 Ga0070664_101300668
1213 Ga0068857_100025069
1214 Ga0068857_100090863
1215 Ga0068857_100399872
1216 Ga0068857_101365107
1217 Ga0068854_100143340
1218 Ga0068854_100355889
1219 Ga0068854_100418746
1220 Ga0068854_100485655
1221 Ga0068854_101033726
1222 Ga0068854_101245656
1223 Ga0070702_100569321
1224 Ga0068852_100016540
1225 Ga0068852_100283692
1226 Ga0068852_100789010
1227 Ga0068859_100005996
1228 Ga0068859_100129916
1229 Ga0068859_100284749
1230 Ga0068859_100572247
1231 Ga0068859_100679017
1232 Ga0068859_100685913
1233 Ga0068859_102106240
1234 Ga0068864_100012127
1235 Ga0068864_100108785
1236 Ga0068864_100270591
1237 Ga0068864_101278815
1238 Ga0068864_101438611
1239 Ga0068866_10002930
1240 Ga0068866_10030642
1241 Ga0068866_10056801
1242 Ga0068866_10057150
1243 Ga0068866_10220067
1244 Ga0068866_10489597
1245 Ga0068866_10527348
1246 Ga0068861_100003626
1247 Ga0068861_100093499
1248 Ga0068861_100147200
1249 Ga0068861_100485336
1250 Ga0068861_100843906
1251 Ga0068861_101178178
1252 Ga0068861_101270506
1253 Ga0068861_101307375
1254 Ga0068870_10006664
1255 Ga0068870_10098597
1256 Ga0068870_10611243
1257 Ga0068863_100219131
1258 Ga0068863_101584258
1259 Ga0068858_100087487
1260 Ga0068858_100241232
1261 Ga0068858_100414419
1262 Ga0068858_100648451
1263 Ga0068858_100720944
1264 Ga0068858_100929844
1265 Ga0068858_100990391
1266 Ga0068860_100024438
1267 Ga0068860_100116974
1268 Ga0068860_100305282
1269 Ga0068860_100450958
1270 Ga0068860_100785850
1271 Ga0068860_102413478
1272 Ga0068862_100032524
1273 Ga0068862_100287236
1274 Ga0068862_100293796
1275 Ga0068862_100316854
1276 Ga0068862_100336146
1277 Ga0068862_100366274
1278 Ga0068862_100452380
1279 Ga0068862_101018700
1280 Ga0068862_101096847
1281 Ga0068862_101663259
1282 Ga0075365_10028098
1283 Ga0070715_10261953
1284 Ga0070716_100167049
1285 Ga0070716_100256937
1286 Ga0070716_100600124
1287 Ga0097621_100022723
1288 Ga0097621_100245362
1289 Ga0097621_100441049
1290 Ga0097621_100752479
1291 Ga0068871_100019549
1292 Ga0068871_100161774
1293 Ga0068871_100476555
1294 Ga0068871_101768266
1295 Ga0075428_101396988
1296 Ga0075430_100042842
1297 Ga0075431_100820471
1298 Ga0075433_10184430
1299 Ga0075434_100086205
1300 Ga0075429_100419400
1301 Ga0075429_100861174
1302 Ga0068865_100009846
1303 Ga0068865_100046522
1304 Ga0068865_100324242
1305 Ga0068865_100381130
1306 Ga0068865_100540160
1307 Ga0075436_100049578
1308 Ga0097620_100005996
1309 Ga0097620_100129913
1310 Ga0097620_100284758
1311 Ga0097620_100572217
1312 Ga0097620_100679038
1313 Ga0097620_100685925
1314 Ga0097620_102106164
1315 Ga0075435_100096259
1316 Ga0075435_101071972
1317 Ga0075435_101103182
1318 Ga0105240_10165354
1319 Ga0105240_10837133
1320 Ga0111539_10351704
1321 Ga0105245_10010181
1322 Ga0105245_10063418
1323 Ga0105245_10176172
1324 Ga0105245_10371327
1325 Ga0105245_10400948
1326 Ga0105245_11259525
1327 Ga0105245_11318578
1328 Ga0105245_12256191
1329 Ga0105247_10007822
1330 Ga0105247_10127503
1331 Ga0105247_10647687
1332 Ga0105247_11262402
1333 Ga0105247_11639582
1334 Ga0114129_10032342
1335 Ga0114129_10529967
1336 Ga0114129_11394255
1337 Ga0105243_10006313
1338 Ga0105243_10008947
1339 Ga0105243_10061539
1340 Ga0105243_10113128
1341 Ga0105243_10340928
1342 Ga0105243_10424372
1343 Ga0105243_10698079
1344 Ga0105243_11211015
1345 Ga0105243_12362227
1346 Ga0105243_12702031
1347 Ga0105241_10031186
1348 Ga0105241_10351769
1349 Ga0105241_10737572
1350 Ga0105241_12397540
1351 Ga0105242_10001731
1352 Ga0105242_10007694
1353 Ga0105242_10063636
1354 Ga0105242_10074807
1355 Ga0105242_10075960
1356 Ga0105242_10200201
1357 Ga0105242_10293568
1358 Ga0105242_10349285
1359 Ga0105242_10673342
1360 Ga0105242_10782392
1361 Ga0105242_11317343
1362 Ga0105242_12364314
1363 Ga0105248_10013383
1364 Ga0105248_10020675
1365 Ga0105248_10035985
1366 Ga0105248_10124050
1367 Ga0105248_10127966
1368 Ga0105248_10150007
1369 Ga0105248_10177339
1370 Ga0105248_10211271
1371 Ga0105248_10211338
1372 Ga0105248_10213350
1373 Ga0105248_10317118
1374 Ga0105248_10516179
1375 Ga0105248_11202054
1376 Ga0105248_11524487
1377 Ga0105248_11614322
1378 Ga0105248_11729790
1379 Ga0105248_12753862
1380 Ga0105248_12755802
1381 Ga0105238_10432334
1382 Ga0105238_11929824
1383 Ga0105249_10041426
1384 Ga0105249_10046510
1385 Ga0105249_10233509
1386 Ga0105249_10520728
1387 Ga0105249_11164026
1388 Ga0105249_12955517
1389 Ga0099796_10176113
1390 Ga0105239_10912468
1391 Ga0105246_10240588
1392 Ga0105246_10411867
1393 Ga0105246_12490914
1394 Ga0157373_10079977
1395 Ga0157373_10443384
1396 Ga0157369_10157414
1397 Ga0157369_10549793
1398 Ga0157369_12530967
1399 Ga0157374_10609305
1400 Ga0157374_11412386
1401 Ga0157378_10027498
1402 Ga0157378_10038678
1403 Ga0157378_10117321
1404 Ga0157378_10121354
1405 Ga0157378_10155494
1406 Ga0157378_10219292
1407 Ga0157378_10624133
1408 Ga0157378_10924819
1409 Ga0157378_11096409
1410 Ga0157378_11115704
1411 Ga0157378_11221895
1412 Ga0163162_10016927
1413 Ga0163162_10504196
1414 Ga0163162_10781836
1415 Ga0163162_11257810
1416 Ga0163162_13496774
1417 Ga0157372_10001889
1418 Ga0157372_10055528
1419 Ga0157372_10449094
1420 Ga0157372_12301982
1421 Ga0157372_13112164
1422 Ga0157375_10103348
1423 Ga0157375_10170956
1424 Ga0157375_10181104
1425 Ga0157375_10427200
1426 Ga0157375_10442706
1427 Ga0157375_10744858
1428 Ga0157375_10790923
1429 Ga0163163_10008318
1430 Ga0163163_10188332
1431 Ga0163163_10404746
1432 Ga0163163_10825991
1433 Ga0163163_12850278
1434 Ga0157380_10005322
1435 Ga0157380_10006772
1436 Ga0157380_10078207
1437 Ga0157380_11063596
1438 Ga0157380_12033505
1439 Ga0157377_10145344
1440 Ga0157377_10236004
1441 Ga0157377_11149429
1442 Ga0157379_10016559
1443 Ga0157379_11909322
1444 Ga0157376_10027019
1445 Ga0157376_10385977
1446 Ga0157376_10455014
1447 Ga0157376_11150974
1448 Ga0163161_10046007
1449 Ga0163161_10195801
1450 Ga0163161_10426747
1451 Ga0207697_10108439
1452 Ga0207656_10068245
1453 Ga0207653_10019055
1454 Ga0207682_10289598
1455 Ga0207642_10052150
1456 Ga0207642_10076151
1457 Ga0207642_10100344
1458 Ga0207642_10104345
1459 Ga0207642_10106430
1460 Ga0207642_10405755
1461 Ga0207642_10619741
1462 Ga0207710_10015102
1463 Ga0207710_10385615
1464 Ga0207680_10082338
1465 Ga0207647_10332163
1466 Ga0207685_10216090
1467 Ga0207685_10335148
1468 Ga0207645_10047637
1469 Ga0207645_10078521
1470 Ga0207645_10111868
1471 Ga0207645_10553894
1472 Ga0207645_10761998
1473 Ga0207643_10018568
1474 Ga0207643_10146964
1475 Ga0207705_10040024
1476 Ga0207705_10496692
1477 Ga0207705_11414501
1478 Ga0207684_10124716
1479 Ga0207684_10195739
1480 Ga0207684_11234291
1481 Ga0207707_10002650
1482 Ga0207707_10215422
1483 Ga0207707_10447756
1484 Ga0207707_10482743
1485 Ga0207707_10634567
1486 Ga0207695_10344938
1487 Ga0207695_10802996
1488 Ga0207660_10025499
1489 Ga0207660_10027149
1490 Ga0207660_10030177
1491 Ga0207660_10116666
1492 Ga0207660_10211928
1493 Ga0207660_10834809
1494 Ga0207660_10916835
1495 Ga0207660_11031584
1496 Ga0207660_11510879
1497 Ga0207662_10007207
1498 Ga0207662_10123035
1499 Ga0207662_10283392
1500 Ga0207662_10400786
1501 Ga0207662_10549501
1502 Ga0207662_10679194
1503 Ga0207657_10018259
1504 Ga0207657_10454929
1505 Ga0207649_10047344
1506 Ga0207649_10750266
1507 Ga0207652_10004748
1508 Ga0207652_10026650
1509 Ga0207652_10124114
1510 Ga0207652_10303448
1511 Ga0207652_10616812
1512 Ga0207652_10705918
1513 Ga0207646_10001909
1514 Ga0207646_10020376
1515 Ga0207646_10048888
1516 Ga0207646_10076769
1517 Ga0207646_11603320
1518 Ga0207681_10031727
1519 Ga0207681_10101123
1520 Ga0207681_10139452
1521 Ga0207694_11036063
1522 Ga0207650_10175530
1523 Ga0207650_10177015
1524 Ga0207650_10290556
1525 Ga0207650_10356562
1526 Ga0207650_10358611
1527 Ga0207650_10820568
1528 Ga0207659_10334437
1529 Ga0207659_10833243
1530 Ga0207687_10288322
1531 Ga0207687_10834777
1532 Ga0207664_10055111
1533 Ga0207644_10031226
1534 Ga0207644_10346690
1535 Ga0207690_10094490
1536 Ga0207706_10051235
1537 Ga0207706_10069560
1538 Ga0207706_10125820
1539 Ga0207706_10993855
1540 Ga0207686_10009492
1541 Ga0207686_10016100
1542 Ga0207686_10020990
1543 Ga0207686_10032454
1544 Ga0207686_10459256
1545 Ga0207686_10749490
1546 Ga0207686_11830278
1547 Ga0207709_10012061
1548 Ga0207709_10091584
1549 Ga0207709_10174276
1550 Ga0207709_10426915
1551 Ga0207670_10362566
1552 Ga0207670_10394328
1553 Ga0207670_10435171
1554 Ga0207670_11004954
1555 Ga0207669_10021938
1556 Ga0207669_10117263
1557 Ga0207669_10408068
1558 Ga0207669_10439606
1559 Ga0207669_10873151
1560 Ga0207704_10012093
1561 Ga0207704_10066357
1562 Ga0207704_10415646
1563 Ga0207691_10074169
1564 Ga0207691_10173222
1565 Ga0207691_10199525
1566 Ga0207691_10657092
1567 Ga0207691_10684318
1568 Ga0207691_11146859
1569 Ga0207711_10009730
1570 Ga0207711_10013459
1571 Ga0207711_10051458
1572 Ga0207711_10064458
1573 Ga0207711_10069831
1574 Ga0207711_10131763
1575 Ga0207711_10228897
1576 Ga0207711_10269520
1577 Ga0207711_10523399
1578 Ga0207711_11146704
1579 Ga0207711_11287451
1580 Ga0207689_10051142
1581 Ga0207689_10084520
1582 Ga0207689_10315244
1583 Ga0207689_10514052
1584 Ga0207689_10720973
1585 Ga0207661_10006492
1586 Ga0207661_10064919
1587 Ga0207661_10139563
1588 Ga0207661_10256365
1589 Ga0207661_10665394
1590 Ga0207661_11073800
1591 Ga0207679_10016488
1592 Ga0207679_10019804
1593 Ga0207679_10085794
1594 Ga0207679_10512934
1595 Ga0207679_10530297
1596 Ga0207679_10569941
1597 Ga0207667_10095989
1598 Ga0207667_10371768
1599 Ga0207651_10022140
1600 Ga0207651_10044403
1601 Ga0207651_10093905
1602 Ga0207651_10243234
1603 Ga0207651_10812923
1604 Ga0207651_10884367
1605 Ga0207651_11750273
1606 Ga0207712_10049501
1607 Ga0207712_10173096
1608 Ga0207712_10852699
1609 Ga0207712_11099881
1610 Ga0207668_10070289
1611 Ga0207668_10087312
1612 Ga0207668_10207095
1613 Ga0207668_10259812
1614 Ga0207640_10066928
1615 Ga0207640_10143186
1616 Ga0207640_10176126
1617 Ga0207640_10433213
1618 Ga0207640_10747963
1619 Ga0207658_10086948
1620 Ga0207658_11164956
1621 Ga0207658_11382392
1622 Ga0207677_10028141
1623 Ga0207677_10141672
1624 Ga0207677_10347645
1625 Ga0207677_10679778
1626 Ga0207677_10888129
1627 Ga0207677_11235836
1628 Ga0207677_11431483
1629 Ga0207703_10005090
1630 Ga0207703_10109581
1631 Ga0207703_10257820
1632 Ga0207703_10266762
1633 Ga0207703_10626474
1634 Ga0207703_10780821
1635 Ga0207703_11711948
1636 Ga0207639_10161393
1637 Ga0207639_10420962
1638 Ga0207639_11348568
1639 Ga0207678_10027841
1640 Ga0207678_10749383
1641 Ga0207708_10014453
1642 Ga0207708_10019568
1643 Ga0207708_10054048
1644 Ga0207708_10342963
1645 Ga0207708_10353328
1646 Ga0207708_10584226
1647 Ga0207641_10089670
1648 Ga0207641_10524481
1649 Ga0207641_10655149
1650 Ga0207641_10737523
1651 Ga0207641_12033571
1652 Ga0207648_10061013
1653 Ga0207648_10152535
1654 Ga0207648_10185600
1655 Ga0207648_10246779
1656 Ga0207648_10401278
1657 Ga0207648_10441973
1658 Ga0207648_10947608
1659 Ga0207648_10995156
1660 Ga0207648_11380126
1661 Ga0207676_10036069
1662 Ga0207676_10041523
1663 Ga0207676_10114355
1664 Ga0207676_10841389
1665 Ga0207676_11110534
1666 Ga0207676_11542524
1667 Ga0207674_10006815
1668 Ga0207674_10007951
1669 Ga0207674_10010253
1670 Ga0207674_10016170
1671 Ga0207674_10102541
1672 Ga0207674_10228657
1673 Ga0207675_100005501
1674 Ga0207675_100027077
1675 Ga0207675_100091653
1676 Ga0207675_100108865
1677 Ga0207675_100124167
1678 Ga0207675_100148787
1679 Ga0207675_100176375
1680 Ga0207675_100289901
1681 Ga0207675_101037219
1682 Ga0207683_10029082
1683 Ga0207683_10381277
1684 Ga0207683_10861970
1685 Ga0207683_11659060
1686 Ga0207698_10011925
1687 Ga0207698_10163413
1688 Ga0207698_10361985
1689 Ga0207698_12009086
1690 Ga0268266_10042157
1691 Ga0268266_10074919
1692 Ga0268265_10003201
1693 Ga0268265_10133364
1694 Ga0268265_10160352
1695 Ga0268265_10168137
1696 Ga0268265_10244186
1697 Ga0268265_10290676
1698 Ga0268265_10375220
1699 Ga0268265_10588024
1700 Ga0268265_11107853
1701 Ga0268265_11257653
1702 Ga0268265_11755936
1703 Ga0268265_12646624
1704 Ga0268264_10234056
1705 Ga0268264_10276915
1706 Ga0268264_10307732
1707 Ga0268264_10776178
1708 Ga0268264_10870597
1709 Ga0268264_11235344
1710 Ga0268264_11924309
1711 Ga0268264_12042110
1712 Ga0265319_1184062
1713 Ga0265318_10154581
1714 Ga0265338_10011337
1715 Ga0307511_10068812
1716 Ga0265330_10156447
1717 Ga0265332_10033825
1718 Ga0265332_10153162
1719 Ga0265320_10092417
1720 Ga0265325_10224130
1721 Ga0265340_10044498
1722 Ga0265331_10276883
1723 Ga0265331_10425538
1724 Ga0307509_10070678
1725 Ga0265314_10046574
1726 Ga0265314_10114384
1727 Ga0307405_10117759
1728 Ga0307405_10500099
1729 Ga0307413_10408482
1730 Ga0307410_10571356
1731 Ga0307406_10107282
1732 Ga0307406_11684482
1733 Ga0307407_11266786
1734 Ga0307409_101283534
1735 Ga0307416_100031842
1736 Ga0307416_100036276
1737 Ga0307416_102737954
1738 Ga0307411_10071665
1739 Ga0307411_10381841
1740 Ga0307415_100090573
1741 Ga0307415_100341923
1742 Ga0307415_100634861
1743 Ga0307415_100642767
1744 Ga0373934_0000815
1745 Ga0373923_0025277
1746 Ga0373936_0429117
1747 Ga0373945_0401610
1748 Ga0373954_0277782
1749 Ga0373956_0374587
1750 Ga0373943_0426439
1751 Ga0373955_0000938
1752 Ga0373924_0012115
1753 Ga0373931_1183221
1754 Ga0373935_0090714
1755 Ga0373935_0459486
1756 Ga0373947_0503941
1757 Ga0373937_0000357
1758 Ga0373937_0916384
1759 Ga0373925_0193759
1760 Ga0373925_1141254
1761 Ga0395899_0050610
1762 Ga0395900_0139693
1763 Ga0395898_0098069
1764 Ga0395905_0033247
1765 Ga0395901_0041568
1766 Ga0451793_1530940
1767 Ga0451798_0845512
1768 Ga0451807_0790791
1769 Ga0451807_1189504
1770 Ga0451807_2760709
1771 Ga0439449_0002401
1772 Ga0439462_0036635
1773 Ga0439462_0126351
1774 Ga0450923_035312
1775 Ga0439446_0144682
1776 Ga0439444_0050536
1777 Ga0439444_0065246
1778 Ga0451577_0195259
1779 Ga0451577_0744748
1780 Ga0453684_0192227
1781 Ga0466971_0441409
1782 Ga0451576_0206236
1783 Ga0451576_2098904
1784 Ga0495592_0016234
1785 Ga0495592_0073047
1786 Ga0495629_0287239
1787 Ga0495629_0412380
1788 Ga0495651_0000098
1789 Ga0495651_0592647
1790 Ga0495653_0000168
1791 Ga0495582_0011103
1792 Ga0495582_0085679
1793 Ga0495639_0039185
1794 Ga0495608_0004664
1795 Ga0495618_0098434
1796 Ga0495628_0058932
1797 Ga0495630_0003348
1798 Ga0495630_0315656
1799 Ga0495643_0347487
1800 Ga0495663_0013771
1801 Ga0495663_0043204
1802 Ga0495663_0186536
1803 Ga0495652_0011033
1804 Ga0495665_0073585
1805 Ga0495586_0190735
1806 Ga0495587_0000808
1807 Ga0495621_0006207
1808 Ga0495621_0078576
1809 Ga0495621_0110980
1810 Ga0495645_0000106
1811 Ga0495645_0016060
1812 Ga0495645_0080033
1813 Ga0495645_0414975
1814 Ga0495667_0000570
1815 Ga0495634_0652495
1816 Ga0495657_0003960
1817 Ga0495657_0066703
1818 Ga0495599_0010947
1819 Ga0495599_0031543
1820 Ga0495599_0484399
1821 Ga0495623_0000509
1822 Ga0495646_0108854
1823 Ga0495658_0032272
1824 Ga0495658_0642618
1825 Ga0495669_0100660
1826 Ga0495669_0303456
1827 Ga0495613_0402710
1828 Ga0495613_0619461
1829 Ga0495600_0000944
1830 Ga0495581_0781249
1831 Ga0495604_0002016
1832 Ga0495604_0250385
1833 Ga0495604_0987654
1834 Ga0495674_0152908
1835 Ga0495674_0382309
1836 Ga0495680_0041242
1837 Ga0495680_0484235
1838 Ga0495675_0030845
1839 Ga0495675_0150694
1840 Ga0495677_0089492
1841 Ga0495684_0037228
1842 Ga0495684_0126312
1843 Ga0495593_0343497
1844 Ga0495602_0210020
1845 Ga0495615_0013968
1846 Ga0496100_0028208
1847 Ga0496102_1752566
1848 Ga0496104_0249524
1849 Ga0496104_0282038
1850 Ga0496104_0517218
1851 Ga0496104_0580603
1852 Ga0496106_1555731
1853 Ga0496108_0048777
1854 Ga0496108_0069171
1855 Ga0496108_0123989
1856 Ga0496108_0540242
1857 Ga0496109_0095642
1858 Ga0496110_0269422
1859 Ga0496110_0769358
1860 Ga0496110_1053518
1861 Ga0496111_0170189
1862 Ga0496112_0174223
1863 Ga0496112_0207343
1864 Ga0496112_0247424
1865 Ga0496112_0266072
1866 Ga0496112_1426619
1867 Ga0496113_0123886
1868 Ga0496113_0631036
1869 Ga0496114_0161935
1870 Ga0496114_0493676
1871 Ga0496121_0542975
1872 Ga0501298_019005
1873 Ga0501299_012200
1874 Ga0501202_031979
1875 Ga0501243_118615
1876 Ga0501245_072184
1877 nmdc:mga0yw44_71063_c1
1878 nmdc:mga05p37_264477_c1
1879 nmdc:mga06r32_1809748_c1
1880 nmdc:mga06r32_91127_c1
1881 nmdc:mga08y16_451391_c1
1882 nmdc:mga0n895_773555_c1
1883 nmdc:mga0rr50_1176336_c1
1884 nmdc:mga08x19_1103526_c1
1885 nmdc:mga0a205_131884_c1
1886 Ga0495601_0028603
1887 Ga0495612_0009710
1888 Ga0495595_0015720
1889 Ga0495595_0085950
1890 Ga0495595_0350931
1891 Ga0495619_0300194
1892 Ga0495619_0478820
1893 Ga0495619_0692987
1894 Ga0500650_0354363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

21

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.973 1 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9661 3 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9648 3 120
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9638 1 118
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9631 2 119
ID Description Score Start End Superfamily
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9622 1 118 3.40.50.2300
4hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9571 1 117 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9553 2 82 3.40.50.2300
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9541 2 68 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9513 1 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-C5SZM3-F1-model_v4 Response regulator receiver protein 0.9985 1 118 GO:0000160
AF-A0A2U2HI55-F1-model_v4 Response regulator 0.9969 1 122 GO:0000160
AF-A0A6P2B3H8-F1-model_v4 Response regulator 0.9959 1 117 GO:0000160
AF-A0A7Y2JWC1-F1-model_v4 Response regulator 0.9936 1 122 GO:0000160
AF-A0A7M1PZP0-F1-model_v4 Stage 0 sporulation protein A homolog 0.9935 2 122 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201

Map